LOCUS       BC000687                2713 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens translocation associated membrane protein 1, mRNA
            (cDNA clone MGC:784 IMAGE:3347823), complete cds.
ACCESSION   BC000687
VERSION     BC000687.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2713)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2713)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-NOV-2000) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 20, 2003 this sequence version replaced BC000687.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 5 Row: l Column: 10
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 31543822.
FEATURES             Location/Qualifiers
     source          1..2713
                     /db_xref="H-InvDB:HIT000029835"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:784 IMAGE:3347823"
                     /tissue_type="Kidney, renal cell adenocarcinoma"
                     /clone_lib="NIH_MGC_14"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..2713
                     /gene="TRAM1"
                     /gene_synonym="TRAM"
                     /gene_synonym="TRAMP"
                     /db_xref="GeneID:23471"
                     /db_xref="HGNC:HGNC:20568"
                     /db_xref="MIM:605190"
     CDS             83..1207
                     /gene="TRAM1"
                     /gene_synonym="TRAM"
                     /gene_synonym="TRAMP"
                     /codon_start=1
                     /product="translocation associated membrane protein 1"
                     /protein_id="AAH00687.1"
                     /db_xref="GeneID:23471"
                     /db_xref="HGNC:HGNC:20568"
                     /db_xref="MIM:605190"
                     /translation="MAIRKKSTKSPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITA
                     KASIIFVTLQYNVTLPATEEQATESVSLYYYGIKDLATVFFYMLVAIIIHAVIQEYML
                     DKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFILISENYISDPTILWRAYPHNL
                     MTFQMKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHL
                     GLVLLVLHYFVEFLFHISRLFYFSNEKYQKGFSLWAVLFVLGRLLTLILSVLTVGFGL
                     ARAENQKLDFSTGNFNVLAVRIAVLASICVTQAFMMWKFINFQLRRWREHSAFQAPAV
                     KKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNKKEKSS"
BASE COUNT          832 a          482 c          475 g          924 t
ORIGIN      
        1 gggaggcggc ggcgagtcgg tgagcagctg ggaagagcag aaccggggcg gagcacctgc
       61 aggcgcgggc ggcggcccca ccatggcgat tcgcaagaaa agcaccaaga gccccccagt
      121 gctgagccac gaattcgtcc tgcagaatca cgcggacatc gtctcctgtg tggcgatggt
      181 cttcctgctg gggctcatgt ttgagataac ggcaaaagct tctatcattt ttgttactct
      241 tcagtacaat gtcaccctcc cagcaacaga agaacaagct actgaatcag tgtcccttta
      301 ttactatggc atcaaagatt tggctactgt tttcttctac atgctagtgg cgataattat
      361 tcatgccgta attcaagagt atatgttgga taaaattaac aggcgaatgc acttctccaa
      421 aacaaaacac agcaagttta atgaatctgg tcagcttagt gcgttctacc tttttgcctg
      481 tgtttggggc acattcattc tcatctctga aaactacatc tcagacccaa ctatcttatg
      541 gagggcttat ccccataacc tgatgacatt tcaaatgaag tttttctaca tatcacagct
      601 ggcttactgg cttcatgctt ttcctgaact ctacttccag aaaaccaaaa aagaagatat
      661 tcctcgtcag cttgtctaca ttggtcttta cctcttccac attgctggag cttacctttt
      721 gaacttgaat catctaggac ttgttcttct ggtgctacat tattttgttg aatttctttt
      781 ccacatttcc cgcctgtttt attttagcaa tgaaaagtat cagaaaggat tttctctgtg
      841 ggcagttctt tttgttttgg gaagacttct gactttaatt ctttcagtac tgactgttgg
      901 ttttggcctt gcaagagcag aaaatcagaa gctggatttc agtactggaa acttcaatgt
      961 gttagctgtt agaatcgctg ttctggcatc catttgcgtt actcaggcat ttatgatgtg
     1021 gaagttcatt aattttcagc ttcgaaggtg gagggaacat tctgcttttc aggcaccagc
     1081 tgtgaagaag aaaccaacag taactaaagg cagatcttct aaaaaaggaa cagaaaatgg
     1141 tgtgaatgga acattaactt caaatgtagc agactctccc cggaataaaa aagagaaatc
     1201 ttcataatga attataaact aattgattaa tgtccccaaa gaaatctgct ttctactata
     1261 tctttcagca ttagagattt ttctgttctt gaaaatacag tctgtgctct ttgatttttg
     1321 ctattgtacg gtttcatgca tttttttaaa gggcatttga ggggaggatt attgctatga
     1381 atgaaaaaaa tattttagct tagactaagc tacctgcctt caaaatagtt tagggaccac
     1441 caccatattt tattttgttt ttatttttga acatttttct aatgatttgg agagaaaact
     1501 atttacaaaa attccacata tcagtgatac aatttcttgc tgtcaccaat tttttataat
     1561 agcagagtgg cctgttctaa gaaggccata ttttttaagt tatctttcag ggtaacatgg
     1621 aaatactata aagttggatg tcaaacttta atatgttttc agtgttctct aattttttgg
     1681 aatttttgta gactttacac ctggaaaaaa agatttgtaa aatcaccgga acaattgtgt
     1741 gctttatttt ataggtagtg gttattagta ttacatcccc attttaaaaa caaaaacata
     1801 ataatggtta caacacgtgg agttttacta acatacatat taaatcaaag tatattctta
     1861 aaagtacttg tgaagtaaaa tctttcttgt gcattttcaa tacttgtaaa ctggaaatca
     1921 gaaaatattt actatgaaca ggaaaatctg acatatagcc ctttttgata tgtttattaa
     1981 taatgattct taatggggct cataataagt ttaatatgca cagcatctta gaaaagttta
     2041 acctgcaaac acttttaaaa cataatgcct acttgattta tatctataaa aagactgaca
     2101 ggtaattata tttggaaaac atttaatgca ctaactttaa agaaattgaa aattcaggtg
     2161 gataaatagt cttacaaaag acaatgtgct ttatgttata cctatagctt tggtcccatc
     2221 tttaattgag aaacatttat ctgtataaaa catatttttg gataaatata tatatatata
     2281 tttgtatcgc tacagaaagg ctctaaaaag catttgagga aaatatttgg ttcccttttc
     2341 tataatcatc ctttaagatt cttatagcta catttggttt attcatcata tttacagtat
     2401 atatattgtt cttttcagtg ttcacatctt gttccccatt tctcacttgt gtcaccagct
     2461 gtttgtgcca tttttagtgt aaaagttgca gacctattag atctgcagtt taagttgcca
     2521 tgctgctagg aaattgtcct ttttctttct agctgttaac ctacttcctg gaaaaagtag
     2581 tagctctctg tagcattatg gagtttcagt ggaaccaaat ttttgccatt aaaaactggc
     2641 attatactga actatacatt gagaaatcaa tcaaaataaa aatttttact ttcacaaaaa
     2701 aaaaaaaaaa aaa
//