LOCUS       BC000771                2080 bp    mRNA    linear   HUM 14-SEP-2006
DEFINITION  Homo sapiens tropomyosin 3, mRNA (cDNA clone MGC:3261
            IMAGE:3506357), complete cds.
ACCESSION   BC000771
VERSION     BC000771.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2080)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2080)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-NOV-2000) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Oct 28, 2003 this sequence version replaced BC000771.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 7 Row: m Column: 2
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 39725631.
FEATURES             Location/Qualifiers
     source          1..2080
                     /db_xref="H-InvDB:HIT000029910"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:3261 IMAGE:3506357"
                     /tissue_type="Kidney, renal cell adenocarcinoma"
                     /clone_lib="NIH_MGC_14"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..2080
                     /gene="TPM3"
                     /gene_synonym="hscp30"
                     /gene_synonym="MGC14582"
                     /gene_synonym="MGC3261"
                     /gene_synonym="OK/SW-cl.5"
                     /gene_synonym="TM-5"
                     /gene_synonym="TM3"
                     /gene_synonym="TM30"
                     /gene_synonym="TM30nm"
                     /gene_synonym="TPMsk3"
                     /gene_synonym="TRK"
                     /db_xref="GeneID:7170"
                     /db_xref="HGNC:HGNC:12012"
                     /db_xref="MIM:191030"
     CDS             43..789
                     /gene="TPM3"
                     /gene_synonym="hscp30"
                     /gene_synonym="MGC14582"
                     /gene_synonym="MGC3261"
                     /gene_synonym="OK/SW-cl.5"
                     /gene_synonym="TM-5"
                     /gene_synonym="TM3"
                     /gene_synonym="TM30"
                     /gene_synonym="TM30nm"
                     /gene_synonym="TPMsk3"
                     /gene_synonym="TRK"
                     /codon_start=1
                     /product="tropomyosin 3"
                     /protein_id="AAH00771.1"
                     /db_xref="GeneID:7170"
                     /db_xref="HGNC:HGNC:12012"
                     /db_xref="MIM:191030"
                     /translation="MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQ
                     AEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDE
                     EKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQ
                     IRLMDQNLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTID
                     DLEDKLKCTKEEHLCTQRMLDQTLLDLNEM"
BASE COUNT          592 a          448 c          507 g          533 t
ORIGIN      
        1 ggaggcagga accggagcgc gagcagtagc tgggtgggca ccatggctgg gatcaccacc
       61 atcgaggcgg tgaagcgcaa gatccaggtt ctgcagcagc aggcagatga tgcagaggag
      121 cgagctgagc gcctccagcg agaagttgag ggagaaaggc gggcccggga acaggctgag
      181 gctgaggtgg cctccttgaa ccgtaggatc cagctggttg aagaagagct ggaccgtgct
      241 caggagcgcc tggccactgc cctgcaaaag ctggaagaag ctgaaaaagc tgctgatgag
      301 agtgagagag gtatgaaggt tattgaaaac cgggccttaa aagatgaaga aaagatggaa
      361 ctccaggaaa tccaactcaa agaagctaag cacattgcag aagaggcaga taggaagtat
      421 gaagaggtgg ctcgtaagtt ggtgatcatt gaaggagact tggaacgcac agaggaacga
      481 gctgagctgg cagagtcccg ttgccgagag atggatgagc agattagact gatggaccag
      541 aacctgaagt gtctgagtgc tgctgaagaa aagtactctc aaaaagaaga taaatatgag
      601 gaagaaatca agattcttac tgataaactc aaggaggcag agacccgtgc tgagtttgct
      661 gagagatcgg tagccaagct ggaaaagaca attgatgacc tggaagataa actgaaatgc
      721 accaaagagg agcacctctg tacacaaagg atgctggacc agaccctgct tgacctgaat
      781 gagatgtaga acgccccagt cccaccctgc tgctgctcct ccctctgacc cagactccgc
      841 ctgaggccag cctgcgggaa gctgaccttt aactgagggc tgatctttaa ctggaaggct
      901 gctttctcct ttcaccaccc cctccttccc tgtgtctttt tcgccaaact gtctctgcct
      961 cttcccggag aatccagctg ggctagaggc tgagcacctt tggaaacaac atttaaggga
     1021 atgtgagcac aatgcataat gtctttaaaa agcatgttgt gatgtacaca ttttgtaatt
     1081 accttttttg ttgttttgta gcaaccattt gtaaaacatt ccaaataatt ccacagtcct
     1141 gaagcagcaa tcgaatccct ttctcacttt tggaaggtga cttttcacct taatgcatat
     1201 tcccctctcc atagaggaga ggaaaaggtg taggcctgcc ttaccgagag ccaaacagag
     1261 cccagggaga ctccgctgtg ggaaacctca ttgttctgta caaagtacta gctaaaccag
     1321 aaaggtgatt ccaggaggag ttagccaaac aacaacaaaa acaaaaaatg tgctgttcaa
     1381 gttttcagct ttaagatatc tttggataat gttatttcta ttttttattt ttttcattag
     1441 aagttaccaa attaagatgg taagacctct gagaccaaaa ttttgtccca tctctacccc
     1501 ctcacaactg cttacagaat ggatcatgtc ccccttatgt tgaggtgacc acttaattgc
     1561 tttcctgcct ccttgaaaga aagaaagaaa gaagactgtg tttttgccac tgatttagcc
     1621 atgtgaaact catctcatta cccttttctg ggtttgaagc tgctgtctct agaagtgcca
     1681 tctcaattgt gctttgtatc agtcagtgct ggagaaatct tgaatagctt atgtacaaaa
     1741 ctttttaaat tttatattat tttgaaactt tgctttgggt ttgtggcacc ctggccaccc
     1801 catctggctg tgacagcctc tgcagtccgt gggctggcag tttgttgatc ttttaagttt
     1861 ccttccctac ccagtcccca ttttctggta aggtttctag gaggtctgtt aggtgtacat
     1921 cctgcagctt attggcttaa aatgtactct ccttttatgt ggtctctttg gggccgattg
     1981 ggagaaagag aaatcaatag tgcaactgtt ttgatactga atattgacaa gtgtcttttt
     2041 gaaataaaga accagtccct ccaaaaaaaa aaaaaaaaaa
//