LOCUS       BC001106                1533 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens transmembrane protein 9, mRNA (cDNA clone MGC:891
            IMAGE:3506442), complete cds.
ACCESSION   BC001106
VERSION     BC001106.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1533)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1533)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2000) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC001106.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 7 Row: b Column: 23
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 24308523.
FEATURES             Location/Qualifiers
     source          1..1533
                     /db_xref="H-InvDB:HIT000030138"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:891 IMAGE:3506442"
                     /tissue_type="Kidney, renal cell adenocarcinoma"
                     /clone_lib="NIH_MGC_14"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1533
                     /gene="TMEM9"
                     /gene_synonym="TMEM9A"
                     /db_xref="GeneID:252839"
                     /db_xref="HGNC:HGNC:18823"
     CDS             72..623
                     /gene="TMEM9"
                     /gene_synonym="TMEM9A"
                     /codon_start=1
                     /product="transmembrane protein 9"
                     /protein_id="AAH01106.1"
                     /db_xref="GeneID:252839"
                     /db_xref="HGNC:HGNC:18823"
                     /translation="MKLLSLVAVVGCLLVPPAEANKSSEDIRCKCICPPYRNISGHIY
                     NQNVSQKDCNCLHVVEPMPVPGHDVEAYCLLCECRYEERSTTTIKVIIVIYLSVVGAL
                     LLYMAFLMLVDPLIRKPDAYTEQLHNEEENEDARSMAAAAASLGGPRANTVLERVEGA
                     QQRWKLQVQEQRKTVFDRHKMLS"
BASE COUNT          314 a          412 c          434 g          373 t
ORIGIN      
        1 caactgggtc ttttgcggct gcagcgggct tgtaggtgtc cggctttgct ggcccagcaa
       61 gcctgataag catgaagctc ttatctttgg tggctgtggt cgggtgtttg ctggtgcccc
      121 cagctgaagc caacaagagt tctgaagata tccggtgcaa atgcatctgt ccaccttata
      181 gaaacatcag tgggcacatt tacaaccaga atgtatccca gaaggactgc aactgcctgc
      241 acgtggtgga gcccatgcca gtgcctggcc atgacgtgga ggcctactgc ctgctgtgcg
      301 agtgcaggta cgaggagcgc agcaccacca ccatcaaggt catcattgtc atctacctgt
      361 ccgtggtggg tgccctgttg ctctacatgg ccttcctgat gctggtggac cctctgatcc
      421 gaaagccgga tgcatacact gagcaactgc acaatgagga ggagaatgag gatgctcgct
      481 ctatggcagc agctgctgca tccctcgggg gaccccgagc aaacacagtc ctggagcgtg
      541 tggaaggtgc ccagcagcgg tggaagctgc aggtgcagga gcagcggaag acagtcttcg
      601 atcggcacaa gatgctcagc tagatgggct ggtgtggttg ggtcaaggcc ccaacaccat
      661 ggctgccagc ttccaggctg gacaaagcag ggggctactt ctcccttccc tcggttccag
      721 tcttcccttt aaaagcctgt ggcatttttc ctccttctcc ctaactttag aaatgttgta
      781 cttggctatt ttgattaggg aagagggatg tggtctctga tctccgttgt cttcttgggt
      841 ctttggggtt gaagggaggg ggaaggcagg ccagaaggga atggagacat tcgaggcggc
      901 ctcaggagtg gatgcgatct gtctctcctg gctccactct tgccgccttc cagctctgag
      961 tcttgggaat gttgttaccc ttggaagata aagctgggtc ttcaggaact cagtgtctgg
     1021 gaggaaagca tggcccagca ttcagcatgt gttcctttct gcagtggttc tttatcacca
     1081 cctccctccc agccccagcg cctcagcccc agccccagct ccagccctga ggacagctct
     1141 gatgggagag ctgggccccc tgagcccact gggtcttcag ggtgcactgg aagctggtgt
     1201 tcgctgtccc ctgtgcactt ctcgcactgg ggcatggagt gcccatgcat actctgctgc
     1261 cggtcccctc acctgcactt gaggggtctg ggcagtccct cctctcccca gtgtccacag
     1321 tcactgagcc agacggtcgg ttggaacatg agactcgagg ctgagcgtgg atctgaacac
     1381 cacagcccct gtacttgggt tgcctcttgt ccctgaactt cgttgtacca gtgcatggag
     1441 agaaaatttt gtcctcttgt cttagagttg tgtgtaaatc aaggaagcca tcattaaatt
     1501 gttttatttc tctcaaaaaa aaaaaaaaaa aaa
//