LOCUS       BC000050                1242 bp    mRNA    linear   HUM 18-AUG-2006
DEFINITION  Homo sapiens NIN1/RPN12 binding protein 1 homolog (S. cerevisiae),
            mRNA (cDNA clone IMAGE:3504549), partial cds.
ACCESSION   BC000050
VERSION     BC000050.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1242)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1242)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-NOV-2000) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Sep 16, 2003 this sequence version replaced BC000050.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 7 Row: m Column: 15.
FEATURES             Location/Qualifiers
     source          1..1242
                     /db_xref="H-InvDB:HIT000029309"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3504549"
                     /tissue_type="Placenta, choriocarcinoma"
                     /clone_lib="NIH_MGC_21"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            <1..1242
                     /gene="NOB1"
                     /gene_synonym="ART-4"
                     /gene_synonym="MST158"
                     /gene_synonym="MSTP158"
                     /gene_synonym="NOB1P"
                     /db_xref="GeneID:28987"
                     /db_xref="HGNC:HGNC:29540"
     CDS             <1..884
                     /gene="NOB1"
                     /gene_synonym="ART-4"
                     /gene_synonym="MST158"
                     /gene_synonym="MSTP158"
                     /gene_synonym="NOB1P"
                     /codon_start=3
                     /product="NOB1 protein"
                     /protein_id="AAH00050.2"
                     /db_xref="GeneID:28987"
                     /db_xref="HGNC:HGNC:29540"
                     /translation="ETPLHISGFHLPYKPKPPQETEKGHSACEPENLEFSSFMFWRNP
                     LPNIDHELQELLIDRGEDVPSEEEEEEENGFEDRKDDSDDDGGGWITPSNIKQIQQEL
                     EQCDVPEDVRVGCLTTDFAMQNVLLQMGLHVLAVNGMLIREARSYILRCHGCFKTTSD
                     MSRVFCSHCGNKTLKKVSVTVSDDGTLHMHFSRNPKVLNPRGLRYSLPTPKGGKYAIN
                     PHLTEDQRFPQLRLSQKARQKTNVFAPDYIAGVSPFVENDISSRSATLQVRDSTLGAG
                     RRRLNPNASRKKFVKKR"
BASE COUNT          332 a          348 c          331 g          231 t
ORIGIN      
        1 cagaaacacc tctgcacatt tctggtttcc atctgcccta caagcctaaa cccccacaag
       61 aaacagaaaa aggacactca gcttgtgagc ctgagaacct ggaatttagt tccttcatgt
      121 tctggagaaa ccctttgccc aacatcgatc atgaactgca ggagctgctg attgacagag
      181 gtgaggacgt tccaagtgag gaggaggagg aggaagaaaa cgggtttgaa gacagaaaag
      241 atgacagcga tgacgacggg ggtggctgga taacccccag taacatcaag cagatccagc
      301 aggagctgga gcagtgtgac gtccccgagg acgtgcgggt tggctgcctg accacagact
      361 tcgccatgca gaatgttctg ctgcagatgg ggctgcacgt gctggcggtg aacggcatgc
      421 tgattcgtga ggcccggagc tacatcttgc gctgccatgg ctgtttcaag acaacgtctg
      481 acatgagccg agtgttctgc tcacactgtg ggaacaagac cctgaagaaa gtgtccgtga
      541 ccgtcagcga cgacggcacc ctgcacatgc acttctcccg caaccccaag gtgctgaacc
      601 cccgcggcct ccggtactcg cttcccactc ccaaaggggg caaatacgcc atcaaccccc
      661 atctcaccga ggatcagcgc ttccctcagc tgcgactctc ccaaaaggcc aggcagaaaa
      721 ccaacgtgtt cgcccctgac tacatcgccg gggtgtcacc ctttgtcgag aatgacatct
      781 ccagccgctc agctaccctg caggtccggg acagcacctt gggagctggg cggagacgct
      841 taaatcccaa cgcttccaga aagaagtttg tgaagaaaag gtgaagagcg agttcccgca
      901 ggcaaattgg atgggcgtct ggccgccgtg gagttccggt gacccatttc cccagccgtg
      961 tcgtctccag gaccacccga tggaaataac aggcgggctt cacggtgcgg ctctgtccgc
     1021 ccatgccccg ctgggtctgc agggaactgg actgtcccat ggcctgtgag caccggagcg
     1081 cctggctgcc tgccaaggaa gtgcaattgc ataaaaacag aaagaacaac gccctggagc
     1141 caatcttcaa gaaaggaatt tccaaaggat aatatttttc taataaatgc ggctgcaacc
     1201 tcctgtgcat ttaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa
//