LOCUS       BC000025                1135 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type
            motif 5, mRNA (cDNA clone MGC:1143 IMAGE:3505623), complete cds.
ACCESSION   BC000025
VERSION     BC000025.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1135)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1135)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-NOV-2000) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC000025.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 7 Row: l Column: 11
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 37594463.
FEATURES             Location/Qualifiers
     source          1..1135
                     /db_xref="H-InvDB:HIT000029290"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:1143 IMAGE:3505623"
                     /tissue_type="Placenta, choriocarcinoma"
                     /clone_lib="NIH_MGC_21"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1135
                     /gene="NUDT5"
                     /gene_synonym="hYSAH1"
                     /gene_synonym="YSA1H"
                     /db_xref="GeneID:11164"
                     /db_xref="HGNC:HGNC:8052"
                     /db_xref="MIM:609230"
     CDS             328..987
                     /gene="NUDT5"
                     /gene_synonym="hYSAH1"
                     /gene_synonym="YSA1H"
                     /codon_start=1
                     /product="nudix (nucleoside diphosphate linked moiety
                     X)-type motif 5"
                     /protein_id="AAH00025.1"
                     /db_xref="GeneID:11164"
                     /db_xref="HGNC:HGNC:8052"
                     /db_xref="MIM:609230"
                     /translation="MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTR
                     TWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDG
                     ETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKP
                     KPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLK
                     F"
BASE COUNT          341 a          259 c          275 g          260 t
ORIGIN      
        1 aaaaagagct ttagtctcga aagaggaatt accgaagtgt cgagagagga attttaagaa
       61 gtttacaact ccgtcttcgc cctaaacgca cgctgacccg gaaagtaatc tcctgaagct
      121 aggtcaaagg cgggggttct acggatgccg gaaggagggt gcgcgcccat ccttttagca
      181 ccgcgagagg cgccggtgtt tcgagccgtg gcaccggcat cggctgacac tgctgcctcc
      241 agctagttat ttcgtcctct tccgttcttc acccctacac cttggaggtg aacttctcac
      301 ctgagggctg taaagactcg tttgaaaatg gagagccaag aaccaacgga atcttctcag
      361 aatggcaaac agtatatcat ttcagaggag ttaatttcag aaggaaaatg ggtcaagctt
      421 gaaaaaacaa cgtacatgga tcctactggt aaaactagaa cttgggaatc agtgaaacgt
      481 acaaccagga aagagcagac tgcggatggt gtcgcggtca tccccgtgct gcagagaaca
      541 cttcactatg agtgtatcgt tctggtgaaa cagttccgac caccaatggg gggctactgc
      601 atagagttcc ctgcaggtct catagatgat ggtgaaaccc cagaagcagc tgctctccgg
      661 gagcttgaag aagaaactgg ctacaaaggg gacattgccg aatgttctcc agcggtctgt
      721 atggacccag gcttgtcaaa ctgtactata cacatcgtga cagtcaccat taacggagat
      781 gatgccgaaa acgcaaggcc gaagccaaag ccaggggatg gagagtttgt ggaagtcatt
      841 tctttaccca agaatgacct gctgcagaga cttgatgctc tggtagctga agaacatctc
      901 acagtggacg ccagggtcta ttcctacgct ctagcactga aacatgcaaa tgcaaagcca
      961 tttgaagtgc ccttcttgaa attttaagcc caaatatgac actggccatt tttgtaaacg
     1021 agaccaccag gccttcttca ctaagacttt gtattcaact tagtttaatg tagatttgcc
     1081 attagctttt tcgtaaaata aaagcacaga acagaaaaaa aaaaaaaaaa aaaaa
//