LOCUS       BC000183                 637 bp    mRNA    linear   HUM 18-MAR-2009
DEFINITION  Homo sapiens thymosin beta 15a, mRNA (cDNA clone MGC:2089
            IMAGE:3350388), complete cds.
ACCESSION   BC000183
VERSION     BC000183.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 637)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 637)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-NOV-2000) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 6 Row: c Column: 1
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 11496272.
FEATURES             Location/Qualifiers
     source          1..637
                     /db_xref="H-InvDB:HIT000029414"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:2089 IMAGE:3350388"
                     /tissue_type="Eye, retinoblastoma"
                     /clone_lib="NIH_MGC_16"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..637
                     /gene="TMSB15A"
                     /gene_synonym="Tb15"
                     /gene_synonym="TbNB"
                     /gene_synonym="TMSNB"
                     /db_xref="GeneID:11013"
                     /db_xref="HGNC:HGNC:30744"
     CDS             72..209
                     /gene="TMSB15A"
                     /gene_synonym="Tb15"
                     /gene_synonym="TbNB"
                     /gene_synonym="TMSNB"
                     /codon_start=1
                     /product="thymosin beta 15a"
                     /protein_id="AAH00183.1"
                     /db_xref="GeneID:11013"
                     /db_xref="HGNC:HGNC:30744"
                     /translation="MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQT
                     S"
BASE COUNT          192 a          123 c          121 g          201 t
ORIGIN      
        1 cgagtctggg tctcagcccc gcgaacagcc tttcacgagt cttcaagctt tcaggctatc
       61 ttctagtcaa gatgagtgat aagccagact tgtcggaagt ggagaagttt gacaggtcaa
      121 aactgaagaa aactaatact gaagaaaaaa atactcttcc ctcaaaggaa actatccagc
      181 aagagaaaga gtgtgttcaa acatcataaa atggggatcg cctcccaaca gcagatttcg
      241 acattacctg agagtcttga ttttaggctt gttttttgta aacccatgtg tttgtagaga
      301 ttttaggcgt cttcggatat cttctcacct atgttccctg gctaagaagt cagaggtagc
      361 caatgtttcc ttaaattcat ttttaaactt accattggtg catatgttcc agatggcaga
      421 tgctgtcaat aatctcacca ttgatgacct ttgtgtatgt agttcttgca tcctatactg
      481 gataagcctg ttttaacctg ctatgatggg tgcttccatt gcttcataat cttcatgaag
      541 ttgcatgctt ttgcagcttt tcacagttta tttgcatttc taatgtagta ataaagtaac
      601 caatataatc attatcttga aaaaaaaaaa aaaaaaa
//