LOCUS       BC000027                1404 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens transmembrane emp24 protein transport domain
            containing 3, mRNA (cDNA clone MGC:1302 IMAGE:3507308), complete
            cds.
ACCESSION   BC000027
VERSION     BC000027.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1404)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1404)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-NOV-2000) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC000027.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 7 Row: e Column: 12
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 56676386.
FEATURES             Location/Qualifiers
     source          1..1404
                     /db_xref="H-InvDB:HIT000029292"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:1302 IMAGE:3507308"
                     /tissue_type="Kidney, renal cell adenocarcinoma"
                     /clone_lib="NIH_MGC_14"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1404
                     /gene="TMED3"
                     /gene_synonym="P24B"
                     /db_xref="GeneID:23423"
                     /db_xref="HGNC:HGNC:28889"
     CDS             97..750
                     /gene="TMED3"
                     /gene_synonym="P24B"
                     /codon_start=1
                     /product="transmembrane emp24 protein transport domain
                     containing 3"
                     /protein_id="AAH00027.1"
                     /db_xref="GeneID:23423"
                     /db_xref="HGNC:HGNC:28889"
                     /translation="MGSTVPRSASVLLLLLLLRRAEQPCGAELTFELPDNAKQCFHEE
                     VEQGVKFSLDYQVITGGHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCF
                     SNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTH
                     YRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS"
BASE COUNT          312 a          389 c          402 g          301 t
ORIGIN      
        1 cttacatcct cctaggaccc ggtcggtagt cgtcgcccca gcccgccggg ggcgcagcgc
       61 ccgagccgcg gccctcgaga cgggaccgag agcatcatgg gcagcactgt cccgcgctcc
      121 gcctccgtgc tgcttctgct gctgctcctg cgccgggccg agcagccctg cggggccgag
      181 ctcaccttcg agctgccgga caacgccaag cagtgcttcc acgaggaggt ggagcagggc
      241 gtgaagttct ccctggatta ccaggtcatc actggaggcc actacgatgt tgactgctat
      301 gtagaggacc cccaggggaa caccatctac agagaaacga agaagcagta cgacagcttc
      361 acgtaccggg ctgaagtcaa gggcgtttat cagttttgct tcagtaatga gttttccacc
      421 ttctctcaca agaccgtcta ctttgacttt caagtgggcg atgagcctcc cattctccca
      481 gacatgggga acagggtcac agctctcacc cagatggagt ccgcctgcgt gaccatccat
      541 gaggctctga aaacggtgat tgactcccag acgcattacc ggctgcggga ggcccaggac
      601 cgggcccgag cggaagacct taatagccga gtctcttact ggtctgttgg cgagacgatt
      661 gccctgttcg tggtcagctt cagtcaggtg ctactgttga aaagcttctt cacagaaaaa
      721 cgacccatca gcagggcagt ccactcctag ccccggcatc ctgctctagg gcccctcatg
      781 ccccaggctg gagcagctct cctaggtcac agcctgctgg gctgggtcgc gtagcccagg
      841 gtggaggcag aacgatgctg ctgtggtagc cctttgcctt tcatgcccat gcttgattct
      901 tgcacctcag cagctgaagg tctcagagac cagtaatcag aaggcatccg actgcattaa
      961 gtgtgcagcg ctgaaaagac atttacaact aggccaggga ttagccactg tgggagggtg
     1021 gacaggcaat ggttcagtgg cctggctgtt ggcaggaact ccaagtgccc aggcctcttg
     1081 ggcagcttag ggccctgcct ctgtttcatg atgcatgggt catttgtctt gggtgtccta
     1141 tcccatatgg agaagaaagg ggctctaagt tctggctctt ctttctttgg ggttctctgt
     1201 acctgaggaa accaggccct gggtgacttt gcagatctgc tcaccctcgg tgagcaacag
     1261 tgtcagccat gcaagcagga cagaatggtg actgggtgcc cttggtgagc tgtgtatttc
     1321 ctaggaggta gaaaactgtg ggaaactgtg gctaataaaa actaagtgtg agcgtcaaaa
     1381 aaaaaaaaaa aaaaaaaaaa aaaa
//