LOCUS       BA000048             1680938 bp    DNA     circular CON 08-MAR-2012
DEFINITION  Candidatus Caldiarchaeum subterraneum DNA, complete genome, from
            subsurface mine microbial mat.
ACCESSION   BA000048
VERSION     BA000048.1
DBLINK      BioProject:PRJDA49157, PRJNA39577
            Sequence Read Archive:DRR000358
KEYWORDS    ENV.
SOURCE      Candidatus Caldiarchaeum subterraneum
  ORGANISM  Candidatus Caldiarchaeum subterraneum
            Archaea; Thaumarchaeota; unclassified Thaumarchaeota; Candidatus
            Caldiarchaeum.
REFERENCE   1  (bases 1 to 1680938)
  AUTHORS   Nunoura,T., Takaki,Y., Takami,H. and Nishi,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-2010) to the DDBJ/EMBL/GenBank databases.
            Contact:Yoshihiro Takaki
            Japan Agency for Maine-Earth Science and Technology,
            Extremobiosphere Research Program; 2-15 Natsushima-cho, Yokosuka,
            Kanagawa 237-0061, Japan
            URL    :http://www.jamstec.go.jp
REFERENCE   2
  AUTHORS   Nunoura,T., Takaki,Y., Kakuta,J., Nishi,S., Sugahara,J.,
            Kazama,H., Chee,G., Hattori,M., Kanai,A., Atomi,H., Takai,K. and
            Takami,H.
  TITLE     Insights into the evolution of Archaea and eukaryotic protein
            modifier systems revealed by the genome of a novel archaeal group
  JOURNAL   Nucleic Acids Res. 39, 3204-3223 (2011)
  REMARK    DOI:10.1093/nar/gkq1228
REFERENCE   3
  AUTHORS   Nunoura,T., Hirayama,H., Takami,H., Oida,H., Nishi,S.,
            Shimamura,S., Suzuki,Y., Inagaki,F., Takai,K., Nealson,K.H. and
            Horikoshi,K.
  TITLE     Genetic and functional properties of uncultivated thermophilic
            crenarchaeotes from a subsurface gold mine as revealed by analysis
            of genome fragments
  JOURNAL   Environ. Microbiol. 7, 1967-1984 (2005)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..1680938
                     /db_xref="taxon:311458"
                     /environmental_sample
                     /isolation_source="subsurface mine microbial mat"
                     /mol_type="genomic DNA"
                     /organism="Candidatus Caldiarchaeum subterraneum"
     CDS             62..1252
                     /codon_start=1
                     /locus_tag="CSUB_C0001"
                     /product="archaeal cell division control protein 6"
                     /protein_id="BAJ49870.1"
                     /transl_table=11
                     /translation="MSAALDEFLGSMSVFSHEERLSPEYVPDKLLFRERELELLFSFF
                     SSLLRDEKSFHVRVFLSGAVGTGKTSLAKLFGQEIERKGLGLGRKIRFVHVNCRIHKS
                     LYTALRKTAEALGVEIPRRGYSDEEILEIIVSFLRFNKTRLILCLDEVEALIAEEGSG
                     PIYLLTRSSEDIEAGALVSLILIFRGADFLERLDGQTLSGMGSNSIHLEEYSRDQLFE
                     ILRYRASEAFVKNAISDEVLDFLAEVAAERKDARYAIDLLWRSGKYAEAEGSSAVTAE
                     HVRKALASVYPTIRRENLAYLRPDERIVLLSAARSMLGNKASVTSQDVYETYKLVCEE
                     LRQEAKGYTSFWEILQQLQDLGFLRLSVKSEGARGRKTFVYLPGIPAQLLEQELVKGL
                     SHGP"
     CDS             complement(1236..2465)
                     /codon_start=1
                     /locus_tag="CSUB_C0002"
                     /product="replication factor C large subunit"
                     /protein_id="BAJ49871.1"
                     /transl_table=11
                     /translation="MTQLWTEKHRPRKVSEIVGNKEAVQAFLEWMAGWEKGKPSKKAA
                     LLYGPAGVGKTSLVHAYASEKGYEVIETNASDFRTRENIERIVGAASGMASLTMGQRK
                     IILVDEVDGIDARADAGAVTSLADIISKTHVPVVLVANDPWDPRLAPLRDACLMIQFR
                     RIPKPSVAAHLKKIAAAENVRVPEDVLRRIVENSEGDLRSAINDLQMASAALEMGLVT
                     GSRDRKDEIFTALATIFNAKSFNTAQEAARNIDIDHSELMQWILENAPQQLSPTDLAE
                     ALENLAKADLYLQRINTRQNWQLLRYAVPMMTAGVALSRKTSPSKFVKFTYPEAIKFL
                     GRTKSIRETLNSISEKVGKKLHMSARKARTEILPYLKIIMSHDGKELAEYFELSPEET
                     QYLRGGEVKKSRAKGRG"
     CDS             complement(2462..3445)
                     /codon_start=1
                     /locus_tag="CSUB_C0003"
                     /product="replication factor C small subunit"
                     /protein_id="BAJ49872.1"
                     /transl_table=11
                     /translation="MSASDVKNLPWVEKYRPRRLDDVVNQEQVVEALKNIVVSKNVPH
                     MLFAGPPGTGKTATAHAFAQDLFGPRYIEDGHFIEINASDERGIETIRERVKTYARSV
                     PFGGIGFRLLLLDESDQLTDAAQHAFRRTMEQFSTTCRFILAANYSNRIIEPIQSRCA
                     VLRFKPLSKDMVETMLKKIAASENIKLDDSAIDAIYEFSLGDMRKAINILQSAASISK
                     TIDSKTIYDVMGVVSRGEITRMLQLVLDGKFIEARNLLRELLYVQGYQPTDIVSSIAR
                     EIPLLPVSEQDKLRLMDLIGETDYRISEGGTPEVQLQAFLAKLALVKRSGA"
     CDS             complement(3468..4202)
                     /codon_start=1
                     /locus_tag="CSUB_C0004"
                     /product="TatD DNase family protein"
                     /protein_id="BAJ49873.1"
                     /transl_table=11
                     /translation="MIDVHCHLTEEPLFSNLGEVIEEAKKSSVEAIITSGIGPADCEK
                     VLSIVDKVYIYGSLGIEPYALEGYEQVIELIMRNRERVVAVGEVGLDYYWGKKETREM
                     QAKVFREFIQLAKSLDLPLVIHSRSAGKYALDILIEERAERVVMHAFDGSAGEAARGA
                     AKGYFFSVPPSVVRSEQKQKMVRRLGLENLLLESDAPVLGPERGVVNKPSNIAVSAKT
                     IASLKNIPLEKVLEKTTENAKNIFRI"
     CDS             4177..4542
                     /codon_start=1
                     /locus_tag="CSUB_C0005"
                     /product="hypothetical protein"
                     /protein_id="BAJ49874.1"
                     /transl_table=11
                     /translation="MRWQWTSIMLRKILAFLFMLSALLRCVCGAAVEGLDDLRVADEV
                     DGLIRLRCRNSYCELEEICAVSVSEGVADVRFSRMFSEFNLLFMGRDELTKKLRRLGV
                     KVVKGLFGGKSIKTRIKNL"
     CDS             4545..5204
                     /codon_start=1
                     /locus_tag="CSUB_C0006"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49875.1"
                     /transl_table=11
                     /translation="MGFRLRDVEITWLGHDGFRITRGNFVVYIDPYQITGGPAGDLVL
                     ISHDHFDHLSLDDLRKIVSNKTTIVAARNCQKQLGEIKVAAVKYVSPGDEVSVGEAKV
                     KAVHAYNVNKFREPGKVFHPKEYGGVGFVLTLGGVSIYHAGDTDFIPEMKGLRVDVAL
                     LPVSGTYVMTAAEAVEAAKSMQAKTVIPMHYGAIVGSEQDAHEFKRLYGGETVILSKE
                     S"
     CDS             5210..5662
                     /codon_start=1
                     /locus_tag="CSUB_C0007"
                     /product="hypothetical protein"
                     /protein_id="BAJ49876.1"
                     /transl_table=11
                     /translation="MRWMSGCADSHDYFYYGALNIYHRSELLKVVDAWRCRRCGVLRV
                     GVRGPEVLTSTEGMLPEPEDGKKWILLVCRHGEPPCFELLQLRDGESFVHKCAFGEES
                     LTYIDGKGVFYGLDGPPATRCHVYELAKILKGYIEIGKNPPEVVSLIR"
     CDS             complement(5651..6082)
                     /codon_start=1
                     /locus_tag="CSUB_C0008"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49877.1"
                     /transl_table=11
                     /translation="MKWSLEKQAEEVYRVVVEALEAGIRGDEETFNDLHSHGYTRYSD
                     LPPYRLQSREEALKLKISLLTQLIDFEYSLENFQTFYHGDVAVACFLLRYRGMAVNDY
                     AFEGRMVEGVARCTVVLEKNGDKWRILHEHLSRVPEGFSAD"
     CDS             complement(6054..6323)
                     /codon_start=1
                     /locus_tag="CSUB_C0009"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49878.1"
                     /transl_table=11
                     /translation="MIEKIVVESVEGDRLFKLVRGQVFVRGVAARFEGVIYQSVGGPN
                     VRAMIDSGDAEKLRQHGLGGEDVEKLELMLQEKILNGEVELGETG"
     CDS             complement(6316..6723)
                     /codon_start=1
                     /locus_tag="CSUB_C0010"
                     /product="hypothetical protein"
                     /protein_id="BAJ49879.1"
                     /transl_table=11
                     /translation="MDEVEKFIEAYARAIQEPSDNNLLTLLHALLPFSPAGIEWGLEI
                     ASLAGVTYMLEDGRAIAVKVSRDEFGPFMQTSVAQVSLNTIPSAALKNIKDVKAFVNR
                     VAEHLSEWARRMPDTNPVKKRVETLLMRVRQLD"
     CDS             6752..7228
                     /codon_start=1
                     /locus_tag="CSUB_C0011"
                     /product="hypothetical protein"
                     /protein_id="BAJ49880.1"
                     /transl_table=11
                     /translation="MFYTITPVWHIMTEHDPGRKFFPKEFSDRERAVFEAGIALGALF
                     HSLIGLPATTETKHILEKAFEKSFSLQPFRKSVKLKLYAVKRKHGPYGYGSIGPRDIS
                     ASVTVCYGAATAVAEVRYVASLGYPLMYVSRVNERRSVSSPRPYARTRGAKARRSV"
     CDS             complement(7152..8264)
                     /codon_start=1
                     /locus_tag="CSUB_C0012"
                     /product="molecular chaperone DnaJ"
                     /protein_id="BAJ49881.1"
                     /transl_table=11
                     /translation="MPSNDKDYYEILGVPRNATKEEIKRAYRRLALQYHPDRNKSPEA
                     EEKFKEISEAYAVLMDDEKRRLYDMYGKAGVSQTYSTEDIFRSRWFDFEELFRDLGFG
                     GFESLFERLFGFGRRQKSPQPTVVDVEISLEELYRGGVREIPLETYETCQRCGGAGGE
                     PGYVDKCVECGGTGQSVKRVQTGFLYFTSVQPCGRCGGTGRVVRRSCSACRGRGMVSR
                     TEKVVVNIPPGVGDGETLVLRGRGLYDMDAGSRGDLLVRVHVKLGRWFRFEDNRLVML
                     LPVAPSEVASQREITVPFFDGDIKVKLRRELLDKPLVIRGKGPPMAGGRKSDLEIRLV
                     LKMPEHLGGEALKHYAELLRHESAHMDEERRRFFSH"
     CDS             complement(8267..10045)
                     /codon_start=1
                     /locus_tag="CSUB_C0013"
                     /product="molecular chaperone DnaK"
                     /protein_id="BAJ49882.1"
                     /transl_table=11
                     /translation="MAEKIIGIDLGTSNSAAAVVIGGRPTIIPSVEGVTLYGKAFPSY
                     VAITKEGDLLVGEPARRQAVLNPEGTVTAWKRRMGTDYRYNLHGKEFTPQQLSAFLLQ
                     KIKRDAEAFLGEPVKKAVITVPAYFNDNQRQATKDAGVIAGLEVVRIINEPTAAALAY
                     GLNKLDQEMKILVFDLGGGTLDVTIMEFGQGVFEVLATAGDTQLGGTDMDKALVDYIV
                     DTYRRETGIDLSNDKSAMNRIREAAERAKIELSSMTETEINLPYIAYDSSGPKNLYMR
                     INRATLEQLVKPIVERCRGPVMQALQDAKLKPEEIDKIILVGGPTRMPIIQQFIKEVL
                     GKEPERGVDPMECVAMGAAIQAAIISGEMKDKDIVLLDVVPISLGVETLGGIFTKIIE
                     RNTTIPVRRSEIFTTAADFQTSVEIHVLQGERPMAADNVSLGRFTLSGIPPAPRGVPK
                     IEVTFDINADGILTVTAKDLGTGKDVSVKITAPHRLSKEEVERMIREAEQFAEQDRRK
                     KQEAELRNEADGLIYTVEKALKEFGDKVSPEAKKEVEDDLAKLKEALAGKDIQAIKTA
                     LEKLRASAQKIGTAVYGQREDQQKKS"
     CDS             complement(10133..10627)
                     /codon_start=1
                     /locus_tag="CSUB_C0014"
                     /product="molecular chaperone GrpE"
                     /protein_id="BAJ49883.1"
                     /transl_table=11
                     /translation="MDGMSGEGAESLEELRAQNRELLERLSYALAEMANMRRVMEKEV
                     SRAEQAAAERLLRKLITVYEDLERVVKSLETSEAPPALAQALQMIYRELTNILASEGV
                     EKMDVVGKEFNPFDHEAVEYIDSDTVAVDTVAEVLSNGYRMGDKILKPPRVKVARPSK
                     QTSG"
     tRNA            join(10708..10760,10791..10812)
                     /locus_tag="CSUB_T01"
                     /product="tRNA-Arg"
     CDS             10950..12401
                     /codon_start=1
                     /locus_tag="CSUB_C0015"
                     /product="hypothetical protein"
                     /protein_id="BAJ49884.1"
                     /transl_table=11
                     /translation="MHVADGGLVFVMDNVPVNSVTETIKLGYPLDMVKNLAGYYLLNE
                     RGRFVEKSDDVFWLEVSPETGWSGRTVSVVTVWRDMLVETGQGKYQLVVPSNPIIEKE
                     LSEIFVTFSSDGTPTINSVSGAEMSISGDKRSANGTVKNIPPKQFKPLTIYFDAPDLL
                     RYTVEQATILYDLEQNTVSISMYVKNLGDASMNSVSLRLGREAKIVSAKSGIFNLGTS
                     WSAETGTLDVTFLYSIDRNERTLIEVTYVAKEAVDRMGDRLEVKLPYLLNASYTTLYV
                     TVKTPPATQVTTEKEPWSLKILDNNRREITFMYQNKYLTGGETVSITYSPASTFPVPA
                     VLLAAIVVVAVFLAVKTTSAPRRTVSPQLKKAQTSLENALDKLLKELETLKPGDKPLK
                     TTKVGEEAVKSLRTELTELRKLPEMSQAYPQVEKTVEEILSIVSALSRSAEDYKAGRI
                     TGAVYQKIYDEYLKQVRRTAGRVLEVFDRLMRT"
     CDS             complement(12388..13455)
                     /codon_start=1
                     /locus_tag="CSUB_C0016"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49885.1"
                     /transl_table=11
                     /translation="MATVWLDILTPKQFWFFRKVAKLLTKRGYRVVATSRNYEQLSSF
                     LVNPGFEGFHVVGEFGGAGLRGKLVKSVERMRGLLDVLEDFDCAVSSGSPEAARIAYG
                     LSQPHVLASDTPESPVNRLAAPVSKKIATPWIVGKHPWKAYGVRDGDIITYRALDPVA
                     WIKDHKPNKQTLDELGLVSMEYVLVRTPEYKASYLIKSGYQLEVFASVARRVAEMIRP
                     RRLVLLPRYVDEILYLRDRVGDVALVVEKPVTDLTLLSSSLIFVGGGGTMTQEAALLG
                     VPCLSIYPITPPKVIRYLVSKGLVERVKKVEQLPSKLERMLKTIDKLRDVSEKRAANL
                     LRRMEDPAEKVVSTVEAAMSS"
     CDS             13554..14540
                     /codon_start=1
                     /EC_number="2.7.8.15"
                     /locus_tag="CSUB_C0017"
                     /product="UDP-N-acetylglucosamine--dolichyl-phosphate
                     N-acetylglucosaminephosphotransferase"
                     /protein_id="BAJ49886.1"
                     /transl_table=11
                     /translation="MFQTAIVAAAAAAATAFVMLPVSMWLSRRSGAMGLDVHKPNPYP
                     VPKLGGLAIVAGLAAGALVCWVFTSSSILAPFVGSLAVAALIGLWEDFREINPVLKPV
                     LLVVAGVPVVAAGVYSPDPVLPFVGPTRLTILYPLLVLLGFSIVCNAVNSLDVLNGSM
                     AATSLTAILPLTIIAYLEKKAEIFSLCLVTAVVLLVFLSKNIYPAKTFAGNVGSLAVG
                     AVIAYVAIVGRMEVAAIVALLPHIMNEFHIIYSLGGLRSGKKAPTRPTIINSGVITAN
                     VDRKAPVTVVRLLTAGEKLTEPAVVWRLFLLCLYSAVLSLLTYFLFIRRWLP"
     CDS             14537..14803
                     /codon_start=1
                     /locus_tag="CSUB_C0018"
                     /product="hypothetical protein"
                     /protein_id="BAJ49887.1"
                     /transl_table=11
                     /translation="MSRGFLKVLVLVTVVWLLFLAASSSIAYIVLAVLDGSAASVAVS
                     VARTVAGVVVFLVWVVGWHRLTVFWLHRVLLGEKVHEGSAGGDG"
     CDS             14775..15821
                     /codon_start=1
                     /locus_tag="CSUB_C0019"
                     /product="hypothetical protein"
                     /protein_id="BAJ49888.1"
                     /transl_table=11
                     /translation="MKVLLAAMDETGVAAAAKLAKQGFQTVFYTPDPYVEKKASEYNP
                     SLHRGMSKQEFIKLCAENKLTVTRQPEKSYQEVWITVNTIKEGRDTLHSAENLVKTVG
                     EKLRQAERLTVSGLTKPGECRHLLNLFTRSSAADPTETNYVGAVSATGKLLPAWSSSE
                     KTSPVLEKLGATFFQSPELAEIASLWNILSEAVEAWTLIEMAILHGHKELVMNCFTRE
                     AVLYHEHLDAVKAYRMQRDTPLLNNLYTKMRKTVYRAEASVLSQVREVSRKYRREFRL
                     LVVGCPEMVGERFVDALKGRRVKVSVVDAEDVSPEKLGSFTGFDGVVVAGLRIDMLRE
                     LSKHFSYVWFVPTV"
     CDS             15833..16819
                     /codon_start=1
                     /locus_tag="CSUB_C0020"
                     /note="Similar to 3-chlorobenzoate-3,4-dioxygenase
                     dyhydrogenase/idhA; putative myo-inositol 2-dehydrogenase
                     (EC:1.1.1.18)"
                     /product="dehydrogenase"
                     /protein_id="BAJ49889.1"
                     /transl_table=11
                     /translation="MVDVAVVGAGFWGVNHIRVLKELGESEVVAVCDIDRERAGKAAA
                     RFGIEHVYTEVDTMLMETRPDAVTICTPSTTHASLALKLLDHGCDIFIEKPMASTVDE
                     AAKILDKIRETGRVVMVGFIERFNPAVQFARHMIEDKEIGEVLLFYGRRIGWWPERIG
                     DTGVVKDTAIHDLDLVTWIFRTLPDEVYAMCGRLRHSYEDHAQIFLSYGEGRSALLEA
                     NWLTPRKKREMHITGENGVVSVKFIEQEVVVEKAEQTIIPHLKASEPLRNELKHFIES
                     VKNHSEPGVTAYDGLKATLLAECVLESAKNRSPINPRKYITMLGYGKHVEKP"
     tRNA            complement(16825..16900)
                     /locus_tag="CSUB_T02"
                     /product="tRNA-Pro"
     CDS             complement(16942..17580)
                     /codon_start=1
                     /locus_tag="CSUB_C0021"
                     /product="hypothetical protein"
                     /protein_id="BAJ49890.1"
                     /transl_table=11
                     /translation="MEVSVEWILETILGKTLLSIQAAEAALSKNRKTVYALTTMSPQN
                     FLELAKSIGAEFDNHLDEGRLVLVDCHTRGEHTYPAKYSISPEASLLEIRQTFLEAAD
                     YSSNYFLVIDDLSTLLAYIPSENAFKFYQAVASDVRRNGGTCVAIIVPDILEQKLTNL
                     LYSLSDGVVEMMMEEMGGNLRRFLRIRFLRGVRHPTEWSEYVIGLHGIELLP"
     CDS             complement(17740..18096)
                     /codon_start=1
                     /locus_tag="CSUB_C0022"
                     /product="hypothetical protein"
                     /protein_id="BAJ49891.1"
                     /transl_table=11
                     /translation="MIVQSHIKGYGLLSSRILCRLLRVVDRRFMKAYRGKRSRFRHLF
                     KPRGPIPFTGLDPGLEEYRSNILREVDRVYAVASAYRERTREPLPFVETVFADRMEER
                     VELLVPPQLSRSRGGG"
     CDS             complement(18374..19219)
                     /codon_start=1
                     /locus_tag="CSUB_C0023"
                     /product="hypothetical protein"
                     /protein_id="BAJ49892.1"
                     /transl_table=11
                     /translation="MRFYADIHRKKDDSGYRITYTTDGETFRHVDSPAKIPAEVGDKV
                     YVDVIPIMHTDGFIELLKRGVEVYYLRRLTLIEKMRKKLGISKSAKTDIKILMSIDEK
                     WFKRVDEDFLAMRQLISSFRRLERTKQRLENQSKDVSDVAKDSFKRLIDHIEEEKLIT
                     ARPITEEAERRYPLFRIIAEELGITGENHLLAREALAELLTYVDFNLSFTDVRLYLGL
                     FRQRINNQKYNHIARKALNRLTMSITNKEPIARDEEEIAFKIWLTIRRETQERLAGVA
                     AQQQG"
     CDS             19578..20285
                     /codon_start=1
                     /locus_tag="CSUB_C0024"
                     /product="hypothetical protein"
                     /protein_id="BAJ49893.1"
                     /transl_table=11
                     /translation="MEETPCLSHGEDGSESFLGGASESPESSEPSAWVSPAGANRTRA
                     GRLPIHSWSHKGRPDTCTVLETSRSSASSACLQAAAAQGQAAAPAAHGQAGPPYAGAA
                     HGQAHRRARTRARPRGGGRRTGRRMHRPAHGQGLRSPSTRAWSQARASQPPPPPHIYQ
                     WGGRLVSGVYGMVVLVMGLLVNLCPGFLATSSPHPRVRLGLCFAAFGRVASTRARKPS
                     QDGEKGPRHPKNPIETI"
     CDS             21199..24258
                     /codon_start=1
                     /locus_tag="CSUB_C0025"
                     /product="type II restriction enzyme, methylase subunit"
                     /protein_id="BAJ49894.1"
                     /transl_table=11
                     /translation="MRLDTGFWVSKAEELGYPVKIEELSVDYLRESGVFPRVLNVVQS
                     LRLYLDDYIEFVIISVDGKVSRGLCTRVARSWKEKRLIRPLLIFTSGKDESFIVTVPG
                     AGTGGEARVLHIEGEFYRTDIEVIESLRYRGDPENLRKAYDSEMLPYDKVREEFFEGY
                     RELYERIVKTVKSVLKDNASSYAQRFLGRLMFLYFLQRKGWLKGDRSFINKINDYLEL
                     NRLFYESLNKKNGEEGIPFLNGSLFEREEYLTSKVEKELAMKMNSIFYDARNFFNRYN
                     FTVDETTPLEVEVSIDPLLLGTVLENLLEEKERGEKGTFYTPVNEIGFMCRRAIAAWL
                     GLEEGVQQRNGELRFVDGLQRYVDELKKRRDEREIREFREKLLTLKILDPAVGSGGFL
                     VVMMQTILQLIQEVEEAVGWKSDLEQYKRRIIPNLYGFDIEPEAVEIARLRIWLSLIV
                     DQMQPEPLPNLDLNIVTISDSLELPQGVQTALGEFGKELGYLSIVEDIEAVKARYLNE
                     HDATKKNALRKRIEELRQEFVKRTGLAVRAGPPVEFFMPSLADIVVMNPPYVRQEKIP
                     KLKKDYYVTNYKLDKTSDIYAYFMVRALRLLKSGGAAALITSDKWLEVNYGKTLQQVL
                     KPHILAIYGQRMRSFQADVNTVITVLKKEEQPKDKPIQFIYLETYGGEKVRNYKSIER
                     GKLQPGKWYYLRAPRIFEQVLLPKLTHKLKDFAEIRFGIKTGANEFFYMKDVTHLYEA
                     DYLANPRRFEQWGVRAKTAKELQQQGLIYIENEAGERFVIDRKDVKPIIRSPREIRSY
                     IIKDVRTLCLYTANPGRYTRKYITWGEQQGHHQRPTCRARNPWWTLPEFKPAHILLPM
                     SWRKIIYIPYSEQPVICDARLYAFYSKEPIKTWKYINSTIFLLTVELFCRRLGGGGAA
                     TDIKVEDYEDMPAPNLNNLMIDFPVEILASNVPLQYSDEVKREERRMLDKAVLKALGF
                     PENELDRLVDELHRAFVEVVEDRLIKAGRPIVEDIESKEAGEVGEDN"
     CDS             24242..27322
                     /codon_start=1
                     /locus_tag="CSUB_C0026"
                     /note="SNF2/Rad54 family"
                     /product="helicase domain-containing protein"
                     /protein_id="BAJ49895.1"
                     /transl_table=11
                     /translation="MAKIIDNKKETLAFVLNKEFSEVDEIAIASAYFNVRGYGAIAQG
                     LGDKPMKLLLGREPTETIKWEDEILQELEQFEDDADYFRLLQKTIQYFKDDKRLVRIM
                     ERRFFHGKAFIGVSLDKKEVRRGIGVVGSSNLTYGGLVSNRELNMLNTDREVVQELAE
                     WFEEQWNQSRDFKEEFISLLSNYVTSWSPYEVVAKALYETYKGSLIERETKMLKHLYP
                     HQQLTYIDAKEKLEKYGGVLIADSTGLGKSRVALALAHEAIREGIRPLLIAPKSILET
                     TWEAEMNETLVRIDTLSTEMLSQNPDIVDDYVGEKGPELIIVDEAHYFRRSSTNRYIA
                     LRELVNKNQAKIVLITATPVNTSLMDLYSLLSLYLPENCIADLNHQSLYEYFVTQQRR
                     WLAGEPINMDDILRRFIVRHSRELAKALDREGRIRFPKRVFDEKIGRYPITISLDEIY
                     KKLENLSLAFYDLSIERLSAQFRLPDGTRIEKKDPTQVENLKNLVKTIFIINLFKRLE
                     SSYAAFEETLRRMLSYIRAAKHYATKFSVFIPPKMRGDILNLFPDVEEREDEIPFEEF
                     PAPEELFSKPRYKGLYNECKLSKQEAEEFVANCSKDEEAIESLLRMLPNHDEKYFLLE
                     RRLQQIMKQIKEPNGVIIFTQYADTAHYLYRRLKASFNRVMLVTGAGGYNDKGEKALE
                     DHIVRRFQKVGGLLISTDVLSAGQNLQNAQYVANYDFPWNPVVLIQRVGRIDRIGSNY
                     DIVYLINVLPRNGDPDDPESLEHFLGLMQRLYKRLEMIRGTIGLDASTLGEEAAPRDF
                     SIQAMIARNDERVLKILEQKIEQFTKDPIDILARILNEKGLQWVERIPNGIGAIKRGT
                     LNGIFALLTDGDNFYWRLHVLDKDKEKIITSPTEIVDLLLEGESDNRGEKLEYDKLIP
                     LLVMVKESLKKELEEVMRRETTAMGPPRVDKKTRTVFDALSQLGDEGERLASMFRRVA
                     SKPAIVNHLYRAYLEGKLLEEARKILPKAVQEIATTNPETKELRRVCWCYFTKT"
     CDS             complement(27475..27801)
                     /codon_start=1
                     /locus_tag="CSUB_C0027"
                     /product="hypothetical protein"
                     /protein_id="BAJ49896.1"
                     /transl_table=11
                     /translation="MLPSLPPSAFSSLFPSFCIQVFSSSLEELAADSRKFDEVVVYVR
                     HGSTLRLLEKWLHSFRVGDEAEIGEEMFYVVSALQRTPASGQNIAVDEKTVVVLRCVA
                     AKGVWL"
     CDS             28106..28510
                     /codon_start=1
                     /locus_tag="CSUB_C0028"
                     /note="excalibur calcium-binding domain"
                     /product="hypothetical protein"
                     /protein_id="BAJ49897.1"
                     /transl_table=11
                     /translation="MKMQSITLTNEVTKTMSTTVTMRATATVTALITKTLTATERSTA
                     TTTVTTPKTTTTTVTSMTTTTVTMTATTRLTTTVTGSATGQRCDPSYPDVCIPPPPPD
                     LDCSDIPYRNFRVLPPDPHGFDRDGDGIGCET"
     CDS             complement(28820..29095)
                     /codon_start=1
                     /locus_tag="CSUB_C0029"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49898.1"
                     /transl_table=11
                     /translation="MAVSLTELFILITPPIIIIVLILRYRKRKRSEMLARVLAVIRSR
                     GKASLDDIIIISGLPIYSVHNAVNELVARGIIYVKEEDGKIFYTVSK"
     CDS             complement(29596..30312)
                     /codon_start=1
                     /locus_tag="CSUB_C0030"
                     /product="hypothetical protein"
                     /protein_id="BAJ49899.1"
                     /transl_table=11
                     /translation="MFDYVYREYLPGIIGSIRDFQPAYWACTEIQALLSDVTDLVNID
                     LPRRFKTEDNIKRLLGYSFPVVMVCVVRPSVDHLFGAFMVGALPLCFHPLRIIIESIS
                     YSYYIDSVNYEGHRDGLERLRHLDEELRKGSISFSRFVKEKLVDEAKMSVKLAEDLKK
                     LWYMVSNDFLHIRGYIDKLDRWNKDDRDTSLPSWMVGAFTEYSEGDEETLEELANCIK
                     KLRPLIRNIYDSWLILVTKK"
     CDS             31206..31625
                     /locus_tag="CSUB_C0033"
                     /note="Probable gene remnant of transposase"
                     /pseudo
     CDS             31867..32742
                     /codon_start=1
                     /locus_tag="CSUB_C0034"
                     /product="cobyrinic acid a,c-diamide synthase"
                     /protein_id="BAJ49900.1"
                     /transl_table=11
                     /translation="MSKVVSFINYKGGVGKTTLAVEIAAALAYHRGKKVLLVDADPQT
                     NATFYLISEEDWDVWQKNKGTLKNIFDNYLEGRDTDINELIIKDLEVSSRTPNLHLLP
                     SHIELIHIDLKLAGISGSRGIRAKGLLKKALEKVKQNYDYVIIDCPPNLNLVTQNSIV
                     ASDSFIIVLKPEFLSTIGIALILRVINDIVREINDEFQSFGFREEFTGPEFSGMIFNF
                     VKYLSGGTRSQEVVINEVKRQYPGKVFKSFLSESVKLAERPVEKIPISISGLASDRNY
                     ENQLKSIVEEFLQRV"
     CDS             32745..33152
                     /codon_start=1
                     /locus_tag="CSUB_C0035"
                     /product="hypothetical protein"
                     /protein_id="BAJ49901.1"
                     /transl_table=11
                     /translation="MKKLVKPKTLHELAKILIQIGELMQSLPDFNLVDIEQPSKINEQ
                     REKEVSKNFLAQPVVGTDDDISAFVSRMRQIKREEAEKMLSALTYKKLKLVVKTLGLP
                     VGERKNKDVLIRKILWHLFDFEKGHKLLRNGES"
     CDS             35245..36705
                     /codon_start=1
                     /locus_tag="CSUB_C0037"
                     /product="hypothetical protein"
                     /protein_id="BAJ49902.1"
                     /transl_table=11
                     /translation="MMRVGILILVISLLVVGVLATTTFLHPSTHQITSVKPGETDTHT
                     TVQTAMSPSMTRLNLIAKLEGDAIPLWFDRGVLYLAHGLISVVTGQDGGGVDLVKLDV
                     GSDSMVKVTTLRDDWRGQVYLHLAVGQPIFDSDKAYFLMENMQLAKIVDLNSGEMWTV
                     DRRGTYLYFVGAGAGVLYALDAASGDISLVAIDNMGNELWRSPREPLVLKDPYQYIIF
                     RAGEVPRFLLVEANGFVERSGGWFATPTLLTITISPDGKAKVERRHISGEIGPMPAIS
                     SGGWAAAARDGYYVLVVFGQRLFLCRLGVEMSIMWCNDFGEYRIDLSNGGILLHTFGE
                     GVLVGFPYQYRLNTTYEAYGVRIRLAFYGQDGKLVWSSNYTPNDLPFNFNVVGEHGGS
                     LYALIPDGKQFIGPVSQGTKITLVRIGRDGTINAILSVKDFLAAELFRGEDPWSYRFS
                     DDIHAIIIDNKLILTTKASVKDHVYTYVVAFERILQ"
     CDS             complement(36729..36992)
                     /codon_start=1
                     /locus_tag="CSUB_C0038"
                     /product="hypothetical protein"
                     /protein_id="BAJ49903.1"
                     /transl_table=11
                     /translation="MPEGYRIDILITAAMIVVEMDELQNYQERVHAKNLEKFNVSKKR
                     GYEAFMIQAVDVSRDTASIAEMIKDSYIRRMNSGQKACEHWLQ"
     CDS             complement(37175..37612)
                     /codon_start=1
                     /locus_tag="CSUB_C0039"
                     /product="hypothetical protein"
                     /protein_id="BAJ49904.1"
                     /transl_table=11
                     /translation="MTEKFVLDENIIILAAKMENEKGEPDVTCLRLLLDIIQKCHTMV
                     CSGNLLERYLRVISNLAGKHQSSVPKLLQMAIIIKAKVQLINYLPKLSNENQIPPDDV
                     EIVRLANHANATLVTIDSRLKEAMKRLPYTIRVLTPNEAYDFV"
     CDS             complement(37615..38910)
                     /codon_start=1
                     /locus_tag="CSUB_C0040"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49905.1"
                     /transl_table=11
                     /translation="MIEKLTIQGFKSLKNVSLDLGLITVIIGPNRSGKSSVLHALAAL
                     RQSLGQGHLYANGQMINLGSYQNILSTQSKEIKFVLTGKRFIDPAELAPISRSDNKIE
                     YVTYKYGVMFGSDAAWVWHSGEISCNGLRFKATLDSYGNQELEPRRIQVDEIGAVDLA
                     EAPYIAKPIVSTMTFSSNTPTTSIMLRRVKDAYDKIFNVIFNDLDSFRFVPVLRGFDN
                     HSYKLTGYNSDVIANPNVTIQAQYASNLLTYRRDKLEDKVSDWTEKITGARIYVRIEP
                     PDLAALRSRDGEVETYLVNDGFGLNQIVIMLLALAVAPEMSIIGIEEPEIHLHPRSQA
                     TLADILTDVAKKEKKQLIITTHSEHILLRLLTAVARRDLSPEELKVYYFERVGGETKV
                     TNLAVNEKGQLEGGLKGFFEAELENWEKYLEALRPSKER"
     CDS             complement(39340..40257)
                     /codon_start=1
                     /locus_tag="CSUB_C0041"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49906.1"
                     /transl_table=11
                     /translation="MGEVLIGAGGWRYFNVPGDRLTKYAKVFDFVEVNSLFYRLLPLD
                     VVASWRKKVPDSFVFTVKCNRKITHIHGLANNRESMKVLEYMLRVCRLLRSPLLVMET
                     PPTLRVTCELLRDFFSSSPSKDVMYALEIRGESDGKALEAMRELGLIHVVDISRQEPS
                     YYHDEITYSRLFGKGVHNIYQFDDDELLEISRKAEASPSKRVMLSFHTVKMYEDAARL
                     KYYHETGKFPQTTGKTGIQSLEKVLREDPFFPASRDDLIAIHGWKIIDLTHDKRIRAA
                     QLLSTLDPTRRYHTVDEVISNIASKTEKT"
     CDS             40296..41462
                     /codon_start=1
                     /locus_tag="CSUB_C0042"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49907.1"
                     /transl_table=11
                     /translation="MFLLTGILLGTSGWSYDEWVGPFYRSKSEPKLRRYSNLFETVEI
                     DSTFYSYPGERTVAGMMRAVPESFQFTAKVPGEVTHRLGLDVDKGALEAMERFTKLMR
                     PMLVKGMLGCLLLQLPPSMKYSPELLEKFLESVDRGFRYAVEFRHPSWIRKETFTLLR
                     RLEAAYTIVDEPLLPPVVEVTTDFAYVRWHGRGKNPWYNYHYNEAELRGWVDKLQSIK
                     GSVRRVYGYFNNHFHGYAVHNCIQVLEMLGLADERHKAVKTQLENYFMMTGIWREEEA
                     PVASDEEKMRLLSSLVDTPRLRRASEIADEQVQIITASPHYIRARIKEYTAIVDVEKM
                     VILHDCEDWKKGSIQKRLCKHLTRLFLTLPEDTATPILKSIKSYLSTWSFEVKN"
     CDS             41587..42075
                     /codon_start=1
                     /locus_tag="CSUB_C0043"
                     /product="hypothetical protein"
                     /protein_id="BAJ49908.1"
                     /transl_table=11
                     /translation="MFIASYRERLERIRVGDVVYKEEEETSVTEIGSILNGFEPVIAD
                     VRLSTETLLSTLRMFERDFDYVMFSFRDGVLSISSKSLERSLKVSGRGEVDKQYFSLY
                     YLLRYLKGIDRLGIKGVRLLFSEAPQEFSKDPQKNSPKPIIIEGRIRDMEITLYQAPR
                     IE"
     CDS             complement(42347..44851)
                     /codon_start=1
                     /locus_tag="CSUB_C0044"
                     /product="hypothetical protein"
                     /protein_id="BAJ49909.1"
                     /transl_table=11
                     /translation="MRSTILLVMVFLLLVSAYAAEPIPPGTPYGTVYVRVTDCITGAP
                     IQGASVNLDNPTHRTGGVTNSTGYASIEAFAWFYTYYVTASGYRIDAGERRFSLDEVF
                     NVCLVPEAAGFWRVVADVLAWQGDIHAGGRGWAIIRLKNLEAGVFNITEFQIWVAGYD
                     GPAITYTVPGGVILDRLVERSFNISINPRPDIPTGRLKAELRFRAVFTGADGRSIGPL
                     TVSTDLDYVMIAPYRSFRIQVLDKWGQNPVPGAVVEFIPTLPNVEGSFTYRADENGYI
                     DVKRVNDGAYLTRITYLSPYDEKVYLAAQQYTVLFDLVKQPFLRSSLFEVHVDVRDLG
                     NRPLETDVYLNGVRAFSVDGLARFVNVPPGEYSVSVRWMDVEVYTSQIRVEEPLVINS
                     PGGRLQATVDVGDVGVKLETLEGKQVNLPVKILLTPLNRLAENVSATVFERLPRGEYV
                     VKVQAYDAYRERYVDVGEQYFAIPRDHGQHTIRVKVFDAAVEVVDKEGRRIDAELTIE
                     GKPVSLRGGKATLTNLTPGPYLFKASWNGYTVLDIMAEPRPGETLTLSAEIYKMRLRV
                     LGVDGRPLMKASALLWQGQSSEQQTVVNGSAVFDQVPAGAHQLTIFLDDVAVFNGTVK
                     ASEEVSVAAEAGWVELFFHDQNGAPISGVEIVATGFDVQKTGADGVARLSQKPLGSYG
                     FTARYRGFTVFEGVAKAGNRTEFTLPLYSLKATVVNELDTPIEASITLTRGDVSLGTF
                     TGSEAFYHLLPPGPYVLKASVGTKQAVQQVNLLSDGQVYVIKVPVTLVLGNISLSSSD
                     LLTILMPIAVAVVAVASIAGLRKAAGQRRKRAKGMV"
     CDS             44842..45156
                     /codon_start=1
                     /locus_tag="CSUB_C0045"
                     /product="hypothetical protein"
                     /protein_id="BAJ49910.1"
                     /transl_table=11
                     /translation="MSAFYRDLAYVCLYLFSVALVGRAVVERRDYIAMMQSIGRWSLV
                     SARNVLRLVIKTVAGLLLIGSAIIAYNLSTTPLASIPVIGTLTVFFTALLVISAVLIL
                     IY"
     CDS             45165..46376
                     /codon_start=1
                     /EC_number="4.2.3.1"
                     /locus_tag="CSUB_C0046"
                     /product="threonine synthase"
                     /protein_id="BAJ49911.1"
                     /transl_table=11
                     /translation="MKPPYLRCISCGAEWSGDEIIYTCAKCGSLLEVVLPGLEEMDGR
                     AVAGLWSGRERTMWRYREVLPVDKAVVSLREGGTPLYEASAAARWAGVKKLYVKFEGM
                     NPTGSFKDRGMSVAVSKAVELGKRVVVCASTGNTSSSMAAYAAAAGLKAVVVVPKTGI
                     AAGKIFQTILHGAQTVQIPEGFDKALSTVISAALGSEAYLLNSVNPWRIEGQKTLAYE
                     LWSDLGDTPFHLSVPVGNCGNISAIWKGFRELQRLELVNTPPRLIAVQAEGASPFVDM
                     VRRGDNMLRPVEKPSTIASAIRIGRPVNWTKALKAMKESEGLAEKVSDQLILEAQRVL
                     ASAVGIGVEPASAASLAGVKKLVESGELDRSETVVCVATGHALKDPNPDIIAPYLSHE
                     NISLDTLLKSV"
     CDS             46405..49293
                     /codon_start=1
                     /locus_tag="CSUB_C0047"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49912.1"
                     /transl_table=11
                     /translation="MVPMAPPLEKIGNNTWRIPQTYRKDMRVPVIVYASEKLLEKMKT
                     DRTLEQAVNVSTLPGIVKQMTVLPDAHEGYGFPIGGVAAMDATEGVISPGGVGYDINC
                     LPAGTNVLTSLGYRLPIERFKANEEVVCVNQKRSVPAGIIFVIKKGRDRLLRIRTKSQ
                     FFLTATPDHPVLTPNGMKPMEQIRPGERVALFPFEGVEYEDPRDCLLLDEKDVPEHVK
                     SELKKRGLLPIKLDNPKLPYLARLLGYFTGDGAFNGKTTVFYGSVEGLEEIRRDIERL
                     GYKPSKIHTRRRQNIINGRKFIGAENSVRVNSRSFTELLRRLGAPDGKKTDAEFFVPR
                     WILLAPRWIKRLYLAGLFGAELNKPQTVNGYNFQVPQLTLNKRPDLEDNGRMFLEQIA
                     ELLRELGVETTKIVSAPEGRCIRLRLLISERPQNLIRLWGRIGYEYNPQRRRLALAAV
                     VWLRLKQSVIDLRIRAQEAAIAMAADGTTISEISEVLANEFVNTRYLERSVYEGREDT
                     PRVPKNFPRFEDWVELHLDGDIVWDEVESVEEAGEVNDVYDLTVANPGHSFIAEGVVV
                     SNCGVRLMVTNLTVNDVRPRIVELVNTVFRNVPAGLGSRRKDFVVTHSDLDRVALEGA
                     RYVIEKYGLGWSEDFKKMEEEGRYPSYKAGNIPDPDPSIVSREAKARGESQIGTLGSG
                     NHFLEIQRVDKIYDPRAAKAMGITQEGQITVLIHCGSRGYGHQICSDFLRIMERAVAK
                     YNLRLPDRELACTPANSPEATQYLKAFGCAVNFAFANRQAISHWVRQSFEQVFKRSAD
                     DMGMQIVYDVCHNVLKFEKHKVDGSDVDVFVHRKGATRSFPAGHPLIPQVYREIGQPV
                     LIPGSMGTASWVLLGNEKAMTLSFGSTAHGAGREMSRSGAKRRYRGDQVLRELESRGI
                     YVKGDSMETVVEEVDAAYKSVDEVVEVSHQVGIGTKVARLVPIGVVKG"
     CDS             49395..50858
                     /codon_start=1
                     /EC_number="1.2.1.9"
                     /locus_tag="CSUB_C0048"
                     /product="glyceraldehyde-3-phosphate dehydrogenase (NADP)"
                     /protein_id="BAJ49913.1"
                     /transl_table=11
                     /translation="MIGTFIGGTWQVSKEKPVFNVVSPIDGTIIARVQRCGPVETAEA
                     VKAAKENQHKIRSLAAIDRIEIMEETAQILKNHAEEIASVITYEMGRPLADAPGEVNA
                     VVERLKLSMEDARKISGEYIPGDWSPDTVGKIAVVLREPVGVVGAIGPFNYPLFIPAA
                     KIIPAILGANSVVAKPASATPISLLLFARALQLAGLPDGVLNVVTDPGEVGAMLASHP
                     DVGMINFTDSTEVGKEIARNAVNKRLHLELGGKGYAIVLDDADVELAARKCVEGALRN
                     AGQRCDAVSMVLVQEQVADEFVERVLQIVETWKTGDPRDMSTRLGPLVSASAAKRVNT
                     LVKQSIEKGASLAYGGEVDNAYHQPTVLTNVPDQAPIVWEETFGPVIPIMTVKSEADA
                     LSVASRSRYGLDAAVFTNNFYRMWKVAKALTVGEVTINDFPRHGVGFFPFGGVKDSGI
                     GREGIGYSIEEMMVIKTIVFNLEPAGLGKLRRPRQTT"
     tRNA            50901..50975
                     /locus_tag="CSUB_T03"
                     /product="tRNA-Met"
     CDS             complement(51356..51865)
                     /locus_tag="CSUB_C0049"
                     /note="Probable gene remnant of transposase"
                     /pseudo
     CDS             52341..53393
                     /codon_start=1
                     /locus_tag="CSUB_C0050"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49914.1"
                     /transl_table=11
                     /translation="MMRYSDMVIVVRNGRRMHTRFKTFRNEEELRDILVSNIDAIPVS
                     EINEEDESIVAWCKEFPVEGVGSIDIVAVGDGGGIYLIETKLSRNFNRREVIGQVLDY
                     AAGMWKSFARNGKVFLEMLKDRNGADIPQEDGEFLRKVDENLTEANFNILIAMDGVDE
                     QTKTLINFLNQFTDLKFIALELERYATEGEEQEIIVPRLHGEEVTKIPRAQYRPNWPL
                     EKVENEIQKISDEKLKNRLSRILEFAKRRNIFYQLKNRHSPAFGIAYRGKLILSIGTD
                     GGLFAYIGQNEIKKYPSVDAWKGFVQSLKDFGFYPPDFNSETQRDGRGSQRKLNDLSD
                     DEFERFLKFLDEFFKN"
     CDS             complement(54161..54553)
                     /codon_start=1
                     /locus_tag="CSUB_C0051"
                     /product="hypothetical protein"
                     /protein_id="BAJ49915.1"
                     /transl_table=11
                     /translation="MDAKRYNHILLPYLRLLISKTGSKWHMMPPHGKSEKRWQDFFEL
                     SYLLLALVGISSNTLAFLYSLHLTSSGILREGSPHMGELMAFPPVAWLTGFLIYMSLY
                     AVLYFVNRPSSYVRLILCYRPVFGQLSS"
     CDS             complement(55191..55547)
                     /codon_start=1
                     /locus_tag="CSUB_C0052"
                     /note="PIN domain"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49916.1"
                     /transl_table=11
                     /translation="MMQLIDTSVLIKKLKEKKPVDGKISIITLIEMLRGIPEAKRGKL
                     KKTIEEGFTVVEITNDIILEYCKLYDRLKEKGQLMNDADLLLAASAKASGIPLLTLDK
                     GFKRLENLGVKVIIEE"
     CDS             complement(55544..55771)
                     /codon_start=1
                     /locus_tag="CSUB_C0053"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49917.1"
                     /transl_table=11
                     /translation="MRNYSTISVPNDVKKTLEKDKGSREWGEYLLELYKEATETRKKR
                     ALENLAKLLSEKELNNILEESRRFRREFKLR"
     CDS             complement(55855..56457)
                     /codon_start=1
                     /locus_tag="CSUB_C0054"
                     /note="Lrp/AsnC family"
                     /product="transcriptional regulator"
                     /protein_id="BAJ49918.1"
                     /transl_table=11
                     /translation="MELDQIDYRILSILQEDGRIPLSKLARKARVSVPTARQRVNRLV
                     KEGVIQRFTILLNPKRVTGYDIFIGISAKPADIGNVVEQLKNIEEVVGLYRTVGEHDL
                     IVRLSVQSYAELDDFIANKLSTLNGIQGIRTNIVTNTIKDEPGPRLKPGAGIRVFCTI
                     CGKEIEGRPIKRTIEGREYYLCCNSCAEIFDQKAPLGHVP"
     CDS             complement(56497..56706)
                     /codon_start=1
                     /locus_tag="CSUB_C0055"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49919.1"
                     /transl_table=11
                     /translation="MGKPYRSLLTLSICLSFATAITALFIAAATLIGRYTSLDITIGS
                     VWFFTISFIVSLPLLLPRLRPRLGG"
     CDS             complement(56715..59252)
                     /codon_start=1
                     /EC_number="3.6.3.4"
                     /locus_tag="CSUB_C0056"
                     /product="Cu2+-exporting ATPase"
                     /protein_id="BAJ49920.1"
                     /transl_table=11
                     /translation="MAQRRRVVLQIGGMHCASCAQSVESMLKSLDGVYNASVNFASSR
                     ALVEYDPTRVSLAEMERAIKEIGYRVLKDQITLGVRGMHCASCVQSVENALKEVEGVV
                     DVSVNLMTGRAVVNVLPETSKQSLIKAVRGVGYDAGEEVSAETAMEREKQERRREIRS
                     QMINLGIAAPIAALVVLGEFRKHLIQYVSLPEFLGSPLFLFILTSIAVFGPARQFFIR
                     SARSLMHGAADMNLLYAVGIGSAYIFSSVHAFYPLAPGFPTWFKAAALLVAFIVLGRL
                     METITRGRTSEAVRRLMELKPLTARVIRDGEEMEIPADDVQIGDVVLVRPGEKIPVDG
                     VVVEGYSSVDQSMITGESIPVDKKVGDEVIGATVNKTGFLKVRATRVGKDTALAQIVK
                     LVEQAQQTKLPIQRLADWVAGHFVTASLIISMLAFAFWFFAGYQLYFVPRGGEMWAGF
                     WRIVAPDTTAGIFALIIAISILVIACPCAVGIATPAAVMVGTGKAAENGILIRDGAAL
                     EICHKLDVIVFDKTGTLTRGKPSVTDLVLLKPAVKMLANPRPIEDERDLLLIAAIAEK
                     RSEHPLAQAIVEQAKELGLEIPEPEDFEAIPGHGVRATYGGKTILLGNRKLMESYGVD
                     VAELEERIRMLEDEGKTVMIMAFDGAPLGLVAVADTLKEHSAEAVKALQDMGVEVAML
                     TGDNTRTAQAIARQLGITRVLAEVLPGEKAEEVKKLQQEGKRVGFVGDGINDAPALTQ
                     ADVGIALGSGTDIAMEAGKIVLVKDDLRDVVNAIHLSKKTMQKIKQNLLWAFGYNAAA
                     IPIAAGALYPATGFIMSPELAALLMALSSVSVTLNSLTLARVKPKMR"
     CDS             complement(59297..59464)
                     /codon_start=1
                     /EC_number="3.6.3.4"
                     /locus_tag="CSUB_C0057"
                     /product="Cu2+-exporting ATPase"
                     /protein_id="BAJ49921.1"
                     /transl_table=11
                     /translation="MAGKVVDPVCGMEVDPATARYKSEHGGKVFYFCAEGCKKAFEKN
                     PHKYIKEPHSH"
     CDS             59866..60096
                     /codon_start=1
                     /locus_tag="CSUB_C0058"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49922.1"
                     /transl_table=11
                     /translation="MAEYVTVSTKVRRKLKEEAERLGVKVSEVLRRALEEEVRRRRLE
                     ELEKRLENLGTALDKLDTDRITLMIREDRKSQ"
     CDS             complement(60423..61010)
                     /codon_start=1
                     /locus_tag="CSUB_C0059"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49923.1"
                     /transl_table=11
                     /translation="MDIQTIEIRQTFYETLYSLFKLLENGDPSASQILEGLRELGCVL
                     NTSKIIEEASSEIPQLLGRSIRVELDPATRRLYPTMVNEFYKNAGYDCESDNPDHLTT
                     MLAFINILLREEKKAALAGDLDTLKNIRRIQHRFLNVHLIPILKSYRDRESLKKLLGC
                     IAEYLEKDMLVLRDFLIAEAAHPLEASDLVNETRG"
     CDS             complement(61018..64479)
                     /codon_start=1
                     /locus_tag="CSUB_C0060"
                     /product="molybdopterin oxidoreductase, molybdopterin
                     binding subunit"
                     /protein_id="BAJ49924.1"
                     /transl_table=11
                     /translation="MSSRRDAIRGIVAVASLGAFLAGYSPTIEQIFRPKREIYPSDPQ
                     RGSNVRYVNSVCLGCNVRCGIRVRIVNRDGVDVIERIEGNPYHPYNRAVSYDRQVKRY
                     TQLDYQTPVEEAMAMWHGTLCARGQDGIHYVYDPYRVLKPLKRAGPRGSGKWKTISWE
                     QLVKEVVEGGVIDETGERLPGLKNFFVYGRLKETGVENPNTLLAEIKKDVDSLVAKAK
                     DKNVGIEELTAAIEGFKEKWTTKLGEYGLRLEDVLIDPDRPDLGFLANKIVFVRGRGQ
                     GHADYFYQRWVYALGSVNWLRHTSACQLGYYAGNRLWSGYTDVNADVMGAKVVIMAGA
                     TMGRQHPGATGQGLLIERAVEGEVKVYYVNPTAPRTLGTRGSVKWVPVKPGEDAALAM
                     AMIRWMIENNRFDKEFLSITNSEAAKTLRGYPVNTNATWLVIFENGHPRFGEHLKASD
                     IGLEGSQPVVSVNGVLMPNDAVEKADIEFSGRVQLSSGEEVLVKTPFTILKEEAFSKT
                     LEEWSEICGVPVETIVEMAHDFTEAAPRASTYLHRGVCMHPNGEYAVWAFRVLDIIVG
                     NLNRKGGLMARAAHTNYNGYLYNTGTSGFGEPPRLGPPVDRHGYAYENTLEYLLKLKR
                     GENPYPAKRPWYPLTPEESYTELFAAIAEGYPYGIGALIMYYANPVLSANYGIKFIEV
                     LKNTQKIPLFIAITTTINETFMYADYIVPDTTYLETGTLGIQYLYATSGGGLLNEGWR
                     SPIILPMTEYIGKCPNGHDRWASMWEFLIDVAKALKAPGYGEKGIPGVAKKKYDGQWF
                     PLNCLWEYIMRVYSNGALDAKDRGLIPAEIPSSEVGFVEQNYPIAKFKDILPADEWRY
                     VTYALARGGVFTKYDDAFNEKGFTKRSPFGDGVARLWNETLAKTRNSVTGERFYGGPK
                     YIPAATYAPIEGKGRLSPLGTPLSELWPATEYPLHLVFLTGPLMTKHRSQFYYWIRQI
                     LPENFVIINPRDAEKFRVKNSEFVEVETPYGVLEAAAVVEPTVMEGVIAVPYGLGRWS
                     DTVIKKTNYLKGLKDPTLKKILDEIPDEVSIPEEAVNPVKQLPPLVKQLLFTKSPDDY
                     YMTGLKPDEWRFNGVTPNPILLGDPSLGDWPLLSWIGAAQAYYDTKARLKPTGKKMKI
                     EVPQIIW"
     CDS             complement(64472..65647)
                     /codon_start=1
                     /locus_tag="CSUB_C0061"
                     /product="molybdopterin oxidoreductase, membrane subunit"
                     /protein_id="BAJ49925.1"
                     /transl_table=11
                     /translation="MVMEQFIYPNELAQPAIWGVLITIYPYITGLVAGSFIISSLAYA
                     FGNTRYKKAGGIAVLLAFTFLLIAPLPLIADLKQPDRAYEIFTRPHLVATPSTPNISP
                     MAVFGYLLVGYIILMVVEIIFLWRADLVEKANRGGKLKTLWRILALGAREVSDTMLKR
                     DKKVVTVLAFVGIPLAALFHAYVGFLFGSMKSRVLWATPFMAVDFLVSAIVSGIALLI
                     IVYYAFASHAGRLDKGVVYGLAGLLAWTLLVDLALKGADELYRAYHRTASWPYLEALK
                     FDLMVSTGVIEFVIGAGIPLVLLLIPSLRRRMSVVLFSSLLALIGVLAYRWNMVIGGQ
                     IISRTEEGLLWYEMPLLGKEGLIASLSIFAMAIFVFTVLSWIFPWDSKYATGVEVHE"
     CDS             complement(65656..66327)
                     /codon_start=1
                     /locus_tag="CSUB_C0062"
                     /product="molybdopterin oxidoreductase, iron-sulfur
                     binding subunit"
                     /protein_id="BAJ49926.1"
                     /transl_table=11
                     /translation="MSNGDQLKRRDVLVSVCAAGASLVLTGLATGVAEVGQESSGKRW
                     AMVIDVSKCYGCYACLAACAAENNVPIGVFRTWIERYVTPGGGVVFVPKMCNHCEEPS
                     CVEVCPVNATFKAPNGEVLVDDNVCIGCGACIQNCPYGARFFNPVKGVADKCTLCRHR
                     IYEGKLPACVEACPTGARIFGDSNDPDSEVSKIVRESSFSRWKPWTGNKPMTFYIGLP
                     EEANR"
     CDS             complement(66504..66932)
                     /codon_start=1
                     /locus_tag="CSUB_C0063"
                     /product="small subunit ribosomal protein S12"
                     /protein_id="BAJ49927.1"
                     /transl_table=11
                     /translation="MGNGEFAARHLKQVRNRFRWAKRDYRIRMLNLKEKTDPLEGAPM
                     ARGIVIQKVGIESRQPNSAVRKCVRVQLIKNSKVITAFLPGDGALNVVDEHDEVIVEG
                     IGGSMGKSMGDLPGVRYKVTMVNGAPLDLLVTGEVKKPKR"
     CDS             complement(66980..68023)
                     /codon_start=1
                     /locus_tag="CSUB_C0064"
                     /product="molybdenum cofactor biosynthesis protein A"
                     /protein_id="BAJ49928.1"
                     /transl_table=11
                     /translation="MYQKSLYSVAYLIFASLQPLVDGFGRVARKLRLSVTDRCNFRCD
                     FCMPLHPVWIPHKEILTYEEMARVIRILVGMNVTKVRLSGGEPLMRRDLEKGVKLISS
                     IPGVETISMTTNGYFLEEKAAQLKEAGLQSVTVSLHSLKPERFEKIVGRKDVFSKVLD
                     GLREAKKVGLQPIKINCVVTRGCNDDEILDFVELGRQSGFSIRFIEYMPFDGRHLWDV
                     SRLVPGMEIIEKIREKYGLVELPREPGSTAVVYEFADGADGNVAVITSMTKPFCGDCD
                     RIRLTADGKIVPCLFSRDEYDVKGLLRGGASDEEIAAFIRESFRKKFAGVETLIKAKG
                     FVPHVRPMHTIGG"
     CDS             complement(68033..69382)
                     /codon_start=1
                     /locus_tag="CSUB_C0065"
                     /product="cytochrome b/b6 domain-containing protein"
                     /protein_id="BAJ49929.1"
                     /transl_table=11
                     /translation="MSQQKTEAGPLGRVFDEFVKWLVERLERTPIVTFRFQIPRVAVS
                     PFGYLGTLTAIVFLLLGVTGALLMLYYRPDVTQAYNSVKQIQDGIAFGFFIRNIHYHA
                     SNAMVFLAIAHLFYQYFSGRFKVKNEVIWVTGIILGTVTVIEAFTGYDLILNQRAMLA
                     VNIAVGLTNSAPFLGAQLAPLLLGGGLYDLIIRFYALHVFILPMVMLLLVLVHFPRNL
                     VFDPPVVAGVIGAILIAGGLYPVDLGIKYDPTRGIVEVPEWYLTGIYAFLRTGLERFT
                     AGAFLPLLFILFFLLIPFVDRSKKLSWKERPFFTAAGISSLVLIAVTTVWGFYTTPRV
                     DAFTAVYIEPLIFYPLLAFLVAASFIISYKFIAPPPSAHPQKPPVRTRPITFQLPYPW
                     AVRIIMGLLAVIGILSLVAFQNYLEGLKNLSLFNLGVVVMLFGAIAHVYRHAMQAVK"
     CDS             69462..70409
                     /codon_start=1
                     /EC_number="2.1.3.2"
                     /locus_tag="CSUB_C0066"
                     /product="aspartate carbamoyltransferase catalytic
                     subunit"
                     /protein_id="BAJ49930.1"
                     /transl_table=11
                     /translation="MLRVLKHVISAKQFDRDTLADLFSTAKALKNRLSEKRGLKLAVD
                     RILMTVFLEPSTRTRLSFVYAMKRLGGEVVDFGPEEVTSRAKGETFEDTMRMLDGYAP
                     DVIVLRSREVGAAEKASKIVRCSVINAGDGWNEHPTQALLDVYTIWEELGKVDGLRIA
                     IMGDLRYGRTPSSLSYLLAKYRDITFHYVAPPQLQIREEVLKEVSHHDVHQHSRLEEI
                     RDEVDVLYVTRLQKERLGDENLYQQLRGSYVVTVDLLKKLKKIPLIMHPLPRVDELST
                     EVDALPQAKYFQQAENGVYVRAALLTKLLNLDTSSLQRS"
     CDS             complement(70389..71684)
                     /codon_start=1
                     /locus_tag="CSUB_C0067"
                     /product="hypothetical protein"
                     /protein_id="BAJ49931.1"
                     /transl_table=11
                     /translation="MLYGLLPLIIFILLVAAAALGLLLIGRRRPGLGGSYSMLYLYLV
                     FASYFFSSFSTLGAVAGLFLATALLTPWLTRLGLRFQKPLIPQLASTTLLLTLIIRPL
                     NGEGLEFPILVVFAVALVSHTLLYERMGPVIAQAVSASAVLGLLAALTTISFPAESTS
                     LTLAILLLATASAGVKTVSTFPQAFTAVAAAVLLFIVLGIFLSPLSETQPSISTELGP
                     EALLIIPAAFAALSPTLSGNGGRFGDAVMVSAAAGLAMYSAVFHTGLANLLTPLTGLP
                     TVDASAALIRRVLQVIALAAAVGVVGEAVKTTYGVKLLRGKAPYQLLPMSSIVLALAA
                     ATSNAPLTSLVTGLGAVNIIAISTLFTDGGWRRKLYSGLLLVLGLNFAAAAVLQMVRI
                     STDLFALLALLPAALVAASAVHGLWMFAKKSEGLASLKA"
     CDS             complement(71718..72692)
                     /codon_start=1
                     /locus_tag="CSUB_C0068"
                     /product="pyruvate ferredoxin oxidoreductase, beta
                     subunit"
                     /protein_id="BAJ49932.1"
                     /transl_table=11
                     /translation="MTRYRTLRDFPVEEYLSPGATMCAGCGAMLVLRAFHKVLGPDVV
                     FVNAAGCLTLLQVYPYTPNKSSWMYTAFASAPAGAQGIRDALDILIEKGRVNSIEDLK
                     VVVVTGDGAAYDIGLQSTSGAIERGLDFYYLVYDNEAYGNTGFQKSGATPYGSATATT
                     PPTERNPTGYTGAKKDLFEIWRSHKPPYIATVAPSHMVDMLRKIETASQFKGPKLFIA
                     FSSCPTGWGFDPSLSVRISRLAVECGVWPLKESVYGKVRHTYIPTVLKPVEEYLRHQN
                     RFRHLFTPRKQEQAIASIQEQVNNYWLEAAQNEGFRITVAKPVTITPP"
     CDS             complement(72689..73921)
                     /codon_start=1
                     /locus_tag="CSUB_C0069"
                     /product="pyruvate ferredoxin oxidoreductase, alpha
                     subunit"
                     /protein_id="BAJ49933.1"
                     /transl_table=11
                     /translation="MREVDMLTGNAAAAWAARIADVDYIPAYPITPQTEIIETLASWI
                     SQGLMKAKLVQLESEHSMLTAAGTASLSGARVFTATSSQGLLYGFEMLYNIAGWRAPL
                     VLVNVSRAVAAPITLEPDHNDVLAARDSGFIQLHAEKCQEVLDLILIAYRVAEDHRVM
                     LPVIVNMDGFYLSFTREPVYIPSKTDVEEFLPPYNPPHPFRAGRPVVKGPAVLGGHIY
                     AYFKHNIHESLLRASDVFKEAAAKFREMWGRAHSPVEGFLLDDAEYVLVVTNSFTSIA
                     RKAVVRLREKGIPAGLVKLVMLRPFPSPDIVEKLRGRKAVAVFDQNISPGLGGIIYNE
                     VAAALYHVKNRPETLLSAIGGVGGKYTTVEEFEHVFHMLMHPEKTQPGKPVFLFRADE
                     LAHVQTALRLAGHIGDEA"
     CDS             complement(73914..74798)
                     /codon_start=1
                     /EC_number="1.2.7.1"
                     /locus_tag="CSUB_C0070"
                     /product="pyruvate ferredoxin oxidoreductase, gamma
                     subunit"
                     /protein_id="BAJ49934.1"
                     /transl_table=11
                     /translation="MLRIRFHGRGGQGVKTSSRILGRAAFSAGLFAQDFPIYGAERRG
                     APVTAFTRISHSPIMERGYIFNPHIVVVMDETLLADAQARPLEGLPRGGVALINSARG
                     PMVSEDQAGHVFMRINFTDPALRIIGKPIVSVSAAAAAAKLCGLRKQHVEEAVREELA
                     ELGVRDELLQKNLTLMSETYDNTPRYSIKVDEESERVVELVDPVSGRVVFSDVFAAGN
                     AVRRSTGNWRVFRPVVDYGKCTGCKVCFVYCPDSAISLDAENKPVIDYEHCKGCLICV
                     VECPIRAISSVREVEIFA"
     CDS             74892..77003
                     /codon_start=1
                     /locus_tag="CSUB_C0071"
                     /product="acetyl-CoA synthetase (ADP-forming), alpha and
                     beta subunit"
                     /protein_id="BAJ49935.1"
                     /transl_table=11
                     /translation="MLEAFFNPCSIAVVGVSGDPHKLGRAIYDRLRQNKLAGVLKSRL
                     YAVSSSITEIYGERVYRRVSEINDEVELVVVAVPATAVPDVVADAAGHGARAVVVISG
                     GFSEAGNRELENRLRQVVVETGIRLLGPNTIGIIDPYTGVDTSFTRETKPFADGTWGR
                     AIIYPRKGNVAIISQSGALAYHSIDLFGDRGVGLRAAACVGNQVDVNITMLADYFSDD
                     PLTRVIVLYVEGVADGRGLLNAVLKARHRGKQVVVLKAGRTAVGGRAAYTHTASMVGE
                     WDVFTGCLRQAGAMVVTGVEQMVDVAHLASLQKPPRNRKTLILTNAGGFSVLAAEHIN
                     INGLETPQLSQQTVEKLLQLRESGAIPAVAVPANPLDLSGSATPEAFEKAYNTVAAED
                     FGIHLLMPFHIPPPMDESVVEKLVRIANGCGATVAAVDTGYSDWGQRIRKLLTENGVP
                     AFESVEAAAQALSIYASASTPKRDSFPIFQQVHGEPQPMERKRLLSLLRVYGVEPAEE
                     RLVYNVDDALAAAEELGYPLVMKIASEKISHKSDLGGVVLGINTSEAAAEAFNKLMNL
                     AKRLGVADDGVVLQETWTGLELLLSTKTDPSMGPVVTVGLGGVYTELWRDIITYAAPV
                     TEEEALNMLDSLQHVRILNGYRNIPPINRRMIAKLIVRFSSIIPENPSINQLEINPLT
                     IRGENVKAVDIRGLETKPTNL"
     tRNA            77030..77105
                     /locus_tag="CSUB_T04"
                     /product="tRNA-Pro"
     CDS             77152..77742
                     /codon_start=1
                     /locus_tag="CSUB_C0072"
                     /product="hypothetical protein"
                     /protein_id="BAJ49936.1"
                     /transl_table=11
                     /translation="MYESSFAEVRFMDVVGFLGQIEPPLPPPWLDPAVFLSNLFWVFL
                     RTFTTFVVVFILGLVSLRVVDWITPGVRELERIRGHPLATALFAAGFFVYLSFGYIAS
                     MASPIPVGLETGIRSGPNFSPLVLIGYKLVTLLIGVLLSYVFAIVYYRILAKVEPFGL
                     DLDDVDKEPLAVGVYLFGYLVFLGAVVYVALMLPAA"
     CDS             77747..78619
                     /codon_start=1
                     /locus_tag="CSUB_C0073"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49937.1"
                     /transl_table=11
                     /translation="MSLREGFSTLFKKPQPIVKPTEEVYAAGVISPRMSRLVLLAIGV
                     MLVLGVAALLAQGLFPILATLTYSLIPVVLLLGWAMKTDRYEPEPKSLVIMVAGIGGF
                     LAAVFTYLPFPTGLAAYLVKIGLLEVVFFLVLYGLDANRVTGREFNDHLDGAVYGLAL
                     GAGYIAFSNFLIAQSGAYVTPLAATLFTLENFFTMVFPGLTGWWIGYVKAKYVSISFA
                     SLFTGFVPVLLLRLVYEGLLIGFAGLSIPVRVAAVTLAGLFFLALLVRRIFWALEDEK
                     IWGYASGLAPVEKR"
     CDS             78577..79638
                     /codon_start=1
                     /locus_tag="CSUB_C0074"
                     /product="hypothetical protein"
                     /protein_id="BAJ49938.1"
                     /transl_table=11
                     /translation="MGLRFWAGAGGEEMKLPKIAAVIALLLTVLMFFNSSWAQGSPPP
                     YIQPGLAFVYQLFDQKTQQAENAFQRYIIESVTSQGITISIVSDITQSGRVTVNPNGE
                     FKPGERIDLWIPPGVSAGARFKMMGVDAAVIQTGYDIGQGLKVTVAASTDQSIFWLFI
                     EDGPQPYNQLKGLLLGILFTQKGKGLALVNIEQAGAVTTTSTYSTTTRATTARPVTTT
                     RTAVTGDRTETVVETETVTETVVVTRTVQTVSTYTTTSTSSVSVQAEGPAAGIPLTVA
                     IPVAAVIIGGGIFFVRSRRRPLPPTYPYPAYPPPPPYPSPSPQPPQQFIQPVGACPAC
                     RFPLYPGEYMCRRCGYRVA"
     CDS             79628..81259
                     /codon_start=1
                     /locus_tag="CSUB_C0075"
                     /product="hypothetical protein"
                     /protein_id="BAJ49939.1"
                     /transl_table=11
                     /translation="MSHKTYAALLAFLMIAVMIYPVTGQEEFEWNRQIPFLGAQPTLV
                     LLVQFSDVKLSISRTQAEQIVKIVDSFVRDASYGKTWLEYTIHPKVITLPKPMSYYGG
                     PSAGAQRGDDNQRILEFHLTTIQLAKKDGVDLSQYKHVITIHAGKDEATGGSANDIWS
                     HCNCVAPKILYFLIEQYGFDTVESELKRQGYDWLVELFMHRTRNGEGRLLSGIETVAE
                     YDFPSVMAHEFTHSMWISDLYVYAKDGYSTGSEVGIWTNMDAGSFFDPPVDIDGWSKY
                     LLGWVEAITVEKDGEYTIHTLDKPDEPHALIMPINDKEYYFIHARRPVKNDAALPGPG
                     ILVMKVNKFKNRNVEGEPFMAQLFDANPDTPRECEQYATGFRDPRSFMTLCVKFDAPF
                     YGPDGYSATWVSKVAGGRTYGTYQLNLANSEYVTEEGFRISVLSFDESAGVARIRVSL
                     GGQPQEEGGETTVVTLTRTVTGTATETLYTTTTIVGTETRTVVVTVTTTQLPVSTGEE
                     YISIAIILAALLFTVAIIALGRRRPRMPPPPPPAW"
     CDS             81309..82163
                     /codon_start=1
                     /locus_tag="CSUB_C0076"
                     /note="RimK-like ATP-grasp domain"
                     /product="lysine biosynthesis enzyme LysX"
                     /protein_id="BAJ49940.1"
                     /transl_table=11
                     /translation="MAGKPVIEIAFDTPRMEEKLLAKAVTAKGAELRLTNVKQNVFTL
                     QKTSLDVCLVRCVSLYSAIHTAALREGSGVRSINSSEAIYLAGDKVLTVSRLKSANLP
                     IPRTAVGLNTRAAEKALEKVGFPAVDKPPIGSWGRLIALVRDIDDFKLVAEHREMLPS
                     GYMKTHIIQEYIDLPNRDIRTLVVGDEVVGAIYRYRASNDWRTNVALGGEPVQAFLND
                     ELVEISLRAAKAVKGDVVSIDVFETTDGSYLVNEVNGVPEFKGLMKATGVNVPEKIID
                     YVIASTRR"
     CDS             complement(82129..82659)
                     /codon_start=1
                     /locus_tag="CSUB_C0077"
                     /product="peptidase, zinc-dependent"
                     /protein_id="BAJ49941.1"
                     /transl_table=11
                     /translation="MLRLKVLNETGDEGLGSAAAARIAEVYGFDVFVENGFVSFAEKA
                     WNPQRRQYNAEKLVKHMHAEGSLVLILTDRDLYVEGLNFVFGYAPPPVGVLSIHRLKP
                     AVEVGGSGRSLLLERVLKEAVHEVGHLIGLGHCSARYCVMSFSNSVAEVDSKSGELCD
                     GCRTRAIFLLRQSRSR"
     CDS             82682..83257
                     /codon_start=1
                     /locus_tag="CSUB_C0078"
                     /note="shikimate kinase domain"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49942.1"
                     /transl_table=11
                     /translation="MIIWVTGTPGVGKTTTGRMLAKRLGIGFIDLPEFVSANNLYTER
                     LGDGTMVVDPRRLERHLSRNVKEDTVIAGHITVRVRGHETRCIVLRLNPLQLRKRLEE
                     RGYSVEKVAENVEAEFLGVVYLDAIRVFGKNRVSQIDVTGKEASDVVNRCVDVLEGRD
                     AGDDVEWMSRLDEDILSQLLRYLSTAKTRGL"
     CDS             83326..85113
                     /codon_start=1
                     /locus_tag="CSUB_C0079"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BAJ49943.1"
                     /transl_table=11
                     /translation="MVSDHRVAVLDRDRCDSKKCGNWPCITYCPPVRNNIEAIKMGED
                     GFPIISETLCISCGICVKKCPFEAITIINLPTELREDVAHHYGVNKFKLFRLPYPEAG
                     KVVGLLGKNGIGKSTALKILAGQLVPNFGILDRPVTWEEASRFFRGSLIQEHLSSISK
                     GKSKVSYKPQNIAEIPKVVTGTVKQVLSRLGDAAAVEEVMEKLELTKLSDRDIRFLSG
                     GELQRLAIAACLLRKADVYILDEPSSFLDIRQRLRMVEAVRNALRDNVKIVVADHDLA
                     VLDYFSDTIFLFYGEPSVYGVVAGPYGVREGINIFIEGYIPDENMRFRSERIDFQVKP
                     PTREQTSSEKLVWPSFTKTFEGFRLEVEEGWVYRGEVLGIVGPNGIGKTTFASIIAGV
                     QETDQGFTFDPKAVSYKPQYPQADDRTVEEHLREAAGQEYDTSLYQSLILRPFGLEKL
                     LEKNMKELSGGELQKVVVAECLSRKADIYVLDEPSAFLDVEERYHMAKILKRLALEKK
                     VYVLLVEHDFTVLDFASSALMVFSGEPGVAGHGLSPTDLRTGFNMFLEQMDVSFRRDQ
                     TTKRPRINKRDSQLHRLQKKMGEYYYLST"
     CDS             85163..87343
                     /codon_start=1
                     /locus_tag="CSUB_C0080"
                     /product="AAA family ATPase"
                     /protein_id="BAJ49944.1"
                     /transl_table=11
                     /translation="MSSPSPTRKKELSLRVAEARQRDIGRKIARVDSQGMKELELSPG
                     DLIEITGRRSTVAIVWPPYKEDDGQGIIRIDGEIRRNSGVSVGEFVRVSKTTAKPATK
                     IVLAPFEPLPFVGDFGRIVRSQLLNMPVAKGDIIVVPVLGMGVELKVSSTSPSPIVMV
                     TESTVVEISSTTAKRIEEVSGVTYEDIGGLHDELQRIREMIELPLKHPELFRHLGIEP
                     PKGVILYGPPGTGKTLIAKAIANETGAHFVSINGPEIMSKFYGESEARLREVFQEAEQ
                     NAPSIIFIDELDAIAPKRGEVTGEVERRVVSQLLTLMDGLKSRGQVVVIGATNRIEAI
                     DPALRRPGRFDREIRIGVPDRNGRKEILLIHTRRMPLAEDVNIDELAEITHGFVGADI
                     AALTREAAMNALRRFLPQIDLEKEVIPAEVLEKIKVTREDFANALRTIQPSALREVVL
                     EIPNVKWDDIGGLENLKQELREAVEWPLKYPDVFKRLGIRPPRGILLYGPPGTGKTLL
                     AKAVATESQANFISVKGPEVLSKWVGESEKAVREIFRKARETAPCIIFFDELDSIAPR
                     RGIHTDAGVTDRIVNQLLTEMDGMQSLKGVVVLGATNRPDILDPALLRPGRFDRVLYV
                     PPPDKNARLAIFKIHTREMPLDQDVDLEQLAALTEGYTGADIEAVVREAALIAARENI
                     NAQVVSMRHFGLALQKIKPSVGAEEKAEYDRIVSNFKKSMAYIG"
     CDS             87453..88073
                     /codon_start=1
                     /locus_tag="CSUB_C0081"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49945.1"
                     /transl_table=11
                     /translation="MKMPWTREPAQQPAYVRPVNYQDRMLEILTQLKIQNEKLNRTIE
                     RLKHRGKELFEQCVRAEQEKDTARATIYANEIAQLRKMTRTLLASHMSLDKVVLRLET
                     VKEFGDVMHVLGPATQIIKQVQHEISGIVPEVAHSLRRVDEMLESIIIEAGNVTGGSV
                     YVSPSDPEAQKIIEEAAEVAAQRMKSSFPELPETYQHLESAANRAD"
     CDS             complement(88085..88972)
                     /codon_start=1
                     /locus_tag="CSUB_C0082"
                     /product="iron complex ABC transporter substrate-binding
                     protein"
                     /protein_id="BAJ49946.1"
                     /transl_table=11
                     /translation="MRIVSLVPSATDILVELGAVDELAAVTYACGVVSKPVVVKPQIT
                     TENLSPEEVDRKISSAHANGEQLYIVDYGLIASLKPDLILAQGLCEVCGVTGDVVTEK
                     LKSLAPTFTLNPHTVKEILDDILQVGRLVKREREAVELVAAISAKLEYVREYAAGLPR
                     VRTAVLEWLHPPFCSGHWVPELVEMAGGHDLGVAGKPSRRIRAEEILAHEPEKLVAAP
                     CGYSLEKAVSEVNRFSGQTWVQQLPAYRLGEVYAVEADRYFSRHGPQIGDAALILAEI
                     LHPEVFREKAPPKTFKKMM"
     CDS             89031..89798
                     /codon_start=1
                     /EC_number="3.6.1.27"
                     /locus_tag="CSUB_C0083"
                     /product="undecaprenyl-diphosphatase"
                     /protein_id="BAJ49947.1"
                     /transl_table=11
                     /translation="MDLGEALFLGVIQGFGEWLPVSSEGLVTLFSTLIFGSSFEYALA
                     VAIWLHLGTLFAALLYLRKDVRLVLQGFKGDNEGRRLLRFLIVATLSSAVTAAPLLLF
                     LRGLELSEKHFTITVGLLLIVTALVQRRAASGEQKIDTQTALVAGLLQGLSIMPGISR
                     SGITLVALVGLGFNVRDALRLSYLMSIPAIAAAQVLPPLLTRGFTASPEMFAGAFAAF
                     AVGLLTMRMLLSAAARLDRRLFMIPLGVAIVLLGLLL"
     CDS             complement(89795..90400)
                     /codon_start=1
                     /locus_tag="CSUB_C0084"
                     /note="KH domain, putative RNA-processing protein"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49948.1"
                     /transl_table=11
                     /translation="MVSGKNFPHITHSSFVVNIPRERVGVLIGEGGSVKAEIERLLGV
                     SLQVDSSEGTVVISLAKPVEEGGDPASLFKARDIVTAIGRGFSPEKALKLVEDGTVLT
                     VIDLTDYVGDSPNHLARVKARVIGTQGKTRRIIEETCQVDVSVYGDTVAIIGEYENAR
                     AAEEAVVTLVRGAPHGAVYRMLNEYARRRKTGGLYPPRPRF"
     CDS             complement(90406..91203)
                     /codon_start=1
                     /EC_number="2.7.11.1"
                     /locus_tag="CSUB_C0085"
                     /product="RIO kinase 1"
                     /protein_id="BAJ49949.1"
                     /transl_table=11
                     /translation="MGMGVDDVEDRLRLREFRKERAQRYLEKRSELDESLEEVFDQRT
                     LLALYELLNTGKLREVMGVISAGKESRVYHGVAGDGSETAVKIYLTSSAEFRRNRLQY
                     VVDDPRFKSIPRDFRKFVYLWAKREFANLVDAYNAGVSVPKPIVQRENILVMQFLGEN
                     GVRYPLLVEEKFESDELKMIWEQLLENAAKMYRKAALVHGDLSEYNVVVGRGPAVYII
                     DFAQAVKLGHPLAETLLLKGFETLAKFFNKRGFSVNIEEAVRMVKAG"
     CDS             complement(91418..92023)
                     /codon_start=1
                     /locus_tag="CSUB_C0086"
                     /product="acylphosphatase"
                     /protein_id="BAJ49950.1"
                     /transl_table=11
                     /translation="MRATVRVFGNVQAVGYRALVKFIARSLGVRGLVRNLDDGSVEVF
                     AEAPEDIMDRFVKMIDVKGRAEDVLSLHVERVEVSREGETGYSGPWRSYGAFEIDYGE
                     ERPRPIERDMAESLEWSGLYFTKLVTEFSDLRREFRDYRDEFRDYRNEFREFKNESIS
                     LANETLEEVKELRRDLKTILDERLARLERDISEIKAKLGLL"
     CDS             complement(92122..92388)
                     /locus_tag="CSUB_C0087"
                     /note="Probable gene remnant of transposase"
                     /pseudo
     tRNA            complement(join(92453..92491,92542..92579))
                     /locus_tag="CSUB_T05"
                     /product="tRNA-Tyr"
     CDS             complement(92557..93147)
                     /codon_start=1
                     /locus_tag="CSUB_C0088"
                     /product="hypothetical protein"
                     /protein_id="BAJ49951.1"
                     /transl_table=11
                     /translation="MAAYKTVKKQVATYSALPAVAYFLFYLFFTGAAQLIQTPRIGIA
                     STVFVYTFVETQLYTGPLLQVVGDGFVFNLRLYPMLLGVVVSALVGYNAGLLFTLYRR
                     GMLRTCLLGTAWSGVGGLLASIISFGYLCCGWPVSLIFFGVAAVTALSPILTAAAVTL
                     LAINAYILTKRLQALEKLKNTEKTKTMNTSRGSSAW"
     CDS             complement(93126..93740)
                     /codon_start=1
                     /locus_tag="CSUB_C0089"
                     /product="electron transport protein SCO1/SenC"
                     /protein_id="BAJ49952.1"
                     /transl_table=11
                     /translation="MNRSRLLLFMGVAALAVAAGAAAAVLSRQVLEPYKPAIEIPGER
                     VLPDFTLTDQNGNPFKLSSVKGKAVLIYFGYTHCPDVCPLVMTKYGQLVKALGNRAND
                     VALIFITVDPERDNVEAMKKYVAYYSDRIIALTGSPEEIDAVARLYNVYYKKYPPDEK
                     GNYLVDHYALVLGADRKHILRLAFTPDMPFEEYQKGVEWLLTKP"
     CDS             93869..96373
                     /codon_start=1
                     /EC_number="1.17.4.1"
                     /locus_tag="CSUB_C0090"
                     /product="ribonucleoside-diphosphate reductase alpha
                     chain"
                     /protein_id="BAJ49953.1"
                     /transl_table=11
                     /translation="MDFDAERIRGAIRKAMAAKQVMDEKVLEKVVASVLEQLSSRFGA
                     EKIPHVEEIQDIVESALMEHGLKEVAKAYILYRHERTRIREEKMRILETGYVDEVDKA
                     FSVNALRLMAARYLLRDRSGRLIERPKQMFQRTAALIVLADILYNPMFFDKSGQQKKW
                     EEDDVKLEEYADNIGVGPSDNMHETKWNIHHLERLATLYKRLNERGMMRKPLREVLEY
                     LKSNPSRFYENYRRYYDLMVGKRFLPNSPTLFNAGTVLGQLSACFVLDVEDDISSIMR
                     TAEEAAVIFKTGGGVGINYSKLRPEGDVVSSTGGVASGPVSFMRIVDTVTDVVKQGGR
                     RRGANIGILNINHPDIDKFISAKQRPGFLENFNISVMVTADFWKHYEEDRPYPLVNPR
                     DGSVWRLVDTRKLLRQIAENAWKTADPGLLYHDNINELNPLREAYGDIYCVNPCGEQP
                     LYPHESCNLGSINLHAFVKDGRLDWDALGKCVEDAVRFLDNVVDLTKHPTEAIEKMTL
                     RTRRIGLGIMGLADMLYALRIPYSSEEGFEMMRRVMEYIAYKAVETSVELAEERGPFP
                     DFPRSSWARGELPFRGLREGRELKMYWSRLVEHVKKGIRNSHLLTVAPTGSISMLADT
                     SSGLEPQFALVYRKQVTAGVFYYSDPVFEKALEEYGLPKQEIVRRVAENGGSVQGIQE
                     IPEDLRRVFVTALDIPWWDHLRAQHEIQKWVDASVSKTINMPSWVTVDDVLKAFIAAH
                     RLGLKGVTVYRDGSKSAQVLVTPTQRNRRYELSVINNTPELLRGLGIEVEEKIAETPP
                     PAIIHTTCPVCGSTSIVFQEGCEKCLECGWTSCVIA"
     CDS             96405..96842
                     /codon_start=1
                     /locus_tag="CSUB_C0091"
                     /product="osmotically inducible protein OsmC"
                     /protein_id="BAJ49954.1"
                     /transl_table=11
                     /translation="MPEVVNRAKAVWQGDLFHGQGTVSFDNGALPTVDVSWTARSSKV
                     SGKTNPEELIAAAHATCFAMALSNIIAKEGKRAEKLEVTAEVVFSIGDQVKISESRIT
                     VVGKVPGMDQASFEKAAQAAKDGCPVSKALKGNVAISLTAKLV"
     CDS             96835..97365
                     /codon_start=1
                     /locus_tag="CSUB_C0092"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49955.1"
                     /transl_table=11
                     /translation="MYKPLLVAAAFLTIFLGILSSLFFLSNQLTATTTTTSTKPSETI
                     TTSEKPREPYVKIRETIFYVEVADDDAERGRGLSGRESLPENRGMLFVFEKPGRYSFW
                     MYEMRFALDIIWIDADGRVVHIEENLQPCTPNQVCQSYTPSADAKYVLEINAGLVKKH
                     GVVVGDFVEFWLGSAD"
     CDS             complement(97354..98754)
                     /codon_start=1
                     /locus_tag="CSUB_C0093"
                     /product="Fe-S cluster assembly protein SufB"
                     /protein_id="BAJ49956.1"
                     /transl_table=11
                     /translation="MAGETKLEIDYSKYDFKDPELYVYKSKPGLSEKVVEEISQHKDE
                     PEWLRKFRLKSLEIFYRKPMPIWGADLSGVDFDRIHYYIKPSDRKARSWDEVPEYIKK
                     TFDRLGIPEAERKFLAGVGAQYESEVVYHSLQKELEKKGVIFVDPDTAFREYADIFKP
                     YFGKVVPPDDNKFAALNSAVFSGGSFIYVPEGVEIQYPLQAYFRINAANVGQFERTLI
                     IAEPYSRVHYIEGCTAPIYSTSSLHTAVVEIVAKKGAYVRYTTLQNWSSDVYNLVTKR
                     AHAYEEATVEWVDANIGSRVTMKYPSVYLLGRGAKADILSVAFAGRGQHQDTGAKAVH
                     LAPDTTSRITSKSVCKDGGRTSYRGLLHVAKGAKRVKSSVRCDALILDDISRTDTYPY
                     NEINEEDTTATHEATVGKIGEEQLFYLMSRGLSEQEALNMIVLGFLEPFTKTLPMEYA
                     VEFNRLIELEMSGSVG"
     CDS             complement(98833..101112)
                     /codon_start=1
                     /EC_number="1.17.1.4"
                     /locus_tag="CSUB_C0094"
                     /note="molybdenum hydroxylase family, large subunit"
                     /product="xanthine dehydrogenase"
                     /protein_id="BAJ49957.1"
                     /transl_table=11
                     /translation="MHQRFIFVLVTAERYRVVGKSVPKIDGGLKVVGAARYVDDVELP
                     NMLYAKILRSRYPHARILRINTEKAWRVPGVRAVVTGYDVQLGRMGILQDHPPLKIGK
                     VRSVRDEVAAVAAETLEAAEEAVEAIEVEYEPLEGVFDPEEAMKPDAPLVHEENRSNV
                     VDLKMRFSTSHSTHLNQVFEKAAAVVSDRYQVHYNNASPLGTMGVIAHYNHLGELTIY
                     TNTQAPFLYRHELAKILGINPAKIRVIQPEIGGAFGRGMDVYPLDPIAAVLSMKTRRP
                     VKLVFTREEELQYAPPRQPAIIYMRTAADRDGRLLAREARVILDAGAYVSWGPFDGRV
                     MMATTTGLYTVPEVLFEATVVYTNNPYTGTQRGAGNPQITFAIEQQMDALAEELGMDP
                     VEFRIINANRPNTVTPQGLKITTCELRECLRRAAEEIGWRGRGMAGPNRGIGFAAFFH
                     VGGGARVYRSDGCGTVLSVDDFGLVTVITGSTDLGTGSDTAIAQIVAEELGIPLEKVR
                     VVNDDASIRPWDVGTHASRATFVAGNSALLAAKKAKEILAKAAAEELQTTPENLVFEN
                     NTVYDITNHAKKIEFDKLVRRIHFRQGGSNIVVSVYYDPPTEMQDENWMGNLSAAYVF
                     GAQAALVEVDPETRWVKVLKIVSVHDSGRILNPAAAEGQVHGGVAMGLSYTLYEELVL
                     EQGRVVNAALTDYLLPTALETPVIKTVFVEKPDPAGPFGAKGLGETGCIPTPAAIANA
                     VYDATGKRVKKLPIKPESL"
     CDS             101186..102334
                     /codon_start=1
                     /EC_number="2.6.1.-"
                     /locus_tag="CSUB_C0095"
                     /product="aminotransferase"
                     /protein_id="BAJ49958.1"
                     /transl_table=11
                     /translation="MLLMIPGPTEIDERVIRAMARQMIDHRSDEFRALMKSVVEKSRK
                     IFEANSSDIYILTSSGTGGVEAAASNLAQPGDKVLILSAGLFAERMAEAFAAYGANVV
                     KHPLENGQGPNPVAVKKLLEAHPDAAIVGFPFNETSTGIISRDVKEIGRICREHGALL
                     VVDAVTAVGGVRVPVDEYNIDFCVAGTQKCLATPPGLALVTVSKRAWEKIEQKKLRPP
                     YFDLVKYRHFMERWETPFTPAVTLFWAFDEALNIIFEYGYERWLARHAAGAAGLYAGL
                     RSYGLEFYAGPGFESPIVAAMHIPPGLTDTAIRETMKKKYGILISGGLAHYKGKMFRI
                     ANIGLITRDKVVNTIFALGKTLKSLGMDVDVSEAVENTERELDRNWPS"
     CDS             102338..102775
                     /codon_start=1
                     /locus_tag="CSUB_C0096"
                     /note="MaoC domain protein dehydratase"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49959.1"
                     /transl_table=11
                     /translation="MFFEDFEVGREFVSRERVVTPSDIDLFATWTWAANPLFLSDEFA
                     KARGFPQRIAPGALVIAFAIGLLYQTGAFDNIVALASIDGMSFRSPTHPGDTLKVVAR
                     VVEKRESKSPDRGVVKLEVACHNVTRGTLAFTAEMLFVVFRKT"
     CDS             102801..103520
                     /codon_start=1
                     /locus_tag="CSUB_C0097"
                     /product="threonyl/alanyl tRNA synthetase"
                     /protein_id="BAJ49960.1"
                     /transl_table=11
                     /translation="MRHGRTELLYLDDSYLREFSAEVVEVSGDCVVLDRTVFHPRGGG
                     LVSDVGFLRFGGVVSRVVEAFFTDGGVAHRLEGGVPRVGEVVEGVVDWEKRYRVMRMH
                     TGLHVLAATMVEKTGALITGNNISYDGGRVDFSLEMFDRGVIEDVVQETNRRLAEDHP
                     VKIYYLEREKVLSTPGLVKLANRLPPDVPVLRIVEIVGLDVQADGGPHVGNTVEVGRI
                     NVVKLENKGKTNRRLYFTVSP"
     CDS             complement(106284..107507)
                     /codon_start=1
                     /locus_tag="CSUB_C0098"
                     /product="GTPase"
                     /protein_id="BAJ49961.1"
                     /transl_table=11
                     /translation="MTVRIGLIGKTNTGKTTFFNAATLQYAEVSTYPFTTKQPNYGTT
                     YAITPCVCREFNVTDNPRNSLCIDGYRHIPVEIIDLPGLIKGAWAGKGLGNQFLSVAS
                     QADALIHVVDASGSVDEEGRITEMGTGNPLADFYDIQEELVMWLMRLIDRQEDKIVRN
                     LKAGKGFVETLAEALQGVKITAAHIEAALRLTGLRGEEFEKWTMLEDKKFAEKLLEVS
                     KPMIILANKMDLETAGANFEVLRDTLTSYMVIPASAEAELALRRAVQKGFVKYIPGEE
                     DFRIVDESKLTAEQRKALEFIESRVLGEYMRTGVQFAINVAVFKLLGMGVVYPVSDPA
                     KLSDGAGNVLPDAYLMPPNSTVKDLARAIHTELEKGLLYAVDVRTGLHLPGDYRLKDR
                     DVLSIVSTTRHRPKT"
     CDS             complement(107551..108423)
                     /codon_start=1
                     /locus_tag="CSUB_C0099"
                     /product="sugar kinase"
                     /protein_id="BAJ49962.1"
                     /transl_table=11
                     /translation="MAVSWREAGEEDLARACVPRRAWSRKGDNGVVLVVGGSWLYHGA
                     PFLVSMAAMRTGVDLVYTAAPEKVATAIRALSPSLIVLPLPDYKLTSKSVDRIVRVLD
                     DVNAAAVGPGLARGCEKGLLKLVRLLVERNIAVVLDATALFSDVLLLLRGARAVVTPH
                     AGEFRRLFGEEPGSTLEERVEKVYNVAKQFGVTVLLKGHVDVVSDGVEVVVNRKQPLS
                     SAMTVGGTGDVLTGVVAGFLARMVPPFHAAVAAAVANGYAGVAAAEKLGLHITPEDVI
                     GMLPVVLKRFDRVV"
     CDS             108472..109233
                     /codon_start=1
                     /locus_tag="CSUB_C0100"
                     /product="hypothetical protein"
                     /protein_id="BAJ49963.1"
                     /transl_table=11
                     /translation="MGQETIYLLGRGVYAVTAAARLNRRGHKTHLIPPARRLGVFPFT
                     LLPQQFFDEMNMKPTNHMETEITLVETENDTAELRDPLYLCRTTPLLEEVITLHNIDY
                     TSKQPPTSKLIDCTGTRWREIRCIQTLETAPPGKNRLQIDTMPGKQVAITVHFRGLIL
                     KTLYTKTKTSLPKEVLASVERATAFKDPETMQTVPTVSLLGPDHGEWRPNTDQALAEA
                     DAVERLLSIGSDPTELNVFIQRISSTVAKGGEQHG"
     CDS             109226..109516
                     /codon_start=1
                     /locus_tag="CSUB_C0101"
                     /product="archaea-specific DNA-binding protein AlbA"
                     /protein_id="BAJ49964.1"
                     /transl_table=11
                     /translation="MVEDSVVLVGRKPTMNYVLATTLPLAEGKRVILKARGRAIAKAV
                     DVVEVVRRRFVQNAVVEKINIGTEEGKVGNDGRQRNVSTIEIILTQPKASKK"
     CDS             109663..110214
                     /codon_start=1
                     /locus_tag="CSUB_C0102"
                     /product="small GTP-binding protein"
                     /protein_id="BAJ49965.1"
                     /transl_table=11
                     /translation="MKCGSPLTPYKSQYQYRFRVDVLGEKNVGKTSLIEKLVASSDIS
                     AVSGSTTSGSWMIDKVEIIIDFRELDGVHAAPDDKMDAALLVFDLSNRRTFVKSLLFF
                     EKLKMLPNPPPTFLIANKSDETGNRTVEEKEAADVAKAHGATYIEVSASNGFNVDLLR
                     EKLIKGLLAYRLEKIKRLLKNGQ"
     CDS             110204..111226
                     /codon_start=1
                     /locus_tag="CSUB_C0103"
                     /product="hypothetical protein"
                     /protein_id="BAJ49966.1"
                     /transl_table=11
                     /translation="MVSDSLLRRPGVESFLRYLENSGKESIDPLFEKTAYRYPVAEEF
                     FGEDAETVLENLAELGIFEKRLMDAAMMCPDCGTIAQVVKPVCPTCSSGRLVKGNVIE
                     HMLCGYVDFEQEFYKQGFKCIKCGKELKTLGVDYRRAGVFYKCMSCGRVSAIPVKRFI
                     CGHCGRASTEEELQLKPVFSYVVVREKFAVLKGIFLDLTPIISLIESKGFVVESPAKV
                     AGLSGVVHEFTLFASRPGAPASSSLAIDIARDADDNKLFEFFTKTFDVKAGASLLLCL
                     GHVDEKAKKLADTFNIQMLTFTSPDELVEKSKTEIEKILDKLSKKDLYEEASYLENLL
                     NKLGKV"
     CDS             111254..112300
                     /codon_start=1
                     /locus_tag="CSUB_C0104"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49967.1"
                     /transl_table=11
                     /translation="MVFGGRWLLPPVFINLFLGLAAGASRMGLIPVFASNAVQNHGAV
                     MMMGFISGIIVAERANTLKDPFLTAASIAFPAGGFLLVAGIDFAAYFAWFFGSLLFVI
                     WSAIFLAKYRSRYSGFFFLFSSLLNLLGIYFYAFGYSATFYVYSWVGFIVSFICGERM
                     DMLQISRPSRLSRLAAYVSPAAAAAGVILVGKELMALFFLLLLLAVARHDLAIRMFRR
                     PGFSRFLSIGIITAYAWLGVAALVWALTFSWDTMLHTIFLGFVGTMILTHGPVVLPTI
                     LKIKHFFTPLLYIPFTILQAATVLRIVSGVFIRLDAWAYSGLITIIAVAIYVFLAFSN
                     TFLRKNFLKNPSIS"
     CDS             112304..113098
                     /codon_start=1
                     /locus_tag="CSUB_C0105"
                     /product="voltage-gated potassium channel"
                     /protein_id="BAJ49968.1"
                     /transl_table=11
                     /translation="MASWSETVSSVLAVASIVLIVVEYFVPLSFDQVVAIMAADGVIV
                     LYLAVDLVRQARASGNVSRYLIKRWYEVVALTPMFVLYLLETQTIFGAVLRGMRLTRL
                     LRVVLLTARARKSLTHLLEVVRVSRLGYLLLASALVVLAGTFSAYLLEAGVEGARIHD
                     FGDAFWWALATVTTVGYGDVVPVTVAGRIVGSILMVTGIAILGVFISSLGSAIIGEKL
                     ATHPESDELKELMKKRIDALESLSEEEVSQLVELIKFYHGLSKRER"
     CDS             113101..114225
                     /codon_start=1
                     /locus_tag="CSUB_C0106"
                     /product="major facilitator superfamily MFS"
                     /protein_id="BAJ49969.1"
                     /transl_table=11
                     /translation="MSTGVRVILIIGIVSLLGDLVYEGGRSVLPDYMRQLGMDAFTVG
                     AALGVAELAGWAARPVGGLLADKTGKYSLIVKMGYAGLIVIPLMGLVSVWWLLVILAF
                     LERVFRGMRVPARDAMLVRMRGDVKVGKAFGLHELLDQVGAGGGPLLAIAVLSILPTP
                     YVYMSLTIPYILLLFTLMFVPSHVEKAHETSELKPARSVAVFSLAAAFNTAGLLPVPL
                     LLYMISLTAGSGSWLIPAAYTVAMVVDAVAGLFLGMFFDRWGLKVVALVIPLSVLPTV
                     FIYSDVALLMVSAFLLGVVIGAQESIFRAMVAELAHANGLGSAYALYGLAFGVGAAVA
                     GTVFGYMIQTGRSVLELVLYAAAMQAGSAIFLFKTAKLRK"
     CDS             114255..115205
                     /codon_start=1
                     /EC_number="4.3.1.19"
                     /locus_tag="CSUB_C0107"
                     /product="threonine dehydratase"
                     /protein_id="BAJ49970.1"
                     /transl_table=11
                     /translation="MITIRDVYLARKIVSKYLKPTPLQYSRKLSKELGADVYVKLENL
                     NPTHSFKVRGGLYYMSLMHDKVKGVVTASMGNHAQSIAYSGSLYGVETTIVMPSWVNP
                     LKKEAVTDLGAKVITYGAYYDEAAAYAQHYAEEHGLVFVDPINEVKLYPGVATMHLEV
                     VEELPNVETVFNPLGGGSGAIGAVTVYKSINPAVKVYAVQAEGAPAFYLSYKKGGLQS
                     TDGVKTRAEGLAVAKAYETPLQILKNKLDDVVLVSDEEMEKAVVKLYNTVRQVAELAG
                     AASTAAAYKFAEKISGKTVVLMLTGGNIDHKRFSEILARH"
     CDS             115247..115582
                     /codon_start=1
                     /locus_tag="CSUB_C0108"
                     /product="translation initiation factor eIF-1A"
                     /protein_id="BAJ49971.1"
                     /transl_table=11
                     /translation="MGKRKIVSEPDELDQMVEPGPGDVYGVVSKMYGYDRLLVDCSDG
                     KQRVCRIRGQLKRRIWIKEGDLVLVSPWDFQRDSRGDVWWRFTHNQALELAKKGVIPD
                     FLKAKLGAS"
     CDS             complement(115579..117159)
                     /codon_start=1
                     /EC_number="3.6.5.3"
                     /locus_tag="CSUB_C0109"
                     /product="elongation factor EF-1 alpha subunit"
                     /protein_id="BAJ49972.1"
                     /transl_table=11
                     /translation="MAENRRFTIPSIERMHIEFKERLIPEIHLRTEKRQKLASQMKYR
                     LENGGGTAVYILGVRDDGTALGISDIELEESLSVLKQVASECGAVIDRVEKFDSNGGL
                     IARVIITTQSRPSVDHLVVSVAGHVNHGKSTFLACLITGEKDDGQKWLYLDTLPHEVE
                     RNLSADLHFIVLGFRGMEPNLMKNPLDRAERIRVTRESERLVSFVDTVGHEPWLRTTI
                     RGILGQEIDYGFLVVAADDGPTHITREHLGIMLAMGIPVIILITKIDKVPANRVEAAE
                     SEIATLLKRVGRIPFIVNSINDVELLIDKVSVVVPVLKISSVTRQGYDLVYHLLRRLP
                     PRAKKRDLPFLLYIDRVYNVEGVGNVVSGSVKQGSLTPGAELLIGPTRKGVFVPVRAR
                     SIEMHYTRLAEAEPGYIVGVAVKGVREELLERGMIVCEPSLNPVSVWSFEAEVTVLSH
                     PTRISTGYEPIVHIHTIASTTRVKLLDKPYLKAGESGRVEMRFKYRPFYIQPGDRFVF
                     REGKTKGIGVVTKILETS"
     CDS             complement(117159..117401)
                     /codon_start=1
                     /locus_tag="CSUB_C0110"
                     /product="transcriptional regulator, AsnC"
                     /protein_id="BAJ49973.1"
                     /transl_table=11
                     /translation="MGEPMALAFMLLNVRPGREEEVLSQLRAIKEVRDAQRVYGVYDM
                     VVKIEADSMDALKQVVNNRVKKIENITSVISLIVMH"
     CDS             complement(117441..117803)
                     /codon_start=1
                     /locus_tag="CSUB_C0111"
                     /product="regulatory protein, AsnC/Lrp family"
                     /protein_id="BAJ49974.1"
                     /transl_table=11
                     /translation="MKVFAYVLIRTQPGTSHQIVALRSMPGVVSAHSVFGRFDAVLFV
                     SADSVEQLSQRVYEILAKQPNVVKVETLVCMPSPAEEPVTPRKEEIKLVTSFHCPSCR
                     ALNEVDALVCSFCGYRFR"
     CDS             complement(117803..118054)
                     /codon_start=1
                     /locus_tag="CSUB_C0112"
                     /product="AsnC family transcriptional regulator"
                     /protein_id="BAJ49975.1"
                     /transl_table=11
                     /translation="MVKAYVLVSAKPGTSEDIVRFLKEASAIKGVVAADSVFGRYDAI
                     ITLEVEDLRTLSQVLYKVIEKIPNVVRTETCIVMFSGNG"
     CDS             complement(118061..119497)
                     /codon_start=1
                     /EC_number="6.3.1.2"
                     /locus_tag="CSUB_C0113"
                     /product="glutamine synthetase"
                     /protein_id="BAJ49976.1"
                     /transl_table=11
                     /translation="MNKIMDSTKVLESIKESGIRFIDLQLTDLPGKLHHVTVTSNYLS
                     EDTLQEGVAKLDGSSLRGFADIHESDMVLKPDPRTFAILPWSDGPNKTARMICDVYRG
                     FGSGRFSRDPRYVAQKAEEYVKAQGYDVSYWGPEIEFFVFDKVHWDVKTPFEGVSYKI
                     ESREAAWNSGGTQHPIRFKEGYYPVPPQDTLMEYRNEVCRVLSDYFNVEVDAHHHEVA
                     TAGQCEIDMRFDTLTRMADKAQTYKYVARVVANSLGMVATFMPKPIFGDNASGMHVHV
                     SLWKNGVNLFYDENDEYAELSQLGRYFVGGLLEHSRALTAITNPTTNSFRRLVPGYEA
                     PVFIAWSRSNRSANIRIPVYYRGRASMKSKRIEFRTPDPSANPYLCFAAMAAAGIDGI
                     KKKIDPGDPVNEDIYKLSPERRKQLGIRELPGSLREAVEELLSDHEFLKPVFTEDLIE
                     VYTEMQLKMFIDVATKPHPYEFYLYFDV"
     CDS             complement(119990..120382)
                     /codon_start=1
                     /locus_tag="CSUB_C0114"
                     /note="vitamin K epoxide reductase family"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49977.1"
                     /transl_table=11
                     /translation="MIPYLIFAVSLSGLFLSIYLTLLPPPPFCEISSFLSCDTVLSSP
                     YAKFLGVPTAFYGVVWFAGAASLSMLASNGKQLAKLALGWSVIGVAVVAVLVYVELGL
                     IGAVCILCTAAHAMTVAVAALSFYQFKS"
     CDS             complement(120379..120972)
                     /codon_start=1
                     /locus_tag="CSUB_C0115"
                     /product="thiol-disulfide oxidoreductase"
                     /protein_id="BAJ49978.1"
                     /transl_table=11
                     /translation="MPSKKVKKKRNLSTYLAVLPAALLVVFIAYLIVTPPSQSISTIS
                     TTGQTNTVKTGDIATPFSLDLIDETGLKNEKVSFRPDSGQIYFIDFIHEWCVHCRNMA
                     PIVERLHQTYAEKGVVFITVAGGYNTDAQKTAQFIKNYRVTWPVGFDPQLEIFRQYGV
                     RGTPTYVIVNKNGIIAAKLEGEQPYEALARELDRLLG"
     CDS             121063..122463
                     /codon_start=1
                     /locus_tag="CSUB_C0116"
                     /product="drug resistance transporter EmrB/QacA subfamily"
                     /protein_id="BAJ49979.1"
                     /transl_table=11
                     /translation="MTGQRLLLIGLLMGIFLAAIDSTVVGVALPSIVSSLKGLNIYSW
                     AFTAYILTSTVTGPLWGKLSDVYGRRFIYVAGVLIFLAGSLLCGLAQDMVQLVLFRGI
                     QGLGGGALLVLTFTIVGEIFTLKERAKATGYTSSVWAVASIVGPPLGGFIVDTVGWRW
                     IFLINLPVGLFCVATVGRILKTTTRTETKIDVSGSILFLLAASPLLLYLSEFQNIGET
                     APLILLTSGAAFTLFFYNERRSPSPLIPFHLFREKILRTGFLGNLLAGFVFFGIIAYM
                     PLYLQTVLGYSATFSGVLLLPLVLGWVASANAAAQLAIRSSLKIPAILSGFFLVSGTV
                     FLSLASQNIPVLLTGFALTGLGMGFTVSTFLIATQTVVPRGVLGVATSLLSFLRLMGG
                     AISAAVLWLPIGALVRDLGLQQSVGVVLSEAEKTAFTAGFSQSLAIAIAASAIALALY
                     IFTPSIKLAKLGDKSS"
     CDS             122491..124131
                     /codon_start=1
                     /EC_number="6.3.4.2"
                     /locus_tag="CSUB_C0117"
                     /product="CTP synthetase"
                     /protein_id="BAJ49980.1"
                     /transl_table=11
                     /translation="MKNIHMPKYIFVTGGVVSSVGKGTVAASIGKILSVRGVKTGFLK
                     IDPYVNVDAGTLNPFSHGEVFVTDDGAETDLDLGWYERFLDITTSRKNNITTGQIYAE
                     VIARERRGDYLGQCVQIVPHVTDEIKRRIREASEGVDVLIVEVGGTVGDIEGQPFLEA
                     IRQMRLEEGVENTLFVHVALVLTLKATGEFKTKALQHSVNTLRALGIQPDIIVARSDK
                     PIDQEARRKIALFGTISEKAVFSSHDVDCVYKVPVVLEKQGMGDYLVTRLALAEANPD
                     WREWNHVLNLYDNAVFPVKIAVCGKYTKLADSYVSVKEALQHAGVNIGAHLEIDWVNT
                     EEFENGSRSLETLHGYDGVLVPGGFGRRGTEGMIECIRFCRTNDIPFLGICFGLQLSI
                     VEFARNVCGLAGANSTELNPETPHPVIDLMPEQRRVSGLGGTMRLGALTVKLIKDTLA
                     HRLYGADEIRQRHRHRYEVNHTYWETLQKNGLVFSGFSPEGDRVEIIEYPVNRFFLAT
                     QFHPEYLSRPNRPDPAYLGFVKAAMERRKTLKAAEAVA"
     CDS             complement(124128..125393)
                     /codon_start=1
                     /locus_tag="CSUB_C0118"
                     /product="ABC-2 type transport system permease"
                     /protein_id="BAJ49981.1"
                     /transl_table=11
                     /translation="MSLTPLLSKELRELLSEKTILIGVVLMPLVIFPLIGFTMAPVTM
                     REGDIGARAAVLVVDQDGGKYAALFVEALRKTGLNPQPIQLQNDNLLQLIKNSEASAA
                     VIIPQGFSTQLEQKNKPTVKLFLKLASSSVAEFERIGAIRDRIYTAVSLMGEALASEE
                     DIAVSFYKSPINLSGEVVYRDQTIPETDAGQLFQQFFASTLLIPIALIIVVTTSGTIA
                     ATSIGLEKEAKTLEMLLTYPIARSTILASKLLGSTVVALLGTASLMTGLIFYFSRVTA
                     FAGMSISFSLSPLSLVLLAVVLFFALVTTLGLGVLAGVLAGDVRGSQQLASLIQVPLI
                     LLPLLLFLSGGIQSLQQPLATIILIIPFTHVMLATQAILESSYLNILLHIGVMVVWTV
                     AVIGLAAFMFRGERLLTLRVRLGRRRQAV"
     CDS             complement(125390..126112)
                     /codon_start=1
                     /locus_tag="CSUB_C0119"
                     /product="ABC-2 type transport system ATP-binding protein"
                     /protein_id="BAJ49982.1"
                     /transl_table=11
                     /translation="MAMQAIVAEGVWRFFGDNPVLRGVSLVVEEGGVFGLIGPNGAGK
                     TTMFRILATLLRPSRGTAKVFGKDVVKEASEVRRMITYLPEEAGVYKNLTGRSFLKMV
                     SRVYGLGSSALEKGIAISGLGEAVDRKMGEYSKGMRRRILLAGCLMVEPRLAILDEPT
                     AGLDVEHSVYVRKIIRQYAEQGTTFIVSSHNMLEVDYLCDRIALIHRGGIVAEGKPRE
                     LTASHNVQNLEELFVKKVGEAP"
     CDS             126151..127002
                     /codon_start=1
                     /locus_tag="CSUB_C0120"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49983.1"
                     /transl_table=11
                     /translation="MPTLWEQLSAFYGVASAVSWGAGNFYGGYASKKASVLMVVAVSQ
                     SLGLVLLLSLGILSGEKPPTTSDIYWSAAAGFFSGLGITLYYAALSRGSMGLAAPVTG
                     VLTAAVPAVAGTFLEGVPSPLQAIGFLLAFLSIFLVTGNKADRLDVKRQLVPAAAAGL
                     GFGLFLVTIGQVSPGHYYYPLVVSRLVTVSMVLAASLAKGHTSLSNSRLTTAAAGIFD
                     TGGSFFYLLARQQGRLDEAGVLSSLYPVSTVLLAKTILGEKLGKQRTAGIICAAAATT
                     LIQTANI"
     tRNA            127030..127103
                     /locus_tag="CSUB_T06"
                     /product="tRNA-Asn"
     CDS             complement(127152..128027)
                     /codon_start=1
                     /locus_tag="CSUB_C0121"
                     /product="type I restriction enzyme R protein N terminal
                     domain protein"
                     /protein_id="BAJ49984.1"
                     /transl_table=11
                     /translation="MVRELVSLVEQLKKRIQDYQKELQSSEALTRYVLIDPLLRGLGW
                     DTENPELVRPEVSTPAGRPDYALLHNGQRLAFVGAKPLGKQEDLLQQISYCVSEGVRY
                     FIATDGSRWEVYDTGIQKPLQEKKIVEWDIQSMNAGEVVRRAFAIMRYAGINEPAPPS
                     IISEGTGPPPPGKRLTDFSLKPGDQLKFTRIIFPDGKSYQLKYWRDILTAAVEWLHST
                     GKLPPPPIKAGNGVTYLVNTRPVHENGKSFHASKRIGTLYVNTQFKIRDIIRHTISLL
                     QKSGVSPDNVFLSVD"
     CDS             128100..128519
                     /codon_start=1
                     /locus_tag="CSUB_C0122"
                     /product="nitrogen fixation protein NifU"
                     /protein_id="BAJ49985.1"
                     /transl_table=11
                     /translation="MWVSLSSGLGEAQFEIILDHYRNPRNYGEMSDASVKVKDSNPLC
                     GDVVEVFLKINSDGVVEKATFRGHGCAISQASASMLIESIQGKKLDELKNLDKQHIFE
                     MLGIEVGPVRVKCALLPLKALKAAVYSYLGLKLDEEE"
     CDS             128547..129713
                     /codon_start=1
                     /locus_tag="CSUB_C0123"
                     /product="metal-dependent phosphohydrolase"
                     /protein_id="BAJ49986.1"
                     /transl_table=11
                     /translation="MLKLVKDPVHGYVTISDEERRLVDSAAVQRLRRISQLPLVHLVY
                     PGARHSRFDHSLGCMHLAGEFADHLNLDTHERNLLRASALLHDIGHTPFSHLFEQLLM
                     EKRLSHEDMSIKIVQEDDEIASALEIMGLDVKEVVDVLRGRSRLSGLVSGPLDVDRLD
                     FLLRDAYFTGATYGVVDVRRIIRLTRLLEDGPAVDSRGIGVVEELAIARYHSFINIYF
                     HHAARAAQHLLLRAAKMLGDELDFSTMTVQEYLQHDDYTTWCLLRSREKSRPYIKMLE
                     KRILPKRVFEQKFLGENGLRINYSDISLLERLIAEEAGTEPTKIYVDYSYAPPLTKYG
                     PGEVRIHPPPDTDSWIIQQLSKPLKLVRVYVEREAAELDRVRKAAEKIIGSETV"
     CDS             complement(129886..130089)
                     /codon_start=1
                     /EC_number="6.3.5.7"
                     /locus_tag="CSUB_C0124"
                     /product="glutamyl-tRNA(Gln) amidotransferase subunit D"
                     /protein_id="BAJ49987.1"
                     /transl_table=11
                     /translation="MVTGYGGLAAEVLRGLGVGLGDEVEVVRNGLRLHGFVMARYEFG
                     EPDVLVLKLPNGYNMGVRVDAST"
     CDS             complement(130647..131513)
                     /codon_start=1
                     /locus_tag="CSUB_C0125"
                     /product="hypothetical protein"
                     /protein_id="BAJ49988.1"
                     /transl_table=11
                     /translation="MTRFYADIHRKKDDSGYRITYTTDGKTFKHTDSPTEMPVGPGDE
                     VFVDVIPVVHTDGFVELLRRGAEVYYLRRLTLIKKMRDKLGITSKSARADVKTLMAIE
                     EKWFKKVDETYLIMRKKASTFRSLQKTLEQYKNRLEAASGDEREDLLDMVKITEKKLH
                     RQAKRIVEEAERRYPAYSILVDELGISGENHILTQEALAEIMMYVDPRWGLRKTLNFF
                     GLFKNTNKKKKKKYNGHARKALERLTITVYKIKPKDLTAKLQKQLLRQIWLTIQQETQ
                     ERLAGIPAQQQG"
     CDS             131705..132115
                     /codon_start=1
                     /locus_tag="CSUB_C0126"
                     /product="hypothetical protein"
                     /protein_id="BAJ49989.1"
                     /transl_table=11
                     /translation="MNGFEPVIADVRLSTETLLSTLRMFERDFDYVMFSFKDGVLSIS
                     SKLEYEEKSLERSLKVSGRGKVDKQYFGLHYLLKYLKSIDRMGIKGIRLLFSEGPQEF
                     SKDSQKNSPRPIIIEGRIKDMEITLYQAPRRIEE"
     CDS             complement(132140..132742)
                     /codon_start=1
                     /EC_number="2.7.4.9"
                     /locus_tag="CSUB_C0127"
                     /product="dTMP kinase"
                     /protein_id="BAJ49990.1"
                     /transl_table=11
                     /translation="MKTFYIAVEGIDGAGKTTQAKLLARKLTRHGFRVMNVHEPTDGK
                     IGGLIREALAKRVNMSEEVLALLFAADRLTLREKIVSAKQSGVYVVSDRSVVSSLAYQ
                     SAALGLRNWVYEVNRFAVKPDIIVYIDISPETALKRLRKKSQRYENMVFLRKVKNAYS
                     RVLHDFRRVVVVDGEQPVDAVAETIVEKLSRFIPVMRFHA"
     CDS             132772..134463
                     /codon_start=1
                     /EC_number="4.2.1.9"
                     /locus_tag="CSUB_C0128"
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="BAJ49991.1"
                     /transl_table=11
                     /translation="MRTNTFCAMVRRLYSHEVTEGPERAPHRAMLRAVGLRDEDFGKP
                     FIGVVSTGNEVTPCNLHLTDLAKEARRGVWENNGVGIEFTTIAVSDGISMNTEGMKGS
                     LVSREVIADSIELECFAERFDGLVGIAGCDKSLPGTVMAMARLNIPSVFLYGGTILPG
                     KYMGRDVTIQDVYEAVGSYSTGQMTLQQLVELERVACPTEGSCAGLYTANTMASAIEA
                     LGMSLPGTASIPAVDQRIYDAAYRSGAQVLKLLENGIKPRDIMTYEAFENAITVVCAM
                     GGSTNSVLHLPAMAYEAGVKLDIDVFDKISRRTPHIADMRPGGRFVMVDLDRVGGVPV
                     VLKKLLDAGLLHGDCLTVTGKTLAENLREMRIGDGGEVVRPLSNPIHPTGGIAILKGN
                     LAPEGGVVKSTASAVQYFKGPARVFNSEEEAYRALLKRQIQPGDVIVIRYEGPKGGPG
                     MREMLAVTAIVVGQGLKEKVALLTDGRFSGATHGLMVGHVSPEAAVGGPIAALKDGDI
                     VEIDVPNRKLSVELSDEEIRKRMENWTPPPPKYTRGVLAKYAKLVGSASRGAVCG"
     CDS             134527..134808
                     /codon_start=1
                     /locus_tag="CSUB_C0129"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ49992.1"
                     /transl_table=11
                     /translation="MAQAGADWESKRQQVVQILETIINDADTPRNIRRIAKQASTELF
                     NEKLRPAVRAANSIELIEEIINDPNMPSFTRTQLWMAISILETIRSSQT"
     CDS             134869..136266
                     /codon_start=1
                     /locus_tag="CSUB_C0130"
                     /product="citrate transporter"
                     /protein_id="BAJ49993.1"
                     /transl_table=11
                     /translation="MDFLFGKPIKYGAVVASVAILGYFLGLDVKQMTSLIVLAGMIGA
                     TLMFWRFRLVFAFFALALMLGTDLLEIELLIKFAHLDTILFLASMMVVVGYLEEARFF
                     EYVIDRLQAIIGNRPRAMVVFFMAMSAMLAALVDEVTSILIMTAVLLDFTSRYNLNPV
                     RFIILSIFATNIGSSATVVGNPVGVMIAFQAQLGFADFLRWATPISIGSLILCILLSL
                     VIFRKDIANLSQAMTSESGVKIAAMEKADGGHRVDIRLPAAIFLATILGLILHTPIEQ
                     ALGLGKNAMLLGVPFLFAGIVLLMERERARELVETRIDWWTLLFFMIFFASVGTLSHT
                     GATQVFANLILANAGDSITTLSIFVMIVAGLMSAFMDNVLAVATWIPIIKTLGEFGVN
                     VFPLWWTMLFAGTFWGNLTVIGSTANIVAVGMLERRERIHITLRQWIGVGAAITLPTV
                     ATALILIVIQLPLMT"
     CDS             136593..137423
                     /codon_start=1
                     /EC_number="4.2.1.51"
                     /EC_number="5.4.99.5"
                     /locus_tag="CSUB_C0131"
                     /product="chorismate mutase / prephenate dehydratase"
                     /protein_id="BAJ49994.1"
                     /transl_table=11
                     /translation="MHTTVAFQGEKGAYSEEAIFHFFGENVQTMPCKSIRDVFKNCEA
                     RVVDYGVVPVENSIEGSVFETYDMFLSSSVKAVGEIILRIRHCLIALPDVSLSEVETV
                     YSHPQALAQCRGYLQSLGVSVEVTYDTAGSVKMIKERGLRNAAAVASERAAEIYGMKI
                     LAKGIEDYGHNYTRFLVISVKEAQYSPSSKTSIIFSTAHKPGALYNALGAFARNGINL
                     TKIESRPTRQRPWEYYFFVDFEGHQEEEHVKKALAELVSYTSFIKILGSYPRASTELS
                     "
     CDS             complement(137406..138305)
                     /codon_start=1
                     /EC_number="1.1.1.31"
                     /locus_tag="CSUB_C0132"
                     /product="6-phosphogluconate dehydrogenase NAD-binding"
                     /protein_id="BAJ49995.1"
                     /transl_table=11
                     /translation="MERVGFIGLGLMGKPMAKNLLRRGFKLAVFNRSRSPMEELASLG
                     ATACSSPKEVTESSECVITMLPDEKAVEQVLLGRNGVLEGLTKGGVVVDMSTVSPGFS
                     REMARRVEERGGEMLDAPVSGSTMAAEQGTLTIMVGGKPEIFEQIRPIFEAMGKNIYY
                     MGGNGSGSFTKLCNQVAVSLNLLGVCETLMIAAKAGLDLKKVIEVISTGAGGSWQLST
                     LGPRMVVRDFRPGFKVKHLRKDLRIVRETTESLGLCLPGVALVSELVKTLDEMGHGEN
                     GTQALVEVLEKLCNIRIGSGQLG"
     CDS             138381..139076
                     /codon_start=1
                     /locus_tag="CSUB_C0133"
                     /product="hypothetical protein"
                     /protein_id="BAJ49996.1"
                     /transl_table=11
                     /translation="MKQRPQHLYPVPVRVEDLSSLVRLASSRWDYIPHLIAFQHGQQT
                     IIAYLQTMPLGRVNIPLLFHTTAPELVKKYVVYTALEKEETRLSDQPETGRYISYPII
                     HADPPPRILEKAITSKHGRKIRGIEKIKVRALDSIMRLVSAMTDESFSPPVWCFKSRN
                     GYSLAVLYPVYEYYDSIALPFLYYVEVEEKPPAPFIAYSPTLGRESIRYTNSVSDTRY
                     SYGRLIFLEKFIV"
     CDS             complement(139066..139215)
                     /codon_start=1
                     /locus_tag="CSUB_C0134"
                     /product="CopG/Arc/MetJ family transcriptional regulator"
                     /protein_id="BAJ49997.1"
                     /transl_table=11
                     /translation="MKLISVKMPEALIDGMDELIKKGVYPSRSALMRTAVRDLLRKEL
                     WEAKR"
     CDS             139321..140976
                     /codon_start=1
                     /locus_tag="CSUB_C0135"
                     /product="thermosome subunit alpha"
                     /protein_id="BAJ49998.1"
                     /transl_table=11
                     /translation="MAATVGTATQPVIILKEGAKRMRGREVQSANIMVAKIIAETMKS
                     SLGPRGMDKMLVDSFGDIVITNDGATILKEMDVEHPVAKMLVEVSKAQDEEVGDGTTS
                     TVVLAGELLTKAEELIEKEVHPTVIIEGYRKAAVKALEILDEIGVKVDPTNKDLLKKV
                     AKTSMISKLVAEEADYLADLVVEAVTRIAEKVGDKWTVDLDDIKLEKKEGQSLHDTKL
                     IEGVVLDKEVVHPDMPKLVRNAKIALLDAALEIEKTEFDAKLNIESPEQMRAFMKQEE
                     DMLRQMVEKIVSTGANVVLCQKGIDDLAQYFLAKKGVLAVRRIKKSDMDKLAKATKGR
                     VISRIDDLTPEDLGKAALVEERRVGEDKMVFIEGCENPRSLTILIRGGTQRIVDEAER
                     SLKDAINVVKDVIVEGKVIAGGGASELETALRLRDYAKTLPGKEQLAVNKFAEALEAI
                     PSQLAESCGMDPIEAIVNLTSKHKEGNINYGINVFKSELADMKQLDVLDPLLVKKQTI
                     KSAVEAAAMILKIDDIIAASRLETPGAGKKGEKEEGGVGESED"
     CDS             140957..141214
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /locus_tag="CSUB_C0136"
                     /product="DNA-directed RNA polymerase subunit K"
                     /protein_id="BAJ49999.1"
                     /transl_table=11
                     /translation="MASQKTEAKTAQLRLTKYEKARIIGGRALQLSLGAFPLVEVRPG
                     ESNIDIAKREFERGVLPIIIRRKRFDGSYVDIPLKELLGNE"
     CDS             141207..141404
                     /codon_start=1
                     /locus_tag="CSUB_C0137"
                     /product="hypothetical protein"
                     /protein_id="BAJ50000.1"
                     /transl_table=11
                     /translation="MSDAEERGWRDAFILLVAVALVLFTLDVLLGFQLTFQFLFFAVY
                     FPIFFSGAVYMFKRLRRLRRY"
     CDS             141482..142576
                     /codon_start=1
                     /locus_tag="CSUB_C0138"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50001.1"
                     /transl_table=11
                     /translation="MFRSGVKDLRGWSGKAARFHYNRSREIINEVVHSFLNIYGPDEL
                     VQGFAEPFFTDFVITAAGLDETSADSTLYMGSMLKEVISPRDGAAVLGGRFATRFRIP
                     NELPEVAKLFGFSETMVERLLYCSRMVAKTDSVALQDGFDLYFHMMILSSSGVWTVIQ
                     QSLNPYTQAVRRYHWFSGRVKSFVDEPHTGIISDEIRQRVLDMTAKTSSESRRASLEV
                     LEREVSKLQRLHMFGRLTNQTTLDEEGKSVAEFLRPMERINWTLVYKLGEQTPKSYEE
                     LLAVKQVGRGIIRLLAFGVYMMYGVKPSLRDPAYPASEYTARYDESYFLWRLQQLVDA
                     IKSSTLAPELKRYSLHRLGEVFGEGEPVSA"
     CDS             complement(142573..143646)
                     /codon_start=1
                     /EC_number="5.5.1.4"
                     /locus_tag="CSUB_C0139"
                     /product="myo-inositol-1-phosphate synthase"
                     /protein_id="BAJ50002.1"
                     /transl_table=11
                     /translation="MPKIKTAIIGVGNCASALVQGVYFYKDVDDNAFVPGLMHPRLGG
                     YHVGDIEFVAAFDIDKNKVGLDLSQAIFQKPNCTLRFADVPHLGVEVMRGMTHDSIGK
                     YLKDVVVKHDSPTVDVADVLKSTGADVVVNFLPVGSESATKWYVEQALVAGTGFVNGI
                     PVFIAREKRWQEIFAKHNIPIIGDDVKSQVGATILHRVLTKLFVDRGVKIERSYQLNF
                     GGNTDFLNMLERERLQSKKISKTQAVTSLIPYELPAENIHIGPSDYVPWLEDRKWAYI
                     RLEGSAFGNAPLNVEVKLEVWDSPNSAGVVIDAIRCIKIAKDRGIGGVLEGPSAYFMK
                     SPPKQYPDDVARQMVEDFIAGKA"
     CDS             complement(143697..144014)
                     /codon_start=1
                     /locus_tag="CSUB_C0140"
                     /product="PadR family transcriptional regulator"
                     /protein_id="BAJ50003.1"
                     /transl_table=11
                     /translation="MAYERLVRKLTHENLWLYILTLLSKRPLYGYEIRNLIEKEFGFK
                     PGEVTSYVVLYRLERAGLIKVAEESKSSRGPSRRYYTLTPRGKDTLKKAKTFLEELVS
                     RLA"
     CDS             complement(144241..146214)
                     /codon_start=1
                     /EC_number="4.2.1.17"
                     /locus_tag="CSUB_C0141"
                     /product="enoyl-CoA hydratase"
                     /protein_id="BAJ50004.1"
                     /transl_table=11
                     /translation="MKMVVVGAGVMGHGIAEVAALAGFDVVMVDVAEEFLAKGLEKIR
                     WSLEKFVEKKRITKEAADAAFSRIRTSTNLAEAVVDTDLVIEAAPEDIKIKKNIFQVL
                     SQNAPAHAILATNTSTLPITEIASATNRPEKVVGMHFFNPPPLMPLLEVIAGEKTSQE
                     TLAKAVEIGKKMGKTVVICRKDVPGFIVNRILTPLLNHSCQLVEDGVYTVAEIDSALR
                     YRLGLPMGAFELADYTGIDVIVLASKSIKERDPNTPPVCSQFQRLYEKGNYGLKSGKG
                     FYEYRGGVYERPSIPREAGEKVDLVELMAPAINSAAWIVRNGVASLDDVETGVKLGLG
                     WPKGVFQYADELGLDKVAAALTKAAERFGDFYRPDPLIMELVNQGKLGVKTGAGFYTY
                     AAAETGYTEILVERKPPVTKIILNRPHRLNTITPRMIEELMDALLKAWSDSETRVVVL
                     RGAGERAFSAGADITAFTEIKTRQDAEKFLRAFQELMNIMESMPKAVIAAIDGYALGG
                     GCELIQGCDIRIATDRSEFGQPEINLGLIPGAGGTQRLPRLIGVAKALELTLLGNRIS
                     AEEAYRIGLVNKVVKPENLEQEVQSLAEKLASQPPLAVRAAKQLIYMTREAPLSRGLA
                     MERMFFADLLFTKDFMEGVSAFFAKRKPEFKGE"
     CDS             complement(146480..147709)
                     /codon_start=1
                     /EC_number="2.8.1.7"
                     /EC_number="4.4.1.16"
                     /locus_tag="CSUB_C0142"
                     /product="cysteine desulfurase / selenocysteine lyase"
                     /protein_id="BAJ50005.1"
                     /transl_table=11
                     /translation="MPSTGLDPHRIRQDFPIFQNNKNLIYLDSTATSQKPAQVVEAVA
                     EFYKKINANVHRGVYEISVEATEAYENARKKVAEFIGARSSREIVFVRNTTEALNLTA
                     YSLGLHRVKPGGKIVLTTMEHHSNIVPWQLIAKINRLKIEYIPFDDQGYLDLSEADRK
                     LKDADIFSFTHASNVLGTINDAKMLCRMAHEHGALAIVDAAQSVPHMPVNVQEMGCDL
                     LAFSGHKMLGPTGIGVLFGRRELLEEMEPFQGGGEMIKEVYLDHSLWNDVPWKFEAGT
                     PNIAGAIGLGAAVDYLRRIGMENVREHEHRLTAKALEIMSEIRHAKVYGPENPLHRCG
                     LVSFNLADIHPHDLATYLDKHGICVRAGHHCAMPIHTHLGISATTRASFYIYNTEEEL
                     EIFREALLQALKVFHVQ"
     CDS             complement(147752..149578)
                     /codon_start=1
                     /EC_number="6.1.1.3"
                     /locus_tag="CSUB_C0143"
                     /product="threonyl-tRNA synthetase"
                     /protein_id="BAJ50006.1"
                     /transl_table=11
                     /translation="MRILGLHVDFVEYRPVKRESTVVEEAAPEPVRIEDAYVLLTSVE
                     PEDDERVAEAAVADAVEFMSRLKIPRLVIYPFAHLSRELARPEHAVEILALMEKIAKE
                     RGVEVHRSPFGWNKALALSVKGHPLAERSRVFSQATLQQKQVTVVEKTYMVLTPDDEL
                     LKPEEALPRLPDGLAVLVEKEALGKGLNEVSEPEHGKVLRRLGIDWEELSDSGHMHYG
                     PEGTIIYDLISDYASKIVRELGFPVYFVKGTNLFSLESRPIREHASLFGQRMYKVEVD
                     GRPYVMRYAACFQQFALARNWVISYRSLPFGMFEVADSYRLEQRGELVLGFRLRKMSM
                     PDLHVFCRDIPEALQIVEKIHDKIYSEIEKLGRDYYSLYNLTSRKFFEENRGFFQKLL
                     KREKKPVLLSFYPENSSYYWVLNIEYHIIDKFGRPREIGTVQIDVGNAERFGITYVEK
                     DGEKKYPVILHSALIGTVERYLYAVVDTALSKTPPTLPTWLCPTQLRILPLNEKYNKR
                     AVQLAEKITKYGIRVDVDDRPETLAKKVYEAETSWIPYVATLGPKEAKKGTLAIRIRG
                     KKGVKQMRLKPLVKLIQKETENYPFRPLTLPIELSKRPKYNP"
     CDS             149798..150082
                     /codon_start=1
                     /locus_tag="CSUB_C0144"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50007.1"
                     /transl_table=11
                     /translation="MTIKINYCQRQNLTMRTKIDHTGRLYIPKEVRDRVAAEEFTIET
                     LEDGSIILRPIRTDPVDEYYGIVKTKPMSVEDMEKKIKEYVEALYRNDIS"
     CDS             150069..150434
                     /codon_start=1
                     /locus_tag="CSUB_C0145"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50008.1"
                     /transl_table=11
                     /translation="MIYLDVNVLQYWLTADPRFGERSKEILKHHRDKATSALTIWILF
                     VLNQGNEKKIMEAVDAIGLSVAPLTIQDLRDATTLSESLGLDVEDAIHLATMKRLGID
                     AIASNDKDFDKVSRVKRVF"
     CDS             150955..151437
                     /codon_start=1
                     /locus_tag="CSUB_C0146"
                     /product="bacterioferritin"
                     /protein_id="BAJ50009.1"
                     /transl_table=11
                     /translation="MGRQGKAIVKAPIDEVISDLLKAYADEWLAHYQYWVAAVSLKGV
                     DADTFRPVLMEMSQHELKHAEKLAKRIIQLGGKPVLHFEKLLATSGCGYIPPPEDPAN
                     YEQLIKDILKAEACAIKFYSEMVEKYRVTDVVTHELFEELLEDEVEDEQTWEDFLAKL
                     "
     CDS             151728..152294
                     /codon_start=1
                     /locus_tag="CSUB_C0147"
                     /product="hypothetical protein"
                     /protein_id="BAJ50010.1"
                     /transl_table=11
                     /translation="MTRFYADIHRKKDDSCYRITYTTDGKTFKHTDSPTKIPAEAGDK
                     VYVDVIPIMHTDGFIELLKRGVEVYYLRRLTLIKATRQKMGITSKSARADVRVLMAIE
                     ERWFKAVDETYLIMREKASTFRSLQKTIEQYSNRLDSASEDEREDLLDMVKITEKKLH
                     RQAKRIVEEAERRYSAYSILVEELGISG"
     CDS             152331..152594
                     /codon_start=1
                     /locus_tag="CSUB_C0148"
                     /product="hypothetical protein"
                     /protein_id="BAJ50011.1"
                     /transl_table=11
                     /translation="MMYVDPRWGLRKTLNFFGLFKNTNKKKKKRYNGQARKALQRLTI
                     AVYNIKPKELTAKMQKTLLRQIWLTIRQETQERLAGTPAQQQG"
     CDS             152994..154232
                     /codon_start=1
                     /locus_tag="CSUB_C0149"
                     /product="GTP-binding protein HflX"
                     /protein_id="BAJ50012.1"
                     /transl_table=11
                     /translation="MKVALVQRLDDWAEYNLDELEELCRSAGYTPVYKLVQRRPPHSK
                     YMIGPGKVEELRRAVKSLKIEKIVTENELKPVQEYNLAKALSIPVITRTQLILETFAR
                     RAASTEAKLQIKLAELQYELSRAKEKVRLAKKGEQPGFHGLGAYEADVYYNEVFRRIS
                     TIKQKLKQIRMRKNLVRQRRLEGGLPTVALTGYTNAGKTTLFNRFSGEEHPAGPQLFT
                     TLSTTARIVKFRGRKAYLSDTVGFIKNLPHLLVESFHSTLSEFIYADLLLLVVDISEE
                     KSVVESKLNTCLNVLDEVGVKNVPILVVFNKIDAAADYREKIESINPEFRYVAVSAWT
                     GQGLDTLEEAVADMMGGYIRVRAQLENGETTPSLLNEIKQFCNVLKIEYNSSGYEIEC
                     ETPLQLAEKIKRLAAEFHVV"
     CDS             154222..154686
                     /codon_start=1
                     /locus_tag="CSUB_C0150"
                     /product="RNA binding PUA domain protein"
                     /protein_id="BAJ50013.1"
                     /transl_table=11
                     /translation="MSFDEFLLRQVRQLAFFQFGVAGEMFIPDGCVVEVSPSTGRPRR
                     IWLDGKCLATIRAMDGWLTLTVFGAQRLNSLLERGRNRVVVNREGAEKVAAGYDVYGG
                     HVVEADASIVPGMEVLVVDEDYRLLGVGKAVVAGVEMTELRRGAVVKVRHKV"
     CDS             154713..155081
                     /codon_start=1
                     /locus_tag="CSUB_C0151"
                     /product="nascent polypeptide-associated complex subunit
                     alpha"
                     /protein_id="BAJ50014.1"
                     /transl_table=11
                     /translation="MKRLSPREMRRAQERMLKNLGLNVEEMGQAEEVVIKLGERVITL
                     RGPLVYAVKTGGEKIFQIIGGEEVAAQEVETKPVYEPSEEDVSLVMAQTGASEEEAKK
                     ALLDSGGDLAKAILMIRSRR"
     CDS             complement(155070..156677)
                     /codon_start=1
                     /locus_tag="CSUB_C0152"
                     /product="hypothetical protein"
                     /protein_id="BAJ50015.1"
                     /transl_table=11
                     /translation="MRRHSSVSEMSEAIDDAKIFKSLASPNRLSILRKLEKSPLNYTE
                     LMHVLGMNKKSDAGKFAHHLKMLYAAGLITLNRQTKNYELTTKGVQVLKILNEMRASI
                     SQRIKVRRSDMVLEDFDRNKITRVLVEEASLPPKTADKIVKLFEEKVEELKLGELSAP
                     LIREMVNALLVEHGLMEHRNRLARLGMPVADVDKLVRENHHQRDFMSLITTASGAVFR
                     EYVFHKILPSEAAQLYLVGAVDFEGLETWGFSVYSRLYTPDSLKTVFGEVGGVEAEVV
                     LRDPNIDVNILTLLFESVHMFGRRLSVFYSEPRENTSNLLTEAGICATLPFDKNVARL
                     TGDVLLVLAHGVVSSEGHPFGEAGIISGKASINMVSLFLRSGSSERKFWDALRETVDT
                     VAAAFSAKKRFLQRFWPGEEGSFVLSLVGVEQLVVKQGFGRVELVKKVAQECSGVDED
                     VVVLLGSRASRRAAERMKRLDELSLGVREVERIAGDAPYSFDVASSSSREARELARFF
                     TGGMVAKMDVKMAEDLLDLRPFIILSS"
     CDS             156666..157667
                     /codon_start=1
                     /EC_number="2.1.3.3"
                     /locus_tag="CSUB_C0153"
                     /product="ornithine carbamoyltransferase"
                     /protein_id="BAJ50016.1"
                     /transl_table=11
                     /translation="MPSHLLIALSFQVKIKLCSDEGVAKMRHFLEVGDLKPKEIDAIV
                     SAALRWRKSGYPRTRPLRDKTVVLVFQKPSTRTRVSFQAAVAKLGGESMYLGWSELQL
                     GRGESVEDTGKVLARYVDCIVARVFGHGDLVELAKNGRIPVINALSDRHHPCQALADL
                     MTIYMYSKKPYQSKVAFVGDGNNVCVSLMQVCAAAGVDITVATPPSHRPPEEEVKKAL
                     KVAEETGASVILTDDPREAVRNADFVYTDVFVSMGQEAERNRKLADFLPTYQVNASLM
                     SHAKPTAKFMHCMPMHLGEEVTPEVAYGPQSVIYDQAENRMHTEASLLAYLLRGMVK"
     CDS             157892..158800
                     /codon_start=1
                     /locus_tag="CSUB_C0154"
                     /product="hypothetical protein"
                     /protein_id="BAJ50017.1"
                     /transl_table=11
                     /translation="MDRLSTAGMRYFAVKTTVGQERTVANVLEARFHGIFLDFVGESV
                     GTVAISDKTHAAVIFVSPKTTTLEKVAVYISKAGEPTEPLRAQLLEYSDETGFGSEPL
                     GEGSYDPLLLKTEGWAEIVFRSPVKLKRGASYALKIFKTVEEPGGYNLFLGEGEKEEL
                     RFKVLEQEEWRDDARLPLFKLIEKPAIASIFILPALKGYVFVEATSKEVIADALQNVR
                     HVKARPPMPVKLETIASHLVEKPLIEVLAAGQMVEIVSGPLKGIVGKVIRVEKSRREV
                     TLELKEAAFQLPISVSIDAVRPLDKT"
     CDS             158836..159324
                     /codon_start=1
                     /locus_tag="CSUB_C0155"
                     /product="large subunit ribosomal protein L11"
                     /protein_id="BAJ50018.1"
                     /transl_table=11
                     /translation="MGEKTFRFLVEGGKVTAGPPLGPALGPLGLNVLAVAEEANRLTQ
                     EFNGMRVPIEVVVDTDTKKFEIRVGTPSTSALLASAAGVQKGSGTAGRDYVGDLKFTE
                     IVKIAEKKLQDMRSKTLKAAVKEVLGSCVSMGIKVDGKDPKEVVKLVEQGKYDNLLGE
                     QN"
     CDS             159324..159980
                     /codon_start=1
                     /locus_tag="CSUB_C0156"
                     /product="large subunit ribosomal protein L1"
                     /protein_id="BAJ50019.1"
                     /transl_table=11
                     /translation="MRSELAKTVEALKKAKQNRKNTKFKQSVELVINVTGVDLTKPQN
                     RFSEVIELPNDLGRKRRKILVIASGNLALEASKTPGVARVIQKEELEALVGRKKEAKK
                     IAAEYDFVLVEPALVGLAARVLGAALGARGKTPIPIPPGSDIQKLVKRYENSVVATLR
                     KSPQVACLVGVEEDPDEKIAENVETVLNRVVEKLEKKRRNIASVYVKTTMGKPVKVEF
                     "
     CDS             160038..160901
                     /codon_start=1
                     /locus_tag="CSUB_C0157"
                     /product="large subunit ribosomal protein L10"
                     /protein_id="BAJ50020.1"
                     /transl_table=11
                     /translation="MSTTVTRPSLVKKAKLVEEVAELIRKYPVVAIFDLRSTRANTIH
                     EMRKKLRGVCEIRVLKRTLFVKACRLAGKPELEKLVENIKAPIGFIFSSVNSFQLAFT
                     LEKNKVPMHAKAGEKADFDIWVPETNTGLPPGPILSDFGKLKIPTRIEGGQVWIAKDT
                     LVAKKGEEISQLLASLLAKLDIKAVLRGVNLISAYEDGVILKAEELLIDPVKIGQEIA
                     SAASLALAFAVEISYITRETLPPLLIRAETHARALATEAGFYTKETLPIIFAKALAES
                     SALARAAGVSE"
     CDS             complement(160872..163601)
                     /codon_start=1
                     /EC_number="6.1.1.7"
                     /locus_tag="CSUB_C0158"
                     /product="alanyl-tRNA synthetase"
                     /protein_id="BAJ50021.1"
                     /transl_table=11
                     /translation="MPYDEHEYRFEFFLQNGFVRSRCRVCGEFFWSLDPGRDVCGESP
                     CVEYSFLEKKYCSKPLSVREARQSFIEFFAQRGHAPIKPYPIVARWRTDLYLTDASIV
                     DFQPWVTNGIAPPPANPLVISQPCARLVDLDKIGLTFGRHLTVFEMGGHHAFNYPEKK
                     IYWKSETAEYCHEFMTSVLGVPTGELVYKESWWAGGGNEGPCLEVIAGGLELATLVFM
                     QFKTLDGERAETPIKTVDTGYGIERLAWFSQQTPSAFDAIYGELLAKVRELIPVNRPD
                     EELLIKYAKYTGLVKPGADATVSELRRKVASMAGISVETVNEQIVPYEKVYQALDYSK
                     AIAFIVAEGVVPSNVKTGYLTRLLIRRAYRLLRMVDAEEKLLDLVDLQIRYWEKDFPH
                     LSEMREEVLDIVEHEVNKFRETIKRGTETVLRELRSTKAISVEKLIQYYDDKGLTPDI
                     VAEVAAKQGVEVTVPENFYELVASRHLREKPVKTTMQKQIDVSSYPKTHKLYYEQPNS
                     YSFRAKVLGVENGYVILDATLFYPEGGGAVGDTGTLVCRDKVCTVVDTQILEDVVVHR
                     VEGPVPDVGEEVEGYVDAERRQAIVRHHTATHILLGAVRRVLGKHAWQAGARKEPEKG
                     RLDFYHHKRLTLEQIREIEKLANRVVARRIPVRIKWMDRNEAEETYGFGLYQGGEVPL
                     GVIRVVEIPGWDAEACGGIHCENTEDVGLIKIVSSERIQDGVERIEFVAGPANLHRYQ
                     GMETMLHEVAEKLQAPVEDIPKKVAELDENLRILRKTVKTLSEKLIVYRAAEIRSVGI
                     AVDSLLLYISEEEYDDEEYLIKLAAEIVKVDKPAVALAYAGTPSAKVVAVANDKAVAA
                     GVNVGEVLRKFLQLAGGGGGGSRTLGRGAAPREQLVYNLPELSNLLRNTRGPR"
     CDS             complement(163649..165097)
                     /codon_start=1
                     /locus_tag="CSUB_C0159"
                     /product="hypothetical protein"
                     /protein_id="BAJ50022.1"
                     /transl_table=11
                     /translation="MSKAAAPLMFYMLYLFVIGLVSLTLRFYGIVAGMDLNDFVRALK
                     PLATSGVLAVGVFLGLKGGVTALGYEIDYIFTSNVRPRTYLWSDFLFQFVFLNMFTLP
                     SMILVVTVLTFPRHLVHLYSFVMIVEAAVVSSILLSHLLGLLRNWLGKRGVLAVGGVT
                     LMLVLLPLLDIFTSLPWVNSFPYPPTLLLGMTEGGFKTAAALLLIGGLLAVHLFLSRT
                     IEYAGLAPILTNVFTDPPRKLITSFKLPMPVARFLLINPGDRPTALLVKAHLTRFLRD
                     GSLWITAFVLLLLVYVGSALPRALAFTAQPEAIFLTIVSLYTPMIPALLSFNWLLTER
                     HNLWLVQLSIYRISSYFYTLLIAYVIVSLIFSSVLVAAIQVFGGFIALTYLDILLFLC
                     SAVFGSFLALVISSSVKRFSSPFSFTAIFIVVLPLLGSQLLSLPLLMSRLFAPVATNP
                     PAFLPYLLIGYVLFASALVAYSTKDFSVEPPH"
     CDS             complement(165147..165884)
                     /codon_start=1
                     /locus_tag="CSUB_C0160"
                     /product="ABC-2 type transport system ATP-binding protein"
                     /protein_id="BAJ50023.1"
                     /transl_table=11
                     /translation="MASLVEAVEIWKRFGRVEAVRGVSLRLEAGQVHGLLGPNGSGKT
                     TSLKCIVGLLKPDKGIVTVFGEKPSANNGYRMKLGYVPENPSLPDYLTVQEFLIFSAR
                     LKGLVGDSVRSRVSELMESYELHQVSDRLVYELSKGIRQRLAIAASLVSSPTVLILDE
                     PFNGLDPEAQKVTRLYINEIIEDGGGVLISTHLLDSAEKLCNYVTIIVDGRVLCSSSL
                     SELKAKNGDSSLEEIFLSLVRVKKSAD"
     CDS             complement(165927..166238)
                     /codon_start=1
                     /locus_tag="CSUB_C0161"
                     /product="large subunit ribosomal protein L12"
                     /protein_id="BAJ50024.1"
                     /transl_table=11
                     /translation="MEYVYAALLLHKAGKKIDEEGLKRVVEAAGITPDMSKIKSLSAA
                     LAEINIDEVLKQATAAPVAVAAAPASAAAASKPAEAPAEKPKEEKQQEEALSGLSALF
                     G"
     CDS             166386..167486
                     /codon_start=1
                     /locus_tag="CSUB_C0162"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50025.1"
                     /transl_table=11
                     /translation="MKRVGTATLWLTEGPVPHFREMVELGREIMRALCAQVGYEETVR
                     RFADPFWLSSLACALGFEWDTSGQTTVTLKALSLGLMGTDIPVRVLGGKGAEMRMAQL
                     EAGKLLAEIGVREVGEIRRAMRLTTSVDNAALQDSYDIYFQAAAVSESGQWAIINQGM
                     NTVNKTARRYHWSSDRGLGVEEPHTEILSDTVEDVVLDLTSTTSAETRQTILEVLEDT
                     PPSRLNEDLAQVKAIARKQHTLTSTFEELPTIPKHLSPPNRLDEETIRRAKNVSSFDE
                     LLTTQGVGAATLRGLAYIAALVYGSKVSWRDPVKFSYAFGTKSGKPYPVNRAAMHEAA
                     EFIKQAVMASKTGDETKLTVLRRLNSLLDSNH"
     CDS             complement(167483..167773)
                     /codon_start=1
                     /EC_number="3.6.5.3"
                     /locus_tag="CSUB_C0163"
                     /product="elongation factor EF-1 beta subunit"
                     /protein_id="BAJ50026.1"
                     /transl_table=11
                     /translation="MWKVGLPYMGKVLMVVRILPKDSDTDLDELARAVESKLPKDVRV
                     SDKRVEDIGFGLKALLMGFLMPEVDGVGEALEQYLSTVELVGEYDVQSVTRI"
     CDS             complement(167775..168674)
                     /codon_start=1
                     /locus_tag="CSUB_C0164"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50027.1"
                     /transl_table=11
                     /translation="MRGMRVCGVILSGGVSKRFGGDKALALLNGEPLIRHVAKSLHEA
                     VEEVWLSVRDAERGEQLMKACEPFVKGYIVDEFSAGPLSGFLSAANRLEADVVVTSPA
                     DVPRIKAATFQKLVEKFLHHSASVASVVWGNGAVETLVQVLSVDAVKNYLETVFMYRG
                     GLHRPSDMLRCASKMLLAAGFKLSSDPYEFSNINTYQDLLEPKPRGSGGDRVRDDLLL
                     TESSQHFRQAAAAAAEKRFKESAQEYVSEALVLLSYGVAHLAGHALADAAKMFETGRS
                     PEAALICSRMEAFIRRDMLSGMR"
     CDS             complement(168671..169198)
                     /codon_start=1
                     /locus_tag="CSUB_C0165"
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein B"
                     /protein_id="BAJ50028.1"
                     /transl_table=11
                     /translation="MKHLAIMGFKKTGKTFLATKIIEDLVGDGYRVAAVKHVHHEFTI
                     DTEGKDTWRMARSGASIVTSISPNEMAIIFPKQTHETNRDELLGKIFQEEGIDVVVYE
                     GFAKLYGGSPHVYKILTVRKSEDIGLIEEISPPVVAVFRLENTSLPEIGVPVYGPELS
                     QDFFNHVRRSLGLVK"
     CDS             169500..170174
                     /codon_start=1
                     /EC_number="5.3.1.6"
                     /locus_tag="CSUB_C0167"
                     /product="ribose 5-phosphate isomerase A"
                     /protein_id="BAJ50029.1"
                     /transl_table=11
                     /translation="MFSVEAKKRAAKEAVKFVDDGFVVGVGSGTTVSLILSELAAAGK
                     KIVIIPASWQSYYEAIELGLMVSSLDQHPCPDVYLDSFDQVTRDGAMIKGGGGAMLRE
                     KVLASASRNRVFVGDHGKLVEKLRRPVPLEIIPFAYKFVENRLREKGVKLVMRTSQAK
                     NGPTVSDNGNIIGDADFGEIDEPAQVEKFLKEIPGVVESGIFMGLVDTLIIAHDYGKV
                     ERLTFR"
     CDS             170207..170791
                     /codon_start=1
                     /locus_tag="CSUB_C0168"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50030.1"
                     /transl_table=11
                     /translation="MPDLNQARMIGGIGSILLVLTIVPNVGPVLSIVGFILVLLALKY
                     VSDTVQQPAIFQNALYAVIIGIVGAVIAMVLGGAALFAAVGPGFGGGFGDGVSGDFFS
                     LLAGVVVALVVVWIFAVVSAFFLRKSLYLTSDVLGVKLFRTGGLLLFLGAILTIILVG
                     FILSLVAYVLLAVAFFQIPQTGGQPPPPPPPPPP"
     CDS             complement(170788..171507)
                     /codon_start=1
                     /locus_tag="CSUB_C0169"
                     /note="transcriptional regulator, TrmB"
                     /product="hypothetical protein"
                     /protein_id="BAJ50031.1"
                     /transl_table=11
                     /translation="MEKLQKVFGFNKYQAKAYLAVLQGYSKPADVARKSKIPITRVYD
                     VLSSLCENGFLTRTSDGYRVTEPASAFTFWLERERARIESLMMEKKRMVEQIIPTVSR
                     LRERGAVENEAAILRGLQPVVVKLREMVDSGTRFVFAVKKAVKLKEEFKKVVAAFPEK
                     KFLFILHPSVQMGKDDYEFFESIGARVFFSEGVLLDVLVTDGGEAVIGLPLDDEPVVV
                     WVRDRGFASSLMRSLEALASS"
     CDS             171581..172285
                     /codon_start=1
                     /locus_tag="CSUB_C0170"
                     /product="ubiquinone/menaquinone biosynthesis
                     methyltransferase"
                     /protein_id="BAJ50032.1"
                     /transl_table=11
                     /translation="MQRREYGLGPDWRTVMRSLEKLAPMYDRLNKTISFNTDIRLRAE
                     CLNGNVGVLDRVLDAGSGPGVFTETLLRTQNWRGEVVMLDPLPSMHMLARKKVPQNIS
                     HQVVAVFEQMPFRDGVFDTVLMGFSLRDAANMAKALTETRKILRKGGRLLVVDLGKPA
                     NILKKIAIGVYWALLAPLLAALKLGKTGLEAAAIYLTYRRLPTNKELKYLLKTFFETV
                     EVGEKMLGGVVVIRAC"
     CDS             172325..173782
                     /codon_start=1
                     /locus_tag="CSUB_C0171"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50033.1"
                     /transl_table=11
                     /translation="MANTELEKTLFPTGHQVFDRIVYFRHGMTVLVTDETFSEARAFL
                     RTLLKKHQQSIIELVSTRNPQTEQVPVPIEALQDLSINVNQKRRAEKNRIFIHNYLPE
                     LLIRHNGDEVLKLLEMWQKDVANAGNLEFYLLPRNTFADFEKKAKAIVDAVIEIHVVK
                     ENNQFLYYFTPIRSCSQAHHLKNIRYEIKEGQLLIEWENILISDLPAEPISRKQLRDQ
                     LESNEDRILIKLGKIDPRNFTVEDYALLTSLDNIRLLDAKLLFPDRWPEVFDKIIEWI
                     LAGALKTEETKPAKKYARRQKLKFKNKLLLNVPTRLSLMLVSLSKGFLGKRVRTVPLD
                     AHLAVLEAVKNIVDMLASDRPEIRRDARFATRYFGELSARKTALEYIMRLEGTPYTSF
                     SVKHVPSLISITLKAGWGLDVNFITSSGEIWLFEVRNCHLCGDAVSDEPFCDKFVSSV
                     VVGVLSVCLKRRFECFEVSCKAVGNESCIFKAYKV"
     CDS             173784..174641
                     /codon_start=1
                     /locus_tag="CSUB_C0172"
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="BAJ50034.1"
                     /transl_table=11
                     /translation="MRVKMSKYFIQKMIGFATLPKSYFSLFTSTFMASVTIMIITGEG
                     LLDLWVFWLYFFLSTAFLNSFNNLMDIKSDYITKNNFPLPSGLISPREASLFSAATLI
                     AAVATLIPILEVNASAAGILLIDLLIGYFYSAPKIRLKRYPVLKATMLIIHTAILPLI
                     VGLTLANKSIADYLAIVFPVYLMGLAVHTLQDIGDVVGDVLMGDKTFPSMLGMKNSVL
                     LTVLLFMLAAIFTWLVFDASYRILIMFLFFSQIVLSMLLFIRVNLWKIVYWSTALIAF
                     LIMVLLLVK"
     CDS             complement(174634..175794)
                     /codon_start=1
                     /locus_tag="CSUB_C0173"
                     /product="hypothetical protein"
                     /protein_id="BAJ50035.1"
                     /transl_table=11
                     /translation="MTQNSGEGLDYFTKAAGLVMLRYIAGNRRNLSEMLCIIREASDY
                     FGKTMENILGGEETASLQELMDLGVMKKKYLPYSSYMATISAYPLLHKKATRAQIFST
                     VLAKMALIISIKVLDNINDTFHTTEEAEQSLQRQKKAIEEGIYISAGNNDIVKRAENS
                     CTLLALLVNKWLKSLPDTILTARKEFLRDLALYISGQGATFKQQNSIDREKLTIRDYL
                     KNMNEKGVGRVWVGLDLCMLESLCERTKEEIKGFGYLRKGFDYVFKSSNYYDDVADLS
                     VDIGLGIWNSVVYLGRDLAIITKPEESLKNNFLKRQTIRLGDLHFLRGLDLLRQAAKY
                     VEFDEKSLIASMNVFRFFTVRKWFFQSKNPADFVDFLVARVPDRLMRYAHII"
     CDS             complement(175827..176705)
                     /locus_tag="CSUB_C0174"
                     /note="Probable gene remnant of circadian clock protein
                     KaiC"
                     /pseudo
     CDS             176734..177468
                     /codon_start=1
                     /locus_tag="CSUB_C0175"
                     /product="hypothetical protein"
                     /protein_id="BAJ50036.1"
                     /transl_table=11
                     /translation="MLPQPPLTPLEEEGDDVAVLGSPAPYLNSLLVIAVMFLGSLAML
                     WLIRFRRALAVIVSVVLFTTAVSVTFLLLFVSTSLGEELLAAVSILVGGMVLAGVFSR
                     KGLFNVLAAAYVASASGVVFGSSLPFWTSLVLLAAVSVYDVVAVFKGHLKRLGDMDMA
                     ELRGLVVTFEGFSIGLGDLFFYSVVLSFSVNNLGWLPGIAASAGLIVGYLATIKLAET
                     RPVFPGLPLTLLAAMGFAFISYLIPV"
     CDS             177465..178340
                     /codon_start=1
                     /locus_tag="CSUB_C0176"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50037.1"
                     /transl_table=11
                     /translation="MKTMSPEDAARCCTLGLLLELATSPKPGLVDRLSNPDVYACFTA
                     SAVALYPCFLKAAQGTSVGDAVLCSTREMMSWQKGGNTHLGSLLLLTPIAKAAVEAGK
                     IERLRGSLEKTLKQMDYRDLHKILKAIKMVGPGGLGKVAYLDVNNAKTYNLVKQRKTS
                     VIEAFNPYAQWEVVAHEYCTNYQASIMHGYMFLRKRIEQEDWNTAGINTFLNILQHLP
                     DSHVSRRQGRHAAKILSRMAKQVLDAGGVGTEEGGRRYTQFIKHVKRAGMKPAAAADV
                     LAVSYTLLLLSGWRP"
     CDS             complement(178345..178635)
                     /codon_start=1
                     /locus_tag="CSUB_C0177"
                     /product="hypothetical protein"
                     /protein_id="BAJ50038.1"
                     /transl_table=11
                     /translation="MGPLWLINILISLMIVTGLLYSLRNYLLTRKYARTKFTNALVAL
                     TSVFLIQHLYAAYVFYMMSVSYSEEMHIATPLLMLNVIGFAGFTIFIYLSRT"
     CDS             complement(178617..178946)
                     /codon_start=1
                     /locus_tag="CSUB_C0178"
                     /product="transcriptional regulator, ArsR family"
                     /protein_id="BAJ50039.1"
                     /transl_table=11
                     /translation="MSDRPIKTFFRWVLLGTRGGPTRLLILLKLRDGPANANQLAKAL
                     HLNYKTILHHLEFLIENNLVEADEGRYDVKYRLSQVVSENMDILDSVVDEVLGSSKAR
                     VSWARSG"
     CDS             complement(178975..179769)
                     /codon_start=1
                     /locus_tag="CSUB_C0179"
                     /product="cyclase family protein"
                     /protein_id="BAJ50040.1"
                     /transl_table=11
                     /translation="MKIVSSAKVYDLGQPYFNGMPVHPEDPPYSMVIYRYHEYTKKLF
                     EKVAPGFSDSMELVITSMHSGTHIDAKCHMARNGLLYNGVKAAEIVKHSGYTKYGTEE
                     IPIYVKRAVLLDIPASKNLDILPPRYGITAQDLEQALKLQKTEIKEGDAVLIRTGYSR
                     YFTTDKEKYLHDFAGITEESAKWLIDRKISLLGIDNLAMAVPKPFTVHLMFLVDAGTH
                     VMKSLYLEDMARDKAYVSVLVVTPLKIVGGTGSLVRPIALVYEGKA"
     CDS             complement(179815..181017)
                     /codon_start=1
                     /locus_tag="CSUB_C0180"
                     /note="CoA-transferase family III"
                     /product="formyl-CoA transferase"
                     /protein_id="BAJ50041.1"
                     /transl_table=11
                     /translation="MKPAAPLDDVSVLEIGTAIAGPLCGAILAEMGAKVIKVEHPSRG
                     DDARHFGRIVKGESLYFFNYNRNKLSLAVDIKKKEGLAIVKELIRRVDVLIENYRPGT
                     LSKLGLAYEQVKRLNKRIIYCSISGFGSHGVYRDFKGYDVVVQAMSGLMWMNREQDAE
                     PMRLPAPLTDILAAYSAATAVCAALHLRKRLKKAVKIEASLLQMGLAAVSQWLVDTWV
                     TKEEVKPFGNKYPALAPYEPFRTKDGWIVVAVGNDEQWLSLCKATGRLDLMQDERFRT
                     NQDRINPNNRSYLASELQKTLVERTSKEWVTLFQKMGIPAGPVYSLTDVLNDENLSSL
                     GLFSPTRHPTIGEVLAVRLTAFFQGFTAYQRPSPRLGEHTENILKELGYSSRKIHELA
                     NKGVVKTT"
     CDS             181086..181883
                     /codon_start=1
                     /EC_number="4.2.1.55"
                     /locus_tag="CSUB_C0181"
                     /product="3-hydroxybutyryl-CoA dehydratase"
                     /protein_id="BAJ50042.1"
                     /transl_table=11
                     /translation="MTEYKHIIYQKFPEDKVAVITFNRPEARNAMSVAMLTEFNDALH
                     KAADDPEVWSIIVTGAGDKAFCSGGDAKEFLANVEAGKISEIEKFNRFNLDVWRFMEK
                     MRKPIIAAVNGFCNIEVIQAVDLVIASQNAKFGLPEVTIGVSPGAGITVRLPRFLSKY
                     WAKYFLFTGEWVSAEEGYRLGFVNKVVPHEKLMEEAMALARKINKNAPLAVGATKACV
                     NLGGEMPIDEGMEYQLKESILMFYTQDLKEGIRARFYEKREPRFTGK"
     CDS             complement(181884..182468)
                     /codon_start=1
                     /locus_tag="CSUB_C0182"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50043.1"
                     /transl_table=11
                     /translation="MQRQKRYEDYGYVLDVFPAQQRAGFQKFHHDKNEYIVQLLGEDF
                     FTLLEVAVNEKFKPKPGTKLYIGRDVPREILRIVRRIDYTDLTETSIANLEPAVYKIV
                     EEHPQRFLDFINNSGMLTPRMHALELVPGIGKKMLQKFLTERDNASFTSFEDVKNRTG
                     LPNPVEAIVKRIVQEIKNKDEKYRLFVREPSPRE"
     CDS             complement(182482..182838)
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /locus_tag="CSUB_C0183"
                     /product="DNA-directed RNA polymerase subunit F"
                     /protein_id="BAJ50044.1"
                     /transl_table=11
                     /translation="MARKILSKTEVPMATVVKLMEQRAEDLNSLQTRVYTYAKKYAKL
                     SPDQAELLVQKLMTDVGLTREEAVQVADTCPRNVEELRAILSGYKRLVSFLLFSEEKM
                     RTVVKLVEDAVAGRLQ"
     CDS             complement(182842..183129)
                     /codon_start=1
                     /locus_tag="CSUB_C0184"
                     /product="large subunit ribosomal protein L21e"
                     /protein_id="BAJ50045.1"
                     /transl_table=11
                     /translation="MPQSKGFRRKSRGYLKKPRGSRSGPRPDIYLREYKPGDRVLLAI
                     EPSVQKGSPHRRYHGKIGVIVEKRGRGYVVKVGDEEKTLSILPDHIRGVVN"
     CDS             complement(183173..184492)
                     /codon_start=1
                     /locus_tag="CSUB_C0185"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50046.1"
                     /transl_table=11
                     /translation="MDKLSTILDDVLLLLRSEALCDYCLGRQFARIHHEVSNREKGRI
                     LKIALLLDAVKRRDMDTLFVLASNGGLDEAVKYVSEAGRSVEKRVCGLCHGVLDETVF
                     RKAAEKAAELLHDIEFETFLVGAKASGDVVNTEDRLRALAGLTEGENIRNEIKREISR
                     VFANITGKKLDHSSPDVVITVDLFRDKVEAFPNPVFISGRYLKHSRELPQSPWHCKKC
                     WGRGCQECGYTGRLYPTSVAELVGEPAKTLYQAADYKFHAAGREDVDALVEGEGRPFI
                     LELKRPRRRNIPLDQVQQHINTNTQGLVTVYLEAYTTRRQVRQIKLAASTAAKTYLLK
                     AVYDADLNPDKVKELETRFRNTVVEQLTPLRVLRRRAEKLRRKTVYSVEAELVDSRTA
                     LFRINCQGGLYVKELVTGDGGRTKPSFADVLGLVPIAMELTVLKVEA"
     CDS             complement(184485..185885)
                     /codon_start=1
                     /locus_tag="CSUB_C0186"
                     /product="signal recognition particle, subunit SRP54"
                     /protein_id="BAJ50047.1"
                     /transl_table=11
                     /translation="MPQRALFKRGMFNTILGVCLFDGMSSFSSMGRSLKEVFRKFLAS
                     PSADKSSVEELVRGIQRSLLMADVKVELVQKISERIRARAFEEKLPPGVSRKDSVAKI
                     VYEELINLLGGKPAQFSTGGKKPYVVMLLGIQGTGKTTTAAKLANYLKVGGYKVGVVC
                     ADTYRPAAYQQLKHLLEPRQIPVYGEPENNNPVEIARKGLEHFKQMGVDVVIIDTAGR
                     HRQQESLMDEMKMLEKELKPDENILVIDGTIGQQAGAHAAAFHKATPVGSIIITKLDT
                     SGRGGGALAAVAETGAPIKFVGVGESVEDFQPFNPSSYIASLLGMPDIESIVERVKLA
                     ELTADEKQFEAILKGKFTLEDMVEQVNSLTKLGPLKKLLAKLPFPGIDALPDDQLEKA
                     QDRIRKWNAIIKSMTAEEKNDPSILDGSRIRRIAYGAGVLERDVRELLRSYQASKKMM
                     KSRQLRQLLKSSRGLG"
     CDS             185854..186810
                     /codon_start=1
                     /EC_number="5.1.3.2"
                     /locus_tag="CSUB_C0187"
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="BAJ50048.1"
                     /transl_table=11
                     /translation="MPRLNKALCGKSLMKVLITGSEGFVGRHLREYLGGRGFVVVGAD
                     ISSGADIRMDVTDFDSVLKTFEQNRFEAVVHLAAVADIPLSMRDPHRCFKVNVYGSLN
                     VLEAARRMGVRRVVVFSSANYYGAPVKLPVTEDTPPNPRTPYDYSKVALENVAWSYHR
                     NHGVPLTVLRPWKAFGEYEPGEKMVPRFVKACLASEPIPLFNGGADVTDPYHVDNLCH
                     AVELGLIKDEAVGEAFNVGTGNALSVRELAEKIKQLTNSSSKLESLPPRTPAEATPMK
                     SIPSIKKIATKLGYTPQVSLEQGLKRVINFIASKQQNTNTGR"
     tRNA            186801..186874
                     /locus_tag="CSUB_T07"
                     /product="tRNA-Ala"
     tRNA            complement(187064..187138)
                     /locus_tag="CSUB_T08"
                     /product="tRNA-Met"
     CDS             187200..187952
                     /codon_start=1
                     /locus_tag="CSUB_C0188"
                     /note="MOSC domain-containing protein"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50049.1"
                     /transl_table=11
                     /translation="MAEFRVVRLFRYPVKSLLGEEVADVDVSFEGFDGDRLFAVVDPV
                     TGYALSAKGEPRLLQIGATLVDGELGLIFPDEVVRDNYDEKLTNFLRRPVRLRRNTGT
                     SLRFRGLEIDFEKGVVFEKTGETRETRFHDSMPIHLINLRTLEKMGLSIDEAARFRPN
                     IVFSAEQNDESLVGGYLDTGEALLKIVKPTRRCIVITHQQKNLSRNLDLLRTLRANSE
                     GRFGLYATVVKPGKISVDARLRFYPAETHHTT"
     tRNA            187952..188025
                     /locus_tag="CSUB_T09"
                     /product="tRNA-Gly"
     CDS             complement(188007..188990)
                     /codon_start=1
                     /locus_tag="CSUB_C0189"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50050.1"
                     /transl_table=11
                     /translation="MVSIVGPAVDGKGEGAKEGGRYTLRELRMEAFDLVQQLHEEGLS
                     YTQIIDEVERRLGVKIGKSNCSYWVRRIHSPYNGIYIGSIELLQPTEDLAYLIGTEAG
                     DAYATKTDEGTRGEKYIIGLKVKDKEFADEYATRIARVLGRDAPEPKPNKDGRWVVRI
                     RSKVLYQLFKKPIDIDRIRPFVEYSERCVAMFLRGFFDSEGCVDKRGAMTVYNTDYQL
                     LLYVMYLLKKLGIETTSDTPKIKTRGGTSFKDPKKGKTYHHNKDYYYLRIRMPSNETF
                     YNWVGFTIERKKRRLEEYLRRRGRLPPANQPPIFSPMHIVKALPANAAGGI"
     CDS             189359..190729
                     /codon_start=1
                     /locus_tag="CSUB_C0190"
                     /product="gylcosyl transferase group 1"
                     /protein_id="BAJ50051.1"
                     /transl_table=11
                     /translation="MMCFWCRMRMLVCSQTPLVRFLGDGWAGQEFVDVSRLVEGVDFI
                     FSPGGVTRMVYPLIMRLVENDVLDEGHWLSLNTNGPRQAILGPVRLYFVKLGAEALRG
                     YGAAKEEMWKLLHGVQDERPLSLLELAWTDEYAYYNLYNRVCSETALALDRELDFDLF
                     YIHDFQQLPMGEMMGTLKPKLFRWHIPFNEEAIPPEWSGFLGRYLNAYDAVVVSSKSY
                     METLLKRGYVGRAFYVYPYIDTSQYGTPTKSDLQQFADKHGLGEDDGVISIVARLDPL
                     KGHDRALKALAKVVKTHNVKLLIVGNGSFSSSKKGLGLSKGEAWRTYLQTLVKNLGLE
                     KHVIFTGHVSQKELECVYTLSDFTVLPSVAEGFGLVVVESWLFGKPVVVSKAAGIAEL
                     IVDGVNGYLVGPDDVSGLADRMRTLLENPSLTEEMGKNGRETAKLCSLERSLEEEKRI
                     IEEVVG"
     CDS             190726..191493
                     /codon_start=1
                     /locus_tag="CSUB_C0191"
                     /product="small conductance mechanosensitive ion channel,
                     MscS family"
                     /protein_id="BAJ50052.1"
                     /transl_table=11
                     /translation="MISLELPELTAIVTQLTMVAIMLLVTAFAARLISSVIRRLLFKA
                     PPLINEQISRGASIFIWLVGLLFIVNQLGLNLDILLLLMGLAGVAAIIAARDILSNIS
                     SRYLIGSFIPFNVGDEMQVSSFRGKVVEINPVASLLLSEEGTLAVVPNSVLLKEISLN
                     LSPYASRRITISVHVPQEVNVPDAEAEVLKLCNKYRSKLDQRFPPLVSVKSSGQADVV
                     LELVLLAAQPEKRNELAAELGAKISELMEKMRMSQRK"
     CDS             191548..192435
                     /codon_start=1
                     /EC_number="3.4.11.18"
                     /locus_tag="CSUB_C0192"
                     /product="methionyl aminopeptidase"
                     /protein_id="BAJ50053.1"
                     /transl_table=11
                     /translation="MSAPEPLFRAGEVARRIRMAIPSLVSPGASLLQIAEQVEKMILD
                     NGCQPAFPCNVSVDSVAAHYSPIPGDTSTLHRNFIAKIDFGVMVDGYIADTAVTVTDT
                     AVGEMLKTAVEEALKAAVKTVAAGVKVSAIGSVVQNVLTRYGVKPIRNLTGHEIQRYN
                     LHAGVSIPNIASGEGAKLQEGHVYAIEPFATVADGFGEVIEHRTATIFRLWKTFAGQV
                     SSPESNLLKTLSERFNGLPYSPRWLTDLGPDALSIHQRLVKTGRVKAYPVLVERLNKP
                     VAQAEHTVLVEKDGCTIIT"
     CDS             complement(192428..192604)
                     /codon_start=1
                     /locus_tag="CSUB_C0193"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50054.1"
                     /transl_table=11
                     /translation="MPEPLTFLKCLNCGVENSRPFRENDYVLKIVEDEKCPKCGGTRS
                     RIINIYVPEKKESK"
     CDS             complement(192646..193794)
                     /codon_start=1
                     /locus_tag="CSUB_C0194"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50055.1"
                     /transl_table=11
                     /translation="MTVLFAALLNPSTGGDNILSLLLSLVWFAFLMIFFLYPSFGQRM
                     QLSYMLRDLEKKLNKLKLIKDEINQITVETIKRVGKPEKDPAPDINRLSEFFIIQPES
                     MDPYGLVYKLEHILETGESVYEQEVAKLAPHATEHQVKSLTNLVEVLRGINTIYRVVR
                     HYYLLGKKTANIYMVLQIQMVLPQIIEIAESYRQAAVAFSKGQPIGDGVGPLVAAKLV
                     NGMEKERYEIAKDTVVQEIELENRKVYVVRAIGPGGTVGRPGEGVKQLVERLPENPKL
                     IITIDAALKLEGEETGKIAEGVGVAIGGPGVDKYKIEELAKSRGIPLYAFVIFQSITE
                     AITPMRESIAKAADQVLEKVKQLILEKVKSGESVVVAGIGNTIGVGLG"
     CDS             complement(193818..195638)
                     /codon_start=1
                     /EC_number="5.99.1.2"
                     /locus_tag="CSUB_C0195"
                     /product="DNA topoisomerase III"
                     /protein_id="BAJ50056.1"
                     /transl_table=11
                     /translation="MTSTSDKDTMDGEKLIIVAEKASVARAIKAVVSAAKANAVVSSV
                     RGHMMEADLPDGYEWGAKHPFEIIKLRKVVDKISDNRVFEQLVKVFSGGGVLVIATDN
                     DSEGELIGYEILQVYRRVTGGEPVVYRMRFNSVDRRELFASLRNLEKGLNMRWVEKAR
                     FRQIFDLVTGAAFTRLLTLSTRRLAPVRVISWGSCQTPTLNFVVEREKEIQQFKPQKY
                     WVIEATLRKASGEEFKAATQQIWNRDEAEQVFEKARKAGEAVVTSYTKSEKTLPRPLP
                     MRTDDVLRDLTRITGVSANRLLSMMEELYAEGYISYPRTDTNRYRRGFDFQTPLKAVT
                     AADALRDAKPDKAEPDPRNGSRDDGAHPPIYPVATFRGSGVLMQIWEYIACRFYANAF
                     FDDAVQSTAKAEIGIDGIAFSAEGSSVTKQGYLQVFSYFRPRDKPLPELMVGEKLQII
                     DVTIREDETKPPPRLTEADLLRLMEKNGIGTDATRASFPQLITERNYAVRAGRFFKPT
                     PLGMALIESLAEADTRLITPETRRLVEDYMAKIERGETSFQESLEQSLSLYEELLRRC
                     SDKIDEISRRLAQHVKPFARKRQRKKKGEPSLMNSNKLNK"
     CDS             complement(195642..196172)
                     /codon_start=1
                     /locus_tag="CSUB_C0196"
                     /product="hypothetical protein"
                     /protein_id="BAJ50057.1"
                     /transl_table=11
                     /translation="MARQPSAAGRWVKGYVSGLVARAVSDGVVYFFTLSTLEGEDVVF
                     RMRQPPEWMYTGTPVEGFLVKADDFFQIQDLSQAAELAQPRVVEVDRCDVDYVGAGPV
                     KKPVVTGSAGRMVISAPAITMGVARKAEKIGYSRCVLHVADLATGARIVAVQTPQEYR
                     IDTSMKKMISMLRRGE"
     tRNA            join(196258..196282,196304..196352)
                     /locus_tag="CSUB_T10"
                     /product="tRNA-Phe"
     CDS             complement(196513..197313)
                     /codon_start=1
                     /EC_number="1.1.1.100"
                     /locus_tag="CSUB_C0197"
                     /product="3-oxoacyl-[acyl-carrier protein] reductase"
                     /protein_id="BAJ50058.1"
                     /transl_table=11
                     /translation="MSSPPLTELISLKGRKALVTGAASGIGRSVSERFAEAGASLVLV
                     DINEPSLTSVASAIKDRYGVEVEAKKADLSRKREIDELWAGLKERAPDILVNNAGIYE
                     FRDFLEVDEDFLERTLDVNLKSVFYMCQHMVRTRGDRGGVIVNVSSIEAVIHLVKGLT
                     HYGVSKIGLVGLTRALAREYGGKGFRVNAVMPGGIHTPGTDKVRNEALKRLQLGFFIT
                     GMNFISRIPLKRLGEPDEVARVILFLASDLSSYVNGSVLVVDGGYLTD"
     CDS             197412..198083
                     /codon_start=1
                     /EC_number="2.1.1.63"
                     /locus_tag="CSUB_C0198"
                     /product="methylated-DNA-[protein]-cysteine
                     S-methyltransferase"
                     /protein_id="BAJ50059.1"
                     /transl_table=11
                     /translation="MCMLMVHFFNGPGKVSHVFDACVWKNGAGLKIIGWSCVVVFVRE
                     VVSVDCLMSPIGLVCFASTRRGVFRVVWGVGMNAFVRVLVREGVVVGDGAAEVNDLVK
                     RQLGEYFEGVRRVFNVPIDLRVAGFAGKVLNVVASIPFGEVRSYRDVAVSVGSPKAYR
                     AVGNAVARNPVPIIIPCHRVVKSDGSIGLYGGDENVKAWLLRHEGITLLPERLPALAR
                     LKIVK"
     CDS             complement(198371..198625)
                     /codon_start=1
                     /locus_tag="CSUB_C0199"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50060.1"
                     /transl_table=11
                     /translation="MGVNVRIVYCVPCGHLPTALELAKNLLSRYGQRLNKKFSVTLDT
                     SDGGTFEVYIDGERIFSRHEARRFPTLDEIAEQVDKRLNG"
     CDS             198766..200670
                     /codon_start=1
                     /EC_number="1.1.99.8"
                     /locus_tag="CSUB_C0200"
                     /product="quinoprotein alcohol dehydrogenase"
                     /protein_id="BAJ50061.1"
                     /transl_table=11
                     /translation="MRKCLRVSNLAMCGEIINARALLYPLFMVLFLKMAAAVLMALVL
                     SYYNAHVGDGDWPNMNHDPYGTNYSPQQKITKDNVNRLDVVWSIEIPRFMDGLGYGVI
                     GPPLVIDGVVYLATNTPSILAVEASNGRILWEYRPRLQKIPLTPPHIHGINYYNGFIL
                     YPSPDCSIKLVDASTGTEKASIDSICDNVPGNAGDYSVEAAPVMDVERNIIVWGPSAA
                     GGTASGRGFVAGFSLNGTMLWRLFITPPAGGDQLWDFRYVVERGGRFFEGRAKGNVEP
                     MLGDWGDLGLRDGRTRAGAGLSFGHISVDSESGVAYVSTSNPKPDWNATYRPGPNLYS
                     SSVIAINITTGDMLWFYQVVSHDFYDHDCAWNTVLAKTLNMVIKGCKNGELVALNASN
                     GDLLWRFNPQSLVKTIQPSIMKRWHNDPSDQSFLQCPGAFGGIESDIALAYGKVFVAV
                     MNLCTVHVPTPVEQYGEVVKGSVYNIAPTPINTTIYAVDLSNGEVKWSFFVDSAYRGW
                     LTATGGMVIASTVNRGMIFLDAETGKPIHSISLDGTLRTGAVVGRDGEGRYVILQLVE
                     KQGQFGETGSKQFLVALSLGEERTEPWAITLIFIAAAVTLVFLKLRLRKRWTKLTPVS
                     RLRKHMVLRG"
     CDS             complement(201545..202153)
                     /codon_start=1
                     /locus_tag="CSUB_C0201"
                     /product="hypothetical protein"
                     /protein_id="BAJ50062.1"
                     /transl_table=11
                     /translation="MDGRRILLLALAGAVLFGSASLTLDQSPFKLRPLKTFYVVAYYW
                     GYVFYDENFNEIPYMVVNRGDEVVINLIPAYVIIRDPVLSSREGRYVEYENRTHRKGI
                     GELPPGDPRISQEIVKAHLEGYSDHGLFIEGYNMGTYTCSKCFGGEHKVRDFQQVLQD
                     AAEAIGSLRFVADKPGSYTIYCQIYCGYGHPFQRMENAFIVK"
     CDS             complement(202163..202639)
                     /codon_start=1
                     /locus_tag="CSUB_C0202"
                     /product="hypothetical protein"
                     /protein_id="BAJ50063.1"
                     /transl_table=11
                     /translation="MKAKTSLVLFATIAAGALILAVAQLQPSLALSANGGQKQPASLE
                     TIFSTLNGKTPNEVYEEIDRLTDSEYQTLLNSIKPRFSAAPPFRCTPDMGTRLCELLS
                     RSSANGVVEPWEFCFNEPIDAGCPAATFCDAYSGRCQSSQGPCFLDQARQNFERGG"
     CDS             203212..204324
                     /codon_start=1
                     /locus_tag="CSUB_C0203"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BAJ50064.1"
                     /transl_table=11
                     /translation="MRFSETLLDVLNLVKKFGRVIAVDGVTFNVEKGECLALLGPSGC
                     GKTTTLRCVAGLEKADMGEIRIGDRVVFSKDTFLPPEKRGVGMVFQSYALWPHMTVFD
                     NVAYPLKIRKYQKTEIKNRVSHALELVGLAGFENRYPSQLSGGQQQRVALARAIVYEP
                     SLILLDEPLSNLDAKLREKMRVELKRLLKKIGLTTLYVTHDQEEAFVIADKVAVMNNG
                     KIMQMGKPLEIYERPINSFVAEFIGRANLIEARVVERGDNSGMGLISLRKLGDIMLQC
                     RVPEYIGTECIAVIRSNEIAIRSSGRENGLNTLTGHVSFIEFRGQYIDLRVDVGNGVE
                     MVVSTHRFCGVANIEELSVGKKVHLYIEPDAITLTQ"
     CDS             204401..205345
                     /codon_start=1
                     /locus_tag="CSUB_C0204"
                     /note="sulfonate/nitrate/taurine ABC transporter
                     substrate-binding protein"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50065.1"
                     /transl_table=11
                     /translation="MEKILMPSVFSILLTGERILLGFNKFAFHWFFPELVALEHGFFG
                     ENGLRCELVELRGGGVEKSDLYVDALRTGKTDFYHCGEWVGVVRVLKNTAGKIVAQSK
                     PAPGTLNSSFTIFVRQDSGISSPRDLAGKSIAVEAGTGSFYAARMDLEPYVKSEEIRL
                     ISVSEPHARLKALMDGRVSAASLLGPWTKIAVKLGLKPVLTTKRDNPTLLIVSDRLGD
                     ETVVRLIKSINKAVEKINSDPSAYSDLYMDYLRQVVDEGGLDSRWLDSLDKDSLVDRW
                     STWEPYSYSRLYQVSRWMLERGLVSTVPDNNVVRSLRI"
     CDS             complement(205342..207036)
                     /codon_start=1
                     /locus_tag="CSUB_C0205"
                     /product="iron complex ABC transporter permease"
                     /protein_id="BAJ50066.1"
                     /transl_table=11
                     /translation="MRLKQYTPRLLTYIIFTIGGFLVLQPAAFLFFGTVWSSAPGKPG
                     HLTFSNYIELFNDKYLGTVLLNTFVFAAGSALLATVVGSTLAFLASRTDVFFKKTVVY
                     ASLITFAIPSSVESIGWTYLLSPRTGLVNMAYMRLTGFEEPLVNLYTLQGMTLVMGIN
                     LTPVALMITAPTFTLFDRSLEEIGRISGGGLFQVYKRIVLPLSAPSIASAFLYCFIVA
                     LEAFDTPAIIGIPSGVYVITTTIYSQLVSEVPPRYGSATAYATTLLTISILLIIVYNW
                     FSKKADRYETLTGKTGIVAELSLGKYRPLGTLILIGYLLIHPIPLIATLAAASFQKYW
                     NPEYLFTNITLDNYIKFFNYPTTSQAFVNSLVVSFSSTALAVGIGFLGTYFSVRRPIR
                     GGRALTTLLSIPLAFPPIVLAVGIFWSVIYIDIGLYGTIWALVYAYSLRYIPLVIRFL
                     SGSLLQIHRDLEDSAIVHGGGVFTTITRITIPLLRTAVSSAALYVFIRTITDLGVAVL
                     LVTHNSTVLSTTLFALWNTGEKLTVVAGGLIYTTTLMCLLFIAHRFGFRIIREKTI"
     CDS             complement(207043..208392)
                     /codon_start=1
                     /locus_tag="CSUB_C0206"
                     /product="iron complex ABC transporter substrate-binding
                     protein"
                     /protein_id="BAJ50067.1"
                     /transl_table=11
                     /translation="MVKGPAASILMMFSLVFKCQKNYDKRNINNTILQRFMAGAAAGK
                     TPLLIAVVAVLISLLAAGYTASSLQMIQSDASSAAVRQIQPKIDYLQSRLDSLEKLII
                     LYAKAAGIESPQQAEKIIAEREETQAKIEAARRESGKLVVYGSVDYADIKSTLDAFQA
                     KYPFIQVVYESMRPPEVYTRVTSEISANKPTADLVVISHTTGIRLAQEKHYLPYVSPS
                     AASYPEMLKDRNGEWTAFVLLPIAFAYNTDKVKQPPSTLDQLTDPQWQGKVIMHDITL
                     GTVGTQYLVTLKNIIGETAWNRFIERLATNVKPVLDISTATVAEKVASGEYYIGLIAN
                     LHDIVRLKMQGAPVDYFLPSEVPLLTTFAHVAIINTTKNPNSAKLLVDYLLSQEGQTI
                     IGNTPVRFPARPQTPAKFTIQNFFPPTLKIVNYPDEEAIAKARDWATRFKDMGFGAK"
     CDS             208367..209074
                     /codon_start=1
                     /locus_tag="CSUB_C0207"
                     /product="hypothetical protein"
                     /protein_id="BAJ50068.1"
                     /transl_table=11
                     /translation="MLAAGPLTISQLAFRLGIPRQLVHYHVKHLQSEGLIRVKDVVKT
                     GRRVSSKAYMLKQGAVLAVADPYEVEKVSAWLEHYYVRNVRNMSKKSRTAKNPSIELP
                     LFFYHLMRLCSNPGMDAGGLFRIYGERFAEDVIIKNVHPNDSRGSGFKMFGKALLLFK
                     EFASANLAMMNENGLIHFRAFLGSDVYDSRVDEFIHSVLRRLVNAYLGGRFVVHKFPP
                     NGKTYSYIIKRTGVKEL"
     CDS             complement(209061..209687)
                     /codon_start=1
                     /EC_number="1.3.3.11"
                     /locus_tag="CSUB_C0208"
                     /product="pyrroloquinoline-quinone synthase"
                     /protein_id="BAJ50069.1"
                     /transl_table=11
                     /translation="MKLFYNGKLTPQQVRGWIINRYYYQRQIPVKDSIILSNITEPVS
                     RKMWLQRMMKREGLGAYRGDVEGWAKFAEAAGIASTTLEKMDILPGVRMAVDAYINFV
                     RTVSWFEGAAASLSELFALDELPKRITALRNHYNWIDQRGVEFFLERLSYLKEDVDLV
                     LELVAPHIRGREMLKKCLQAAAFNCDVHWSMLDAIYMGYVVSKKATAP"
     CDS             complement(209684..210553)
                     /codon_start=1
                     /locus_tag="CSUB_C0209"
                     /product="hypothetical protein"
                     /protein_id="BAJ50070.1"
                     /transl_table=11
                     /translation="MNFAKAAALFVGVFLVSLLVDNMAMDLRMYLLTRGGGVYESLAA
                     YYFVHYVVFQLTIIFLVYGLLQGSQLGRGEEVFLVFAITAGKLLGRLVVEQAPTLPQA
                     IFSIVISTQLSMGAFLLGYRLPMQLRHSTKTRNEDWSLETYAGLSVLFWFAVMPGVDA
                     LGNNVYSNLLRTAMALSLLLITFMFFKGWTNYVHRFALLTGFCVVALVLASVFADVLW
                     RAGTLLVLPLPENIYYLVAQAFQGFFLALAASSGIWLNLILKNPSQVAATRAEQKKLR
                     NISPTDIFQTILS"
     CDS             210645..211124
                     /codon_start=1
                     /locus_tag="CSUB_C0210"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50071.1"
                     /transl_table=11
                     /translation="MKRKFIVIFAVVFVAAVAGFFTMLSQRPEVRSLTVTVYEFGYRV
                     DGGEPTIRMKAGEEVRILFENRGTHDHEFLLVRDKDEAIGVVEKKLEAGASDAELDRL
                     KAEMALMGVRFESEPGGTSVFRLRLTEPGTYYFLCLETEPDEEPHANLGEIGVIVVE"
     CDS             211137..212204
                     /codon_start=1
                     /locus_tag="CSUB_C0211"
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="BAJ50072.1"
                     /transl_table=11
                     /translation="MMDVRLENISKTFGGKPVLKNITLEIRKGEFFTILGPSGSGKTT
                     ILRIIAGLEKPDQGKVYFNNINVTDTPAHDREVSMIFQSLALYPHLTVFENIAFPLRV
                     RKRGEEDVKKTVREIASTLRIEDILNRNISSLSGGEKQRVALARALIYQPKIFLMDEP
                     LTGLEPAFRQELRREIRTIQRSTGITTVYVTHDQVEAFSLADRVALLHEGVLQCVDEP
                     QRVYEKPENLFVAKFVGDTPLNMFTGTVEPVGNGALVKIEDIGVVFRANITKMPAGGK
                     VLVAARAEAFRVDENHAALSGVVVGREVLGDRIVYTVDVKGREIVVKTGADTIHNKSA
                     QIRLAVDVDKLMLFDEEGRRL"
     CDS             212201..213085
                     /codon_start=1
                     /locus_tag="CSUB_C0212"
                     /product="multiple sugar ABC transporter permease"
                     /protein_id="BAJ50073.1"
                     /transl_table=11
                     /translation="MRTSAVLLFAPAIALAAITIAYPLAMSLYVSLHDMGPGGWVFAG
                     PKHYVQILTDRFFYQSLLVSVVYSLMSVFSALLLGVLAAFVVRGVGGGRRVVEGFLAV
                     PLAVSPILAGIVWSPPAVWDDLNTVLHHVFGLGFIDVTDPLVYFPVMVLSEAWVWSPL
                     FMLAVVVVLDNIPRDCMEAAELTGASRLQIFNLVYLPAILRSRVVAMLVALKVVDFFR
                     SFEIPFAWSFWVRESQLGAPTDTLSLMLFKLLLTPRPDGTIPIPYISTVSSVLMLVSL
                     LSSLLIWRQLNLFWRKTI"
     CDS             213082..213921
                     /codon_start=1
                     /locus_tag="CSUB_C0213"
                     /product="multiple sugar ABC transporter permease"
                     /protein_id="BAJ50074.1"
                     /transl_table=11
                     /translation="MRLLTYLTLTILALFYYYPIIVIVLEGFDADISPLLAPGIRLIG
                     GVPYYSGGFTPSLVYYVDMFTTQSFQRLIINSLVIGVGSTALALLVGLFAAYGLTFYF
                     KQMSGKYDYVMLVMRSVPPFLLIIPLLLTLSSLGMWDTYPGMILSYLILNSPIAYLIM
                     RSLLAEMPRDIVDSAMVMGCRPLTAVVKVVVPVLIPSILVSVVFMFVLTWNEFLLASV
                     LTGPYARTVSVGVWSGVGEQIGTFRTVEFEAQAAAGTVALIPASLLILLIRRRLVRLF
                     TFS"
     CDS             complement(214134..215336)
                     /codon_start=1
                     /locus_tag="CSUB_C0214"
                     /product="kelch repeat protein"
                     /protein_id="BAJ50075.1"
                     /transl_table=11
                     /translation="MMVIQQIFNNTPPSLSLAALRRRQVLGVAASVAAAGAFYLIYSF
                     SGPVREQRPTSGATETTTMTPYHTTQNTATDTSLTTPATTVVQQPHHTTQVTAKETST
                     TTAATTGIQPRWLVEEPLPMALTEVAMVSDGKSLFLAGGLTAEGNASSHFFSYNVELK
                     KWRELAPMPAPLHHVGLVYLNNRVYLLGGYDNRWNAQRKAYAYRVNRDVWEELSPLPV
                     ARAALTAQAVKDVLYAVGGARGNMPLNINEAYDPTSNEWKPMAPMSIAREHLTSGAVE
                     GKMYAIGGRVVSANTMTNLNVVEEYDVEKNVWRFRKPMPTARSGLAAAVVGGLIYVCG
                     GESQVKTFGEVEAYDPVSDTWLKVAEMVTPRHGLGVAAAGDKIFTVAGGPRPGLYVSD
                     VNEALALG"
     CDS             215339..215818
                     /codon_start=1
                     /locus_tag="CSUB_C0215"
                     /product="hypothetical protein"
                     /protein_id="BAJ50076.1"
                     /transl_table=11
                     /translation="MPETDRVNSSKLFMRICLMNAVAACFFTAPVLVPGLAFPILLTQ
                     WGAVYMVLGYFSFLVYGVLGALGWAAAYRLLDESAQGYDKALTYLQLSTHLVSSYGVA
                     SSLFIGGYLGARLVYEGRPVQAVGAIMEVVEIPAGLFIMLAIASTLMGIINITRLKK"
     CDS             complement(215831..218047)
                     /codon_start=1
                     /EC_number="1.1.99.8"
                     /locus_tag="CSUB_C0216"
                     /product="quinoprotein alcohol dehydrogenase"
                     /protein_id="BAJ50077.1"
                     /transl_table=11
                     /translation="MNLGKNLRLSIAAAFMVLLFSPLVLAQQQSVDWARYNSVPGNWN
                     YSPQTQLNKENIKFLEIKWAFPVPPASVGDPFFSGSEGVIHTPLVYKGVVYFVTNWHR
                     VYALDLATGKTLWTQTLQPPKEFVDELTAGKPPIWEPFFRGHFHQIHIFEIDGRPYLF
                     LITNYYYLVAIDPFTGDIRLRWPVFTADYLSQVPGNRGVYDISTPSFVIDTKRKILVT
                     GVSTPEDQGAGRGFFVGVDLKPWLEGRGNPQIIWRAFHIPPQDGSDPEWTLKMVDQMR
                     GAWIWDGEKLVNIKTLPAEQKRQLLYDDWGYARFVQRYPSEKVSYAGNGAGWGGAYAV
                     DEDKGVAFVATNQASPDWNATFRPGPNLWSASILALNIETGQPIWGVQTTTHDLYDWD
                     CSWSVVYLKDVQIGGQRRDAVIKGCKNGVVYALNAEDGSLLWAFNSWDPAKNGGDPRY
                     GIKPSKYSKFLNPLNPQDMNWRWQGEWTDDANYLRARGKFYQNPPATGGIESDPAYDP
                     VRNRLFVAVYNSPSAFSLANVGPGTGWPNGWGVAFETLPTQPTNTTLYAIDVATGRVV
                     WNVFIPDVPYRGGITTTNGLVFTTFNDGTIRVFDADTGAELRRIMIAGPVMTQPAIAT
                     TADGKVRIIFPVSNPLPGFWAPTALSGFVTSLGLPDVVAERTVQQTVVQTLSTEVTRT
                     QTQEVTRVQTQVQTLVTTRVTEVTVEVVPTWVYVLAGAAVVAVAGAAVTAARTRRR"
     CDS             complement(218112..218891)
                     /codon_start=1
                     /locus_tag="CSUB_C0217"
                     /product="short-chain dehydrogenase/reductase"
                     /protein_id="BAJ50078.1"
                     /transl_table=11
                     /translation="MPYRHGDWVVLVTGASSGIGRATALEFARLGSTVVGVARRLDEL
                     LKVAEEAASFGGRFKPLRCDVSDKEQVYNTVKETVENYGRVDVLVNNAGFGLYGEFKD
                     FGLEEVEYQVSVNLMGVIYFVKAVLPHMLGQRFGRIVNVSSLAGFITVPKMNLYCAVK
                     SAVTVLSRALDMQLKKHNIRVSAVCPGSVDTAFFQNPSFYSRGGRPLGPLIKAEKVAK
                     TIVSAAEKGGGVRVVPSYYWAAVYLLNTLPFMYRLVEKVAP"
     CDS             218984..219835
                     /codon_start=1
                     /locus_tag="CSUB_C0218"
                     /product="hypothetical protein"
                     /protein_id="BAJ50079.1"
                     /transl_table=11
                     /translation="MSSSRLVKFGIPIVVALVAVGLGITFLASQPSQPPVTTTTKSPT
                     VTTQTTTTLSPTTPQTTTTIQTTSPPTTITTTQTTPTQTTTTPTFQVNLRSFFNTYIQ
                     DISKRDVSAVSSKYTSASVAVWGGKAAGLGGTYRGEGNIRILYIAALGTAKTIEFKEA
                     SYKERVENNMGIIESEQEISGNSDILGSFTGKVKITLKVTVEGNRPVIIEENWDYLEF
                     NYEKTGGATTFPQWADVKAGRPIVLEPSKNFKDLAWFLSDYFALTVYAAVAAVAVVAL
                     TASRRKR"
     CDS             219841..220350
                     /codon_start=1
                     /locus_tag="CSUB_C0219"
                     /product="hypothetical protein"
                     /protein_id="BAJ50080.1"
                     /transl_table=11
                     /translation="MDTLKTSKLFFLLGIANGFITIAVTSLILIPDLRLAAGPGSVLT
                     HNGDVWPGAWSWVAYFTFLIIGVCGAFLWSLAYYLLKSLFGVERTPSLLTKSSLILYE
                     VGLLATVSLAGYVGLVGGRFVAEGGSAVVVTALIGWAVIPSGAAVFLALLGNLLGLAN
                     LVLAVSKRR"
     CDS             220347..220862
                     /codon_start=1
                     /locus_tag="CSUB_C0220"
                     /product="hypothetical protein"
                     /protein_id="BAJ50081.1"
                     /transl_table=11
                     /translation="MILAEKKSLHPHTAARYFLFTTFVNICAAVLITTPVLVARLALP
                     LKLTEWPGTWMFIAYGVFVGFGVFGSLAWSTIHYLSATLLNIKLLRRKLVVTHLILHN
                     VAAYGVGFLMGYGAGYVGGTARLEGVGVAVITALISWTVIPIGILIFIGLLSAILGVF
                     TVLDGWTMSRR"
     CDS             220841..222319
                     /codon_start=1
                     /locus_tag="CSUB_C0221"
                     /product="multiple sugar ABC transporter
                     substrate-binding protein"
                     /protein_id="BAJ50082.1"
                     /transl_table=11
                     /translation="MDDVQKMITRRKTLSLLAGAAAAGVLASYGLFSTQSQTPSQTRD
                     IRAVLAGAGRVNPPDQYVEFMEWLAEVSKNIETGKEPAVALMAESAALAVQRIDGEFF
                     LASGLASRLDVSPYPVHVSKTLSSLTVGASIYDAVAVESFDVNLFINYFTPVQDFMEK
                     YREYTYEKFRLDDFLPESLNLVGVYPPKLDSGGEKGNVVMLPFSTPTMINFYRRDIYE
                     KNGHEPPATWEEYLEDLKALNNPSEGFFATAQQVGSDVGIVTEFNNLVHSFGGRLFEV
                     SDGKIIPVMDSDAVVEALKMYSSIRPYADPASISYDWDAVATAMRRGRIVQAILWQDY
                     AWMMDDPVRSVVVNKVGYKPNPAGPAGSFHQFVGDGVGLVKNGKNPVAMWLWLQWATE
                     VGTRIILMLDEKARVVPIRRSVLMDRNVQSTLENPKFSSVKVVKEILEMKQVASIPPL
                     PRANQVFFIMGRYLRSGWSGADPRQTLREMKNEIESLDSLSY"
     CDS             222462..222914
                     /codon_start=1
                     /locus_tag="CSUB_C0222"
                     /product="hypothetical protein"
                     /protein_id="BAJ50083.1"
                     /transl_table=11
                     /translation="MKIGFTLYLDELPPLKHYTGYLTLTFTLVSENGQMISRTSISNR
                     MEPYKVDYIYPGHRWGPYVLTLKPDYSRLQGETSVSVYVVLDVEEYVEDQLGVPVIPT
                     KPSPETVFAGAIKVSQPLPLLETGLAGFAIVVLVVAYLYIRRTRKPPR"
     CDS             complement(222911..224266)
                     /codon_start=1
                     /locus_tag="CSUB_C0223"
                     /product="major facilitator superfamily MFS"
                     /protein_id="BAJ50084.1"
                     /transl_table=11
                     /translation="MAGWVPITYLIVITALMPLLGQYSDSKSRKNMFIVGLLIFASAA
                     YLSSTAFTIYELLVYRALQGIGAALVLANSRALIVDVFEEKGGGLAMGVHVAVIYSAL
                     LMGPLLGGVILTLTSLIGWRDVFLLNVPVCLVSAALVYITYPREKALHKKSAEKIDWL
                     SGILLLIGVFNLLGGVTLWPIHKGIIEVLVEEVRIFGLYLRPFFYISFPAWLMVALGL
                     LSVMLYVFRERRKSDSQVIPLKLLSTNTRLRSASLAILLLYSAHHGVWVVVSFYLTAL
                     MGLDPVTAGFVLGVLPLTVLAVSPIGGLLSDKYGYSAVSTLGLFICSLALFALSLVSQ
                     QSSIIYVAISLTILGIGIGLFAAPNTNSALASVEPETRAQVNGLMGFMRHLGQTLSIA
                     LSTIILDYSIGYEKFLEGGVIEINSFIRGVSFNFLLGGVIAAIAAVIVLWHEVLARNR
                     G"
     CDS             complement(224355..226247)
                     /codon_start=1
                     /locus_tag="CSUB_C0224"
                     /product="quinoprotein alcohol dehydrogenase"
                     /protein_id="BAJ50085.1"
                     /transl_table=11
                     /translation="MLRKMTQASLLFFLVLASLNAVGVGQERYEWSLPAYDFKNTNYS
                     PQTAINKENVDRLALAWLYQVPENPFRIPSLAPLQGIETTPLVVNGIVYFATPYNRVV
                     ALRSDTGNLVWQYQVNMTTFTSKPYWAYVANQKSISYHGGAIYMMASDCSVHVLDASN
                     GRPLRIVQGETICNVPGNTGFYWGEQAPIVYRNLVIVRASTAAFGGRGFIAAYDINNF
                     NLVWRWFSVPPAGGDPEWGLKYVVETGDGVRTGVPRGNIRPYPNDRGSNSLIGGGALW
                     GLIAVDESSGVLYATVGQPSPVYDAAERPGPNLYTMSIVALNASTGDLLWFYQTIPHA
                     LVAVEPGWSVILADVEIAGAPRKVVMAAAKSDYIYVLDARTGQPIYPPIKIGGEELNI
                     YNVNAGENADMTLSTEVLVGKTYCPGAQGGVESPPAFANGILYVATQRACHRISKGPV
                     FYKNEVIEGFISQIDPSIQQNSTLYAVDIRTGRILWKFEMPNRYQAASVVVSGGVVYA
                     VDRAGVLYMVDAETGRLLRRISLGGLGAAGVSISTDIQGEPILLVPTGGGELGGTYTP
                     GVVAAFKLSQTVQGQGTGLSLGEAFVLVAVGAAVIVGIVMLTRRGRRHTGEKGSTQKM
                     AGGGSN"
     CDS             226351..227265
                     /codon_start=1
                     /locus_tag="CSUB_C0225"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BAJ50086.1"
                     /transl_table=11
                     /translation="MSEILVAENVSKRYGKHEALADVSFNARKGEALAILGPNGAGKT
                     TLLKCCLGLLDFDGKITVDGVDVGTNGAVARSKMGYVPQKTALHDKLRIIDEMKLMAR
                     IKGIRDEQRCREVLEMLGFWERRKDPVGSLSQGMKQRLMLGFTLLAMPDVLLLDEPLS
                     NIDVEGQISLLNQLDEIKREGKTILISSHIVGMGNVIDRVLVLNKGHVAAFGEINEVL
                     SRLRVRNKLYIKLNDKEAVSRALEEKLMQQGDVYAVQRMDEWLIVECESRDKARVISI
                     VLDSGYQLADIVSEAVSLERHYYELIKR"
     CDS             227274..228101
                     /codon_start=1
                     /locus_tag="CSUB_C0226"
                     /product="ABC-2 type transport system permease"
                     /protein_id="BAJ50087.1"
                     /transl_table=11
                     /translation="MASATLALTVHTFLEGLRARWVIVYTLVFFMLAINVPMIVLISA
                     RYLPPDYLEAYLTGLMALSFPFLPLLSLPLAATSIVDEKESGLLEYMLSNPVSRLSYL
                     MSKLAGLFLSTTLVVVGGYLIAAFLSYGIRINQMGAILPLLGSAMLLNTIMLLLGLLI
                     SIVSKRKITAMMIGIFFWFMFTVLSDIGSLSILVSIAGAAPIVLFLTALNPIEAARLL
                     GIYGTRNVGFTELGSIGLILRQLIGEGAPLFILSVQLMWVGLLLILCINIFIRSEIL"
     CDS             complement(228079..230067)
                     /codon_start=1
                     /locus_tag="CSUB_C0227"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50088.1"
                     /transl_table=11
                     /translation="MFRYFWKCLIALVIYMGKMRALALVLSVIMLLTMFSSANSQTTG
                     GEWLSAGAGPHNMKYSYASSLSSDNVGELFQEWFLPVPPSRVGGIHGVTHPILVKYGV
                     GYAVTNGYLVYSFDLRGGKIFWTIELQPPPALNPSVSSERLGHIYQVLLVKAGSDELL
                     VVGTSWQRIYLLDSFTGRLVHAVDLLTPNEAVDGNIGKYGGIPVNIAYDSRRNILITG
                     STSPDTENSGRGFIDGYAVSQEGVRRVWRIFLMPPQTHNTPEWTLNFVKNTRYAWAMD
                     GDDVVNLKAFDENLLLNDWMAAAGSPPKAGVMASWMNGWALDEDAGVVYVGVSHPMPS
                     LDAEGRRGPNIPSSSVLALKVETGEVLWLFQAIPHDVWGYGCNGGVSLVGNTVLALCG
                     NGVLYALDKDTGQMLWMFEPPVNTGGNLSQLSIHDTNQMNTPYMGYGVQVGKTVTVSP
                     PPKALLSYAVNPNSRSVYYAFPLYSESIEVKPPLRSKNVFSQSQQSNLMLYSVDLSTG
                     RLLWEKKLEGVGSSFISAASDIVLVQTSSSGLYIFSEKDGEIKYSKPAIGTTLSHATV
                     GVDVEGGPRIIIAMSSVTDPGYIASFRLLPKNMEQNGTVSVITEHTTITRTVTMQLNI
                     ADFSGGGWVLYVIVVVLAASALTSLFFVLRRSRESRSV"
     CDS             230098..230490
                     /codon_start=1
                     /locus_tag="CSUB_C0228"
                     /product="hypothetical protein"
                     /protein_id="BAJ50089.1"
                     /transl_table=11
                     /translation="MGFARILMLVAAAAVTATALFTIFFMVEQSEAGEKTTTVYMYEY
                     YFSPDEITVGRNVKVLIVFVNNGTYPHNAYLSQEKKDLAPVLYPGDSASVELFFRERG
                     VFEVLCTVSYPAPVSHYELGMRAKIVVR"
     CDS             230609..231025
                     /codon_start=1
                     /locus_tag="CSUB_C0229"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50090.1"
                     /transl_table=11
                     /translation="MELRWVAVVLLTLFIWGVWGVVARVGASALGWRDSAAVAAIGHM
                     IVSLMFIISSRAQVIPASQAWFAALLAGALGFLGAVAFYLALDLNPSSIVVVATSLYP
                     LVTLILSYLFFNEALTLRQIIGVAFALTALVLISGE"
     CDS             231062..232504
                     /codon_start=1
                     /EC_number="1.2.1.27"
                     /locus_tag="CSUB_C0230"
                     /product="methylmalonate-semialdehyde dehydrogenase"
                     /protein_id="BAJ50091.1"
                     /transl_table=11
                     /translation="MSVLPNFIAGQFAESKSSEKIPVKNPAFDTDIAYVPVSTEEEVA
                     AAVEAGVAAFEKFRKTAPTERVSYLLKIRELMIRDTELLAKILVDNHGRTYAEAVGEV
                     KRSLENVEAAASLAYTLAKGEKMVNISPEIDQELIREPLGCFAVITPFNIPLHAWSSY
                     VPYAIALGATVVLKPSEVTPVVANEVARIVKEAGVPAGVMSVVHGDGRVAEKLVRHPD
                     VQGVGFIGSTKTGKFLYELAAKEGKRASINAGAKNHLIVMPDADFVKTADAAVSSFFG
                     MSGQRCLAASNLVVVKGAERVVDLVRERSALKLGYGMDKETEMGPMASRAGLEKVMKF
                     IELGEEYGKLLVDGRKNKPVKPLNGYFVGPTIFTDISPTAPLAKEEIFGPVVSILHAE
                     SLDAAIELINKNTPYGNAASIFTSNPNTARRFVLDVNVGNVGVNIGVPQPMAYFPLGG
                     RKQSFFGTAHSRVDTIRFFTEHKIVTTRWW"
     CDS             232504..233112
                     /codon_start=1
                     /locus_tag="CSUB_C0231"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50092.1"
                     /transl_table=11
                     /translation="MPEAAPGVAIRKVAVYVDEVFMEMGKGLQKPVRKSAAAAVIKNP
                     YAGRYVDDLQLLIDAGDFLGGFLARKAREALGIAPADVESYGKAAIIGLGGELEHGHA
                     ILHPKFGRGLREECGGQDVCKAIIPSSAKLGAPGTAIDVPLHYKRAAFVRSHYDAVEV
                     RVPDAPLPDEIVVIAAVTDSGRPLPRIGGLRKEEVKGEDGLR"
     CDS             complement(233109..234077)
                     /codon_start=1
                     /locus_tag="CSUB_C0232"
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="BAJ50093.1"
                     /transl_table=11
                     /translation="MVTDKHVKTRLYVLAALILIYIALPLPFINTPYAVFILAQMTFF
                     TIFAYSFNFLFGFTRQLFLCIGAFTGIGAYITGIILRDGIAGPVGAVALSTVVVAFIG
                     LAVSILSVRRKLVAIFTGIFTLAITLVFSNLVTGLVDLTGGETGFRIRGVSLLFLDNL
                     PYYMRYYYIALTTLLIVTVIAFYLIYYTRTGYAYRCIIDDELSAELVGINVQRVKTLT
                     SLLASALLGFSGALYGLFSQLISPSYYAFGSIDLPVQIIVILGGRTSLLGPYIGSAII
                     AVVNESLRFLGPLTQLLYGLILMLLLAFFRNGIVDFVKRKVAPWFY"
     CDS             complement(234071..234943)
                     /codon_start=1
                     /locus_tag="CSUB_C0233"
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="BAJ50094.1"
                     /transl_table=11
                     /translation="MAASIILYLLDGVVFGLVLSLIAAGLTLIYGLAGVLNLAHGELL
                     VVTTVTAAVLSGLLGLPLPLALIVGIAATLAVAVVLDRVVLSPIYKLEGEERVLLGLY
                     ITLAFSIFLHSGIITTFPLAYLTVNLPTPNIEVLGLSFRTAQLLAGVLSAVILLGIYL
                     FLKKTWSGRAIRSLTQNETGALLVGVSVKKYRMLVFMVGGVLVGLAGIVRSIIATVAP
                     ESGLEFTILGLLVTVVGGIRSVSGTIAAGLVIGVVYTFLVVVVGTYLAYVALLILIMV
                     LLLTRPYGILGERW"
     CDS             complement(234944..235663)
                     /codon_start=1
                     /locus_tag="CSUB_C0234"
                     /product="branched-chain amino acid ABC transporter
                     ATP-binding protein"
                     /protein_id="BAJ50095.1"
                     /transl_table=11
                     /translation="MPSLLQLEGLDSGYGDIQVLWNVSLTVEKGEVVAVLGPNGAGKT
                     TLLKTIAGIIKPKKGKVLLEGKRIDGQPPEKIVEEGVALALAEKELFPLMTVHENLLL
                     GAFNKRARQKLDENLEMVYSIFPKLKERASQKAGTMSGGEQQMLAIGRALMTDSKLLL
                     LDEPSTGLAPLLVKTIFQALRKLMETKRELSILLVEQRTVQAAQLSDRGYVLSNGRIV
                     YEGDIKEAVYSRTFLRKYMGM"
     CDS             complement(235641..236387)
                     /codon_start=1
                     /locus_tag="CSUB_C0235"
                     /product="branched-chain amino acid ABC transporter
                     ATP-binding protein"
                     /protein_id="BAJ50096.1"
                     /transl_table=11
                     /translation="MATLIRCVDVTKYFGGLPALKNINLEIEANEIRAIIGPNGAGKT
                     TLFNVVNGVYKPSAGKIFFDGKDITGKPPHEIFKLGMSRTLQIPRPFKDLTVWENVLA
                     GGLFNERVDRTELEKHVSTLLDRLGLAEKSEMKAGLLNLQERKKVELARALASKPRVL
                     MVDEYMSGLNTAEVEEAVDLFRDLRREYGLTIVWVEHVISAVASLADKVTVLNQGAKL
                     AEGRPEEVVMDQEVVEAYLGERGVAEPSSA"
     CDS             complement(236426..237643)
                     /codon_start=1
                     /locus_tag="CSUB_C0236"
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="BAJ50097.1"
                     /transl_table=11
                     /translation="MKRSVLVAIVAVVVVAAVAASAGFLFLSQQRLGASEVKIGALVP
                     LTGPFAVYGSYTLDGMRFAVDELNARGGVLGARVVLVEADEKNDAKEAVAIFKRMAEV
                     DRVTAVVGTISSGIGAVLSAEAEQAKVPLFLVAAGSHTILTKESRYTFRTCLPPAPTN
                     GELLANFVRDKGYKRVGVVIASYEWGFAIRDVLDQRLKQLQGVQYQIEEAPLGETDFT
                     TVLRKLQPLQPEVMILTGHPPGFPTITKQAIELGFQSAYYIASVQPPELMLRGVGDIG
                     LGKLVTTTCVNSEAPEYKQLAEKFYQKYGKFFDHNAVTGYVTVMMIADAVEKTRSVDP
                     VTVANHIRTSEYNSPIFAWPLSYTEWGEIKKPAMRLAVIKQGNPGSINPGANWVIETL
                     YISPPVQPYVPEK"
     CDS             complement(237676..238662)
                     /codon_start=1
                     /locus_tag="CSUB_C0237"
                     /product="luciferase family protein"
                     /protein_id="BAJ50098.1"
                     /transl_table=11
                     /translation="MKLGLRLPTYARPGEFSSYETLKNYVAKAEDLGVEGFFVIDHLL
                     TSRPAYSTSWHDPLIALSFIAAATRKAIIGPMILVLPFRNPYLLAKQLASLDVYSGGR
                     FVLGAGVGWNPDEFRLLNTPLEKRGAIMDEYLVLLKKLWTDDKITFEGKFFNVRDLVL
                     EPKPLQKPHPPIWIGGGSQPHEILYGAAAKGIDRVLYRVAKFADGWIPHSSSTPEMAR
                     QDWEKVKKYATELGRDPYKIQKVYSNFIYIKSPGSSDEEAVKRFSLYSGMNLDYWRTF
                     YLYGTVEELAEKIKNRIKSLEGVDWIVLNPVTYEESQLRKITDELLPLIDNV"
     CDS             complement(238662..239846)
                     /codon_start=1
                     /locus_tag="CSUB_C0238"
                     /product="amidohydrolase"
                     /protein_id="BAJ50099.1"
                     /transl_table=11
                     /translation="MPSYIIKNAGKILTGDINKPVAEGNSIYIKDGVIEEVGWNISRQ
                     ADGVFDINNMTVMPGLFDSHVHPVFGDFTPRQNTLGFIESSVHGGVATFISAGEVHLP
                     GRPRGDKEASKALAIIAHKSFKNIHPLGAKIHAGALLLEKGMTDADFEEVVRAGVWLV
                     GEVGLGSVQDPDEAAAMVRTAQKHGMKVVIHTGGASIPGSTINNAEVVLKVRPDVVSH
                     INGGPTSPSLQDIRKIIENLNSAIEVVQCGNFRSMLETVRILKHRNELHRLIIGNDAP
                     SGTGVIPLGIIRTISFIASNTDVEAEKIVCAASGNTGRVFGLREGIIETGRPADLVVI
                     DAPYGSVAKDAVEAFSIGDIPGIAMVMIDGVPRVGRSRMTPPPTRSIKTEGSAKLPEA
                     GH"
     CDS             complement(239871..242177)
                     /codon_start=1
                     /EC_number="1.2.99.2"
                     /locus_tag="CSUB_C0239"
                     /note="molybdenum hydroxylase family, large subunit"
                     /product="molybdopterin binding oxidoreductase large
                     subunit"
                     /protein_id="BAJ50100.1"
                     /transl_table=11
                     /translation="MKLQKRIEDPRFLRGEGLFIDDLAFPKMVHLVFVRSPYGHANIK
                     SINSGESLRRAVAAIDGKTVATETKPLYTLIRDVPYYGIAVGKVRFFGEPVAMVAAET
                     LGDALDAADEVSVDYEPLPPVVDPEEAVNSSNLVHENLGSNVALSRRFVFGEVEKVFA
                     EADTVVKEKFYFDRYASAPIETCGVVAVPGKDGSLTVYDNQQTPQLFRKSIAQSLGIR
                     PEKLRFIEHDIGGGFGVKIMLYPYVFLTCFAALKLRRPVKWVETRQEHLTAMAHNSNR
                     VTVAEMALRKDGRVTGYRTSFIEDVGAYARLPDPGGTVRSLMTYLGCYDIQNVAIEFK
                     VVLTNKCPTGPVRGYGCQQAYFVLERMMDIAARELGLTPVEIRLKNMVEKENQPYRTV
                     FGSLYDGGDYKATLLKAWSLSQAEKYLVKDDVGVGVACVVEPAVTNLARNKLLFPELE
                     SSGSGEGAVVRLEESGMITLYAASIPQGQGHATVLTEIVSELLGVKPEQVRVVFGDTD
                     FVYPSPYGGTWASRFSVMTVAAVKKSCETLKQRILEIAAEILETSTEDLEIRDGKISV
                     KGSDVSISLEKLAAIAYRNSLTTNGRHTSLQAEYFYEFPTFNTGEPGKINMSATYGNS
                     AHVAVVKVDRETGEVKILRYVAVHDCGKILNKKIVDGQIMGGVMQGIGATLYEKIVYD
                     ENGQLLTSHFSDYLLPTARETPEIIIDHLETPSMFSELGSKGMGEGPLIPVAAAIVNA
                     LEDAIKTRLTSSHLSPSQLWTAIHRKRL"
     CDS             242286..243035
                     /codon_start=1
                     /locus_tag="CSUB_C0240"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50101.1"
                     /transl_table=11
                     /translation="MEKSAYALVSVSVTAAVLAVALAAVTLLSGSTPSMLTNMADESQ
                     VSSTLSVTGTAQATIVPDTLAITFVVQEKAPTPSEALAKLSEKANRVVSAVLGLGISS
                     ENIKTTSVNISPEYTYPDKEPPRLIGYVATYSIEVRTKRVADAGTLIDTAVNAGADQV
                     SGLYFTVSPEQYSTVYRQLLSAAIGDAEAKAESVLRPLNLRKTGVKSVSVMDVQPAYP
                     ARAAAEASSGPPILAGTTTLTVSVNVVYTIG"
     CDS             243075..243932
                     /codon_start=1
                     /locus_tag="CSUB_C0241"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50102.1"
                     /transl_table=11
                     /translation="MPKLFYVLQGVGAGFFFGTASIFVRFLAGVDAFTIVVFRVLVAG
                     LLLSVLAAFFFRSDVVNTFRKFPREIPLLGFLLSFHFIFFVLGVQNTSVVNATTLVNT
                     TPAMALAIGWGLGWTKPTNVNVIGLVLAVAGSATMALGESSGVSGGLLGNVYAVLGAF
                     FWALYLVVGKRVRQEVNIFAVFGPLLLFTSLPALAAAYLLGRGLYPLNTAQTLFLLAL
                     ALFPTVLGHGLQFSSLRGLHPYQASSLALLEPIVAALLAAVLLAEVAGPVTYLGAAAV
                     ILGIYLVIR"
     CDS             complement(243914..244903)
                     /codon_start=1
                     /EC_number="4.3.1.12"
                     /locus_tag="CSUB_C0242"
                     /product="ornithine cyclodeaminase"
                     /protein_id="BAJ50103.1"
                     /transl_table=11
                     /translation="MYKDIRALPPVPCMKFLTDDEVAFLVDPVKVVEAVERAYILYST
                     GRVVMPVRSRVENREQGGDLLMMPCLVPDMGIFSLKLVTVYPRNLEKGLPTINATVIA
                     LDASTGMPRLVAEARALTGLRTAAATAVSIKHLARRDFTRVGIIGTGYQARWQLRVVA
                     ANHPHTVFKAYDIDSRRLNEFVTEMGRLGHDVKPSPTAEELVRWSDVVITVTTSKQPV
                     VLKSWVKEGTHISAIGGYTPEMVEIEPVLVAGSKLVVDSREAVREEAGDILKPIMLGL
                     MRFEDIYAEIGEIAAGLKPGRIDEREITVFKSVGLAVQDAATAKLLIDYLMTR"
     CDS             244935..247214
                     /codon_start=1
                     /locus_tag="CSUB_C0243"
                     /product="hypothetical protein"
                     /protein_id="BAJ50104.1"
                     /transl_table=11
                     /translation="MNVLVGRAATLLIIALLTISSVFSSHGVVAEQFLQRPPAESSGA
                     SPVVSEMLAELGFDHYMPRRYYPLLDVSLVDIGVDRLLNVSGVNAAAVDGRGVLIAVV
                     DTGVDYRHPAFRTGNGTRIVAIWDQTVEGKPPQGFGYGYECDRQEILSGTCPQRDTVG
                     HGTVVASIAAGGVYGDWVLRGVAAGSELVVVKTGGPACSGTRWFFSEKGLLDGVAYTV
                     DKAKQLGRRLVVVLSLGTDIGAHDGSTPLEKALDKWAEENGVVFVVAAGNSANDSRHI
                     ETTLTQGIQLTLRMTIPEQTTEAALSLVTHSGNVMELALTTPSLNRVELPLNGSKTFR
                     ETTLETSTQRTGVLQEIAISIKANPLESGVWRLSITPRQVYDGKMHAWLESDTCSQES
                     EAFLPSDGYSITSSYTVTIPGTARKVLTVGAYNTRKTWTAGGETWSVGGTVGDIEFYS
                     GRGPTTDGRTKPDITAPGGVVFAARSRDAPRQAFSPSEETAVSRGTSMAAPHAAGVAA
                     LILQLAPTLSPEEVFEIIRNTARQDSYTGDAVSNTWGHGKLNADIPYVLQVEVDGPVA
                     EARPTLLLDNTAVATISTTDAASIVLLKNRQANISLQSPSTPYTRYTTTPSHIIVNAK
                     QEKARFILDAYHRVDVLYPNGTMIDTVWAREGETLDINSLLQAREVKIGLRGYIDEAG
                     VEHSSTTLRVTAPTRIKLILEEPNILTPVLGAFAALLLLVLLSTAVMRLRRYRNSGTR
                     PSSTTHLPSSSTELITKSG"
     CDS             complement(247133..247768)
                     /codon_start=1
                     /EC_number="2.4.2.7"
                     /locus_tag="CSUB_C0244"
                     /note="phosphoribosyl transferase domain"
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="BAJ50105.1"
                     /transl_table=11
                     /translation="MESDFVNILQKLLNGLRTGAHVKVVPVEGKRILRISWLNVVHEP
                     EVFRAIARLVKIHAAKMGYDADAVASVETSGAKYGLALANELGKPYFSIHKAKKLIFQ
                     QPVTAEGFSVTESKPVTLHLDKAVASQFRNVFLIDDVRRTSTTINTAADLLNECGAQV
                     TACYVIIDLAFAGHPRPVKVPRDRYHPLFVISSVDDDGRCVVEEGLVPEFL"
     CDS             complement(247790..248911)
                     /codon_start=1
                     /locus_tag="CSUB_C0245"
                     /product="major facilitator superfamily MFS"
                     /protein_id="BAJ50106.1"
                     /transl_table=11
                     /translation="MTKRLPLLFFAHLANDTLYTSLPPLLPLLAAQQKTSAATLALIP
                     TVYLMTASFLQIAVGFFFDRRPKTVLMPLGLFLGGVAVSAIGFVESFPLILLLGFLGG
                     VGSALFHPPATSMASVSEKRASSVSFFMSGGDIGLAVGSFLATTAYVVMGAQGTGLLI
                     ILPVLAAAMLLVGVRQPLEARVQNSVRPDVRKLGLALAAAVLRAVAALSFVTFLPLYL
                     TKRGLSFSMAGTVLTVMILAGAGGMLSAGYVAEKIGKKRAVTLFLLLTGLWIPVAVLT
                     PEELAYFSYGVLGFLIFAVHPILVAYSHDLLPQNLGAASALMYGLTFGLGHLIVPFVG
                     AAVDAYGYQSVLLSLAFMPFTAALLFQWTPAAAKTRTIY"
     CDS             248981..250123
                     /codon_start=1
                     /EC_number="1.3.99.3"
                     /locus_tag="CSUB_C0246"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BAJ50107.1"
                     /transl_table=11
                     /translation="MVLCYVKEVLDLPSLFPLSYWEKMSNSGLFPEEFWRECGRRRLP
                     GFLIPATYGGLGKTVGELVEAVIYLTMHGCGTALYPLLSNNMSSLVINKSGTEKQRQR
                     LLPRLASGEYIMGLSITEKESGSDVLSIKTTAVKQGGKYVINGEKMYVNNFDRATHML
                     LAARTTPLEHAAKKSLGLTLFVLDMKAGGLSFSELPKMGTNYFRTGVMRLENVEVDEE
                     NVVGEVDNGWKALAHALNPDRIVYAAVAVGSALFAIKTATSYASERKVFGKPIGAYQG
                     IQFPLASLYTETEAARLLTLDAAAKFDRGEDASVAACLAKYFASEVVFKAVGQAVQVL
                     GGYGYLKESGLERVLRDIYLLRSGPITQELALAFIAEKGLGLPRSY"
     CDS             complement(250120..251097)
                     /codon_start=1
                     /EC_number="4.3.1.12"
                     /locus_tag="CSUB_C0247"
                     /product="ornithine cyclodeaminase"
                     /protein_id="BAJ50108.1"
                     /transl_table=11
                     /translation="MVRIISRNELENWLDMKTSVKIVEDFFRDYGDEKYVAPPRMVTA
                     VEERDAVYLNMPAASLHVGGYAVKLINEYRKNPVLHGIEAAHGVVLFFDIETGLLNGV
                     VDAVALTSLRTGAIGGVGAKYLAPDDSRSAALIGSGRTAWTQLTALHTVRNIERLKIY
                     SPTKTNREKLAEKASKTLGIDAKAVDSPREAVENADVVLAATNSAEPVFSGEWLAENV
                     HVTSIGALPTRRELDLETFRRADLIAADLKKSVLREAGDIMAAVEKGVVDPYKVLELH
                     EVVKQNLKRPRNVHVSLLKSVGFAALDLYFTSRVLSMAEKTGVGRVVEL"
     CDS             complement(251099..252409)
                     /codon_start=1
                     /EC_number="6.2.1.30"
                     /locus_tag="CSUB_C0248"
                     /product="phenylacetate-CoA ligase"
                     /protein_id="BAJ50109.1"
                     /transl_table=11
                     /translation="MNSARFFNKPAETMSRKDIEENRDKMLRWTVRHAYRNNPFYRRK
                     LDEAKVSPDDVNSVDDLVKLPFTTKDELRSLYPYGILAVPRSEVLEVHATSGTTGVPT
                     LGFYTKNDIEVWAEVSARSLAMSGLTREDVFQITPSFGMFTGGFGFYYGARKIGAMIV
                     PTGAGFSRRQIQYMLDFGTTMVCAVVSYILRLTETALEMGVDPAKDTLVRKGVFGSEM
                     WTSEMKKWVAEKWNMDVYDIYGFTELCGPGVANDCFVHDGLHLWEDHFLVEVIDPKTG
                     EPVGPEEKGELVFTTLTKEAAPLLRYRCRDISYVYDARSCDCGRTHLRLGYIRGRVDD
                     MIKVSGVAVWPSAVEAVLLKHRELGPEYQIIVWREKGLDKMKVVAELAHELKSDEAEA
                     LRSRLESELRETLLTGVQVELAEPLSLPRQEVGKAKRVIDKRAE"
     CDS             252504..253469
                     /codon_start=1
                     /locus_tag="CSUB_C0249"
                     /product="fumarylacetoacetate hydrolase family protein"
                     /protein_id="BAJ50110.1"
                     /transl_table=11
                     /translation="MKLVTFQHPHRREPRLGIVYGEYVIDGNMAFAVLLNEEGEEDPE
                     VLADALLPSSMISFLRRGRKAFEAAEKVLFKARSFINMSYGEGLVYELGKVRLHAPIP
                     RPGKIIHTAGNFREHAKEAEKAKWEFPIPQWISFLKSPTAVIGPYDNIVYPKYTKELD
                     YELEMAIVIGKRGKYIPKERAFDYVAGFMVFNDITARDIQRQEMKNGLLNFGKNLDTF
                     APLGPYLVTKDEVSNPHNLKMELRVNGEVRQSGNTNRLSVTLQEIIEHYSWVMLEPGD
                     IITTGTISGVAAFRENPEKYYLKPGDVVESEIESLGVMRNPVVAE"
     CDS             253471..254676
                     /codon_start=1
                     /EC_number="2.3.3.13"
                     /locus_tag="CSUB_C0250"
                     /product="carboxyltransferase"
                     /protein_id="BAJ50111.1"
                     /transl_table=11
                     /translation="MSSESWRGEKHWVSPYNFAPQVVSQFNFPEKIEIYDVTLRDGEQ
                     TPGVVLKASEKLEIAKALDELGVHRLEAGMPVVSEEDFNAVKIIANEGLRAKVFGFAR
                     LVKEDIDAALKADVSGIVTEGPVGVPKLMQFGWRPEDVVEKAVTHVQYAKDHGLYTVF
                     FGVDGTRADINFLKHIYKRVVDEAKPDAVAVVDTFGCASPEGFRYLVGEIVQTVRVPV
                     EVHCHNDFGMGTAVSIAGLSAGARVVHVSVNGIGERAGNAALEEVALSLELLYGRRLG
                     LRLEKLVEVSRLVEKLTGFRLAANKPVVGERVFTRESGISVAGWVKYHLGSEAFLPEL
                     VGNRHDVLVGKKSGKHSIEWKLEKLGVKASPEEVQALLQKVKEISIIKKRALSDEELL
                     ECLATVRRS"
     CDS             254649..255725
                     /codon_start=1
                     /EC_number="1.2.4.1"
                     /locus_tag="CSUB_C0251"
                     /product="pyruvate dehydrogenase E1 component subunit
                     alpha"
                     /protein_id="BAJ50112.1"
                     /transl_table=11
                     /translation="MSGDSEAELGLYRVLSPEGELVGEPDPSLSNETMRKMMRDMVVL
                     RAFDQWMLKIHPLGKASRYAPVEGQEASVVGSVHSLSDVDWTFPTYRELTVGLLRGAP
                     LTTLIHRMFATSLDHMKGHEITLYGDKRYRIVVGAGAVSLMCPVAVGMAMAAKKRGEK
                     EVFLVYLGDGATSKGDFHEAINWAGVFKPPVIFFVQNNQWAISIPFKKQTASPTIAVK
                     AKAYGIPGIRVDGNDVLAVYTVCRRFVEKARAGEGAVLIEAVTYRMGPHTTADDPSKY
                     RSEKEVEEMRAFDPLKRMRIYLTRNGLWSPEEEQKIVESFRDELRRATEEAEKTPPPH
                     PRVIFEDVYAELPWHLSEEMAELG"
     CDS             255722..256582
                     /codon_start=1
                     /locus_tag="CSUB_C0252"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50113.1"
                     /transl_table=11
                     /translation="MKLKPWTVTLADTKDLHPHEQSIPQTVSRIAEDIAQKGRFIDPV
                     IVDAETGLVVDGTHRVEAAIRLGLGKIPVYTVDYMSPRVILAGWGRAASKNMSKEELR
                     GLCSQLGFTESETDYAARFMWSDGYVLQVKHREDLSTRQVYEKLSIIDQSLQHLGISY
                     VRDGDVEELVKQGKHVFGYLLRPLRKEEVVSIVKQGYRLPPKSTRHLVDKRPMYINCP
                     LEILRSSNAVEKFAEFLSEGFWVELGPGAELDRRYDEKIMVFYREDLASFYPEKLLKL
                     VKSSLKQTLR"
     CDS             complement(256551..257483)
                     /codon_start=1
                     /EC_number="1.1.1.95"
                     /locus_tag="CSUB_C0253"
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="BAJ50114.1"
                     /transl_table=11
                     /translation="MNRRVLVADPVDRSAVDMLERAGFTVDLRPGISAEELESVIGGY
                     DVLLVRGRTKVTAKVIERGVPVLKVVGRAGVGLDNVDLEAAARHGVKVLNTPESSTES
                     VAELVIGLMIAVARKIAWCDKQVRSGKWPKSEAMGVELAGKTLGVVGYGRIGRRVAEI
                     AHAMGMKVVAYDVIPIPEEVLAKAGAKLTSLEEVLKTADVITLHVPLTPETRHLIDAS
                     KLEMMKPKAIIINASRGEVIDEEALYNALKNGRIAGAGLDVFEKEPPTGSKLLELDNV
                     VLTPHIGAQTLEAQEAAATMLAKKVIEAFASTSS"
     CDS             257583..257867
                     /codon_start=1
                     /locus_tag="CSUB_C0254"
                     /product="small subunit ribosomal protein S26e"
                     /protein_id="BAJ50115.1"
                     /transl_table=11
                     /translation="MPFKRKSRGRSKGAKGKEPTVQCDNCGAYVPRSKVQRVTRRVSL
                     VRGDLARELKQAGAYLAENIVVKNLCISCAIHYGVLKVRARDERKPEQFL"
     CDS             257924..258892
                     /codon_start=1
                     /EC_number="3.4.24.-"
                     /locus_tag="CSUB_C0255"
                     /note="heat shock protein HtpX"
                     /product="peptidase M48"
                     /protein_id="BAJ50116.1"
                     /transl_table=11
                     /translation="MTTAQERARLSLVKLRLAMVGTWALITGVASLLFVAVLTFLRIP
                     LLNFYTIIGFVVVFHVFQWLIGPYIIGAVYRTRPAAEAGLGWVEEAVNRLSMAAGMEK
                     PPKTYVAEIDIPNAFAFGSPLTGPMVAVTRRLVESLPREEVEAVIGHELGHIKHRDVA
                     FMMAISIIPAIIYYLGYTLFVSGAYSGRREGGAYTFLIGIALMVFSFIFNIFVFYMSR
                     LREYYADYFAAKTVPNGARNLQRALVRIMMLAGRLRREEVAHVEQFKAFFIADPEVKL
                     QAFGDIDRVVEEVKNRKPSTVAELFSTHPDPAKRLRALDNYVFSMP"
     CDS             complement(258879..260333)
                     /codon_start=1
                     /EC_number="6.1.1.15"
                     /locus_tag="CSUB_C0256"
                     /product="prolyl-tRNA synthetase"
                     /protein_id="BAJ50117.1"
                     /transl_table=11
                     /translation="MGFFYGLMSTATALNKYRNFSEWFDKLLLEARIVDDRFPVKGFS
                     VYLENGAYILRRVREMLEKELRETGHKEMIFPLVTTEELLGKEAQHIKGFSTEVFVIE
                     SAGGKPLDVKLIVRPTSETIMYPMFKLWIRSHADLPLLVHQSNMVYRHETKATRPLLR
                     VREIPWNEAHTVHATAAEAEQQVRKAVEIYRKVLDQLGLAYLVLKRPDFDKFPGARYS
                     IAFDAWNPDGRVNQVATVHNLGKNFSKVFEIEFETRDGKRENPHQLCYGFGYSRVLAA
                     LISQHGDDRGLVLPPVVAPLHVVIVPIVFKGQEESIKQFCHSLAERLQKFAVKVDDRE
                     DVTPGEKFYHWEKLGVPVRLEIGPREVAENRATLFRRDTLEKQVVAVEEIERAVENVL
                     TNMGQSLAERSWRIMRQMVVEVSSIDEAKKVISERRIARLDWCGSVECAEQLKAAAGG
                     ELRGSRFDELEVPSGPCVVCGKNAAEVVYFARAY"
     CDS             260623..260928
                     /codon_start=1
                     /locus_tag="CSUB_C0257"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50118.1"
                     /transl_table=11
                     /translation="MVDLILSRHASEKIKLRRLRMELINQVLNSPEHIYFDVVTRLYV
                     AIRKVEFHDEKIPLVVIYRTEDDSYYIATVYPCKEFEEEVDRKVKKGRWIKVGVREK"
     CDS             260925..261143
                     /codon_start=1
                     /locus_tag="CSUB_C0258"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50119.1"
                     /transl_table=11
                     /translation="MKVTYDPEADIIYMVLRDGEVYDSREENEDIRLEYDKEGQLIGI
                     EIMNARANLIAAIAKEISREINNALQTR"
     CDS             261445..262128
                     /codon_start=1
                     /EC_number="3.6.3.14"
                     /locus_tag="CSUB_C0259"
                     /product="V-type H+-transporting ATPase subunit D"
                     /protein_id="BAJ50120.1"
                     /transl_table=11
                     /translation="MGFGASLLSVSFGGKFLPTKLELIRARRSLQVAKSIYRILEDKR
                     DVLVRRLNDLVEVAEAEREKMEQPLRQAYMSLFKAYAEMGSVKVEAIAATTPPSIEVK
                     VSEKTILGIRIPTLEIASTKIPLNYGLLDTASSFDEAVRNFREIIATLCRVAEIENTI
                     FRLAEELKKTQRLLNALEHLIIPRYQEAIKFISASLEEREREDFVKLKHVKRILERRK
                     EVETLGGTG"
     CDS             262278..262913
                     /codon_start=1
                     /locus_tag="CSUB_C0260"
                     /product="hypothetical protein"
                     /protein_id="BAJ50121.1"
                     /transl_table=11
                     /translation="MDIRRAAAATIIAVFAYIALFHYPLVRGLELTNLLFYMDVWPTF
                     IAAVGYSTAYLTSTRLNTNLGKPWSRYIGFGAAAALIFYWHLPANSFFGYGVCPADLN
                     NPILYQLKRISYFIVGVLIYFAAKDFNKPWREALAIAFGKVMGWYGFYLTLVTEPLYV
                     APPVIFSLQLHHEAGAAMILSMIALDFLAAASLINHLFKDKKATPYPLTTS"
     CDS             262962..263372
                     /codon_start=1
                     /locus_tag="CSUB_C0261"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50122.1"
                     /transl_table=11
                     /translation="MSQSALLVGAKCSGLVYVDAVVKKGGKSAAARLLVDSGATYTVL
                     KKDVWTILGLEPLGEIDLVLADGTTITRKVSEAIIELPGYGERHTPVVLGEEEDENLL
                     GIVTLEIFGLVLDPLKRTLKPIRAILKTEHHDKQ"
     CDS             263464..263871
                     /codon_start=1
                     /locus_tag="CSUB_C0262"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50123.1"
                     /transl_table=11
                     /translation="MRFSRVEAEYWFKQGVEDFRLAEKLLSDGRYNYSAFLTHQAAEK
                     TLTTLIIEVLREIPPRIHNLLELGESLRKTGIDMAEVEDDLKYLNPHYLTSRYPDAAN
                     GIPTEVYSRRMAELCLQSAARVLAWAENLLEKK"
     CDS             263841..264296
                     /codon_start=1
                     /locus_tag="CSUB_C0263"
                     /note="DNA polymerase, beta domain protein region"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50124.1"
                     /transl_table=11
                     /translation="MGGKLTREEVTQMVSNYVNAVRENGFDVVSAVLFGSRARGRELV
                     SSDVDLLLVLSNCSYGFIERIEALSKFWRHELSLEVFPYTKDEVMRLFERGSITLYDS
                     LEHGVIIYDDGFFSSLRRLFAELVEKGVIRKGPDGWWMFPEPDTIHIQG"
     CDS             264336..265202
                     /codon_start=1
                     /EC_number="2.7.7.9"
                     /locus_tag="CSUB_C0264"
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="BAJ50125.1"
                     /transl_table=11
                     /translation="MVRKVVITAAGLGTRLLPTTKEMPKEMLPIYVRAGNGSVTLKPL
                     LQALFEQLYSFGFRQFCFVVGRGKRAIEDHFTPDWDFVEKMDKMGKYSTVSDLVTFYK
                     MLEESVIVWVSQPSPRGFGDAVRTARHFVGDDNFLLCAGDTIILGNNTHFLKRLFEAA
                     PRNMLDAVLLVQKVENPQQYGVVVSQPLNQTLHQVFKVVEKPKTPPSNLAIMPFYIFT
                     PYIMKALDMISEGVGGELQLTDAIQKLIDMGGKVLAVELLDNEMRLDIGTPETYMEAL
                     SLSYRYANSGEK"
     CDS             265199..266512
                     /codon_start=1
                     /EC_number="1.1.1.22"
                     /locus_tag="CSUB_C0265"
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="BAJ50126.1"
                     /transl_table=11
                     /translation="MKIAVIGLGYVGLTTAACLASRGFKVTGIDIDKHKVETINEGKT
                     PFKEPRLDKLLKRSGLRCSTDYAEAVDADFVFISVGTPAGPGGEIDLSYVAGAARSLG
                     EVLASRRKPCTVVVRSTVVPGTTRGIVKNELEKSSGKRVGEDLFLCVNPEFLREGNAV
                     HDTFNPDRIVIGDDWGSGGKNLLRLYHRFYRRRKPATILTNTVNAEMIKYASNAFLAA
                     RISLINEIANICQHIPGADVTVVSKAIGLDKRIGPYFLNAGLGYGGSCFPKDVKALIK
                     YAEKLGETPRVLEAVDKVNMMQPLKAVELAEKLLGSLHGKTAAILGLAFKPNTDDIRE
                     AVSLKIIKTLLEKGCTVKAYDPAAIENARKVLGDTVNYASSAEECLTDADFCIIATEW
                     KEFRRLGPDDFRKLMRDPVVVDGRRIYDPERFMEKVEFAAVGLGL"
     CDS             266509..267474
                     /codon_start=1
                     /locus_tag="CSUB_C0266"
                     /product="glycosyl transferase family 1"
                     /protein_id="BAJ50127.1"
                     /transl_table=11
                     /translation="MRVLMVGRKPSIALNELRRYWGTVDVATGLHAPRFTRYDLVIAQ
                     EPTIKIGLPALLQAKLSNAALITEVHGDYLRGNFLPWKDRLFAWLVLRSSDFVRAVNS
                     GIAWNLQSRGLSNVHVVPAVYIRLDIFKPLKNPDERGHVVVTAARLVPEKGLDLLLRA
                     VPLLLQDFPDLEVRILGEGPMRKSLQGLAGELGVGDVVKFLGWAPVDDLVKHYNEAAV
                     FVCTSHYEGGPRTVFEAASCLTPSVSTPVGIVPEVLRDGESVLLVERRDPDLLAEKIA
                     QLLHDRDKRRRLAEKAREIVLREFEWSKSVERYARAYLALASPRP"
     CDS             267530..268474
                     /codon_start=1
                     /locus_tag="CSUB_C0267"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50128.1"
                     /transl_table=11
                     /translation="MVSVMTFIGRVEGLDAPTLHAQYFEEYLLLSRHVDHLKVVTDTV
                     VSRRLDTPPNMEIVKLPAIRIPKIYGATKILFYGFKPVLDRDNVDVLYVRTFSPPELS
                     ALWFGRLFSDIPSVLVLPGTWLFGHPSSAKGKERFYRWFLRRALDSCEKIVLYSRHML
                     PEVLLYHPKLDVSKVVYIHNAVNIVRFSPEGEKSKRLEELKRGRKCILYVGRVNEKKG
                     VEDLVKAFRIVSTMHRDCILAIAGAGEAGYVEKLLEEVNKTGLDDSVFFLGPVPNSEI
                     PMLYRSADVVAYASRGERVFQGRCWREWLVGCLPWQQM"
     CDS             268716..269723
                     /codon_start=1
                     /locus_tag="CSUB_C0268"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50129.1"
                     /transl_table=11
                     /translation="MVLDVVVFGGSGFIGSAVANYLSDAGLKVRVADVVRPRGDLGVE
                     FVECDVRDRGAVLRALGDARVAVNTAIVQIPRINEEPRLGYEVNVIGTQNVCEAVAGS
                     GSCLGMVQAGTWHTIGETGLSGVVDEEFGYRPDKVEERARVYALSKVCQESVVRLFSY
                     MFREKAYVVIRTGTVLGPNMPEQTAAKIFIKNAVGGKPLTPYRHSMYRPILYVDVGDV
                     AKAYEVVVKKILDGDMRGVNNVFNLVYPEPMTVIELAETVKRSVEELTGGRISPAVEV
                     VDKGIPPLFTPDDKNRFVCKIDRITAILGINRLKDPKASIKELTARALSNQLDQQNLR
                     A"
     CDS             complement(269748..270377)
                     /codon_start=1
                     /locus_tag="CSUB_C0269"
                     /note="methyltransferase domain"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50130.1"
                     /transl_table=11
                     /translation="MPDMGLLEGIVAFRFASFCRELGDELRVVVDVGCRLGWAGHMLA
                     AIAGRPVEVVGLDVYEPYLKTLSEISKIYKPIKVDLEKEPIPLPDGFADLTICIEVIE
                     HLSKPAGYRLMDEMERITRKGGYIHLTTPNGWRPTDSRRCDPLKHKSGWTVQDFAKRG
                     YVVKGYGFRPIIGRTKIDKLYLVADYVWTPIAPIIPETGFGLEALKKIT"
     CDS             complement(270433..271923)
                     /codon_start=1
                     /locus_tag="CSUB_C0270"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50131.1"
                     /transl_table=11
                     /translation="MSGRPRLRLTGFVSFLVRMGSLASGLVFSVIVARRLSEEDFGAW
                     TYVGRLVSYFAVTASFISFWAARDAGRGGKPLKTALAGSAFMSLILSMAYLGAVAFSA
                     EAIGREPWVVMLGLMQLPILHLLNTAEGVSYGHKPIASAYGFAVFEVAKVIFAVVAVY
                     FLGLGLAGVFISLALAQLIQALLLVYLQRNVLGRFEPRDLIRWLKGFAVPLLNVVGGF
                     VYGLDVFLGGVLYGSAIPLAYWQAALTVALVVGMYNNLVLGLYPVLLSGGGSRDIEKV
                     FRFAMLLGVPLLFGALALGRDILQLLRPAYAEASSILVVLSISYFINGLSYFFSSVVG
                     GLDEVDKRSDVSLADYLRSGIFRYNLVNLVLSSLYIAAFSLATMYAKSAAMSHVETAQ
                     LWAYAHLGFTTSLTTVGYLFSRPRIHFKLPAKPLVKYIAAALLMTAAIAPILLIIPPS
                     NTAIIQLTRIIAILLTGAAAYTAAVMLIDTEAKTMIKLVLKRLFFL"
     CDS             272205..273071
                     /codon_start=1
                     /locus_tag="CSUB_C0271"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50132.1"
                     /transl_table=11
                     /translation="MTQAFINLAGADVVWLFDTATALAPNFLHSPVVLDVDDPKVVLP
                     VDELAKQSKLSLVNEMRMLMDKRVRKIVVTTEIIRRKFVKLGVDEEKIEVIPNGVDSE
                     LFKPSPLPDEPVVLYYGTFQPHRANLLIKVVEKITSIRSDVRFLLIGDVPKPMVDTLR
                     RMAGEKVELPGFIPRDKLPPFIQRSKICIFTQDRSLGGRHPAKLLDYMASGRPVVTTN
                     VDESFPIRESGAGLITPVDADKMAEAVVKLLDDDALARQMAARGVQYAKRFDWRNMVN
                     KYITLIKQVAQT"
     CDS             273305..274408
                     /codon_start=1
                     /locus_tag="CSUB_C0272"
                     /product="glycosyl transferases group 1"
                     /protein_id="BAJ50133.1"
                     /transl_table=11
                     /translation="MRVLFTASGEKVGGATLAMLHLMLGLPSQGIQPILLTPTTSAID
                     PSLAKKLVEKSVLIIEARRRMKGVLHWLWLFLTTLRLARKLGVKIIHTHGPKEAAIMG
                     LAAKILRLKHVYTVEGDPVIETFINKSGLKATITNKLLFKIGLRLADEVVGCSRWMAT
                     HIEKTYGRKATPIWNPIDHEKFSNSTEHQPDQKTILTAARLDKVKDIETLLHAIEDIE
                     PMNRPKLLIAGDGPLRETLTEIVKTKKLQDNVIFLGHRTDVEKLMAKASIFILPSIYE
                     PFGMAAAEALAAGKPVIASNIGGLREIVDHGVNGLLFTPKNHHELAQHITKLLQDKKL
                     WTTFSQNAREKSAIYKPENIAKRYLEVYRRCLG"
     CDS             274434..275399
                     /codon_start=1
                     /EC_number="5.1.3.-"
                     /locus_tag="CSUB_C0273"
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="BAJ50134.1"
                     /transl_table=11
                     /translation="MIIVTGALGFIGSHLTEALLDKGEQVVGVSHPKPPENNINILTS
                     HKAASNLRIIYSDLKNLDEVKQIMKTNAPTHVYHLAALASHRLSMSEPYKYLENNILT
                     TLNILEAARITEPGPRIVFSSSSSIYGNNTPPLREDMKPDPRGPYALSKWICEELCSQ
                     YVRDYGLNVVTVRYFNVVGERCRGNIVFRVFAEHASKNIDLEVYGRYINGVFKPAARD
                     FTYVKDAVQGTILAAEKGGKGEVYNIGFGRPVSVKTVAELIIKNLGSRSKIVEKELKP
                     HESLESYSDNTKARKQLGWKPVTDIEEMVKKFIEYWKNTTHDPLH"
     CDS             complement(275456..275749)
                     /codon_start=1
                     /locus_tag="CSUB_C0274"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50135.1"
                     /transl_table=11
                     /translation="MELSLKAALRPFGVEPPKWHDVGPILRRERSRFPPWMNEQIDEL
                     ASISRALRKERETAMYGDEELSLPPCQASSKPRITRDSQSPQSGTRHPSPANR"
     CDS             complement(275835..276356)
                     /codon_start=1
                     /locus_tag="CSUB_C0275"
                     /product="DNA polymerase beta domain protein"
                     /protein_id="BAJ50136.1"
                     /transl_table=11
                     /translation="MDDTLLAEPYRTLAQKLVESLRRRLGERLVSVVVFGSAARGEAG
                     KESDLDVMVVCEKLPMNRLDRTELFIECEKDLDMLLDTLCGQGYGISISPIILTPGEA
                     ARIPSILLDMTEDAIILYDRDSFLTNLLNSLKANLKKMGAERVWIGRKWYWRLWKGGG
                     VKRVKISGQSGDG"
     CDS             complement(276477..276632)
                     /codon_start=1
                     /locus_tag="CSUB_C0276"
                     /product="small subunit ribosomal protein S30e"
                     /protein_id="BAJ50137.1"
                     /transl_table=11
                     /translation="MPSHGSITKAGKVRSQTPKLEAKPRKSPFPRQRNRQNYLKRVLA
                     PATSQTE"
     CDS             complement(276701..277996)
                     /codon_start=1
                     /locus_tag="CSUB_C0277"
                     /product="hypothetical protein"
                     /protein_id="BAJ50138.1"
                     /transl_table=11
                     /translation="MLLGGLAYNTYVKGINTQITSLLYFNDPSLASSRRNSSNTPPCM
                     IRWNNGTPVYEFLRYWPSVYDKVLDEWLLSSSSSSKYPRVNSSGYYIVREKYCEFLID
                     IGREDVIDTALKNIERLHIYAGYRNPALSPVLFHDNLPNFLYLWNMEGRPPSKYPDRA
                     TRETILDNMLNRMKKNILDPYPDRKIIANIGTFSNEKFEYIVKFDYDGVLIEYFTRIF
                     NRTHTPSLLYQQFHALKNFPDSKFVVLVDVIPREYLELWNENPRLVPENVRRDFSFVL
                     AALYLVNRPNMYITLRGDEGGYPSSYILKDFYVPLGRPLHSFETLEGDEKNGALLLRR
                     YSNGLVLLNTASSKTFTYFISEKHRDRAGNIFTGLITIPPQTGLILYKNETETNREYD
                     TSTNTSTIFPHTTLSWQHLAADPPRTQKPKILTEPHPYG"
     CDS             complement(278083..278721)
                     /codon_start=1
                     /locus_tag="CSUB_C0278"
                     /product="hypothetical protein"
                     /protein_id="BAJ50139.1"
                     /transl_table=11
                     /translation="METATPYGIPLSNYFGGLGELETVVTNMRGPEGFADIFTPYWNW
                     IKWPEGSKGARAEASIDFSDFVSGAGSQKISIKRDNESGEDTRLILSSWKIQPKDPAY
                     KIFYPVPGDRLVFTFSYKTSEEIKNIEYTVMLNFIVSDNAGNERYLSPVHVLRTGEPT
                     PFWRKITFTAQVPANFTAVRVYLTFTCRKSCAGTFWFDDFVMHTEPEKRLPC"
     CDS             complement(278817..279209)
                     /codon_start=1
                     /locus_tag="CSUB_C0279"
                     /product="hypothetical protein"
                     /protein_id="BAJ50140.1"
                     /transl_table=11
                     /translation="MMKKVVLVFLLILLGLSSFWAGQLTAPFPQTIYSTVTETVTSLS
                     RFSTTVREFVSSIVTITRTVTKTTVEPTTEIGTPPASPSNLRVLNADFGQIVITWQDN
                     SDDEDGFRIERSEDNKIFSAIGVTPPAL"
     CDS             279441..280619
                     /codon_start=1
                     /locus_tag="CSUB_C0280"
                     /product="pre-mRNA processing ribonucleoprotein, binding
                     region"
                     /protein_id="BAJ50141.1"
                     /transl_table=11
                     /translation="MSRVIVAPTGVGWAGLDDGGRLVLFRPFSEKVDELVRIVSSNDL
                     PSGFVEAFLKELRDRGYSVLVYWDERVGDVLNKYAVSFGFSLERVEKRLVDVESLLPP
                     SEVERFRELVRAVSMAVARQRIMAEAGRRDLHIVHAVRVLDDLEKTKNQLYVRVREWY
                     SVHFPELSSLLTEGDDFLKLVSVPVLRHGLDERMVSKLLGPDLAKRVLEAAEKSVGGD
                     MGPGDAAMLSATASLGLDVSRLAEKTAEYIRELMASEAPNLSAVAGPVLGSRLISLAG
                     GLERLARLPASTIQVLGAEKALFRFLKTGRGSPKHGVIFQHPLIHMSPKWQRGKIARA
                     LATKISIAARIDYFSKEDRGAQLREALEKRVEEIRRKYASPPAKKTLAKQVERRRRRR
                     "
     CDS             280616..281311
                     /codon_start=1
                     /locus_tag="CSUB_C0281"
                     /product="fibrillarin-like pre-rRNA processing protein"
                     /protein_id="BAJ50142.1"
                     /transl_table=11
                     /translation="MKPSIRPHPRFEGVYLVEGVEGLRPATKSLDPGFQVYGEELVRA
                     VDGEYRVWNPFRSKLAAAILRDVKEIFIRPGSRVLYLGSASGTTVSHVSDIVGLRGVV
                     YGVDFAPKVMQQFIQKVAERRNNVVPILADASKPESYAHLVGVVDVIYADVAWPAQAD
                     LVAANARLMLRKGGGVLLAVKARSIDSVEDPGKVVDREVRTLASSGFEIRETLGLEPF
                     EKDHVMVAAVYLG"
     CDS             281316..281885
                     /codon_start=1
                     /EC_number="3.1.26.4"
                     /locus_tag="CSUB_C0282"
                     /product="ribonuclease HII"
                     /protein_id="BAJ50143.1"
                     /transl_table=11
                     /translation="MLCGVDEAGRGCVVGPLVVAAVAAERDELPLLRALGVADSKTLS
                     PRRREEIFEKLRASFRVGYMLVSPRRISSCLRVNGGDGLNDLEYGVMAELARSFRPRI
                     LFVDSPDRDVRRARRRLLEKLGVEMDVRCMVRGDRRHVLVAAASVVAKVVRDRKVAML
                     RRRLGDFGSGYPSDPRHGNGFSRTLDRQP"
     CDS             281964..282488
                     /codon_start=1
                     /locus_tag="CSUB_C0283"
                     /product="nucleotide kinase"
                     /protein_id="BAJ50144.1"
                     /transl_table=11
                     /translation="MTGRPGVGKTTALMSVVELLRKDGVRVGGFYTRELRETGVRKGF
                     EVVDIISGETALLASVSTTPGPRIGRYVVMLDNLERLGVGSLEKGLETCDVLAVDEVG
                     PMELLSNKFVETVEKILRSGKPSIFTVHVSATHPVAKSVRKLAGENLYLLDTVNRDRV
                     PQVVYEVVKKWLRS"
     CDS             282548..283648
                     /codon_start=1
                     /EC_number="2.1.1.32"
                     /locus_tag="CSUB_C0284"
                     /product="tRNA (guanine-N2-)-methyltransferase"
                     /protein_id="BAJ50145.1"
                     /transl_table=11
                     /translation="MAPMFPTTNVGEPAAPTRSPVFYNPYSALSRDLTVVLARTFGDG
                     VVVAEPLAGSGVRAIRLLVETNTVARALMNDINPNAVKVMRLNAEWNGVAERCEVFEG
                     DAAVFLTRLSGWRDRVHYVDVDPVGAPVKFVENSLRAVANGGYIGVSATDLAPLVGNH
                     PETCFRKYGLLSGKTFFPKEAALRLLASFVIQRGAALNIAATPVLSVQHRHFVRVFFH
                     VLRGRSRVIKLLEKIGWIKSCNCLYKEVFSLQDFPDRVCPRCGGEAAVVGPAWLGPLH
                     NGELVEKMLALSTDLPKAQKILERIRGEDDVVGYYPVDRIAHVRGVTPRSPLVLVASL
                     RSMGYRASLTHVDPTAVKTDAPLEDLLKAAAG"
     CDS             complement(283599..284273)
                     /codon_start=1
                     /locus_tag="CSUB_C0285"
                     /product="ribosomal RNA large subunit methyltransferase E
                     FtsJ"
                     /protein_id="BAJ50146.1"
                     /transl_table=11
                     /translation="MTKEQWLQRRREDPYWRKAKEMGYPSRAAFKLLEIQSRWKIIRE
                     GQRVLDLGAAPGGMAAVASDIVGEKGLVVAVDRQPLQLTRPNIVTIQADIYEARLTRD
                     VQTALGEEFCDVVVSDLSPHHSGDYDLLVEQQIDLLEASLNLCHRFLRRGGNAVFKAF
                     EHPRLRDFEKRMMRCFWKVERYVPRSTKKGSSEIFLLGLGYRGPPRRRLIQQRPSANP
                     REEHQF"
     CDS             complement(284275..284622)
                     /codon_start=1
                     /locus_tag="CSUB_C0286"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50147.1"
                     /transl_table=11
                     /translation="MPAKLSKLEEKALALLMQNEVGMLQSELWHKLGVTSREGSRIGI
                     KLERKGYIKRVKAFSNDRWTRRLVPLIKQINIQPLIGVPCPSCVYDNVCGPRGEPHYK
                     TCILLEEWLSGRK"
     CDS             complement(284669..285376)
                     /codon_start=1
                     /locus_tag="CSUB_C0287"
                     /product="transcription initiation factor TFIIB"
                     /protein_id="BAJ50148.1"
                     /transl_table=11
                     /translation="MAERTASTTPTKKMLLDSRGGVGPRVTSLLHDGGIGTISKGRLL
                     SSEERLLSRLLSEVFWIADKIGLPRQAAEGAGELARKAVSSKVVKRSRRPAAAALVYL
                     SANNNGLCKSIEEIASAADVPLNQLNREISKLVFGLNLRLKPFNVAALIDKLTRTLEL
                     PPTTANTACRIYQSAASLGKISGRKPAAISAAAVYLACRREGVKKPLSTVSEAAGISV
                     LTLRKAIALLESAAGFK"
     CDS             complement(285460..285708)
                     /codon_start=1
                     /locus_tag="CSUB_C0288"
                     /product="RNA-binding protein"
                     /protein_id="BAJ50149.1"
                     /transl_table=11
                     /translation="MVNRQTLRRLKLLGEVLHSRRDYLVIRAYTVPRLGDKVYNGKGR
                     EVGHVSNIFGPVAEPYVAVKPAAEAEVVEGEALYVEKS"
     CDS             complement(285698..285985)
                     /codon_start=1
                     /locus_tag="CSUB_C0289"
                     /product="signal recognition particle subunit SRP19"
                     /protein_id="BAJ50150.1"
                     /transl_table=11
                     /translation="MIRREGLILWPVYFDSKSSRKQGRRVSRGLAVQRPSADDLAAAC
                     RRLGYEVEKNDAAYPRRWSRRTGYVVVKPRPKISKNMFLKMVAEELRKHGK"
     CDS             complement(285982..286371)
                     /codon_start=1
                     /locus_tag="CSUB_C0290"
                     /product="small subunit ribosomal protein S8e"
                     /protein_id="BAJ50151.1"
                     /transl_table=11
                     /translation="MVQWHSDLHKRKKTGAKAHPARGRRKRERGGEINLVSLGEQKVV
                     TRRVSGGNLKAAVLSTKTANVAVGPVVKRLEILRVVSNPSNRDYDRRKVITKGTLIET
                     SEGLARVTSSPGQDGTVNAVLVKQGGA"
     CDS             complement(286301..286897)
                     /codon_start=1
                     /locus_tag="CSUB_C0291"
                     /product="segregation and condensation protein B"
                     /protein_id="BAJ50152.1"
                     /transl_table=11
                     /translation="MAEALLFASDKPVDIKTLQRALKTRSPEKVRKIVETLKNEYSGR
                     AVEIVELDGGRYYMRLRPDLAAHVKKYTRRRMLPHGVLKTLATIAYYQPIPLSTLAAI
                     RGKDSYRQIKILQERGLVESEKKGRTSVLRTSRLFADFFGVENTPSAIKSLIDKMLAS
                     GGETTIKHASTPKKQNGSVAQRPSQAQKDGGKGSSSEG"
     CDS             complement(286890..287579)
                     /codon_start=1
                     /locus_tag="CSUB_C0292"
                     /product="segregation and condensation protein A"
                     /protein_id="BAJ50153.1"
                     /transl_table=11
                     /translation="MRLDNGFAEQLMTAPWRILFDVTRLDRVKVWEVRLSEVLTEFAQ
                     VLRIQGYIDFNICGIAVHSAAIIHRIKSEKLLQADQPPKPKPKPEINIMPPIELPFKP
                     ELITATVQEIVTALQKALSQSGRSKTEAAPPQIMENRLILNEFIVKIEEELDKFIEKL
                     REIFSVRTSITFSELVEGMPRLEAAKTFILLLFAAARRYVLLLQADEFSDLVILGGEL
                     SGASGGQQAGG"
     CDS             complement(287566..290925)
                     /codon_start=1
                     /locus_tag="CSUB_C0293"
                     /product="chromosome segregation protein SMC"
                     /protein_id="BAJ50154.1"
                     /transl_table=11
                     /translation="MAITGFKSFGNKRTVIKLPPGLVVITGPNGGGKSTVLDAVKFAL
                     GELSAHNLRVDRFSKLLHESSKGTDAQALVTLTLDNSDRSIPIDSEEVVISRRLYATG
                     ESEYMLNNRIVSRNELLTILSAANIKPDGLNLVTQGSVVGIAEMTSRELREVLEDAAG
                     ISGYKKRRDEAYKELEIAQKNIDIAKAATSEVRSRVKQLELERNQLLRKTLAEKILNT
                     LKSLSLINEYNSHAQALRELDARAAELLNKLAEKQAEAEQVRARVSALKNEVEELERR
                     QREVATEVSKIDRAVLSLETEKSRKIAEKNSAENALKQLDLQRRSLETRVAKWRERQQ
                     QLKEESEKKTQQVENLREQWAVREAEYNESKKLLEELQKEVDEAENRYAAKVEELRFL
                     KLSDDGKSLLLDNIQKQLTRKQQEKEEAEKRVAETRNSLSEKTEQLTRLTESMEKLTQ
                     LLETQTNTAKNIRRELESRREKIASIDKLLEKTRLLKAAGQQLRETLQAAVKEDKKTS
                     GLKTVREVFGEKLTGIHRAVLGDWLNAVYVADAEAGFSLAREAAEKKIPLKIVAESLE
                     LDSLVKALTHGAGFRAVDSVKQLQPGDRYVATMDGVYVDEPGIISVAGEMSETVAAER
                     VNRSMERLETIEAKLLNAREAFDKEVKLAEKRLRETEAEAEETRRQLNIKALEKTRLE
                     TELNNLSKSAENSLQRLKQLEEEVARLVQEKEKLTQLLSDKTDEITALTHLRQSVAEK
                     KQVLRKAEEDMRRKSQESSTTYRAYVNAERERDRILIELKNIEESLAGAEKEFEQIAL
                     RERELATELEQIRGMIEELDQKIVEASELKEKMDNELSQLTGVLAEKSREVKQLEQHL
                     TTLLNEVSALEKENNNLAIERVRIETTLKSIGERLQSFTSAEEAETSLPLDLIPQLET
                     EVAEIPVVNQLAAMQYDGIVENYRLRSTRINELEMERKRILDLIESINREEVDAFRRA
                     LDRVSDSFSFYFNQLTGGEGFLKLENPDDPLNSGVEMLVKFVGKQTRSTVSISGGEKS
                     VSAVALILALQDLTPAQFYMFDEIDAHLDVVYVKNLVNLLKKMSTKKQIIIITLKDII
                     AEQADALYGVYMANESSHVVRTRLSEVVEAG"
     CDS             291270..292133
                     /codon_start=1
                     /locus_tag="CSUB_C0294"
                     /product="hypothetical protein"
                     /protein_id="BAJ50155.1"
                     /transl_table=11
                     /translation="MNIVEKLGRREIYPTVFEYIGDRRMAVGYDTMPAETYQSIIKNY
                     PSLSLTCVKDLVYEQRQSKSDYEIELIRKASSIVSFAMEIVREVIAGGTTASDIRRAL
                     ADNIYRLEADLPYSPHISIGEDTFLNTDSPPSRGIREGEIVKITFAASVQGYISQISR
                     TYFYKKSQEKIKKTYQQLIRLKEYITSLLSVWSSAVSVYDRARAFAMEIGLDPTSLTL
                     FGRGVGLEAEEHPFIDAASTDIIREGSVISVGPDLLLPGRYGLSVSDIYLVTSRGVEK
                     LTDAEVEMEVG"
     CDS             complement(292130..292912)
                     /codon_start=1
                     /EC_number="2.5.1.31"
                     /locus_tag="CSUB_C0295"
                     /product="undecaprenyl pyrophosphate synthetase"
                     /protein_id="BAJ50156.1"
                     /transl_table=11
                     /translation="MLRKLLQLMGVYWLYERWLLRNVSSGQMPSHVGLILDGNRRWAR
                     VRGWPPWKGHAAGADRVEEILDWLLELGIKTVTLYILSTENLRRPMHEVEEIFRLIEE
                     KAYSLLRDPKIYKHRVKVKVIGRKDMLPPNVVEALEKLEHATERHDNRFLNLAIAYGG
                     RLEILEAVRQIAEQVKTGQLSPEQIDEKTFEKHLYTNGVPNPEPDLIIRTSGETRISN
                     FLLWQSAYSEFVFQDVNLPDFRYIDLLRAIRTYQSRERRFGL"
     CDS             complement(292920..294104)
                     /codon_start=1
                     /locus_tag="CSUB_C0296"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50157.1"
                     /transl_table=11
                     /translation="MAEDGDRLLIIVVDRDDDLGVKAGVSGPVVGRDANLDAAVRLAL
                     ADPEDPDANALFYAVKLYDQLTQSKTGEEVEVATLTGSRKEGMEADMNIFNQLREVLE
                     KFPAQRCIFVSDGETDAIVTPIISSQVAIASVQRVTVKQSQTVEQSWLILGKYLRLGI
                     TDPRYAKFIIGIPGGFIALSALLNIFGLAQPSILLLFLGLLLFLWGFRIDIHLSRLFT
                     GFYKISQMPAIGQIRAFAYLGAGASLLIGLYLGLSSTYTTYVSLNLSGEQLLDPTILL
                     PTALRLSGVFISQSIDFIAISAILVVLSNMIYYYIIRYYGFWRTIHAGVLAIWLWALL
                     KRAGVLLQQPQPTTITESSTFLFILTAVMGVVTLGVTFAMTRVLRSIYGKQFRKGAAK
                     KQ"
     CDS             complement(294828..295217)
                     /codon_start=1
                     /locus_tag="CSUB_C0297"
                     /product="DNA polymerase beta subunit"
                     /protein_id="BAJ50158.1"
                     /transl_table=11
                     /translation="MSIIYHEVLLHEVVDKVRAFFERMPEIRFAVIFGSAVRRRLVRD
                     IDIAVYARPELSLRKLIEVANVLEDLLGTPVDLIPIEQTSPKQRVKILTEGIRVITRD
                     SAIPSSLLSRALSENMDVEIKLREGKN"
     CDS             complement(295214..295624)
                     /codon_start=1
                     /locus_tag="CSUB_C0298"
                     /product="hypothetical protein"
                     /protein_id="BAJ50159.1"
                     /transl_table=11
                     /translation="MPVDPALVRARISDVRLSVNELRRLTSRPFSELDVDQRYSMRYN
                     LIALVESLVSLCTHLCMEAYGKTPTSYREAIKCVAERLTLSCVKDLQALVGFRNLLIH
                     RYWTVDDERVYREILDDFKCVEEFLYAVEEAFTR"
     CDS             295711..296064
                     /codon_start=1
                     /locus_tag="CSUB_C0299"
                     /product="hypothetical protein"
                     /protein_id="BAJ50160.1"
                     /transl_table=11
                     /translation="MGEEKFLTICCSRSAYHRLQKCGNVIKALASDSMPIIVNATFII
                     GKFTATTTAKMELEDTITLITELGIPIEIIQPTDQSYKGIQQLLEEAQQKEKQLEAHT
                     LKEVEKTLKRIKTTS"
     CDS             complement(296099..296518)
                     /codon_start=1
                     /locus_tag="CSUB_C0300"
                     /product="small subunit ribosomal protein S19"
                     /protein_id="BAJ50161.1"
                     /transl_table=11
                     /translation="MEMVRELTYRGYTVDQLKTMSMDAVIKLLPSRARRSLYKRGLTP
                     AQSRLLLKIRKAKKLLESGQKLEKPIKTHCRDMFILPEMVGLTIHVHNGKEFTPVEIT
                     PEMIGHRLGEYAITNKRVIHGRAGIGATRSSMYVPLK"
     CDS             296611..296898
                     /codon_start=1
                     /locus_tag="CSUB_C0301"
                     /product="hypothetical protein"
                     /protein_id="BAJ50162.1"
                     /transl_table=11
                     /translation="MLSVVGTFVLVGDKEVLKIEISRHIAEKFRRWVAERYGMKRGAL
                     SRAVEDLIAKTIGENGHGGVEAIVCVGLLSGYIWRGEDLCEALPAKHVSIL"
     CDS             complement(296926..297651)
                     /codon_start=1
                     /locus_tag="CSUB_C0302"
                     /product="large subunit ribosomal protein L2"
                     /protein_id="BAJ50163.1"
                     /transl_table=11
                     /translation="MGRNIRAQRIGRGSPRFIASKHRRYMVGYPSQLFSGKNLITAVV
                     SDIVHDPGRGAPVAVLRHDGAEFYVPAVEGMYVGQVIEIGEDAKPAPGNILPVGKVPE
                     GGVVSTVERIPGDGGKLVRSSGAYALVAAQLGDRTVLKLPSKKDVEVSAKAFAVMGVV
                     AGGGRGEKPFLKAGAKYYLMRARHRYWPKSRGVAMVPAVHPFGGGSHKRIGRPETVKR
                     TTPPGRKVGLIAARRTGRKKKST"
     CDS             complement(297663..297923)
                     /codon_start=1
                     /locus_tag="CSUB_C0303"
                     /product="large subunit ribosomal protein L23"
                     /protein_id="BAJ50164.1"
                     /transl_table=11
                     /translation="MNPQDVVKRIYITQDTVSLIESENKLVFIVDLKADKHTIKNAVE
                     QLYNVKVDKVNTLITSRGEKKAFVKLKPEYKASELAVKLGIF"
     CDS             complement(297920..298738)
                     /codon_start=1
                     /locus_tag="CSUB_C0304"
                     /product="large subunit ribosomal protein L4e"
                     /protein_id="BAJ50165.1"
                     /transl_table=11
                     /translation="MNFTASLLLQRPQQLTVNVYNLEGEAAETITLPSIFSAPLREDL
                     VSRAYIHLATHSLQPKGASKMSGHKHSIESWGPGFGIARISRIKGRGTPKYGAGGMVP
                     SAVGGRPTHPPTPEKKIHKQINKKELRNALLAALAFTASPQHVKTRGHRITEQTLLPI
                     IVDDGLEALSKTAEVRRVLIKLGLGDELKRCGVKKVRAGKGKMRGRRYKRRKGPLIVV
                     AADRGVGKAASNIPGVEVVTAKDLSVLHLAPGAKPGRLTLFTKSALKALEERLK"
     CDS             complement(298742..299704)
                     /codon_start=1
                     /locus_tag="CSUB_C0305"
                     /product="large subunit ribosomal protein L3"
                     /protein_id="BAJ50166.1"
                     /transl_table=11
                     /translation="MGRRKYSRPRHGSLAYLPRGRAASILPRVKHWPDGEGVLGFIGY
                     KVGMTMVHYIDNTPNSPTQGSEVAKACTVVAAPPLKVIGISLYRNVDGELVNIGKYWS
                     KEVPEDVKRRNPTFRPMPSAEEIGQLEDDVDEVRIVVATQPRLVGAGKAPRIAEIKIG
                     GKPAEALEKAKQLVGKDLRVTDVFKEGQFVDVIAVTKGKGFQGVVKRYGVSILQRKSR
                     KTRRGVAAIGPWNPHYVMYTVPRSGQMGYHRRTEFNKRILRIGDDPASINPKSGWHRF
                     GLVKSDYLVLEGSVAGTPLRPLVLRAPARPPKHMEAPEITLLEV"
     CDS             299736..300269
                     /codon_start=1
                     /locus_tag="CSUB_C0306"
                     /product="hypothetical protein"
                     /protein_id="BAJ50167.1"
                     /transl_table=11
                     /translation="MIKTLTGFTRLICRPNSMKTMKDEVTDEIISLITAENVVGLATH
                     RHYPRERIIYSRFGRCGFAIDVVKMVDGVRKTFSVLVEAYVDTSSDKVEDFFKLPGKI
                     LYTLSSPSDGGRVLKRREAAYRDGEDLFSRVERVRRSFYSVYSRLKEKEKEAVTRIGE
                     EIFHAVGLTADELHLGV"
     CDS             300474..301673
                     /codon_start=1
                     /locus_tag="CSUB_C0307"
                     /product="hypothetical protein"
                     /protein_id="BAJ50168.1"
                     /transl_table=11
                     /translation="MMKYLLTSAGDEGPRTFRASQSIDLGQMTLYVEGETMDVKGFFE
                     GLRDDEALVIIYAPAEKTPTVPHRFERAVEWMRMFEGFAGGVVGGGFVFRDVVGLVPV
                     FVGGGRFTATNVRAEALARGLEPLPPATVLDTTADKTIRYHEWGKNEAGPHQVLEALR
                     HAVEKFCPHRVSVFFSGGLDSLILAKLIQDRSGSPLLLTVGTVESHDFAAAESAASFL
                     GLEVEKVVVEEKNVAEALEMLENVLGPLGDMDAAIAVAMYLLSKKAVEAGCGTAVLGQ
                     GADELFGGYMKYERILHEKGYQVLEQVMLRDFEMLAAEGLVRDFTAVRLGGAYPLPLY
                     LTRNVVSAALSTPVEHKIHVQGGRVVRKHVLRIVGRMLGLGDLADRGKKALQYGSGLM
                     KMVRRLR"
     CDS             301670..302137
                     /codon_start=1
                     /locus_tag="CSUB_C0308"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50169.1"
                     /transl_table=11
                     /translation="MKQLVSALLLLKRLPRTGWLEEGVKNPESVASHSYSLAVMTMVE
                     AEARGLDVCKAVKMALLHDLAESYTGDLTPATKKKIPKNILQQVEKAIVRELFSSLPP
                     KIAQQYTELHQEYLGRRTPEARLVHKLDRRELVEEALWLNKRQKISLKRFGIA"
     CDS             302166..303239
                     /codon_start=1
                     /locus_tag="CSUB_C0309"
                     /product="DNA primase large subunit"
                     /protein_id="BAJ50170.1"
                     /transl_table=11
                     /translation="MSVDDYVVKALLSGFPFLREVRDYVAQQGLRLEDFDGNNEYLEA
                     AVRRVEEALRRWPARRPQPLETSDVEIYSHPLAMALVAMLDSSFAKRRFAAYEAERYA
                     TMLKNIREDQVKAVGYVMSEVLGMRIKEGQPPHEFWIHFVDYLKHATPLNEPRFKLVN
                     RILDKGYVAVTRSEAITLVKNGLEKLIHQRLEKMGSLTPPPFLEKHVERLKKLLESVH
                     QREAAPAVRLDPDKWPPCMQALRKRLLAGEPVSHFGNFAAAAFMLRIGMTVDEVVNIY
                     SQRGDFDPRIARYQVEHIAGLKGSRTKYSVPRCATMQTHGLCIEEGRLCGGVKTPLQF
                     YKRVRAGMRNERSGANASPGGQT"
     CDS             303271..304413
                     /codon_start=1
                     /locus_tag="CSUB_C0310"
                     /note="major facilitator superfamily MFS"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50171.1"
                     /transl_table=11
                     /translation="MTIIVQTFVVHVPITISLLGGSAALAGLGSALMWGGRIVTTYQM
                     GRLMDRVGRMPVIYSGMVVAALSAAAAAFFYQQRFMEAFLMVIVLFGVGRGMADYGRM
                     AAGDMLPPEKRGLGTGVILTGSMVGTLAVPPIIAAVQMLSGGENIAATYLALTPFAAG
                     GFAAAYAVKPDPLQIAKTLRQGNPSETHQQAVRKISEIINRRMVFAIVSAAVSTGVMV
                     AYMSLGSLLLHLGHVETTVISAVVTLHVIGMYAFSIPLGKAADIVGRVPVTLVGVIVC
                     SIGSYIMSVGKSLDIVTIGMFLVGVGWSAATVASIALISDETQPAERGKAMGLNDTAT
                     ALTSLTTPILLSVIFQNYGDTALGLAGLAAATPTIILAITAKRKKV"
     CDS             complement(304693..305304)
                     /codon_start=1
                     /EC_number="1.15.1.1"
                     /locus_tag="CSUB_C0311"
                     /product="superoxide dismutase"
                     /protein_id="BAJ50172.1"
                     /transl_table=11
                     /translation="MTMKKYSLPPLPYAYNALEPVISAEIMTLHHTKHHQAYVNGANA
                     ALERLEKQRKGENPENIRGILRDLSFNLSGHKLHSVFWPNMAPPGKGGGTPGGAIADQ
                     INKDFGSFENFKKQFSDAAKNVEAVGWAILTYDPESETLVIYQVEKQNFMHPPDLPLL
                     LTLDVWEHAYYLQYKNDRAAYVDKWWEVVNWDDVEKRFSKLKV"
     CDS             complement(305346..306311)
                     /codon_start=1
                     /locus_tag="CSUB_C0312"
                     /product="hypothetical protein"
                     /protein_id="BAJ50173.1"
                     /transl_table=11
                     /translation="MPFAMLAERLGVVRVVSAGLVVYAVFHFVFATSSTWNEILFYRF
                     LQGFVGGAVFIPTLQLAFEVGDERRSFATGFVACGFNAGTGLGAYYSFAASGGKWQAG
                     LVSATLVFAALIPVASILMFTAQRRRLEKRPTDFSKNSGFYFLNILHFVRLGVIIAAT
                     TWMPTALASLHGLSGDSAAFYASILQMAGIVSLTVGGYLTDMLGKGRVLVMNVAALAA
                     ALAVSQFVPGWLLLPYVALLGFLIYLPTPAAFAILRDMYHAGGASVAAGYLNTSAAAG
                     AITMPYLFGVLHDVLHGFASSFYLAAALYLILLPLIPTLSKKQLK"
     CDS             complement(306618..307820)
                     /codon_start=1
                     /locus_tag="CSUB_C0313"
                     /product="hypothetical protein"
                     /protein_id="BAJ50174.1"
                     /transl_table=11
                     /translation="MAHIYHKKNISHKIMSTSMTSRKATVIVAVLVIAILFVGLVLDD
                     AEAAKNPRRTRTRTRTSTTLSTTPTSTITTTSSQTTTSQQYSDTFPAVNPLILGNCPP
                     EVHDRYFVIGPDGRKYRTWHPVTVPIDPGDPSKGMCTFAHEHGDNPRQGRFIDLPPFG
                     YAAKVGGMVEEIAAHAGFKVFYKRMAGNGLGNNAEWRIVVHQGTAGARRLVQSLHSIQ
                     IDVVDSAGRVTKVSLMAPTGELNPKCGPRVGDRIVPDEECVRRGLFYEVWYFAVRVGT
                     GQVNGAKFFAAPGIAVYNPMTYMKVGDLSRVYPISEVVEGLPFGDPRSFFLGNMRAVE
                     HPDYGWGNPGPSQFWTDAFGREVSGSCDPTRCIMQTVPAGYYAWFDDDSVFDWPWIDL
                     PLGAAGGN"
     CDS             307901..308554
                     /codon_start=1
                     /EC_number="4.2.99.18"
                     /locus_tag="CSUB_C0314"
                     /product="endonuclease III"
                     /protein_id="BAJ50175.1"
                     /transl_table=11
                     /translation="MDRDAFAQVVEVLKKRYGNEPFPVHVADACAFKVLVGAVLSHRT
                     RDEKTDEAYHNLFTWFNDPRDIASADVRTVARLIKPVGFYRQKAKRIKQLAKIVYGKL
                     GGRVPDNRAELLKLPGVGPKSADIVLSIAFNRPEIAVDTHVETVAKRLGIADGKAGYE
                     EVKKALTTLSKPDDIRLINHLFVKFGREICRRPRPRCSLCPITEYCRYYREVIAPVS"
     CDS             complement(308535..308993)
                     /codon_start=1
                     /EC_number="1.11.1.15"
                     /locus_tag="CSUB_C0315"
                     /product="peroxiredoxin Q/BCP"
                     /protein_id="BAJ50176.1"
                     /transl_table=11
                     /translation="MKPEAGDRAPDFELPDHQGRKTSLKQLLSNGRALVLYFYPKDDT
                     PGCTTEACGFRDSMEKLSKHGVNVVGISVDSPESHQKFIAKYGLNFTLLSDSGGKVAR
                     LYNSYSEEKGRCIRKTFIIDRDGVIRAAFHKVVADGHAEEVLETIKKLGL"
     CDS             complement(308990..309343)
                     /codon_start=1
                     /locus_tag="CSUB_C0316"
                     /product="iron-sulfur cluster assembly accessory protein"
                     /protein_id="BAJ50177.1"
                     /transl_table=11
                     /translation="MEVQKEAFKLTVTERAAKKIAQLIEQEGGSDKMALRIYITGGGC
                     SGYRYGMALDENVYEDDVVVNAHGVKVVVDSFSAPFLEGSEIDYIEDVMGSGFAINNP
                     NVVSSCGCGQSFNLK"
     CDS             309429..310076
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /locus_tag="CSUB_C0317"
                     /product="DNA-directed RNA polymerase subunit D"
                     /protein_id="BAJ50178.1"
                     /transl_table=11
                     /translation="MKIVAEDSESITLDVTDLPHPLANALRRMIIREVPTMAVEEILV
                     IENSSPMTNEVLAHRISLIPFITDLDNFNVAEECSCQSRLGCEKCVVRFVLRAEAADQ
                     PVTVYSRDIKPERHDTKVAPFDGNIPIVVLAPRQKIELELYVRLGRGRKHAKWQSGIA
                     TLYQENSRWLLYVESYGFLPPRRMVLEAARIVKTRIEEIGAGLKELMAREPQSAG"
     CDS             310066..310389
                     /codon_start=1
                     /locus_tag="CSUB_C0318"
                     /product="large subunit ribosomal protein L18e"
                     /protein_id="BAJ50179.1"
                     /transl_table=11
                     /translation="MQAEITIRKLGGKTRFAKRLLKELRRSRRSTREVNISRLQRNTM
                     DNEVVFVPGKVLGQGSLTKKLTVGAFSFSQSAIQKIQKAGGRALLLEEFLREFGKGSG
                     VRIIG"
     CDS             310400..310837
                     /codon_start=1
                     /locus_tag="CSUB_C0319"
                     /product="large subunit ribosomal protein L13"
                     /protein_id="BAJ50180.1"
                     /transl_table=11
                     /translation="MVDAEGYRLGRLASYVAKLLLKGHRVTIINAEKTVITGNKPAIL
                     EHYLMLRNRKQFSSHKKITVWYPTKPDAILRLAITRMLPRKKPRGREAAKRLVVLKGP
                     ANVEGEKIEFEDAKLTKLYNRSAKIIRYITLEELSKMLRGGRE"
     CDS             310834..311229
                     /codon_start=1
                     /locus_tag="CSUB_C0320"
                     /product="small subunit ribosomal protein S9"
                     /protein_id="BAJ50181.1"
                     /transl_table=11
                     /translation="MRKAEQIFVGKRKTSVAKVFLRPGKGNIFVNKTPLELFNEFFRS
                     KVLTPLLLLPEFWKKHDFHVTVKGGGVMSSAEAIAIAVSKAAAAESEEYKQRLESYDR
                     SLLVDDPRRAEPKKPNRRGARRKPQKSYR"
     CDS             311239..311457
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /locus_tag="CSUB_C0321"
                     /product="DNA-directed RNA polymerase subunit N"
                     /protein_id="BAJ50182.1"
                     /transl_table=11
                     /translation="MMFPIRCFSCGRVIAHKWDEYQRRVSEGQHPRDVLDSLGFKRYC
                     CRRMFISAVNVMDELIEFHQKYSEATSA"
     CDS             311460..312704
                     /codon_start=1
                     /EC_number="4.2.1.11"
                     /locus_tag="CSUB_C0322"
                     /product="enolase"
                     /protein_id="BAJ50183.1"
                     /transl_table=11
                     /translation="MARESFTITDAEAWVVLDSRGSETIEVTLYSGKVSATASAPSGK
                     SRGSREAVPFPEGGAKQSVKLFTSSLRSRLVGRDPADQTDIDTLLKEVDGTENFSKIG
                     GNLAYAVSACSVKLAAMLKQKPTWRHVADLSGLAPVYPIPLGNVLGGGAHAGEGAPDI
                     QEFLVFPRKPGSVEEAVRMNVEVHKRLGKVLAKKVGGYGGGKGDEGAYAPPVDDEKAL
                     EAVKEASEGLDVGFGLDVAASSLYDAARKNYHYRNRGKHLTREQHMQHISELVEKYGI
                     SYVEDPFEETDVEGFAELCKAFPKLLVCGDDLVVTRAELIRWASEKRAVKAVILKPNQ
                     VGTITDTVEAAKEAEKRGIVRVVSHRSGETCDSFLTHLAIGLGGKFIKAGVAGVKGWL
                     RQMSCYGYGTRLAAQLACRRLM"
     CDS             312706..313332
                     /codon_start=1
                     /locus_tag="CSUB_C0323"
                     /product="small subunit ribosomal protein S2"
                     /protein_id="BAJ50184.1"
                     /transl_table=11
                     /translation="MTMSAEQEAEILEQLVKYNVHVGSRIKVKHMEPYIFRMRYDGVY
                     LFEVKKILTRLNLAAKLISYYDPSEVLAVSTHVFGMKAVQKFAELTGGMAMAGKMMAG
                     MLTNRTLKNYTEPSIVIISDPRYDAQALEEAAIARIPVIAMCSTDNTCSNVDLVIPMN
                     NRSRTSLPYAFWYLARRVLEERGQLTPDFDALVKPEDFMALPSSAETE"
     CDS             complement(313298..315445)
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /locus_tag="CSUB_C0324"
                     /product="DNA polymerase I"
                     /protein_id="BAJ50185.1"
                     /transl_table=11
                     /translation="MLVCVDGFLLDVWCRDDGVVAWVRRRSGVVRVVVGWWPRLYFAG
                     PLDVLAEVERVLGERYVVRRVVKKVLGAGVVEALEAETPPSEKRFLADFVEERWGCRG
                     IRVYNVDLPPAQEFLYSHGLATTAAVEEKDGRLYAAEDLGNLFYDISFLHVAYLEATV
                     ASSTPFPRFIHPLKNVKVVCGGEEIVLDGDEEKVLMELVHVLDEFDVDVVVTYGGDSF
                     LMPYLRYRARVNNVELRLGREEDPRGRSRGFSYMSYGRVYHSYSGYRLRGRLHIDADN
                     SMLYRETGLHGVVEVARVAKLPVQDAARYTIGRCMTSLQYHQAFLNDVLIPVECGRPT
                     CMTGKELLRADRGGWILDHQPGVYWNVGELDFHSLYPMLMLKHNISGETVNCRCCSGD
                     DIPELGYHVCGKWRGIVPRAIEEPLRRRLEYKRLYQEGGDKVYKARADALKWILVTSF
                     GYLGYRKAKFGSREAHMAVCALARDTLLRSVKLAEEHGFKVLHGIVDCLWIWRRDASE
                     EDYRAFGEALEKRLGLPVGYEGTFKWIAFLDSRTSPGRPVNNRYFGAYVDGRIKCRGV
                     EARRRDTPPLVRRMQQELLTKLAEVCSPRDVPQKLEECHEIFKRYLRMVYLGSVGVEE
                     LAVTRSVSGPVESYGRRIKHVEAAKMLKQMGASVSPGQSVSYVVKHGAGVPLQLIRGR
                     DYDEEYYVEFLRRGYETVVSPFSTLFQRSWEAP"
     CDS             315519..316445
                     /codon_start=1
                     /locus_tag="CSUB_C0325"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50186.1"
                     /transl_table=11
                     /translation="MSMVVFFGAVVPRYDVDFRKVVDTVVMFEELGFSSVWVTDHLQP
                     RRASRILESWTLLAALAPVTDARLGTVVLCSCYRHPSLLAKMAATLDTISNGRLELGV
                     GTGSEPQTEEMQALGMETWPPKEKIQRFKEYVEVLKLLLSDGGPVIYEGKFYSLRAAL
                     RNTPSIQKPHPPIWIGARGRKMVKLAAEIGDGWNFYGETLTEYREAVKLFDDESAKLG
                     RKPSKAIFTNLLLYKDDADKMEKMKHLGSHGSEQEALRKTYTLLHGTPDQVIKQVEEL
                     QERGVGLIILRDMDPEASSIKAFAKEITPSIK"
     CDS             complement(316569..317021)
                     /codon_start=1
                     /locus_tag="CSUB_C0326"
                     /product="PilT protein domain protein"
                     /protein_id="BAJ50187.1"
                     /transl_table=11
                     /translation="MKEIVYLDTSAIVKRYVDDPGSEFVRSLYRKAYTGEIKLASSIW
                     NVGEMLGVLDKAYAVGRINGGDHVAARRRFLNELNRQTRFGTLTIIHLRVSILINSWQ
                     LIEKHHIYQADALQITSAKYVSADQIVVADKKLYDVALREGLKAVYVG"
     CDS             complement(316993..317265)
                     /codon_start=1
                     /locus_tag="CSUB_C0327"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50188.1"
                     /transl_table=11
                     /translation="MPSKVKSSVYIDGEIWRRFKKYAAEQEREASVLLEELMREELML
                     NLQDALEELTEQEGIELDFEPVKPITGLVSSLVREMRDERNSLSGH"
     CDS             317368..317580
                     /codon_start=1
                     /locus_tag="CSUB_C0328"
                     /product="hypothetical protein"
                     /protein_id="BAJ50189.1"
                     /transl_table=11
                     /translation="MENLGVTIHKLRGELKHFSTKALYRYGITFYDSAYVRLAMMENG
                     ALYAADKEVVAKTMLPNVKHLSELAP"
     CDS             317638..318060
                     /codon_start=1
                     /locus_tag="CSUB_C0329"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50190.1"
                     /transl_table=11
                     /translation="MAVKIVYDTIVLNTRSRVELHDVSHEVERVVAASGVKQGLVNVF
                     SQHTTFALYLNENESNLRRDVLEFLEKLAPQREGYHHDTIDPTANTFSHLRSILLSHV
                     ITLPIRDGKVVRGTWQSIIAAEFDGPRTRRLLVQVLGE"
     CDS             complement(318064..318606)
                     /codon_start=1
                     /locus_tag="CSUB_C0330"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50191.1"
                     /transl_table=11
                     /translation="MVGVEERFLNILRQRFEWARERFPLDGVVWERVVDALQGERDKL
                     TVLRRMEETGGEPCLVAYVDDMYVFMDCSAESPKGRRSLCYDREAEKLRKGVKPRGNV
                     LDVANSMGVEVLTEEQYRWLQSFGDFDTRTSSWLKTPEKIRKLGGAIYGEKRYGTVFI
                     GANSAQSFYGGRGFRGLLKV"
     tRNA            join(318688..318740,318771..318792)
                     /locus_tag="CSUB_T11"
                     /product="tRNA-Arg"
     CDS             318858..319418
                     /codon_start=1
                     /locus_tag="CSUB_C0331"
                     /product="hypothetical protein"
                     /protein_id="BAJ50192.1"
                     /transl_table=11
                     /translation="MGQSLSAYWDWVAQTSFHLRQARPSVTDVFYRHIVLSLLDQLTS
                     GNPRRILKLDAYNEATNTQYGFYLMKNDRELILVDISSGIAEKASQRAKAKRLHSRTH
                     IIVGDFRRLPLRSECVDMSCSFGSIEHVPEYDVAFYEQARVVRNGGEVIVGVPNILNL
                     WFRVLSAKILHMLGLMKKMTNPEKHF"
     CDS             complement(319650..320906)
                     /codon_start=1
                     /locus_tag="CSUB_C0332"
                     /product="hypothetical protein"
                     /protein_id="BAJ50193.1"
                     /transl_table=11
                     /translation="MNKRIVFVAALTIVSFLIRVYKLDVPDRQIGDEVYYVPDARSIL
                     GQNEQGLPIDPRSGHPPLGKMLIALGMLAFGDNPFGWRIMSVIAGTAAIPIFYLVVSR
                     LFQDRKEFNYATPLATFLFSFETLTFYFSRVARIDIFMLVFLLAGIYFLLDNRFKRKI
                     MAAPLFATSFLAKESALVVIVPLLLYAGLKTVEKAKKKEHGRLLRYDWRTVLALFAAT
                     GVSVALLWYMLEWVILVPRYSNLVERILAMFSRLSISNPSAVGRSEIWQWFFNYPATR
                     ALAIVPGYQINPATVVTGPLVTPGLRYSYVIQVSWTVIVFMVPTMMYMLWLARKDTLG
                     RFTSLYWFGGLMGWVVVNMVFRGLIYLFYILTLLPPVIIAISYFLGKRLHEESSGKSV
                     KWTALTGLYLLLHILYFVALYPVPIP"
     CDS             complement(321153..322205)
                     /codon_start=1
                     /EC_number="1.4.1.3"
                     /locus_tag="CSUB_C0333"
                     /product="glutamate dehydrogenase (NAD(P)+)"
                     /protein_id="BAJ50194.1"
                     /transl_table=11
                     /translation="MIARPGRVVELNLGQAVGWLVIDYFIMGISWGGVRIASDVTRAE
                     TEMLARLMTLKSSLAGIPVGGAKTGIAADPLNVDKKNLIQKFVEKTKELLVKGSYIPG
                     SDIGFSEEDLQYLYSILGDRRRPTLHRGQSILSDTGLAVAESLHASIEALRHIKNIED
                     VEMFSLQGFGNMGTAAAHLLGRRGYIMVAVSNRYHTLFDPKGLDIDQLLDLRTRHGEN
                     CLRIYAERNPASRLLPPTDITNIKTDIFVPGARPKTITGPIPCRIVAPIANYPISVTT
                     ARILEHTGINIIPDIISTAGGAIASALTLLNRSFEENRKTISKITHYNMKKAVTMAQR
                     KIQHPSKKPTIWRGAG"
     CDS             322293..323465
                     /codon_start=1
                     /locus_tag="CSUB_C0334"
                     /product="peptidase M24"
                     /protein_id="BAJ50195.1"
                     /transl_table=11
                     /translation="MARWGVDAVVVYGESTASCPELAYVVRAPVARGGLYVKKRGEEP
                     LLVVSNLDVESAKTGQVRLVKTYNDYGFREFVRRFGRGRGWAEFVAEVLRREKVGGGL
                     VLAGRFEAGQAVFLADLLRRKGFRVKASPSPSLLDLCRRTKDSWEVDRVREAGRKTVA
                     VVQRVEKILEESRVAGDKVLYENKPLTANVLRQAVRQACAEQGLNLVEGFIIAVGAES
                     ADPHYSGEKDTPIKPGEPVLLDIFPADTTGYRYDFTRTYCVGRAKPLLRKMYADTVEA
                     QRIALDMIRENIGCEAPFIRVCRLYMARGWPTPLSRQPVERGFVHGLGHGLGLTIGEE
                     PYLTRFSRDPLLSGDVVTVEPGLYEKGFGGVRVEDVVLVESSRCTVLAEHRRELEL"
     CDS             complement(323462..324265)
                     /codon_start=1
                     /locus_tag="CSUB_C0335"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50196.1"
                     /transl_table=11
                     /translation="MLLANFFEATVVIAVVGAVALAGRFLDLRGAGAAVVLGYMIYIF
                     GGRMHFLLLLVFFIVSGFSTRYRYREKYGEYGRGVRTWSNVISNGLAAALIASAGYFL
                     IDPATALPLYIGAVSAVFADTMSTELGLLSKRPPILITSLKKTEPGTPGGVTPLGLMS
                     AFVTGFITAATVFIYTGFSLDTLPLSKVALVSVFSGFTGSLFDSVVGGLVQSRYRCKV
                     CGRAVEVRRHCGVETIYLGGSRVINNDVVNFLTSLYGAFAAYSLWVFLG"
     CDS             complement(324488..325537)
                     /codon_start=1
                     /EC_number="6.1.1.21"
                     /locus_tag="CSUB_C0336"
                     /product="histidyl-tRNA synthetase"
                     /protein_id="BAJ50197.1"
                     /transl_table=11
                     /translation="MSFEPPRGMDDLLPEEFAVKQRIVDVIREIYRLYGYEEVETPTL
                     EYLELFEAKSGEEIRHRMFVFDDPHGRKLVLRPEVTASVARLVASKLSRRPLPLRLGY
                     IADCYRYDEPQWGRRRRFWQGGLELFGSRDPMSDAEIILASRDVFQRLGLVEQRFKIG
                     HVGIMRGIMDNVEQKTQDIILSLIDRKMFTEARQLMEQHLDKDAVETLWRLAEHRGGL
                     EVVERARDMVSPWPKAMQSLENLETIVSLIMNVDPNISIEVDLGFARGLEYYTGMIFE
                     QKLEGEQLSFNGGGRYDGLVELFGGKPTPAVGCSIGITRIQMHLLGRKTQTTPFPQQS
                     FSQYYRTKRHPTLCL"
     CDS             325629..326777
                     /codon_start=1
                     /EC_number="1.3.1.74"
                     /locus_tag="CSUB_C0337"
                     /product="2-alkenal reductase"
                     /protein_id="BAJ50198.1"
                     /transl_table=11
                     /translation="MTNGSAKLVTAVVALAVVLVGLNFFFYVTVREDVLGLQQAVSSL
                     QTQAVEKTVTLVSHVTSVVTVAGNRPSYADIFDMVKDSVVLIRVFSSAGGAVGSGFVY
                     DTEGHIVTNNHVVAGASSIRVVFYNGEMYAARVVGTDVDSDLAVIKLENPPKNLKPLK
                     LGNSTELRIGEEVIAIGNPFGLEGTLTTGVVSQKGRLLPTGRGYSIPGVIQTDAAINP
                     GNSGGPLLNMRGEVVGVNTAIEPGGVGIGYAVPSSIVARVVPALIKDGVYRRSWMGIS
                     GTTLDMDIAAAGGYNVTRGVLISQVVNNSPAQSAGLRGGDRTVVVNGVQVIVGGDVIV
                     AVNGVPINSIDELLVYMEEKTSPGQTITLNIVRNNQFITVSLTLSTRP"
     CDS             complement(326779..327705)
                     /codon_start=1
                     /locus_tag="CSUB_C0338"
                     /product="5-carboxymethyl-2-hydroxymuconate isomerase"
                     /protein_id="BAJ50199.1"
                     /transl_table=11
                     /translation="MKLLSFEKYGDRRVGLLTGKGVLDLPSAYKLVYGEDAPRWLYSM
                     RSFLIAGEDSARLVEKLRNKAAQYGDGPPLYYKESEIVFKAPVPDARKILCVAANYVM
                     HGQEMKITVPEKPYFFGKFGNTLIGHGENIIIPRTSTMVDYEIELAVVIGKKGKYIPA
                     KQADEYIAGYMVFNDVSFRDKQLPPGWPEKLNPFGQNWILGKSLDTAAPCGPYLVTRD
                     EVGSPYPLRLVLKVNGEVRQNGSTDEMFFKIGELIEYISDGLTLEPGDIIATGTPAGV
                     AAAGKRYLRDGDLVEAEIEKVGLLRNRCVKET"
     CDS             327792..329276
                     /codon_start=1
                     /EC_number="1.2.1.27"
                     /locus_tag="CSUB_C0339"
                     /product="methylmalonate-semialdehyde dehydrogenase"
                     /protein_id="BAJ50200.1"
                     /transl_table=11
                     /translation="MQAQQFLGLSFGRLRNFVNGVWMDSRTEVWRPVYDPGAGRIIAE
                     VPYATDEEVNSAVEAAAEAFEKWSRTPFLERVKYLFEVKHVLENHLDELAAINTLNHG
                     KTLDESRGDLRRAIENVDAAIAAAYTLAKGEMLHEISPRIDEYSVKEPLGVFAVISPF
                     NFPIMIPFWFFPYAIALGNTVVIKPSDVTPVPMTRVMEILQQEVKLPPGVLNLVHGGK
                     ETAEALVKHPHVKGVCFVGSTPAARNIYRLAGEHGKRCIAQGGAKNYIVVMPDADMDV
                     TIPATVSSFFGNTGQRCLAGSNLLVVDKGFKKSFLDKFSRRSKELVIGHGLVQGVEMG
                     PLVNKAAQTRVKTYVEKGVEEGARLLLDGTEVSVQQFPDGFYLGANIFDEVTPDMTIA
                     REEIFGPVASVITASSLDEAIETINTRTDYGNMACIFTSSGSNAAKFIKNVNAGNIGV
                     NIGVAAPAAYFPFAGRKNSFYGVLHGQIDSVDFFTDKKVVITRW"
     CDS             complement(329372..331045)
                     /codon_start=1
                     /EC_number="6.1.1.20"
                     /locus_tag="CSUB_C0340"
                     /product="phenylalanyl-tRNA synthetase beta chain"
                     /protein_id="BAJ50201.1"
                     /transl_table=11
                     /translation="MPVVNIDVEKLRRLVGRSLTLEEISDNLAALGMSVEETGDILRV
                     EYNPNRPDFSSVYGVAAALRSYLGIETGLRKRSYPLSGISVYVDKSVENIRPHIVCAV
                     VRNVELSEAELIEFIAMQEDLHWIIGRNRRKTAIGLHDLSAISPPFTYKAVGMDEVRF
                     VPLKDYRAMTPREVLSKSEIGRKHAWLLKDASKAPVIVDSRGQVFSMPPIVNASITEL
                     TPGRRDIFIDVTGTDWEKVNQALNILAEAFADAGGVVQRVRVVYGRKGFYTPDTRPLE
                     MMLDMELVKRLTGLQLSLREATRLLRRMGMEPRVKGKRLRVLYPRHRADILHPVDLVE
                     DIAIAYGYNNMTPVAPQSNTYGSLRPQTTFYEKVAETMLGLGFTEVHNLMLTNEQTHY
                     QMSGLDEIEHVTLANPATREYTMVRTSLIPSLLATLANNTDNLYPQRIFELGDIIHIE
                     PAAPEKTVRMKKLAAAIAYAEAGYSEAKSVLDELLKLLQLKPEYIPATMGTFIEGRCA
                     ALTIDGSKAGIVGEVSPTVLENFGIEMPVTLFEIEIEKLYKLQQLYRAE"
     CDS             complement(331047..332648)
                     /codon_start=1
                     /EC_number="6.1.1.20"
                     /locus_tag="CSUB_C0341"
                     /product="phenylalanyl-tRNA synthetase alpha subunit"
                     /protein_id="BAJ50202.1"
                     /transl_table=11
                     /translation="MNGFFIGLFGQYGGMTEALHWLEKAVLRSLYELGGAASYEELAA
                     KAAENVRGWGRDGEAMLSSIAKACGWLRDKGYVTVEQETSRKFVALDAEGEEYVVKGL
                     PERRVVEFLQRRGGEASVDEVRALERADIGLMWARRRGWVEFAKKNGATVVVLKGHVP
                     PSTDVENFLRELKRGGEVEVPHAGALREVVDELLRRQRVVKLVERPVRKVVLTEKGRE
                     AVSLLEETVVPEVTRLTPELIRTGRWRELRLSRYDVKAPTPPIFAAKRHPLTELIRMV
                     RQAYVEMGFEEIEGPIVELAFWNFDALFQPQDHPAREMQDTFYLLEPRAGDPPAQHVE
                     AVRKVHENGGDTGSKGWRYKWSLEEARRLLLRTHTTATTIRHLATVKQPPVKVFCVDR
                     IFRNEKVDWKHLAEFHQIEGIVVERDASLRMLMGVLRDFYSRLGLREIRFKPSYFPYT
                     EPSMEVEVRLGGRWLELGGSGIFRPETTYPFGVKHPVLAWGLGLERLAMVIYGLEDIR
                     TFHLNDLGWLRSVSPFQAFRTMRSM"
     CDS             complement(332707..333330)
                     /codon_start=1
                     /locus_tag="CSUB_C0342"
                     /product="hypothetical protein"
                     /protein_id="BAJ50203.1"
                     /transl_table=11
                     /translation="MCCGWCGRCLKPYRGCMLFMGVEMSLLGGIGYVLNIIPLANIVA
                     PLLIGVAWYQVGSRTGQSLFRATGVLMVVTFLASVGFLVFFLGSIIGVIMSTPFAIGG
                     ENFSTAVASALLPQIMGYLAVFLAAAVTLAALGLATFVLELGSHFRAAKVLNSVWFRR
                     AAVARIVALVLVLVFVAVVLALAVAEPGALMGAAVVGGTSYCCCYRS"
     tRNA            complement(333359..333443)
                     /locus_tag="CSUB_T12"
                     /product="tRNA-Leu"
     CDS             333512..334669
                     /codon_start=1
                     /locus_tag="CSUB_C0343"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50204.1"
                     /transl_table=11
                     /translation="MSETVSSLGYVNRIYRNVSAVDLDSLERLLHDIQSAGVIIPLGE
                     GRSKGALSIAVSEMAKMRDGKIVIDRGDVGFPGREISEAAPILKQRFGRVCLLINSGS
                     GRSITPLVDAQNLASYIGKTGAHRDYTIDLVTSDIQSPLAKIASKYGNVLHLMGREEV
                     AEAEEAKVFRDVGIMEDTFILGSGVLFHAIAEALYDKALPSKAYEYAREICLEAGKVV
                     EKSLTSEFYEFVTRKLETRSLCFFGGLGSSYEVARMTAVRVSHIKRAIGDQVYVARES
                     STPAPRQGDLLIVISSSGETEIVSTWCKSFKRMGGQIAAVVGNADSTIASMADSVLEI
                     PVKNELGRPNRFYVYAEFALSPLPILLVESLEAKGFRLPEYILRWHQSVTA"
     CDS             complement(334670..335752)
                     /codon_start=1
                     /locus_tag="CSUB_C0344"
                     /product="F420-dependent glucose-6-phosphate
                     dehydrogenase"
                     /protein_id="BAJ50205.1"
                     /transl_table=11
                     /translation="MGHTFIMRLRVGMLALNGVLRLGYWAGLEQYDPARIVAHSIHAE
                     AVGFDIIALSDHFHPWSDTGGQAGFPWIVLAAVAEHTKKVELGTAVTTPFFRYHPAIV
                     AQAFATLDYLYPGRIFITVGTGHAMNETPLGFKWPGYREKVERLREAIEIIQLLWKGD
                     FVDYEGKYYQLRSAKLYTKPLTKIPIYVATSNATVAEIAGELCDGILTNPRGMDKYME
                     IIAALEKGARKAGKDPSKLSKCLEFKVSYDHDYDRAYKAALFWAPTAIPREKREKISD
                     PRVLEAMVGDDERRKIKETWLITTDVDDIFKALSHLLKLGFDRVYIHSASPNEEKFLN
                     LLGRDILPWMREFYEQLGRPIRPVLE"
     CDS             335864..336517
                     /codon_start=1
                     /locus_tag="CSUB_C0345"
                     /product="cyclase family protein"
                     /protein_id="BAJ50206.1"
                     /transl_table=11
                     /translation="MWIYLSHILTRNSPCYDDGPRPEFTPDKQIARGDSSNTYFIKLL
                     NHIGTHVDAPYHFDPNGRKISSYRADELVFEKPLLIDVSKDAGELITVSDLEKHSQTL
                     HNVDLLLIRTSFQRYREKDPEAFMRRGPCLSAEAASFLRQFGTLRALGVDTISISSPM
                     RREEGREAHRRLLVGRSFLIIEDMDLHDKPSVFKRVVVAPLLVDEVDSAPCTVLAEV"
     CDS             complement(336514..337356)
                     /codon_start=1
                     /EC_number="2.5.1.-"
                     /locus_tag="CSUB_C0346"
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="BAJ50207.1"
                     /transl_table=11
                     /translation="MRIMSLLRLVRPPNGLLMFFAVLIGVLFSETRAINPQQIFYAFV
                     TSFGLTGSSMALNDYFDREVDLVNNPRRPIPSGEVSPTSAVALSSILAGAGLLTAFLS
                     STACFLMAAVALAVSTVYNMFLKKAGLVGNFAVSFTVVAPFLYGSLLADGYVSWRVVV
                     FVVLAFLANTGREVIKGITDVEGDAVRGVATIARKSGLRTASRVGAGFYIAAVMLSPL
                     PYLLKVVNILYLPLVAAADAGFVYSSIRIIKNPEPAEAKKQKNLTLLWMLLALISFAA
                     GGLA"
     CDS             complement(337366..337890)
                     /codon_start=1
                     /EC_number="3.1.27.9"
                     /locus_tag="CSUB_C0347"
                     /product="tRNA-intron endonuclease"
                     /protein_id="BAJ50208.1"
                     /transl_table=11
                     /translation="MAASLELLNDGEVVFVEGDLGWFRERGYGDMRGEKRYFFSQVET
                     LYLVNHGKAEVYRSGRKLGFSELLSFFAERDHNLWRDYVIYMDLRKRRYVVKEGFGPK
                     LRFRVFERGEYPAKPAKYLVIPLYEGESVSVDELISLVRSCRAMDKVAVVAVLDRRNE
                     VVYYHASTVDLWNK"
     CDS             337965..338741
                     /codon_start=1
                     /locus_tag="CSUB_C0348"
                     /product="hypothetical protein"
                     /protein_id="BAJ50209.1"
                     /transl_table=11
                     /translation="MIKHKKRLFGVWLVKNPRAVLLLAVVALLTGFSLFEIVPPISTS
                     SLQFDIRLSEAPARPYILRVRVEQKPVEGFAAVPVPRVLVSLDNFTTVTNLSGYAFFT
                     TTPGKHVISVASTTATLPTYAVDVEVTTRITELVIRFVETRLSLQSLDVVMDTSTQTT
                     YVTTTYTPPVNSSLYVGKPYLTYIDQNNYLKRHIGEDTVSYLPGPIPQYRGPFNEIKT
                     GETLQPYTASVSIEGLVQLVILKESFIPAFYVETQLTKRE"
     CDS             338749..339198
                     /codon_start=1
                     /locus_tag="CSUB_C0349"
                     /product="hypothetical protein"
                     /protein_id="BAJ50210.1"
                     /transl_table=11
                     /translation="MESLLYNVSFWLMLNIFLVAAIVSLVLVNQSRSKNKQPPNSSQQ
                     IITLKEEEELFKQLLQKGEKRDAVVKVFPQVFKKICKTANVETRGYTFREVLNSGRIP
                     QTFAAYLSSMYEVFEPVRYGEMKPTEETLAKFEESLHRLSEEFWYDG"
     CDS             339188..339460
                     /codon_start=1
                     /locus_tag="CSUB_C0350"
                     /product="hypothetical protein"
                     /protein_id="BAJ50211.1"
                     /transl_table=11
                     /translation="MMVENAFFILLALMLAGALSLLAIPREKKRKDVARGEGVVLDQY
                     ADLVKLVMDGEVREALKRVRRYVEKETDTERRRLLKNVEAELRKHV"
     CDS             339453..340409
                     /codon_start=1
                     /locus_tag="CSUB_C0351"
                     /product="methanol dehydrogenase regulator"
                     /protein_id="BAJ50212.1"
                     /transl_table=11
                     /translation="MSNLFAAMLGEGVKAEVGKVVVGMHDAIESLIIALLTGGHVIME
                     GVPGLAKTLLAKSFAMSLGLSFKRIQFTTDILPSDIIGGLVLNRKTGELEFKPGPVFA
                     NVVLIDEINRAPPRSQSALLEAMQERQVTVEGVTYKLPEPFLVIATQNPVELEGTFPL
                     PEAEIDRFMMRVIVSYPSREEEIQILKMRDMLGEDIPVQPVITSDLLNLAMDEVRHVR
                     VVPEVLEYIVEIVMRSRKDTRLMLGASPRAEIALLYAAKALAALNNRVYVIPDDVKRV
                     CYRVLNHRLMPKPEYIDLSKKTDYGFVEKVIEEYLLETEVPI"
     CDS             340406..341662
                     /codon_start=1
                     /locus_tag="CSUB_C0352"
                     /product="hypothetical protein"
                     /protein_id="BAJ50213.1"
                     /transl_table=11
                     /translation="MKLTAQGYKTLVSMFIIVFFASTVSVYRALSLSIYIVGVFIPLY
                     CFFAASSLRMLSQNDFLFSRHVRRALLRKGEHAEVRVKVENKSGRRVRVRVLERIDGL
                     KVVEGSVQAERNLAPDELLELSYTVTSHGRGIGLLGPLVVHVLDDYGMVYKEFTLGEE
                     VKIVFTEHVIGQPKLSDAVKTVFPTPYAGTGSSHEYGVDDIFREITRYEEGQPLKAVD
                     WRRTARENGEIFVRRFDKQNRLRICLVLDYSHGNILGNPSLLDSVVGAVSTLASSVLE
                     RGDSVTIVVPGAREGVVKATGLRDYFRLLTFLSTVAPVSQYRIVDWLEYLHGFDAVFM
                     VGRFANLDEASLKTVAEKVRLYGGVLYLLVPTLENVTRPAKALEVLEQARVQRLRKIY
                     GHVYLVRQTDLLNYLVHLHRSLRMMI"
     CDS             341659..342372
                     /codon_start=1
                     /locus_tag="CSUB_C0353"
                     /product="hypothetical protein"
                     /protein_id="BAJ50214.1"
                     /transl_table=11
                     /translation="MMDKLLRAVALLPPVVLTLSVLSMLDVSNSFVFVGFFSLLFISA
                     TDRFKWAGIILVYVPAAYTVSLLLTGVVSPFLGLAAGYIVSAPAVFAISAYRSNLFTG
                     LVGGYYASYVFALLLNNVTSSGVVRPERLFIMLVQNILGLFSTGTVNITPANPEPELI
                     FTVLTALASFALLTSFAGNQLQKINEPFLKTLITSLALMSLSIFVGQHSPVLTPYFLL
                     ASFVLLTAALMLWLRTSHE"
     CDS             342365..343882
                     /codon_start=1
                     /locus_tag="CSUB_C0354"
                     /product="hypothetical protein"
                     /protein_id="BAJ50215.1"
                     /transl_table=11
                     /translation="MNRALYLFVIAFLAVPSQGQSIEPYWLVGFDGDIMLPFLDRGVL
                     ECGVGESLAVKLVGRDGFVALVSPNGLSENVFLRDGERTVLRRFGPGDAGNWTLVADT
                     GQTLTLQVRPPLAKPPVQVLARFEGPFVVLTVSTSPNTYALFLDGRGEGEVVAAGSSI
                     ELGLKGFNDTRVRVEIIRREPTIRYGGLLDGLPYTMQLDPLSVNTIVEGRRINDSTVF
                     SVRLPADGEQVSGLRKMGLGPHLIRLYSVSDKRILLEREVVVVPESMKSFTGLSRAVR
                     ADVWAAAAKNFTILVGDEAGNLWILQIRPPIAFIRLYDQIHSRYVKGVGVALADGQAQ
                     NLDEWTGIIFVNRIEINNYGNNSSYSPSTETNVSLNFNATSLTLPLTVTAGDRVTLNL
                     QLHQAHITLIWPNGTTYKGPATLTINSAKFTNATALLLPVDKYVVRADNPPSFSSNVY
                     TLTADTTWTIIILDNPAGVAGFRASAVLLTALLVYTVFRLRKTFYRADLFRREQR"
     CDS             343879..345009
                     /codon_start=1
                     /EC_number="3.1.3.11"
                     /locus_tag="CSUB_C0355"
                     /product="fructose-1,6-bisphosphatase"
                     /protein_id="BAJ50216.1"
                     /transl_table=11
                     /translation="MRTTVSVIKADVGSIAGHHKPHPKMMELASGKLAEAENTGLIKS
                     GYATHCGDDIILVMSHGKGEDNPEIHGLAWNIFREITEKVAKPMKLYGAGQDLLSDAF
                     SGNVRGLGPGVAEIEFEERKSDPVIVFAADKTEPGAWNLPLYRIFASPENTAGLVIDP
                     TLHDGFRFEVLDLVESWSVLLKTPEELYDLVALLGTVGRYAVSKVYRASDGEPAAAAS
                     TTRLSLIAGRYVGKDDPVMIVRAQAGFPAVGEVLAAFATPFIVSGWMRGSHRGPLMPV
                     SFRRGQNVVSYFDGPPRVMAMGWQVSNGRLVGQDGVEPVDLFEDPFWDTVRNKAADLA
                     LTLRTMGEFEPARLGHEEMEYTTLPQIIEKLKPRFKPIETKK"
     CDS             complement(345040..345216)
                     /codon_start=1
                     /locus_tag="CSUB_C0356"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50217.1"
                     /transl_table=11
                     /translation="MGKESFVVESRVREALPEGIRLGSDALEGLNEAVKALIEKAVKR
                     CQANGRKTLMKEDF"
     CDS             complement(345292..345606)
                     /codon_start=1
                     /locus_tag="CSUB_C0357"
                     /product="hypothetical protein"
                     /protein_id="BAJ50218.1"
                     /transl_table=11
                     /translation="MLDMILRVWTCPIKKGMEKAFEEFALKEATQILEKQAGCLNAFF
                     GIDYGEPSVGVVVTLWRDIESLKAFTGDNWKEPYIHPTEAPLLAEKPKVTHYTLVGKI
                     PR"
     CDS             345596..345979
                     /codon_start=1
                     /locus_tag="CSUB_C0358"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50219.1"
                     /transl_table=11
                     /translation="MSSKNAQGLINFKAGWAVDDVVQYFEAFRLGEAVAQRAQNLLSA
                     YTGTAYAAMVVKETRDGWSPVGEENLFTVVRKDENFSIIVICDGDGYAKAMSNPIPHK
                     AAESIAAKMEKDGLKRYSGELILPL"
     CDS             complement(345953..346735)
                     /codon_start=1
                     /locus_tag="CSUB_C0359"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50220.1"
                     /transl_table=11
                     /translation="MFFHKWMRRILVGCCGWAVKGGKEAYYQKFPTIEIQETFYKLPR
                     TETVMRWREKAPRGFVFCMKAWQAVSHPVSSPTWRRSGLQPGKREATRYGWLRPVKEN
                     FAAWDKTAEVAKAMQAHVVVIQTPASMPDDQKTQQNVMKFFEHASTHHLTIAWEPRGK
                     LAKNKTFLQKVCEKHGIIHVTDILKSEPATQHKIFYTRLHGLGRGEVNYRYRYSDQDL
                     RLLAEKIDAINFDEGYVFFNNLWMAEDAERFMKMLKRENKLT"
     CDS             346751..347776
                     /codon_start=1
                     /EC_number="1.2.4.1"
                     /locus_tag="CSUB_C0360"
                     /product="pyruvate dehydrogenase E1 component subunit
                     alpha"
                     /protein_id="BAJ50221.1"
                     /transl_table=11
                     /translation="MQTVLKACELLSDELLLKMYREMVLARLFDSAMVKLQRAGKVAA
                     YTSSEGQEAVSVAAVNAASPLDWIFPTYRETGAFIARGVPLETLIARQLGRVGDPLKG
                     HEVLLFGDKRYRIVTGPGPVAAHIPVAVGFGYAARRKGEDCVMLVFFGDGATSKGDFH
                     EGLNVAGVFKTPTVFICQNNQYAISVPRHQQTASETIAVKAEAYGFEGVTVNGNNIEE
                     MYKIVSRAVEKARNGEGPTLIEAITYRLAAHSTADDPTKYRTVQEVEMWRSQDPITIC
                     RKLLIEKNLLSDEKDNQLWTSLRQMLEQKIEEVEKTPIIPPMSIFEDVYSTPPWHLRE
                     EFSDVNL"
     CDS             347988..348713
                     /codon_start=1
                     /locus_tag="CSUB_C0361"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50222.1"
                     /transl_table=11
                     /translation="MRRTVSGPGGSSTKTQRRSPSTSVSEHARSLSAGAGPRHLGGPP
                     PPIIHQPYIHRVLRLGRMLQGFKSFLLRRFLAALVATALLIGLLAAAALAPMPFVDAE
                     ALVNQFEEMLPRLTETPVMIFLNNLAASLLMMIPVLGMALAGLIVYNTGAVIGAFSAV
                     SNVPVALLLLIPFITVYGFIEMLAYGFAVSQGFFLTTSAFKKQLRKEVRSLPYTVAVV
                     VLLLLAGAVLEWILIRLGSALMT"
     CDS             complement(348685..349398)
                     /codon_start=1
                     /locus_tag="CSUB_C0362"
                     /product="archaeal preflagellin peptidase FlaK"
                     /protein_id="BAJ50223.1"
                     /transl_table=11
                     /translation="MEPWSTAIVSLTLLYSSYLDIKKREVDDIVWVIPSILGLLLNLY
                     TVYVVGFDYLVRYGAAVLVSAGVGFALYFAGLYGGADAKALVTIALVQPFSYTGLQLH
                     GVTSLTVLTNGMIFSLSLPVFFMAFNSYRLLRGEKIFSGFDGEKSLRKLAALFLGTRM
                     RNAAGKNFWGVIESIENGVRRFRFNIGIEELEKVDRDDVWVTPGIPLLVFFTVGYFFN
                     LFAGEVMAYLFRSLAPNPT"
     CDS             complement(349404..350657)
                     /codon_start=1
                     /EC_number="1.4.1.3"
                     /locus_tag="CSUB_C0363"
                     /product="glutamate dehydrogenase (NAD(P)+)"
                     /protein_id="BAJ50224.1"
                     /transl_table=11
                     /translation="MSSGEAFLNNVLDLLKTAAEHLNLDPGLHDVLKKPKRVVVVSVP
                     VKMDDGSLRVFTGIRVQHNNARGPYKGGVRYYPTVDVDEVTALAMLMTFKCAVTDLPY
                     GGAKGGVACDPKNLSKNELERITRRYTAMIYEVIGPYIDIPGPDVYTDAQTMAWMVDT
                     YSMMRGIFTPEVATGKPISLYGSLGRHDATSRGAAYIIREYFKTINKPVKDAKVVIQG
                     YGNVGYNAAKILHEEYGAKIIAVSDSKGGVYLPNGAHPDKILEHKQKTGSVINFPGSK
                     PLTNEELLTTPCDILIPAALENSITKEIAGKVEAKVVVEGANGPTTKEADMVLFERKI
                     PVIPDILSNAGGVTVSYLEWVQNLKRETWTLEEVHAKLEAKMVKGFHDVMNTSKKYET
                     PLRQGAMIFAVDRVAEAINYLGIWP"
     CDS             350739..351344
                     /codon_start=1
                     /locus_tag="CSUB_C0364"
                     /product="phosphoribosyltransferase"
                     /protein_id="BAJ50225.1"
                     /transl_table=11
                     /translation="MEVKSVGSSKFLLLSWGDVERGADALAEKIVDGGCSVDTIIGVL
                     RGGMIVADFLSDILDVREVYVIGCRSYTGTVSTELKIYHDLALERLDGRNVLLVDDVA
                     DTGSTLDAAVEKILKPRNPNSVTTATLLKKPWSRYTPDYFVDETDAWIVFPWERLEAV
                     KTVGKIFVENMGFDAAVDELAALTRLDKRKVLSVIKVLQRT"
     CDS             351348..352646
                     /codon_start=1
                     /locus_tag="CSUB_C0365"
                     /product="2-methylthioadenine synthase"
                     /protein_id="BAJ50226.1"
                     /transl_table=11
                     /translation="MESNPHQRVMPQKVYAEVYGCSANQADGEIALGILQKQGYIMVE
                     RPNEADYVVLVTCAVKKPTADRMIHRIKKFSSLGPRLIVAGCMATGEAERVRRVAPEA
                     VLLPPRSITEVSAAIEGHGFDGGGTKLGLPRLRKNPVIAIVPVSEGCRWSRCSFCIVP
                     RSRPGYESYPVRAVVDEVRKAVNEGCREVWLTSQDMGSYGLESGRNLLPELIESVNSL
                     EGKFYTRIGMMNPIYLKPILQKLVKAYSGEKIYKFIHVPVQSGSDKVLKDMNRGHSVQ
                     LFYHVVEAFRRRFPSITVSTDLIVGYPTETDEDFEQTLKLVEKTRPAVVNVSRYFPRP
                     GTPGEGLKTLPHHVVARRVSELNDLLSKIQLESNEHWLGWVGEVLINEVGKKGKMMGR
                     NFAYRPIVLDAPRESLGRFVEAEVVDVEKNYLLGRVLSGC"
     CDS             complement(352635..353258)
                     /codon_start=1
                     /locus_tag="CSUB_C0366"
                     /product="hypothetical protein"
                     /protein_id="BAJ50227.1"
                     /transl_table=11
                     /translation="MDETILAVAILFIIMGVAGIFIPFMGISETMRPLAEFSGFLLAL
                     GIVMLPIGLFRGGLPVLTGGKVYALSFLGIGLVSFVLVSAALQIGPFMKIEEVGLTGP
                     TPFNVTIVILPGSFDPAATETYSPANVRVLAGYNSTVIWVNGETVNVGHTVTSDQGLF
                     DSGLFGPNETWVFTFGRAGIYPYHCTPHPWMQGVVTVEEGPLPQSAS"
     CDS             353357..354013
                     /codon_start=1
                     /locus_tag="CSUB_C0367"
                     /product="NADPH-dependent F420 reductase"
                     /protein_id="BAJ50228.1"
                     /transl_table=11
                     /translation="MMAAVLGGTGDLGFGLAARLAKAGVDVVIGSRRLERAVEAAEKI
                     RALVGRENVNGAVNRDAVKAAEVVFFSVPYEGLVEIARDVAPFLQPFTVSVSCVVSFA
                     EDVCAAEMLAENLQQGAKVVSALHTVSASLLSDISRAVNSDTFIFGDDRDAKKKVANL
                     LKLVEGLRPVDGGPLKNSRYGELFTRFLVGVNKRYGVSWAGLRVTWLDDEVVNRRWEL
                     "
     CDS             354010..355359
                     /codon_start=1
                     /EC_number="5.4.2.8"
                     /locus_tag="CSUB_C0368"
                     /product="phosphomannomutase"
                     /protein_id="BAJ50229.1"
                     /transl_table=11
                     /translation="MKVSPHIFRAYDIRGVYRVDLDESLAYSVGRAFGKIVTGKVVVG
                     RDVRRSGESLVKALCDGLTDAGHDVLNLGVCTTPACYFGGRFYRAGGGVMVTASHNPP
                     DWNGFKMFLGDGETVSQGAGMEKIRDMIINGDLGSPAKEKGVVEKVDFQSVYIQHIVS
                     RFSPMYGLRMAADFSDGSASLCFPQICEKLGITLRQLNNNPDGYFRGHMPEPTEENIS
                     ELKQVVIAEKLDFGVAFDGDADRAVFVDDMGRVLQGDIAMAVLLKTLDKKGIIVYDVN
                     SSTALKEMAEKLGFTPMEWKVGRAFLHRKVRELGAVMGGEKSNHLYFGELEGDDDAIY
                     AALKMATLLHRTKTSLSKHVDEIPKYPTTPILVYDCPDEKKFAVIEKISERLSQMGFK
                     TNNLDGVKAYGEEGWILIRASNTMPQIKMSIEAKKAESLNMLRQLGERLIREAMETV"
     CDS             355367..355996
                     /codon_start=1
                     /locus_tag="CSUB_C0369"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50230.1"
                     /transl_table=11
                     /translation="MENWLETIAVTYGPLGVFAVSLLGSILPFVPVPYLIVVVLLSDT
                     VNPLILGLAAGIGGSIGKITSYIIGRLGYRLLSDEKKKSMDTLREFIGKYGDIGVFIF
                     ALTPLPDDVYIIPAGMVKLSFWRFLLANTAGKILLAIIVALLSKTYFEYSKLFLGETS
                     WLSTAGAVVAMVVLTIILLRTDWEKLLKTWEERGWRGVLREWVKWRNKG"
     CDS             355978..356298
                     /codon_start=1
                     /locus_tag="CSUB_C0370"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50231.1"
                     /transl_table=11
                     /translation="MEEQRLGDVSWGQLYLAVLKLYHGLEPKYYVEVKVADRPLKVNK
                     DALEVVKGVVKGKMLTRMKKEYVDCPLEGGPVAFLSCFVCVSHIRRVKGVVHCAGTER
                     RTRE"
     CDS             356295..356540
                     /codon_start=1
                     /locus_tag="CSUB_C0371"
                     /product="hypothetical protein"
                     /protein_id="BAJ50232.1"
                     /transl_table=11
                     /translation="MSRYSLFFSGLITLIFGVFMAFAGLPFSYIFLFSGIIMTVLGAF
                     LKPPVSVEPDPGKKFCWHCYQQIPADAGICPHCKLKQ"
     CDS             complement(356545..358983)
                     /codon_start=1
                     /locus_tag="CSUB_C0372"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50233.1"
                     /transl_table=11
                     /translation="MVMDLDGTLIKMKFDIFQVKKRVSEVAKQHGFELRENESIQDFL
                     DRASHLLPPHEFAKLREEIQNILRNEDRKSAEQAEATPGIADVLEKLKTLGFKLVVAT
                     NSHREAVEEALKKTGLDKYFEHVYTRDDVEKMKPRPDILLKIAEDMRIPISSIVYVGD
                     SVNDLRAAREAGARFIAVAWGLHSAEKFMENGATEIAHNPSELLNHLGVHLTKVVPDT
                     STIINGTLTQLVEQGLLDGCEVILPAAAIDELQAQASQKREPGFVGLNELKKVRSIAE
                     QHRLNIRIVGERPSLEDIKLARKGRIDAIIREAAKRENAVLITSDYVQSLVAEAEGVQ
                     VRYFPPKELPTQLSFERYFTEDTLSLHFKEGVPLMAKRGKPGQFQLVKIGEQPLTAEE
                     LNNLIKEVTEYARVKPEANIEIVRAGAFVAQIGNYRIAVARPPFSSGLEVTIVRPIVK
                     LRIEDYKLPPKLLERLEKKAEGILIAGPPGSGKSTFAASLAEFYSRMGKIVKTLESPR
                     DLQVGPDITQYGPLEGDFEKTAEILLLVRPDYTVFDEIRRDRDFQVFSDMRLAGIGMI
                     GVVHASEAVSAIQRFIGRVELGMVPHIIDTVIFLDAGRIAKVYNLSMTVRVPTGMSEE
                     DLSRPLVEVRDFLTDELEYEIYTFGEENVIIPVKKLHDEVRSETRELREKIVEALRSF
                     DENVQVEMVSRKKAIVKVDREVLPKIIGRRGENIARLEKELGVSLDVEPRIASIGVEV
                     PFEVRESGNSLRLELGEKMAGKTVAVYAGEKFLFSATVGRKGVITVRKNSEHGRALVR
                     AIYAEIPLKVLQTG"
     CDS             359056..360240
                     /codon_start=1
                     /EC_number="2.3.1.9"
                     /locus_tag="CSUB_C0373"
                     /product="acetyl-CoA C-acyltransferase"
                     /protein_id="BAJ50234.1"
                     /transl_table=11
                     /translation="MRNVAIVGVGQSPFGRASDKGINELAWQAIKQALQDAGITQKDV
                     GFVSVANVGGWSAEPLPAVSVNEYAGLTGVGTYRVEAACASGSAALVTAANLVSSGAV
                     DIALAVGVERMNESPTPTAVELIGRAGNYFWEFEMFGLTFPSYYALYATAYMNKYGAT
                     EEDLAKISVKNHFYASFNEYAAFRKRVTVEEVLKSRPVAWPLKLLDCSPITDGAAAVV
                     LASEDVARKLTDTPVWIAGFGYGSDTSNLSKRPDFLTLRATRKAAAEAYKKAGVDPSK
                     PVKSFDVVEVHDCFTIAEILAYEDLGFAAPGQGYMLAREGETYKGGLIPVNLDGGLKA
                     KGHPIGATGVSMAAEITKQLRQEAPAERQADIVKGMGLAHNVGGTGHYAYITIYSLKK
                     PG"
     CDS             360237..360785
                     /codon_start=1
                     /locus_tag="CSUB_C0374"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50235.1"
                     /transl_table=11
                     /translation="MRRVSTIPREELEKMVKSWLEMVEQITRSEGLPIVPDEKTSDPL
                     WVDLRELRLKYLIPIARIRKFFDGLKEGKVYATRCPVQGVYFFPPQADCPFCMDENLE
                     WVEIRGKGTLITYTVVNVKPASYLHYPDYIIAIARMEEGFNILCWMAVDDPSKLRIGM
                     PVRLVVKRREPEGFFTYYLEPE"
     CDS             360847..361245
                     /codon_start=1
                     /locus_tag="CSUB_C0375"
                     /note="pyridoxamine 5'-phosphate oxidase-related
                     FMN-binding"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50236.1"
                     /transl_table=11
                     /translation="MAMLNASERRFVEANELCRLATTDENSQPHVVPVAYIYYNNKFY
                     IATDLDTRKLANIRRNNKVALVIDKTNPNRAVMVQGLATILLRGEEYRTVYKIFYDRF
                     AWVRRDPWQEGEAAFIAVEPLKVVSWGLRQ"
     CDS             361529..362920
                     /codon_start=1
                     /locus_tag="CSUB_C0376"
                     /note="amidohydrolase"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50237.1"
                     /transl_table=11
                     /translation="MSRYLLKGGFVVPVDGSRRIIRDGCVLVEDDKIELVGTREEVMP
                     HARGAEVVDAEKCLIIPGLIDTHVHLAQALLRGVVPDNLTLIPWLRDWVWRFLGVYDN
                     MDAKASAALCILEMLKTGTTSFIEIHLHSRYGFDGIAEVVKQSGIRGVLSKTIMDMKG
                     YATEENLMPPSMIEDGEACIREFKQMYQKWNGQADGRIDVWLGLRSAGAVSDKLFYEA
                     AEIAKEYDTGITNHVAEVREDLEYYRRAYGTGVAGYLEKFNMLGEKHVYAHCVWLNEE
                     DMKKFAETGTTVSHCPSSNMKLGSGIAPVSDMLKHGVNVALGCDGGPSNDSYDMIREM
                     KMAACLQKVRTLDPRVISAWDVLTMATRNGARAMGKLNMLGSLEPGKKADIVIVSLTR
                     PSVTPISNPVSLLVYAASGADVRDVMIDGKFVVKDKKVLTMDEEEVIRQANKHLERIV
                     SKVDPNLDLLKTM"
     CDS             complement(362907..363926)
                     /codon_start=1
                     /EC_number="1.5.99.11"
                     /locus_tag="CSUB_C0377"
                     /product="coenzyme F420-dependent
                     N5,N10-methenyltetrahydromethanopterin reductase"
                     /protein_id="BAJ50238.1"
                     /transl_table=11
                     /translation="MGGALKMGKRLDRIGLYFTAPTPLRDEMDYARLAERGGFTSIWQ
                     GESRTSRDSTISIAALGAVTEKIKLGTGVLHTWTRNVVTLATTFTTLDELTNGRACLG
                     IGVLWEPMASKIGIERRKTLQAMFEHVTVLKKLFSGEEVFFEGEFVKVRGVRLERVPS
                     QVPVYVGATGFKMMELAGEIADGVLLNYLVSPEYNRKALQHIENGAKKAGRKLDDIDR
                     PQLLAVAYSVDLEKAYRRARLMVAEYLAMEPHIALASGVSEKITGEIREITGGWPTTE
                     RKLEQAMELVDEKLASTLMAVGDLKTVKRKIIEYVEAGCTEPLLYPVTGEVLPIIEYL
                     APTSF"
     CDS             complement(363911..365248)
                     /codon_start=1
                     /locus_tag="CSUB_C0378"
                     /product="N-ethylammeline chlorohydrolase"
                     /protein_id="BAJ50239.1"
                     /transl_table=11
                     /translation="MEYGEKMTEVDLLVLGGLVVTGADGPVYSPGYVAVGNGVVVDVG
                     KAKPSGYTAQKTVDASGMIILPGLVSAHDHMYGVLAHGIPVKSQLKDFWDFLKNFWWP
                     YVEDRLDKNLAEAAVHYAAAERLRTGTTCVADILEAPNALPNVLETEARAVESLGLRA
                     VLSFEATERMSPENGIQGLEENKRFIEKMNTRPRLVKGMHCLHTTFTCSPDFIRRCRA
                     DADMTKAGIHIHFEEGSYETQQALKKYGKYPAQLYEELGFWRDDVLASQCVKTTSDEL
                     NILAKYDVKISHQPLSNGEVGGGIAPVPEMLQRGLTVCLGTDGFIVDMFEVMRNTWLI
                     HKAAKENAGVMPAETVFRMATENGAKTLGYRGGRIEKGYKADLVLLQNKFPTPVTPEN
                     VLTQVVVYASGSWVDTVIVDGKVVVEKGRLATGDEENIRQKCFKAAEKLWEGL"
     CDS             complement(365227..367551)
                     /codon_start=1
                     /locus_tag="CSUB_C0379"
                     /product="molybdenum hydroxylase family, large subunit"
                     /protein_id="BAJ50240.1"
                     /transl_table=11
                     /translation="MTYSLFNNMLKHDSKLLTGRASFVDDVALPKMLHCVFVRSSYPH
                     AVVHGLRTPENLSEAKIFTWRMLSEIVRPFSLSFPFEGCKRLEVSPLANTKVRYVGEP
                     VAAVLAEDLYTAYDVANSVEVEYEPLPPVSDMFSSGATLYEDWENNTMAKFSRKFGDP
                     FHELERAKVVVEERITTHRVAPAPIETRGVVASYDAGRGFLTVWSPNQNPHMHRTVLS
                     EVLNLPESKIRVIAPNIGGGFGQKGHTYAEDVVVAALSMLTGRPVKWIEERRENLTAA
                     AQSREQVHLIKIGADRNGRIKALIDEAYLDLGAYPLIPHSYLELAHVVIDMLPGPYRI
                     ENYAAEVSLVATNKTPAGAYRGFGHPEATFVRERALDILAEEIGLDPVTIRKRNLISS
                     ADIPCMAATGMIFDSGRPLETFETLVQQAAHHDCGDGEVVGVGYAVGVKGSVPTMSGV
                     SQRWGSSEAAMVRLSMDGKPVVFSGAVSMGTRLDKLLAKIVSDILSVPEEDVEVVLGD
                     TLSTPFSTGLWGSRGAVMVGGAVAKASTMLRKKIQHISSILFECRPEDVVLENGRVFV
                     RDAMENGLTLSELAWKVYNHPNMFPQDIDLSLMAEALYDPPNIWQAPDELGRMNAAAA
                     VSTIACAAFVTLDVETFEVKVKKLVLAENGGTYLSPEDVDEQLIGGAIQAYGASLFEE
                     VVYSNEAMPMTTTFSEYLLPTAAETPAVEIIHVVDPSPYTFRGAKGVGETATIPVNAA
                     IANAIQNALRKKGINVKINFSIVSPTRLWSMVRK"
     CDS             367635..368225
                     /codon_start=1
                     /locus_tag="CSUB_C0380"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50241.1"
                     /transl_table=11
                     /translation="MSSEERIVRRRSPTTLVALFIVSAAITAVLGAFGSIVFPFLAPI
                     SSFYPGVAFQVSFGVWFGIVGALAGGFLGPFIGIVLTGTSAPIAAAVAVGDFFQAFIP
                     MLAFRLGKFDPRLKSSKDWAGHIVFNVIIAQAVGATIGSGSLAAFGVFPWDIWPIAWL
                     GWFGSNVVVVGVITTILFKVFSDYLMRTALYIERFI"
     CDS             368232..369059
                     /codon_start=1
                     /locus_tag="CSUB_C0381"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50242.1"
                     /transl_table=11
                     /translation="MAFIISDILKGLILYTPKNSFFVKVHPAVKLFVVIVFSFAALLT
                     PNHSLALVNLILISVTVVVARVPAKALRLYTFVIGWMLLVSFIFYSFFTPIRSGPVMA
                     TIGPLKIGYENFMAWLLVALKFLAVSYVTALLLATTKHRDLAVALRTWRLPYVVSFTF
                     ASILRNLAVVSVDLFTIIDAQSSRGLNFRKGNPIQRLAKFVRVGIPLIYVSLKRTEEM
                     SNAMASRGFKVRGEKTMYYTIPMKMRDYVVAGLFTLHLVIVLAVLLGLLKFPNFLFF"
     CDS             complement(369056..370339)
                     /codon_start=1
                     /locus_tag="CSUB_C0382"
                     /product="amidohydrolase"
                     /protein_id="BAJ50243.1"
                     /transl_table=11
                     /translation="MVTTLVTNIGKLVSGDWDKGVLKADTVKIVDGIIQDVGYSDEIG
                     KGPADVVIDADGMTVSPTLIDPHTHLSFGDFSPMQHMVGLLTETLLQGTATIVDEWLQ
                     FEGLPLFYGADPEGVKATAILSQKAYRNYRPGGAMKVFAGSIMLVKGLTREDFVQLRK
                     AGVWRVGQIGGSSNINDPKQILEMVSWARELGYFVSTNLGPGVLPESLNMTAELVSSI
                     KPDKIAHINGGTTAPPWEVVKAAIDGTGEAKLEIIPYGNMKMALRVYEYLKSRNQLKR
                     LIVGSDTPTGQGYLPVAIHRAILFLSSICGLPAEKAIATATGNILDCYGKYSEEFNMG
                     KIEPGRAGDLLVMDAPPGSVGNDALESIEAGDMIGIAGVIVDGNLVGLRGKDSRPSRR
                     NIKLNNRQLKVTCPDEYLFDPPRFYYRSTGPTYLL"
     CDS             complement(370355..371200)
                     /codon_start=1
                     /locus_tag="CSUB_C0383"
                     /product="cobalt/nickel ABC transporter ATP-binding
                     protein"
                     /protein_id="BAJ50244.1"
                     /transl_table=11
                     /translation="MSSDAVIEAKNLSHVYSNGVVALNNVNITIRRGEFVALIGHNGS
                     GKTTLAKHINGLLKPTSGQIIVHGIDTREASVADLAKKVGYVFQNPDHQLCMKTVWEE
                     LAFGPRNLGTPEDEVKQVVDEILRLFGLEHYRDVHPFLLSRADRLRVALCSVLTMRPE
                     TLVVDEPTTGQDMRQSYEVMEILKKLHKEGRTVVFITHNMRLVAEYAERCIIMKDGKV
                     FIDKPTREALTDFEKLRQAQLKPPQVTILSARLANIGFEKPALSVGEFVENVINLLNN
                     KHKSL"
     CDS             complement(371190..372056)
                     /codon_start=1
                     /locus_tag="CSUB_C0384"
                     /product="cobalt/nickel ABC transporter ATP-binding
                     protein"
                     /protein_id="BAJ50245.1"
                     /transl_table=11
                     /translation="MDEKPIEVKSFWWKYATSKDWVLSDINFSVREGEFVVITGPTGA
                     GKTTLCLAMAGLIPYHYNGTLRGKVYVFGKDTYTLSSADMASLVGIVFQDPESQFLTM
                     SVEDEIAFGLENLALPLEEMKERVHEAAKLVKVEDLLERAPYELSGGQKQRVAIAAAL
                     AMKPKVLVLDEPTGQLDPIGKEEVVNVLQSLKKQGITIIVVEHILEELAPFTDRLVVM
                     NGGRILYDGDFRGFFKDAEEVSKSGVPAPQVVELTLLLRKELNTELEIPITLEEAEHL
                     MNRLIPVKKFVQ"
     CDS             complement(372078..373430)
                     /codon_start=1
                     /locus_tag="CSUB_C0385"
                     /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
                     /protein_id="BAJ50246.1"
                     /transl_table=11
                     /translation="MKDLRQYLEDLRQNFPEEFVKISEQVSLEYEITAVWKMFERKGN
                     PVLFFEKVQGCDMPVVANVFGSRARVARMIGADMWNFYDKWLEKTSVIVEPEYVSTGP
                     VKEVKHLSSEVDLGTLPALKFFVEDGGRYITSGIVVANHPETGEVNLSFARLMVKDRN
                     KLGVSIHSRGNLWRYFNRATELGRPWLNVAVVIGCNPTLYLAAATRTTDEYKMAGALA
                     SEPVQLVKCETNDVHVPSDAEIVLEGRMLTNVYEDEGPFSEYTGYVSGRSTRNVMIID
                     CITHRRNPIFQTIIPTNSSEHLLLGGLPMQANVYKRLKESIPEVKGINFPVWGTHFVA
                     ILSVDKEGKEGVQIRAAMLLMGANPYVKYVILVDDDIDVFDEMQVLWAVATRSQPDRS
                     MHLFPVTDGNMLDPSQERAGFTSRAVIDATSPPHWKNAGVKVPSLPRDVVEKVQKKFK
                     "
     CDS             373514..374467
                     /codon_start=1
                     /EC_number="1.5.99.11"
                     /locus_tag="CSUB_C0386"
                     /product="F420-dependent
                     N5,N10-methenyltetrahydromethanopterin reductase"
                     /protein_id="BAJ50247.1"
                     /transl_table=11
                     /translation="MRLGIALVPEFIGRAKTITYGVSAEKVGYDSVWVPEHLNGGEAF
                     SLLGAIAAKTSKIRLGTAVVSINLRHPAVTALAAATLSDVSGGRFTLGIGLGDLTQLR
                     NSLGIIDDKPVKSMVEAVKICRQIFRGSSDFEGIRFRSHLQHIIRPKSSPKIFIAAVG
                     EQMLKAAARHGDGVIFSIFMSPESIKKSTAVIKTTSGFSARRDYFEFMGLLATATEKH
                     IQQLRELAAVFLSWPGRAERSLPNNLFNKIDVEKLSMHVSRGQKGKAAELVDDEVLEE
                     FACIGSLKTIRRKIGEFIDAGLTYPVLYPVGDAKNFLDKLV"
     CDS             374483..374962
                     /codon_start=1
                     /locus_tag="CSUB_C0387"
                     /product="hypothetical protein"
                     /protein_id="BAJ50248.1"
                     /transl_table=11
                     /translation="MINVVRVLYIGVAIVVAAAVALAVVFGVGSLLEVSDISMRKGTN
                     SAGIFFDLHNRGFLRDCVVGVEVLGEGHMGEEVLQAELHRTVMEDNVMKMVKVDKVCV
                     EPFSTVKMRGAEGEGYHVMVFGEVEHFDSFHVHLKMESGKVIHFYAQPAGAGSQHTH"
     CDS             375026..376321
                     /codon_start=1
                     /EC_number="3.6.5.3"
                     /locus_tag="CSUB_C0388"
                     /product="elongation factor EF-1 alpha subunit"
                     /protein_id="BAJ50249.1"
                     /transl_table=11
                     /translation="MSAKPHMNLVVIGHVDHGKSTTMGHFLYKMGAIDERTLKTYEEE
                     AKKIGKESFKYAWVLDRVKEERERGLTIDLAFQKFETRKYYFTLIDAPGHRDFVKNMI
                     TGASQADAAIMVVSAKKGEAEVGIAPGGQTREHAYLSFVLGIRQIIVLINKMDDSSVN
                     WAKARYEEVKQMASDLLKTIGYNIAKINFIPVSGWLGDNLTEKSSNMPWYNGPTLLEA
                     LDMLEEPPKPIDKPLRIPIQGVYSIKGVGVVPVGRVEQGVLKPGDIVAIYPGGLKAEV
                     KSIEMHHQSLQQAIPGDNIGFNLKGVEKNQLSRGMVVTKPDTPIPVAKEFIGQIYVIY
                     HPTAIAVGYTPVLHIHTAQTAVKFVELIQKMDPRTGQITEKNPSFLKTGDVAVVRLRP
                     LNPVAIEPASVSPELGRFAIRDSGMTVAAGVVKEITETA"
     CDS             complement(376334..376651)
                     /codon_start=1
                     /locus_tag="CSUB_C0389"
                     /product="small subunit ribosomal protein S10"
                     /protein_id="BAJ50250.1"
                     /transl_table=11
                     /translation="MTQIVRIKVTSTNLTKLEEVCREIKDIAEKTGTKISGPIPLPVK
                     KLVIPTRKSPCGEGTKTWRKHQMRIHRRLIDLGITDQRVMRQIMRIQIPDDVAIEMQM
                     TTK"
     CDS             complement(376700..377461)
                     /codon_start=1
                     /locus_tag="CSUB_C0390"
                     /product="ABC-2 type transport system permease"
                     /protein_id="BAJ50251.1"
                     /transl_table=11
                     /translation="MAITFLLELGLYLVLTRLPPQFIQAFSGAAWTLGIIAPSAGLLH
                     VLALTIGSSTSAEEYELGTADYWMTQPLRRSSYFLGKTIGGLVLLFLIIFTYSLLSLS
                     VSWYVFGPQSKVETFPLALAVSTASAAPFYAIGLAFGELLRRSMMSTIVAGAVFFASA
                     LVQTYANFVALIAGDLTLQEFVRFLPTWAPTGLTPTILTDAVGLGINTPGAPFAGFGA
                     ENLWLAAANLVTYSAVFFLVAWLRFRHSDVTRRAL"
     CDS             complement(377529..378473)
                     /codon_start=1
                     /locus_tag="CSUB_C0391"
                     /product="ABC-2 type transport system ATP-binding protein"
                     /protein_id="BAJ50252.1"
                     /transl_table=11
                     /translation="MSKNPVVVVDSFTKVYGDGTKIGPISLHVYEGEVYGLVGPNGSG
                     KTTTLRAILGLLKPSGGKVSVYGLNPYSHPEKANQKIGYSPEIPNYPPFFTAEKLLRV
                     TCSMKKIFGKDADNEVRRVLDLTGLVNHADRKIGNFSKGMVQRLSIGQALVGDPPLLV
                     LDEPMLGVDPVGRAHIRDVLTQLRKQGKTIIFSSHELYEVQRLSDRVAMVYRGKTVFE
                     DMVMNLLNNSSHTRVVAELAAEPDGKLAKALEEITGVLKVAIEANRVVIHVDSSLDPR
                     EKIAEKIVKLGYGLREFRLSQPSLEEVFINRVRESVGG"
     CDS             complement(378466..379302)
                     /codon_start=1
                     /locus_tag="CSUB_C0392"
                     /product="hypothetical protein"
                     /protein_id="BAJ50253.1"
                     /transl_table=11
                     /translation="MMRFFLAMLLPALMFFPTVAGFEKGNYFSYAYVLAKSDGETVSG
                     ELSLSILDVLPDGRLRLRGVATFNDGVATFEKNLPQSYFSPPAVDLAEYEGVYSFRRG
                     NVSLRISVDEIGEELRAVSGFEFVTKVYHVSASADNQGESTRLEGVIEIIASSKVVYS
                     LDLAYTGSGQKTASFKMSLKDTNVDLSAFNTTATISPTSFTATPASFFSAFPSGSVQF
                     FDSVGRRDVVQEQATLSSAYFDRVGVVLAAGLATIGAVSFLSMRRKGRAMEPGEKKAH
                     YV"
     CDS             379372..380766
                     /codon_start=1
                     /EC_number="2.6.1.1"
                     /locus_tag="CSUB_C0393"
                     /product="aspartate aminotransferase"
                     /protein_id="BAJ50254.1"
                     /transl_table=11
                     /translation="MTTLRAESRRLAVELVKVLAARRELVNKIAEHKRALGQQAVLPD
                     VEKEVRRAMLEEASRHGIPEDTINRIATIIFSDAVEQQAATPKQKLTHFDILKRAVEL
                     QKNGREVHRLEVGEPDLGAPPEVRQSAANALLEGYARYIDSRGLAELRTQIVNQVYEK
                     HGLEITPENVVITPGGRFAIYLAAKTLLREGDELIVIDPSWPMYRQVAPFVGARSVHV
                     KTLFEDGWTPSIDAVEKHISPSTKAIILNYPNNPTGKILDRTTFNKLVELATDHGITV
                     ISDEVYADYVRDGHVSILDNDLGKQHVLIQSFSKSYGMTGYRIGYVIADKNLVAKMAS
                     IIGLVITCVPEFIQRGALTALSLRDAPKEYAAIMMRRMEKAVHELEKVGAEFYRPDGG
                     MYVFPRVGKLGEDAMATAFELLESKGVAVAPGSLFGGYDEFIRISLGAPDESIVKGIR
                     LLGEFIAEKGRARG"
     CDS             380759..381592
                     /codon_start=1
                     /locus_tag="CSUB_C0394"
                     /product="prephenate dehydrogenase"
                     /protein_id="BAJ50255.1"
                     /transl_table=11
                     /translation="MDKRRALVIGAGPMGLWMARNLVKRGYRVTVYDKKRNKLKKIEG
                     GGISAAKSLKEALSSSSLVVLAVGASNAATLLSSLMSTVSGKIILDISSVKTPVAKAL
                     AKHRRSSNMVVLIHPLFGPGTKKLEDKSVVFIPFRKPEEEYRVCTEVFHPCKILRMSV
                     ETHDRKMASAMALPRLLILTLLRSWSMDDVKPLTVSQKALMLVASPILSESPSLFKEI
                     TEKNPYTEKALINALKTLNQFRNNPSTASKIFKQLQTKKLVKGYAKIYQLLEEAASKT
                     W"
     CDS             381625..382146
                     /codon_start=1
                     /locus_tag="CSUB_C0395"
                     /product="nitroreductase"
                     /protein_id="BAJ50256.1"
                     /transl_table=11
                     /translation="MSDNQCLRVVYSKRETREFLDKPVDMDTISKILEAGRRAGSAKN
                     RQPWQFILIREKENLRKLSNFGQFAQHLPSAAFAIVITIPDKYFQDRFDAGRAAQNMM
                     LAAHILGLGSCPITLHSEEAAKNHLNIPGDQRIAICIAFGHPKPSKPLGKIIRKPLHE
                     ILHLEKYGNQPKS"
     CDS             complement(382234..383256)
                     /codon_start=1
                     /locus_tag="CSUB_C0396"
                     /product="hypothetical protein"
                     /protein_id="BAJ50257.1"
                     /transl_table=11
                     /translation="MFTLGRKHTLRKDVLDALFDGPHSVTELVSAVRASRQGVIKTLK
                     SLMSEGLVEKEPGKRGMYMLTEKGYSEHHSRREMLVYDEECEPKLLIDPVNPLKLIFY
                     EEIPAPTSYHARLFISEKLGERIDYDRRFFTLEHGRVYQRRDVVERLTQRFVNEFFWE
                     YFTQSLFDMVNYELNEGEELSEETIGTELSFSAKLSLSLDFTAFQDPEKKIVDKARMK
                     QAAALMILHFLNTFEQRGNATCVDIIRFFERRGWAPKGWTKLLEAAVNQQKIKRRNII
                     MHKKTDNRARLSLIKEALETLRSSGKIDEKSYKQAMKIHGRDLHKFLAGLKPPIKIAT
                     KINKSN"
     CDS             383659..384078
                     /codon_start=1
                     /locus_tag="CSUB_C0397"
                     /note="phage protein, bifunctional DNA primase/polymerase"
                     /product="hypothetical protein"
                     /protein_id="BAJ50258.1"
                     /transl_table=11
                     /translation="MGETTNLRADDYFSRGLVVIPLVRGDKRPMVSEWQKKSREELFA
                     VFREHSGCNIGIRLDSLTVLDIEHARLWRLFFETEPRELASKTWVSRTGGGGYHVYFK
                     GSTTPSKADGYAELRSGEKQFVVAPPQHTPPEIGISG"
     CDS             384075..384515
                     /codon_start=1
                     /locus_tag="CSUB_C0398"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50259.1"
                     /transl_table=11
                     /translation="MTDIETVGIATPNSHELFEQARKVIETLRLHSRLIERLVDAWRP
                     EHRHNLALWVSGALRKTGVGKTEAKIIVKTICLLADDQELDDRLRAVEDTYRKSIEEV
                     KAWSGLRQELVTLIGEEAAEKLLHLFQATKDKSGETKGKKNCTS"
     CDS             384521..385801
                     /codon_start=1
                     /locus_tag="CSUB_C0399"
                     /product="hypothetical protein"
                     /protein_id="BAJ50260.1"
                     /transl_table=11
                     /translation="MKPLMMEAIAFQNIVGEYDDRLLIYENGSFSVVEQLELNGFVFK
                     PRPRKSYPYEPYAFSDGPAPYRLELIERVYREVDTFVDAEPEVKAVFTAFVILSYVQE
                     KFDCIPYLYLVGDNESGKSHTLNLFTWLCYRPFSGVSHTAADLYSYLEDDGLPLTIIE
                     DEFQGSEEDNDKMKIYKSGYKRGARVGRVVTYEGGRRIDYFNTYGMKIMAGERLIENK
                     GLLQRCIIVELVEGYPVKDHYDESDYFRFRALRNDLLKWRMKVLAGDEHLEQPVTELK
                     GRARELYTPLLAVLKGHEFYEKVIEWIKKLEQQKMAEKQLSVEGLLAKILLDSVRKGE
                     NELALDKIWQALLQFADVVTTPNKPDTMYIPHIGSVTKKLLGRRLREVFAASRRYTRL
                     EGRQSVVYCFDACKVTRLARKYGLDPQISTQLSL"
     CDS             386197..387624
                     /codon_start=1
                     /locus_tag="CSUB_C0400"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BAJ50261.1"
                     /transl_table=11
                     /translation="MLHRIPTHFSRVGFFAGLRTRLSYVFTGVSKRTMRVGKVAELMG
                     LGLEDVELPAFKDSEINFEAGDVVYVTGESGGGKSLLLRHLAKQMRNNPEFAPVACSW
                     RLNIPRDKPLIDCVGRDVKEAVEVLSAAGLSDVFTWFRRFDELSDGQKMRFIFAKALD
                     TGARTIIIDEFCSVLDRETAKATAYTMQKLARRRGITLIVATAIDDLVEDLNPNLLII
                     KHLGPHLEVKRLNPVPRPCSLLEKVVVEEGSTEDWRLLSFLHYRSHHTPAAVKIFRAV
                     LNGRVVGVVVYAKPYLHATGYSRFFRPDWYLRERMNHVLRISRVVVHPSFRGIGVARK
                     LLIESLPRLDVPFVEILSTMERLIPFTRSIMTRWTVVEPNKEKKALLKEFRDKFGVDV
                     MRHGVDQILRYINEKGLLNELRRWLLDNLEKFADAAASSRDTANMLKTLKSSCSSKVY
                     AIWINPNKKFEKIIREAITDQSFLL"
     CDS             complement(387682..388146)
                     /codon_start=1
                     /locus_tag="CSUB_C0401"
                     /product="hypothetical protein"
                     /protein_id="BAJ50262.1"
                     /transl_table=11
                     /translation="MSLKPRVTGNILSLDKKKDLSRLMRRLPLWSIIIAIVSIGFALL
                     ALFMPTFLLHTIAGTIFTHEIIESSFSVALLLVCTVFFFTAYKPWKKIVATILSLTSL
                     AIPFIVFHQLTNRLREIAKPVEAYFTFGPGASSLFLAGILMLVASLLWRKKK"
     CDS             complement(388168..389235)
                     /codon_start=1
                     /locus_tag="CSUB_C0402"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50263.1"
                     /transl_table=11
                     /translation="MWVDVVVGAGPSHEEDVSRDLGVLDVWEGFLSAKTGTTAENYRA
                     AMRRFVTTCGFSDLVDAAMRAEEKDLVLFIRHLRDEGLAPQSIRLHYQAVKSFLSLYA
                     RPINWSRVENLLPKKRNVRFNEAVPRDVVEAVLENMDNSTKRLAIWLIWATGLRIGEA
                     LSLRARDIDFTIDPPKLTVISEKTHEPREVPLPTDIAEALKQHLQRLQPGDFIFHPRG
                     NPSKPLARTKLRAAFRSALIKANRAERDKSGIGWRYTIHGLRRSYETNLVRAGVNSMV
                     VGLLLGHRIGIEQHYLRLTYDDIVKEWRKAENLLTLKQPIPTNIEERLHALEEAVKLY
                     EKIFAKLEEKFPNFMRLLDLE"
     tRNA            389359..389441
                     /locus_tag="CSUB_T13"
                     /product="tRNA-Ser"
     CDS             complement(389544..390398)
                     /codon_start=1
                     /locus_tag="CSUB_C0403"
                     /product="hypothetical protein"
                     /protein_id="BAJ50264.1"
                     /transl_table=11
                     /translation="MKLKQVQLLPMLLALLLMSSTAVAHGEDQPRELCLDLATAYDRN
                     FKWYNTMGPQPVYNGDHYLFTGSRATNVYQDALATTSIEAGRTFALSTRISIYMENRS
                     PSDRDEFAVFVTDDTKVFTGDEFGFVIRQKSSTINGYIQSPRIPEFFREFRLDDIPLG
                     VEKTYTLKAVYSEVDDETIIRFFVNDVNVLTYGYPKVTGENFYLVISSKKLSPENVDT
                     SGNYVKVFSACIVNLPPQRADNTTQTSPQQSSTPEQKYILIMLIAQSVLLTLLVILSL
                     ILVKSCKT"
     CDS             complement(390403..392133)
                     /codon_start=1
                     /locus_tag="CSUB_C0404"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50265.1"
                     /transl_table=11
                     /translation="MQLTLFRTFSRLFFWVLAVIVLSILFPALIPNYELAYLRPWALY
                     SNSVFQWAYENMQRSSPSSLILLMDLSLSSIAAVLVVANNRNMDNSLTHHRPPHGELS
                     HPAYLRYTVDNFNRSIDTVFDEKRQHVVDLLGFSFLMGTLFSGAPAVTTGIEFVAHSL
                     KYSWLIGTPHLILQNIGYLSFGKDDFLINEQNITKNAAQLKNKHVIFILPTKGGNHVT
                     VKMSVESAIFWKEIIELKHGKMADISQWIICEQDDYEANVKGYGELASMGARVIIVPR
                     EFNTVNGTRYKARALVYANKVMAEEGLVNKDTWIYHQDDETKVGEDTILGIMDYIINA
                     GDHDIYAAGIINYADSLTYTPSRAQEPSRSYDDFRILLTTKTNGKLSFGHHGSHLLVR
                     ADVEAAVGWDFGDVKTEDWMFGLMMWQRHRPGKTILKGYGYEKPPLTTKDLLKQRRRW
                     AHGAMQIVFDKRIRPRYRLAALYGVVSWMSALPSLIAFAVSIIYPTGGLFPASGIIAG
                     FTWYSLYRYHAGGYKLNDAYLTGPEKRGHRRRYRIIFAVIGGMMLEACAPWYALINPP
                     KGFEVIKKDD"
     CDS             complement(392289..393257)
                     /codon_start=1
                     /locus_tag="CSUB_C0405"
                     /product="sugar phosphate isomerase/epimerase"
                     /protein_id="BAJ50266.1"
                     /transl_table=11
                     /translation="MKLGVFTVLYNDVPLEKIAPKIASFGYEAVELACWRGSLHLDID
                     KALGGGAQEIKRIIENNQLLISAVSNHLEGQLVLGPHDASTDGIFKGSPEEKVKYGIE
                     RMKKTCDVANLLDVPVVVGFIGCPNWGAWYNFPFGYDKIFESYFELFAERWGEILDYY
                     SSCGVKFAHEVHPQELAYNVETAEQALKAINWKKEFGFNFDPSHLIWQLIDPVVFIKK
                     FGDRIFHSHAKDGELVAENLSTSGAIPTGSWLRPDRGFRFRIPGWGQVPWKRVITAFA
                     EVGYDYVMSYEHEDPVMSQEDGLEKTIQYLKPLLIKKRLTEIWWKQ"
     tRNA            complement(393348..393422)
                     /locus_tag="CSUB_T14"
                     /product="tRNA-Arg"
     CDS             complement(393470..395632)
                     /codon_start=1
                     /EC_number="3.6.1.1"
                     /locus_tag="CSUB_C0406"
                     /product="inorganic pyrophosphatase"
                     /protein_id="BAJ50267.1"
                     /transl_table=11
                     /translation="MMVDFLTIALLLGALGALSAVGFVALVNRYPKGGPEFVSVWSAI
                     REGSIAYLKRQYRTIFIISVFIFILIIVSFAAFPQMGGLVYGLQIGGSFLLGVAFSLI
                     AATIAMDSATRANVRTTYAASKDSVSALRVATMGGAALGLAVIAMSLLGLTILYIVFR
                     DPGVLAGFGFGASLAALFAQLGGGIYTKSADIGADLVGKVEAGIPEDDPRNPAVIADQ
                     VGDNVGDEAGRGADLFESVTAENLGGMIVALIISIILFEKINETYVVLPLVVRAVGVI
                     ATLAGVGWALYQKSFKESIEPLRNGLIITSIVAAVLMYLVTSTVFGGGFLPLFVTMLV
                     GLVAGILIMFYSEIYTSLKSRHVSLIATNSESGPALTVVSGLSVGMISTALPVITVVI
                     AIAISFLLGIEWAKVVGLPDLFLGGVFGTTMATMGMLSTAGFVLTMDGLGPIVDNAGG
                     IAEMANAPKTIRDRLEPLDALGNTTKALTKSYAMGSAALAALLLFQAFLLEVGRYMAG
                     IVELSHLTPELSAKLLNNIEQLSTQLQLNSPAVLIGLFIGAMLPFLFSGYAVKAVGTG
                     AFQMVEEVRRQFREIKGILEGKARPEYGRCVDISTRTALRLMVAPTLIVTLSPIVLGI
                     FLGWRAVGALVIGATVSAIPLAILGFYGGAAMDNAKKYLEIAGRKGSDAHKAAVVGDT
                     VGDPMKDTYAPSLHILIKLLNTLSLVFIPLFIYGLLTL"
     CDS             complement(395870..396763)
                     /codon_start=1
                     /locus_tag="CSUB_C0407"
                     /product="hypothetical protein"
                     /protein_id="BAJ50268.1"
                     /transl_table=11
                     /translation="MRLNDDSGSSAAGPAVDDKGESAKEVGRRFYADIHRKKDDSGYR
                     ITYTTDGEAFKHVDSPTKIPAEAGDKVYVDVIPVMHIDGFIELLRRGAEVHYLRRLTL
                     IKQMRKRLGIESKSAKTDVRILMNIEEKWFKRVDEDFLAMRQLISPFRRLERTKQRLE
                     NQYKDVPDVAKQSFKRLIDHIEEEKLVVARPIIEEAERRYPLFKLIAEELGLTGDSHL
                     LGRQALAELLTYVDFSRSFTDVRIYLGLFRQRINNQKYNHIARKALNRLTMSITNKEP
                     RARDEEEIAFKIWLTYRRGAQ"
     CDS             397024..397638
                     /codon_start=1
                     /locus_tag="CSUB_C0408"
                     /note="oxidoreductase molybdopterin binding"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50269.1"
                     /transl_table=11
                     /translation="MDEILPPGQVWARNWVIYSALGTPKIDVEGYRLRVTGLVEEPRE
                     YSYQELLEMADVEYVKPFHCVTKWSIREVRWTGVSMKRLLENSRVKKEGKWLMFVCAD
                     GYTAPVPLDDALSEEAIVALKMDGRPLEVDQGFPARPFIPHLYGWKSAKWLVEMEVIP
                     TYVDGYWEMYGYHERGNVWGEERFKGMGFRHALRKAAGIIQRGT"
     CDS             complement(397619..397981)
                     /codon_start=1
                     /locus_tag="CSUB_C0409"
                     /product="hypothetical protein"
                     /protein_id="BAJ50270.1"
                     /transl_table=11
                     /translation="MEKSHHFSVNWLSHEHVEKMELLAKPAEPTTVDKLKESGLMHRP
                     GENTGAPILVDASAYLECQVTTRLDAGDHILYVAQVVDARAVDDFGEYWGFRVYRPVL
                     YVGSARPGWPKFLKFPSE"
     CDS             complement(398157..398711)
                     /codon_start=1
                     /locus_tag="CSUB_C0410"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50271.1"
                     /transl_table=11
                     /translation="MKIALDVDGVLADLAGMIIRLYEEDTGRRISRDMITEWEFWVKL
                     SMTRQEFIDLITRSWRRWTELQPIEDDVAEDVEKLNTVGEVDILTQRPAETVEYVKQW
                     LKQHGIMYRRFMWVPLKASKTSFVYDVYIDDSPHLAEKLANTQRMVFLYDQNWNRRVK
                     PAPNIKRISSLDEAYQLLVHGDGF"
     CDS             complement(398689..401829)
                     /codon_start=1
                     /locus_tag="CSUB_C0411"
                     /product="DEAD/DEAH box helicase domain protein"
                     /protein_id="BAJ50272.1"
                     /transl_table=11
                     /translation="MKTRNLIDSEKLLEKLGFDYVKFVTPAVSPQLARETFSDILPAL
                     ASSENIRSRKLAEKHLYIHQKEAFDSLARGENLVLKAGTGSGKTEAWFLYTAAHRVKT
                     LAVYPTLALSNDQVERLNDYCMSLGLKAVAIDALRKEELVRRSGARVVRNMVKEADLV
                     ITNPAYLLNELKRIGAGKPAFLRDFLGEVGLVVLDEFDFYGPRSIAILLGMAQILHEY
                     VNPRFQLVIMTATIADPTEAAQILTEINGRKTAIVDGQPYRSENRTYLVLGKSLKKIW
                     TTVAAQRDKLAQAGAGRDILKALDDFEEFRRSFFKVVEAAKAAGVDFPDYFGDPSEII
                     KQFVDDEALTLVFTTGIASAEEFARKVKNEVGESHRIASHHHLLLRTQRREIEQAARE
                     GVVKLIFTPRTLSQGIDIGLIRRVVHLGLPQTVREYWQREGRKGRRPDIPWTETIVIP
                     FSQWDRDLLSRGVEVFRKWTELPLEKTLAHRENEYRRLFKTLFDHQSPHGRTKLGKED
                     VLFLRGLGLEKDGELTYAGKMAWVKMNFYEFAPPYGVKRWRTSEDGGLRNLEDISHVD
                     LVEKFQPGAFDPSSDGVVVEMRTGGKMGRVVTAVVVDSLNESRLRRHDALAPVLEEYQ
                     RTKQRWGEEPNVVRDFHRGNIKSVIHLVAQLPSNGFGQFIEFPQRVEWRIYSGRRRLM
                     TVGDRTYVTRDAKVIEVPTPTYGIYGDYTYGYAVEASPLDDTALLRLGASFILIVLRR
                     IHHLSLMIMKFDMIVLAERKFVRFYEGECAGHLPKIDWKALRRDVEQYTPDELDEIIL
                     QQIDEEVYADFLARKLDWETARSYALKIIDYVLERERIALQLGSSVISLPKPSRALKL
                     AAVAAVPLLLREDLRAGLFCIGFYDGEEEKVFTGVFELGSPTESTSPILSELSSLVDK
                     GFALAVYSLEPLQTVLEQTGLSSLRALLKGLEHSGQLLHVRPLLEKKLSSALSLDAVE
                     KSLRLRRSIEPGDLFARTMLEKRRRPSMRLIRSKPSRLTETIESYLKEELRSVYIAAL
                     LAKYFEADGDENSPRR"
     CDS             complement(401826..402269)
                     /codon_start=1
                     /locus_tag="CSUB_C0412"
                     /note="AIG2-like family"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50273.1"
                     /transl_table=11
                     /translation="MAVWYFAYGSNLDQEGMRRRVGEWLDLKPAILRDYKIVFNVFSS
                     SWRGGVANIEESPGSVVYGAVYLLEESQLEKLDKYEGVPHLYHRRKMTVEVGGRPLEA
                     YVYVATNPRPRLTPSSSYLALVLKGLKKLGYSDDVIHSIRMQVER"
     CDS             complement(402278..403549)
                     /codon_start=1
                     /locus_tag="CSUB_C0413"
                     /product="glycine/D-amino acid oxidase (deaminating)"
                     /protein_id="BAJ50274.1"
                     /transl_table=11
                     /translation="MPDLDVVVVGGGILGLASAYYIKSLHGELSVAVIERGRDVGQGN
                     TARSVGGYRQGIFTSYVNRVLAETTIQHLREAEASGETSLNMREVGYLILLDDNRLKN
                     VETVVETFLKEGKAILLNPETLSEKLHMRTDFTGDEEAMLMGLSNIKAGLFAPRCGFL
                     DVEKVVNLYKKRCIDVGVELILGKRVEKLLLEPENPLGIPREPRAWQKVRVAGVVADG
                     EVIKAGKVVVATGSWTPQLLDPLGVDCFIKAKKRQLFVISAEGELQRLLTNTWDGGRP
                     MPMMFFPNGLYIVPRMSDKAFWVSLTDEFGRGFGLDDEPEPSYYLDNVYPPLVKYYPQ
                     FLNARPSSMWAGTYSMNYLDGNPLIFRFLNCLVVTGASGSGVMKSDAIGRIAEAALFG
                     KEYAMLHGGVKFEVSRLGVENRRVDKEYFIL"
     CDS             403626..404705
                     /codon_start=1
                     /locus_tag="CSUB_C0414"
                     /product="diphthamide synthase subunit DPH2"
                     /protein_id="BAJ50275.1"
                     /transl_table=11
                     /translation="MQIINNYRVEIEEAVEQLRRMNVSRVLVQSPLGLRGVAASVAEQ
                     LKSNKFEVLMSSSNCWGGCDIAYTEASGLDVDAIIHLGHSRFLRHDKLPTIYLECRYA
                     DPSPVYDLMDRIAAELTGYKKVGVGASVQWLDYLSFVKESLARRGVDAVTAMPDMYSV
                     YESQVLGCDVSALKKLEKNVDCFLVLGSVFHGLGIAVSSSKPVYAADPHTQRVENLDK
                     MRERILRQRYAQIIRFRESRTVGVLVSIKPGQKRLGLAKKLNNILNQHGKNSTIVSAD
                     EITSATILENGFEAFVNTACPRLSIEDQSRFTKPVLLPVEALVAVGLMEWETVVEHGF
                     LMYPWGWHDRKVGERFWRGVSLLQV"
     CDS             404702..405274
                     /codon_start=1
                     /locus_tag="CSUB_C0415"
                     /product="exosome complex component CSL4"
                     /protein_id="BAJ50276.1"
                     /transl_table=11
                     /translation="MRKKLVVPGEVLCVLEEFLPRLGSFVNGEGKVKARVLGEAVYDL
                     RSKEVSVRPLKQIIDLRAGDRVIAEVKDVQDKIAVAEAFLKLPNIPLKYRRTGVVIAK
                     RNDVLDNLLGIGDIAVLTVRGVYRGINTFDVYSPGCGVMLAICSVCGNVLDKRDNILS
                     CSRCGNKERRKTVLKYGNLDILKQLIGEEL"
     CDS             405271..405549
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /locus_tag="CSUB_C0416"
                     /product="DNA-directed RNA polymerase subunit L"
                     /protein_id="BAJ50277.1"
                     /transl_table=11
                     /translation="MKMKILEETGDFLAISVYDVDQSILNLFTETLNSIEGVSYAGYR
                     VEHPLTGEITVSIKVESTKITPRKAVQKALERLQETFKILDKELEVLR"
     CDS             405555..405887
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /locus_tag="CSUB_C0417"
                     /product="DNA-directed RNA polymerase subunit M"
                     /protein_id="BAJ50278.1"
                     /transl_table=11
                     /translation="MEFCPKCGKTLTPSRVGGKAMLVCKRCGYQKPLEGEKVVIKLEK
                     ENTVSKNVAAIVEAEEAPLPTTSDVVCPQCGHNEAKWWTVQTRSADEPMTQFFRCVKC
                     GHTWREYA"
     CDS             complement(405884..406588)
                     /codon_start=1
                     /EC_number="2.4.2.7"
                     /locus_tag="CSUB_C0418"
                     /product="adenine phosphoribosyltransferase, fused to
                     N-terminal DNA-binding"
                     /protein_id="BAJ50279.1"
                     /transl_table=11
                     /translation="MKPNPNAYSSYLAVQILKTLKTGMDYKILSKQTGIPVSTLTRYV
                     TNKTIPHGKRAAVLIEKLVSNVDIPALVNQRLVLTEDEVDVSQVVSESSLVELIVAYM
                     LREFSGYRIDAVLGVDRAGTVVATGFGLSTMKRVFYAQNTESYASDRWLEIRYKNKQA
                     RLVQRLYVPSEALKNHILVSAGVLDSHVPLREIRTHIVSARGELVGVCAIAASQEFLK
                     NIKPFQFGKILSFVTF"
     CDS             406678..408861
                     /codon_start=1
                     /locus_tag="CSUB_C0419"
                     /product="molybdenum hydroxylase family protein, large
                     subunit"
                     /protein_id="BAJ50280.1"
                     /transl_table=11
                     /translation="MKRVYTAYDAVRGAPIYTEDIVPEDSLCVKALRSEHSHALIKRV
                     DVSAALEVPGVVAVLTARDIPGENITGAVILDRPFLAYEKVRCLADPIALVAAVDEET
                     ADKAIEKIVVDYEVLEPVYDPVKALEESAPKVHENNLLRHYKLRKGDITRGFNESDVI
                     VEEEFRTQMQDPAPLEPEAAYAVPEKDGTLTIYGSIQNPFYVLTGVSRILGLPRDRIN
                     LVVMAIGGTFGGKSDEAPWDVCAMAGLAALKTGKPAACIYGRDESMIAHSHRHPAVMR
                     YKIGATTDGRLKALDADLYFDTGAYASVGPLVMLRAVTHAAGPYVVENVRVDSYLVYT
                     NNLTAGSMRGFGSPQVHFAVESMMDILADKLGMDPVELRLKNAWRQGVVTASDAVLMD
                     NPDFGVLASRVCEELGWRRGEKEPDEGVGIAFMAHGNSLGPEGEDKSSATVRISPDGV
                     VHVATSLTEYGTGASRGFAKIAASVLGVPEERVVVDRVETKKVPDSGGTFASRSTLMG
                     GNAVYLAAKRLKEKIEKLMKESGRSGLDVADFVRDVFHEEVSEYAEFKLPVCDYNPET
                     GKGTPYLQYTYGVVGVRVKVDRELGVVRVKDIVAAFDVGRVVNEGYLTAQLEGGITQG
                     VAYGLLEELLIGKKHKVLNPNLADYLVPTAADMPRVKVIVIENPSPLTPIGTRTAGEP
                     GIDAPAAAIANAVHDALKIRITSLPITPEKVVAALEKSQAIAVTV"
     CDS             complement(408842..409306)
                     /codon_start=1
                     /locus_tag="CSUB_C0420"
                     /product="molybdenum hydroxylase family protein, small
                     subunit"
                     /protein_id="BAJ50281.1"
                     /transl_table=11
                     /translation="MLRIEFVLNGKQVSAELRGNERLMDLLRRLGMKSVKEACGTGDC
                     GSCNVIVDGKLINSCMMLAVQARGKTVTTVEGITPEEKLHPIQSALLDYTASQCGFCI
                     PGIIMTAKYIADNYPDADEQTIRHILIANICRCGGYTKIVDAVSTALKLLQR"
     CDS             complement(409293..410162)
                     /codon_start=1
                     /EC_number="1.2.99.2"
                     /locus_tag="CSUB_C0421"
                     /product="molybdenum hydroxylase family protein, medium
                     subunit"
                     /protein_id="BAJ50282.1"
                     /transl_table=11
                     /translation="MKAVPSFEVYTPSSLQEVLNIYSSLDEEVVLYAGGTDLMPFMRR
                     GKVRPRAVVDLSGVGELRYVRREGDFIHVGGLTTVHELATSPAIPENYFSIRWLSKYF
                     GAETTRHMATVGGNLASGGERDIPAIMASLDGQVKIMGIDGERVVGPLGLTLRRGEVI
                     VEAVFRDWGPGSVSWFGKFEKRASNGIGVVTAAVSMKAVHGVVEKIAVVLNRVEGRTM
                     GRLTDLEDILTGKAINPSLLRAAVEESVSRIRPASDFRASSSFRKHVSKVLVRRGLEF
                     CWSYLTRGGFVED"
     CDS             410209..411651
                     /codon_start=1
                     /EC_number="3.5.2.-"
                     /locus_tag="CSUB_C0422"
                     /product="dihydropyrimidinase"
                     /protein_id="BAJ50283.1"
                     /transl_table=11
                     /translation="MVRWLTSLYFCLQLIDVLAKDGFDLLVRNCRIVDVEGVYEADIG
                     VVGGRIAAIGRNLETRAEKTYDAGGRYVLPGAIDGHVHFKLKYFEDVYTADDFYTGTV
                     AAACGGVTTIIDFVTPETKDYVEDFRRRKAEADGDVVVDYGLHVSVTDFDEKIARMLT
                     NLFEKEGLASVKMFTAYSRRGLMLDDGKAYKLMKLCREKNVLVMVHAENEHLINTLLE
                     EFVSQGKTEPIYHAWSRPDFVEAEAVERVAFLAGLTGAEILIVHVSSAMGLNTILEAR
                     RKGVKIHGETCPHYLMFTEDVYKRPDGAKFIMSPPLKKEHDKEGLWKGLLTDGFSVVG
                     SDHACFNLSQKLGHKSFTTVPGGVAGTEVINMILYSEGVVKRGMPLSRFVDLTAHNPA
                     KLYGIYPRKGVIRVGADADFYILDPSQKTRLTRENLHSNIDHSIYEDVEVSCRIVATF
                     ARGEQIVDNGEFIGKRGRGEYLHMKRGEAE"
     CDS             411648..412502
                     /codon_start=1
                     /locus_tag="CSUB_C0423"
                     /note="Memo-like protein"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50284.1"
                     /transl_table=11
                     /translation="MKPRRRPAVAGYFYEGSREALLRQVEHCFLSPHGPGKTPAREWG
                     KRRAPALISPHAGLMYSGPVAAHGYYELTKYAVPESVVVFGPNHYGVGTVVSIYPGGS
                     WVTPLGEVKIDEKLAAEIAGQREFFYLDEVSHSREHSIEVQLPFLQYLYGDFQFVPIC
                     INDQSLETCVEIGEAVGEVVDGRNILMIASTDFTHYEPHETVLKKDRLALERIERLDV
                     EGLYGVIERHDITMCGYGAVAALLTAAKKLGAVEATVLKQATSGDTGGDYGSVVGYAA
                     CRIELPEK"
     CDS             412499..413458
                     /codon_start=1
                     /EC_number="2.7.1.36"
                     /locus_tag="CSUB_C0424"
                     /product="mevalonate kinase"
                     /protein_id="BAJ50285.1"
                     /transl_table=11
                     /translation="MRKQVKVFAPGKVILFGEHFVVSGYPAIVTAIDRGVTVTAKKTD
                     DKFVIVSKHSAAAWNATGETITAKPSALAPLYNMVREMCLDHGVSCTGWVEIESDLIS
                     GGGLGSSAAVSVALAKAVSLLHEIQLSKDQLINYALKAEKEFHGRPSGIDPTISTVGG
                     TIAYRGLGNYTAIEVGKPLDLIIVFSGRKRKTSKMVDAVQRFAAEKKDIFTELVKLYS
                     HVYEMAKEALVEGDFQAVGRLFTLNHLLLRSVGVSDNVLEEIVRKLRNKDVYGAKLTG
                     AGGGGCVIAVADGRAVEIAEAMARLYPSAWMSRTGVAGVGEKA"
     CDS             413455..414237
                     /codon_start=1
                     /locus_tag="CSUB_C0425"
                     /product="acetylglutamate kinase"
                     /protein_id="BAJ50286.1"
                     /transl_table=11
                     /translation="MSNLVVLKIGGSVITDKKRENFFRQDVMARIAKEIARCWPTPLV
                     IIHGAGSFGHPVAKQYSVDKGYREQGQLEGFVKTLQSVKTLNQHVVNTLIETGIGAVG
                     MPASTLFITRKGIIETAHLDLVLSALDLGVIPVTCGDAVFDRELKFTVLSGDQIAIHL
                     AKSLKASRIVFASDVDGVYDVDRETGEKRLLDKLDYRKHTTLLYGGVEGEDITGGMFY
                     KVENGFEAVKAGAEVVIVNGLVEGRIEAAVKGKPVTGTTLVM"
     CDS             414239..415315
                     /codon_start=1
                     /EC_number="5.3.3.2"
                     /locus_tag="CSUB_C0426"
                     /product="isopentenyl-diphosphate delta-isomerase"
                     /protein_id="BAJ50287.1"
                     /transl_table=11
                     /translation="MGIEARKSDHIKISLEKDVSYRKSTWLEYVELVHQAAPEIDPDD
                     IQTETIFLGRRFSHPFIIESMTGGTAEAERINANLGEAAAIFKVPMGVGSQRAGVVKP
                     ETVYTFRAAREHGPDAFLIGNIGAVQLVENGVEMGVKAVEMIDADALAVHLNPLQEII
                     QPDGKARFRNLSKTLEKLRKEVSVPIILKEIGCGLSREVVAMADEAGVDAFDVAGSGG
                     TNWTMIEMIRAEEMRDIEKKALAEVFLEWGIPTAAAVMEAVDATTKPVIASGGLRTGL
                     DAAKAIALGASMAGLARPFLEPATKSVEDVLATLKRLSDQLKTSMFLTGCRSVDELRQ
                     APKVVLGPLREWAAQRLSRGSRQT"
     CDS             complement(415290..417014)
                     /codon_start=1
                     /EC_number="6.1.1.17"
                     /locus_tag="CSUB_C0427"
                     /product="glutamyl-tRNA synthetase"
                     /protein_id="BAJ50288.1"
                     /transl_table=11
                     /translation="MKTLRDRVLEEALRNAVEHGGKAVAKAVLSKILGSEPALRQRVA
                     EVKQVVEEVVEEVNSMDLGVQKRVLAEKFGGQEPMRRRDVGETRLPPPLPGAVEGKVV
                     TRLPPEPSGYMHLGHALAGLINEHYARRYGGKLWLRFEDTNPRKARLEFYESFRKGYR
                     WLGIEWDFEKNNSDDMESYYMYAERMIREGFLYPCFCSSEEMHRQRAQGIGCKHRGLV
                     GEAGLETWEKALNRVYGEGEVSFRLVGEMSSPNTALRDPVMFRIVDHPHPLKGREYVV
                     WPTYDFAAAVQDALCGVTHVLRSSEFAFRDELQNMIRGILGLSNPVYVEFSRFEFRGA
                     TTSKREIRSLIEEKVVSGWDDPRLSTIEAVKRRGILPQAIREFTLTYAGVTQAKKIFD
                     WSLLHSINRKHLDPVARRLWFVASPVKLRLINHKRAEVEVPYHPSTNMGKRVVKAGET
                     LYISGPDAENLGVGEVFRLKLLTNVKVVEKGAGEVVGEVVEGPPLKDGRIIQWVSEDN
                     RRVKVIRYGPLFTEDGSVDRKSLWVEEGLAEAAVETVAFEEVVQFERYGFVRRDSPDE
                     LRFVYCHD"
     CDS             417130..417501
                     /codon_start=1
                     /locus_tag="CSUB_C0428"
                     /product="large subunit ribosomal protein L7Ae"
                     /protein_id="BAJ50289.1"
                     /transl_table=11
                     /translation="MPNPYYQTFTPPEELVTAALEAVRLAKTSGKVKKGVNEVIKAIE
                     RGQAKFVLIATDVDPPEIVAFLPTLCEERKISYIFVNSKAQLGEVAGLSVPASSVAVV
                     DPGEAKGYIEEIVKKIQELKK"
     CDS             417513..417734
                     /codon_start=1
                     /locus_tag="CSUB_C0429"
                     /product="small subunit ribosomal protein S28e"
                     /protein_id="BAJ50290.1"
                     /transl_table=11
                     /translation="MSKAPPKVEEPVPAVVEQVVGRTGVTGEVTQVRVRILKGKDEGR
                     VISRNVKGPVRVGDILMLLDTEREAEKIK"
     CDS             417742..417915
                     /codon_start=1
                     /locus_tag="CSUB_C0430"
                     /product="large subunit ribosomal protein L24e"
                     /protein_id="BAJ50291.1"
                     /transl_table=11
                     /translation="MVRTHRCSFCGREFTHGKGMLYVKNDGTLLWFCSRKCRIYMVEH
                     GKDPRKLKWTKAG"
     CDS             417923..418339
                     /codon_start=1
                     /EC_number="2.7.4.6"
                     /locus_tag="CSUB_C0431"
                     /product="nucleoside diphosphate kinase"
                     /protein_id="BAJ50292.1"
                     /transl_table=11
                     /translation="MDRTFVILKPNAVSRGLVGEIISRFERKGLKPLAIQLKQLTRDE
                     AARLYEVHRGKPFYEDLLTAITKGPVVLMVLEGRQAVEVVRKLIGATDPVKAEPGTIR
                     GDYGLDITDNLVHASDSAEAYQRESAIFFTGLEKTH"
     CDS             418364..419602
                     /codon_start=1
                     /locus_tag="CSUB_C0432"
                     /product="translation initiation factor eIF-2 gamma
                     subunit"
                     /protein_id="BAJ50293.1"
                     /transl_table=11
                     /translation="MAFPKQPEVNIGTLGHVDNGKSTIVQSITGVWTAKHSEELKRGI
                     TIRIGYADAAIYICPRCTPPYNHYSVEKCPIHGTANEFQRVVSFIDCPGHHSLMVTML
                     SGAALFDGAIFVTDVRQKFPQPQDGEHLLAAKILGIKNLVIAQNKIDLVDKKRAEENY
                     EEIVDYLEKNGFERPPIIPVSGQHGVGIEPLLYAIQHVIKTPQRDPSKPARMPVLRSF
                     DVNVPGTPARNIKGAVIGGSITQGVLRVGDEIEIQPGLAKQKMGKTVYEPLYTDVANI
                     VAGGKNVEEAYPGGLTGVETTLDPSLGKGDGLVGNVAGKPGTLPPVWTTLTLEYQLFE
                     KVLGLEGNVAVKQIAEKEALVINVSSAVSSGVVAKRSSNRIEIVLSRPLVAEPGSKAA
                     ISRKVGAGWRLIGYGIISGS"
     CDS             419631..419990
                     /codon_start=1
                     /locus_tag="CSUB_C0433"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50294.1"
                     /transl_table=11
                     /translation="MLFCAERGVDYLSVLENKLGERLELVVPSSVVEELRRLAAKGGG
                     KSMLARVALEILKDAEQLPGKVGENVDDVLLQLGRETGYPVLTVDARLMRRLAARNLE
                     YLGISAAGKPIVRLKFR"
     CDS             420037..420600
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /locus_tag="CSUB_C0434"
                     /product="DNA-directed RNA polymerase subunit E'"
                     /protein_id="BAJ50295.1"
                     /transl_table=11
                     /translation="MFMLVEVSEIVGIPPADFGKPLEKVVLNELRKRYEGAVDEELGY
                     IIMVIDAKVDKVGRILPRDGSTYHRSTFTLLTYMPLLNEVVLGEVVEITDFGCFVRIG
                     PIDGLIHISQIMDDYITYDEKNNMLVGRKSGRKLLVGDDVRGRINAVSLAGGAGGKVS
                     LVTRQPMMGSLKWIEEDLAKAVQSSVG"
     CDS             420590..420781
                     /codon_start=1
                     /EC_number="2.7.7.6"
                     /locus_tag="CSUB_C0435"
                     /product="DNA-directed RNA polymerase subunit E''"
                     /protein_id="BAJ50296.1"
                     /transl_table=11
                     /translation="MSAKPRACRNCKRIVVGKTCDVCGSSNLSTSYSGLVIILDVESS
                     EIAKELGIRKSGRYAVKVD"
     CDS             420774..421280
                     /codon_start=1
                     /locus_tag="CSUB_C0436"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50297.1"
                     /transl_table=11
                     /translation="MTNIWSRPIVFTEDMKNRVRKPLGELRHGDLNYSPELAQAKPLV
                     VVGDYTFRRMIEAGLRPDVVVVDAKVMRNAAEMPRLEGYEVTRVRNMAGVIEPEAAEA
                     VMSAVKKGRGAVFVDGEEDLLALPAIHALPDGGVVVYGQPRQGYVVVKASVKVKKLVE
                     EIISMATV"
     CDS             complement(421270..421428)
                     /codon_start=1
                     /locus_tag="CSUB_C0437"
                     /product="small subunit ribosomal protein S27Ae"
                     /protein_id="BAJ50298.1"
                     /transl_table=11
                     /translation="MTKQGLWKRYVLKDGRLEKTLVSCPRCGVGYFMADHGNRYTCGK
                     CGYTRFKQ"
     CDS             complement(421425..421724)
                     /codon_start=1
                     /locus_tag="CSUB_C0438"
                     /product="small subunit ribosomal protein S24e"
                     /protein_id="BAJ50299.1"
                     /transl_table=11
                     /translation="MSKMSLVDSKLVENKLVGRREVIAKISFTKPITRDEAKQLIAAH
                     LSIDPARVVVRKLVYHTGSRLVDVYANVYDKVEGIKVFEPLYILIRNKLAERPKK"
     CDS             complement(421702..422127)
                     /codon_start=1
                     /locus_tag="CSUB_C0439"
                     /product="small subunit ribosomal protein S6e"
                     /protein_id="BAJ50300.1"
                     /transl_table=11
                     /translation="MSQQAAGPRMVLSDPVQKKASTIQLTPQQLTLLIGKRIGETVDG
                     GVFGYKGYLIKITGGSDKDGFPMRPDVSGPRKVRVLLSGGPGFHPRRKPASKRKKKRA
                     RRLVKGLRKRVTVRGDTISEAIAQINAILVKKGEQDVAG"
     CDS             complement(422167..424413)
                     /codon_start=1
                     /locus_tag="CSUB_C0440"
                     /product="translation initiation factor IF-2 unclassified
                     subunit"
                     /protein_id="BAJ50301.1"
                     /transl_table=11
                     /translation="MSYREPIVVVLGHVDHGKCVAPWTLVHEAGEGYVSAEDIFTRYT
                     RDGRVYHVSDGVAVEPAKKPRLATLTGNNEAEAVMLWRRQAPETVIRIHFSNGETVET
                     TPEHPYARAYSSSFYIFTRADRLRPGDRVLSMRKNQVASVAVENVEQVKPCYPYVYDF
                     TVPPTHFYEAQEIILHNTSLLDKMRGTLVAAREAGGITQHIGATIFPIRAIEETCRQL
                     LGELKVKLEIPGILFIDTPGHAAFSNLRKRGGSVADMAILVVDVMKGVQEQTRESIQL
                     LRSRKTPFVVAANKIDMITGWRPTPNAPFIKTYNNQHKTVAEDLDNRIYNLMGELSFL
                     GFRSDLYTRIRSFTDTVAIVPVSAKTGEGIPDLLLLLLGLAQQFMKQRLMKKDDRCEG
                     VILEIVEEEGFGATANILIHTGTLRVGDKVAFLTRRGPITSRVKALLLPKPLDEIRDP
                     RDRLKNISQISAAAGVKMVAEMLEEAVAGSPILAVKNEEEDLRRVAEEAQEFILSTDK
                     IGVVVKADALGTLEAAVNYLREKGVLIRLADIGDVSKRDVVEAHVVRQKDELLGVILA
                     YGVRVDPELEYEAQSKGVRIFKNDVLFRLIEDYEKWVADTIRARQAAEFESLVKPGKI
                     KILKDFIFRRSEPAIVGVEVVAGEVRPGVQLVNKTGKTVGQLSQIQDRGQAISLAKAG
                     MKVAVSIRDAVVGRTIHGDEELYVAVPERDARQLLTTYAAMLEPHALRALEELVEIMR
                     VKNPLWAR"
     CDS             424474..425454
                     /codon_start=1
                     /EC_number="3.4.24.57"
                     /locus_tag="CSUB_C0441"
                     /product="O-sialoglycoprotein endopeptidase"
                     /protein_id="BAJ50302.1"
                     /transl_table=11
                     /translation="MTIVLGIESTAHTFGVGVATDEGKILANIQKIYKPAKGGIHPRE
                     AAQHHAAKAAEALEEAFKKAGIKPSEIDAVAFSQGPGMGPCLRTGATVARTIATVLRK
                     PLIGVNHGIAHIEIGKLVTGCGEPVVLYVAGGNTLLTAFVNKRYRILGETLDIAAGNC
                     LDSFGITAGIGPMPAPEIKASEGNTIYELPYRVKGMDVSFSGILTASEKLLQQGKPIP
                     DVCLSLTETVYSMLTEVAERALAMLDKSSLLLVGGLARSRRLYNMLETMCRDRGARVY
                     VVPDEYAGDNGAMIAWTGVLMLKCGATLPVEQSYVKPRMRIDEVEACWSS"
     CDS             425439..426083
                     /codon_start=1
                     /EC_number="2.7.1.-"
                     /locus_tag="CSUB_C0442"
                     /product="Mn2+-dependent serine/threonine protein kinase"
                     /protein_id="BAJ50303.1"
                     /transl_table=11
                     /translation="MLEQLEFVENRVIRVGAEAVIREMSWKGLRLVAKHRVPKRYRVA
                     EIDERVRRSRTLHEAKVLSHLSENGQPVPLVLFLDLANSIIYMQFIEGVELRSHHSPQ
                     RYAERLGEIVSSMHSMDIVHGDLTLANILAGEDTGLWLVDFGLSAFNADLEEKAVDIH
                     LLERSAAGSFPDKAREFMQLFLRGYSRVAGREKTSEILEKVKEIRSRGRYVVRG"
     CDS             426070..426648
                     /codon_start=1
                     /EC_number="3.6.1.15"
                     /locus_tag="CSUB_C0443"
                     /product="nucleoside-triphosphatase"
                     /protein_id="BAJ50304.1"
                     /transl_table=11
                     /translation="MSVDSLIFVTSNPHKAEEVSQIFKKHGLRLKIHSMKTLEVQSTS
                     LAEIACISAAQAYANLEKPLFVEDSGLFIEALKGFPGPYSSYVYKTIGLDGVLKLVGE
                     RREAVFKSIICLYGLKDRPIFFSGESLGSIAEEPRGVHGFGFDPIFIPRGSRKTLAEM
                     SLEEKNRFSHRGRAVESLVKWIYKDRGRSAGR"
     CDS             426653..427087
                     /codon_start=1
                     /locus_tag="CSUB_C0444"
                     /product="small subunit ribosomal protein S15"
                     /protein_id="BAJ50305.1"
                     /transl_table=11
                     /translation="MARMHASKRGKSGSTRPLSKIPPPWLKLMPEEVESLVIKYAKEG
                     MPPSMIGVVLRDQHGVPLVKTVTGKTILQILEENNLKPPVPEDLQNLLEKIRRMRIHL
                     EKNKSDGHNIHRLQLVESKVRRLVKYYKSRGILPLEYDPLKA"
     CDS             427084..428550
                     /codon_start=1
                     /locus_tag="CSUB_C0445"
                     /product="archaea-specific RecJ-like exonuclease"
                     /protein_id="BAJ50306.1"
                     /transl_table=11
                     /translation="MKKLEGDFEGFVKQAENAAERIRNWVAQGEFIDIFTHNDADALS
                     SAGIIAAALRREDARFRVRSLNRIDDFIELFNSGYVEAKCIIFTDMGSGYTSELLPLL
                     GNRSVAIFDHHEPVQASLPPEWVHVNPHQYGFDGAREISASGVSYFVAKAMNPANIEY
                     SPIAVVGALGDLQDKNTQRRLHGLNEYIVAEAVENKLLEVKDDIILYGRTFRPLHVSL
                     AMTTSPYIPGISGNEQAAYSFLTSLGIGVKEGEQWRTLADLSEEEKKKLYNGLIEYLV
                     SKNLPTTIANELIGKTYDLVKESVWTYLSDAREFATLLNACGKSGKAWAGILVAMGAR
                     SEALEEAQRILEEYRLSVARAMDYVSQPGVLEELSHIVVLKGGDVIDYRQVSSVASIL
                     SSSGLLPPDKPLIALANAGKTVKISARASKQLVDRGLNLGAILSRLGAQFGGKGGGHN
                     IAAGAEIPYDHMIKFLAELDKTVGENVASSKGEVTHND"
     CDS             428528..428776
                     /codon_start=1
                     /locus_tag="CSUB_C0446"
                     /product="hypothetical protein"
                     /protein_id="BAJ50307.1"
                     /transl_table=11
                     /translation="MKSRITIRPKNSQDAIAIYNALKPDDKPLPRGLFVETRQENDAV
                     VVDIVCERGLASFLATVDDILRSAALSEKAAEAIRTKI"
     CDS             428803..429423
                     /codon_start=1
                     /locus_tag="CSUB_C0447"
                     /product="small subunit ribosomal protein S3Ae"
                     /protein_id="BAJ50308.1"
                     /transl_table=11
                     /translation="MELSKKVSEQKKPKKVYEVYAPPYFGGRWLGSTVADDPSKVLGR
                     VLRTSLYAITDDFTKQYMLMRFKITEVKDSVCNTVFYGHEYGREYLRSLVKRGTNKIE
                     YIFDVTTRDGFVIRVYPVVFTTSRISSSKKRAIRKTMREVLEEAAANLTHDQLAQELV
                     LGKTASDIYNRVKKIVLPRHVGVYKSKIIKLGRIEAAKPVEQEASA"
     CDS             429424..429753
                     /codon_start=1
                     /locus_tag="CSUB_C0448"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50309.1"
                     /transl_table=11
                     /translation="MEIDVEEFRRRFPALYKEMVERRMALRISGVRNMKEFAEDEAAH
                     KGPTVIDYLRRCDTEEQGREVINYLRNRGEISEETAESLLKQLDEKGIRSFGSRKQPG
                     HYLREGL"
     CDS             complement(429750..430958)
                     /codon_start=1
                     /locus_tag="CSUB_C0449"
                     /product="translation-associated GTPase"
                     /protein_id="BAJ50310.1"
                     /transl_table=11
                     /translation="MEIAGIVGKPNVGKSTLFSALSMVNVEIANYPFTTKKTNVGVTY
                     VRVECVCKKLGIKDNPRNSICIEGVRLVPIQIIDCPGIIREAHKGKGLGLKFLDEIRQ
                     ASLLIIVADVSGATLADGTPAAPFTHDPVEDVEMVLDEFDAWLAEIISRDWPRISRAA
                     EAKQVSLTQELTRKLSGLGVDENMVLEAIEAAGLDRSKPVSWREGDLLRLATMIRRRS
                     KPFIVAANKADVKGSEKNVEKLVQHGYDVVPVSAEAERTLRLAASKGLVKYVSGDSDF
                     EVVDDSKLTPQQKKALEYIRENVFERWGGTGVQKLVNMAYLEKLGYIPVYPVENPHTL
                     TDHEGRVLPDVYLMPRNSTPRQLAYKIHTELGEGYLYAVDAKTGLRLADDHLLQPGEI
                     VSIVSAKKRG"
     CDS             complement(430961..431392)
                     /codon_start=1
                     /locus_tag="CSUB_C0450"
                     /product="large subunit ribosomal protein L15e"
                     /protein_id="BAJ50311.1"
                     /transl_table=11
                     /translation="MTSMYKMMQKLWRERPEALRSQLRKRMVAWRRMRAVERVEKPLR
                     IDRARELGYKAKQGYVVALVRVRRGGFSKPRPRSGRRQKALGVVRHKVNVSMKEEAVQ
                     RFIKHFPNLKPLGAYPLAQDSLYRWYEVVAVDPSHPAVQAN"
     CDS             431467..431868
                     /codon_start=1
                     /locus_tag="CSUB_C0451"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50312.1"
                     /transl_table=11
                     /translation="MLKLVKLTCRTHVYSTENIEKVKKAVKNILGENILPSSKTSLTG
                     HFGDNITVLEYVGENPDQVGEIFKRVVARVGMSVVGVEERGGGGGKLHIRLDKQKAYL
                     GEVAAEDIDPIKLEFTYVGDWREALKWQSIT"
     CDS             431850..432461
                     /codon_start=1
                     /locus_tag="CSUB_C0452"
                     /product="hypothetical protein"
                     /protein_id="BAJ50313.1"
                     /transl_table=11
                     /translation="MAKHYVDFYLRRLDAEMASTLSLHGFGTVCVEEPVRSDVLKSLE
                     GVRVYGKAVADASSRGEVLEFARKNYGKRVISIRPFSREALMTAGRDERVASVIVHGE
                     VADFDRHVAEVLLNPLEVTVADLVECFQNVNSWGRVTRFLQRASAVGKKIIVSSGASD
                     AEEILPPHQLGYVAAALTGGKNLDTKPVSETPLKILRDKVFGR"
     CDS             432451..432759
                     /codon_start=1
                     /locus_tag="CSUB_C0453"
                     /product="hypothetical protein"
                     /protein_id="BAJ50314.1"
                     /transl_table=11
                     /translation="MGVRVYRMRQRYVSVICGCKVSGVVLENAVKECFIRLYGVEGLV
                     QSGLRRVSVGGQPVFLCGHLWVPRLVLALTLVRHIGDTPVVLKTVKVSGTVRSLWKTR
                     "
     CDS             432744..433415
                     /codon_start=1
                     /locus_tag="CSUB_C0454"
                     /note="CAAX amino terminal protease family"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50315.1"
                     /transl_table=11
                     /translation="MEDEISREIRDILLALALALAALYAAGGGSAAAYTGFGNIWAPQ
                     LALLAVALILSRTRMLDPVLRELRGVLTGFILAPFATFSAIIASLLWSTMFPQTPAAR
                     QLTLALTPSTPVEYLLYIGLTIFVVAPAEEIIFRGIVHEKLSKIMKRGFADVVSSTVF
                     ALAHLDLSRLGPTFVLGLFLAHSVDRARSLTPAVIIHAINNTVYITLLFLSSSTFAAE
                     NLILS"
     CDS             complement(433365..434228)
                     /codon_start=1
                     /locus_tag="CSUB_C0455"
                     /product="sec-independent protein translocase protein
                     TatC"
                     /protein_id="BAJ50316.1"
                     /transl_table=11
                     /translation="MSKDKEMPLIEHLRELKDRVKVVMISFVVALIFWLAFPADLTEI
                     IRNPEFYEPMVTLVLKRIVQDLAGARIEIIGCSMTSPFEIFFLAAAFLALATIMPVIG
                     YETYAYVDPALYPHERRLIYGFTLAFVALFAVGGVFGYFVAAPLIMRAMVFFFELAGV
                     IPTVCAMDFYSLVFTTVLLIGVVFTSPVVLVLLVRFGIISTDLISRNRLYVYGILYIL
                     VAIITPDGWLVGNAVLFLPLVALIESSLFIAKRVERNRLKSMIVGYCKFCGNGLRENE
                     IFCSKCGRAQE"
     CDS             complement(434266..434559)
                     /codon_start=1
                     /locus_tag="CSUB_C0456"
                     /product="sec-independent protein translocase protein
                     TatA"
                     /protein_id="BAJ50317.1"
                     /transl_table=11
                     /translation="MAIQGIEWIVVAVVVLVLFLWGPDKLPKIAKSIGQAKREFEKAQ
                     KGLEEEISKAATTAASPPDDKLLEVARALNISTEGKTRDQIAKEIVEKSQKTA"
     CDS             complement(434604..435374)
                     /codon_start=1
                     /locus_tag="CSUB_C0457"
                     /note="short-chain dehydrogenase/reductase SDR"
                     /product="3-oxoacyl-[acyl-carrier protein] reductase"
                     /protein_id="BAJ50318.1"
                     /transl_table=11
                     /translation="MGILDNKICIVTGASGDIGRAVADWFLEQGAFVSAGARRLQVLR
                     ELEKTWAARYGSVKVHVDMLNVADEKSVESFVAKTLERFGRIDAVVNVAGYVLEPRLW
                     NKGLAETTTQEIIDVMSVDLLGSFNMVKHTIERMVKQRGGVYVNFSSTPAITGYDRGL
                     AYTLAKSAILGLTKHIAYEYGRFGVRAYTLVLGSIETEPSTKHLTKADYAALAAESPL
                     GRWGRPEEVAAVAGFLCSDMASFINGQSIVVDGGAVLR"
     CDS             435429..435914
                     /codon_start=1
                     /locus_tag="CSUB_C0458"
                     /product="small subunit ribosomal protein S13"
                     /protein_id="BAJ50319.1"
                     /transl_table=11
                     /translation="MSKDLRLIVRVLNTDVDGTLRLPYALARVKGIGVNLGYAIARAA
                     GIDPATRLGNLTEKQIEKIEQIARNPTRFGIPAWLLNRRFDPVTGEDRHLTGADLELA
                     IKEDIQTMMRTKSWKGIRHSLGLKVRGQRTRTTGRKGMTVGVSRKAIAQQSGQQKEEK
                     K"
     CDS             complement(435961..437031)
                     /codon_start=1
                     /EC_number="2.1.1.14"
                     /locus_tag="CSUB_C0459"
                     /product="5-methyltetrahydropteroyltriglutamate--
                     homocysteine methyltransferase"
                     /protein_id="BAJ50320.1"
                     /transl_table=11
                     /translation="MSKLFPVMEVGSLNKAPFRVKDVARAVEQAAKWGKALGVENYEE
                     LVDLLRSSQVSEDLLVDWACVYGLRFFESAGLDVVYDGEQRRVEMYEHPLRFIDGFEY
                     RGVVRVWDNEFYRKAAVVKRPRLIQPYHIDELQFNKKHAKKPLKVPVTSAYTLVDWSF
                     DEYYAKHAAGEDLVAKTGAARRDFVLDLVKEVLRPVVMALDSEGVDYIQLDEPAAATK
                     PHESELVVESINETFRSVGAKKAVHICYTDYKALFPALLELKIDVLSISCSNADTTRL
                     GTDPDARTGFEVLRVFKEYDVKFKVAPGLVDVHTDFIEPPELVREGSSTLLRSWETLV
                     KLWPATTAACVPVVGTWLTRSS"
     CDS             complement(437028..437975)
                     /codon_start=1
                     /EC_number="2.1.1.-"
                     /locus_tag="CSUB_C0460"
                     /product="methylcobalamin:homocysteine methyltransferase"
                     /protein_id="BAJ50321.1"
                     /transl_table=11
                     /translation="MKAYLVGALPRTEKLIKAYRDRAKNKIPETALLNELETTSLAYI
                     EAQRRNGFTYIIDGMLGWNDLLRPFASSLENVAVNGLSRWFDNNFFYKAPVITGRLSL
                     RNKIDTSPFFHQSIETAKRKIVVPEPLTFAKLSINKFYNRLDELVYDVAQALALYLKQ
                     LGEFAQVQLTAPFLVSGKISPEDLELSRSAVEVLRRTVDAELMLHLQFGSAEKNLEDF
                     LDFPVDVIGLDMFKTRVECLRGLNTDKSIFLGLVDGRNTLLEDAAPTVSLLEKVSSMA
                     SFRELHVGPNCELEHLPHEYALKKIDVLGEVVKLAGDLL"
     CDS             complement(437977..438987)
                     /codon_start=1
                     /EC_number="1.8.1.9"
                     /locus_tag="CSUB_C0461"
                     /product="thioredoxin reductase (NADPH)"
                     /protein_id="BAJ50322.1"
                     /transl_table=11
                     /translation="MKMTMEPFDVYDITIIGAGPTGLFAAFYAAGMRSMKTKVIEALD
                     TYGGQLTTLYPDKFIYDVAGFPKILSKDLAKNLYEQASAYNPTFHFSERVLNLTRLDG
                     GIIELTTDKGVHFSKTVLIAAGHGAFTPRKLGNPSVERFENKGVYYTVRDKWMFRNKR
                     VVIVGGGDSAVDWALNLKDIASEVYLVHRRSEFRAHEGSVIELFHSPVKVLIPYEVKE
                     AHGGEHLEKITVYNNKTGEETTIECDALLLQLGHIVDVSLFKKWGLDMEGNAIKINAR
                     CETNIPGVYAAGDIATQPDSVKLALLVIGFAQAAIAVNVAKNYIDPKAGYFPGHSSER
                     RM"
     CDS             complement(439006..439998)
                     /codon_start=1
                     /locus_tag="CSUB_C0462"
                     /product="phosphate uptake regulator"
                     /protein_id="BAJ50323.1"
                     /transl_table=11
                     /translation="MEVRRAVQLTGGSSFTVTLPKEWVERMGLSKGSQVIIRPAEDGG
                     LYIYPDKPSSRRPSSVEIALTEDLSQLLVGAYLYGYDTIKIVSKTPITDTWLEVIRRV
                     VRGLAGAEIVDEADESVEVQIVLDEQTVAPEKLLRRQYNLVMGMVEYAVNSVLMDDSS
                     LARVAVTRDEEVDRLYFTLVRVLRSALVDPALAKRLNTSPLSLLDIRVAAKFIEDAGD
                     QAAEMAKEKLRNKKPMSDDVKQEFRNIAKIVLSTGFDPIEAFFSHEITLVNRVTGLRT
                     EFMKRSEEFLRKVSGRGETASLYKLHFHLARVCEDLADVAELSLPIKPYVARQT"
     CDS             440088..440546
                     /codon_start=1
                     /locus_tag="CSUB_C0463"
                     /product="large subunit ribosomal protein L22"
                     /protein_id="BAJ50324.1"
                     /transl_table=11
                     /translation="MPTWRYSTTVGEKEDEVRASLREIDVSPKWAREVCEALKGLTIP
                     EAKRLLEDVINKRRMIPYKRYRKKRAHHAETKGPGGYPVKVSQYLLKLVESLEANAEF
                     KGLDPEKTEIVHAASHKGRVLRKNIERAFGRSSPYNRTYVHIELAAVSRG"
     CDS             440543..441154
                     /codon_start=1
                     /locus_tag="CSUB_C0464"
                     /product="small subunit ribosomal protein S3"
                     /protein_id="BAJ50325.1"
                     /transl_table=11
                     /translation="MTLVKQILETRIKKADIEEYLREKLKNAFFGGVSISFTPLGTRV
                     TIYAMRPSRVIGPKGKVIKEITEALEKQFGVENPVVTVVEVEVPELNPYVMAERIAQD
                     LARGLRYRRVGFWAVKRIMEAGAKGVEVHISGKLTSARSRTEKFTEGFMPKSGELAMN
                     YVLEGKSSVLLKTGLFGVRVLIYPPDAPLPEEIKVKQIEAPRA"
     CDS             441135..441335
                     /codon_start=1
                     /locus_tag="CSUB_C0465"
                     /product="large subunit ribosomal protein L29"
                     /protein_id="BAJ50326.1"
                     /transl_table=11
                     /translation="MKLQELREMNEKELAEKIEELKAELRQVVSEIGKGGMVENPMRK
                     RELRKEIARAYTVLAEKRRQKV"
     CDS             441332..441571
                     /codon_start=1
                     /locus_tag="CSUB_C0466"
                     /product="ribonuclease P subunit P29"
                     /protein_id="BAJ50327.1"
                     /transl_table=11
                     /translation="MTKPLNIYLLGKRVKVMYNNKTSEGVVVSETRNMVMVKTMKGAK
                     SFPKMNSVFIVDGKVVEGVRMVARPFERLLRGGGR"
     CDS             441568..441897
                     /codon_start=1
                     /locus_tag="CSUB_C0467"
                     /product="small subunit ribosomal protein S17"
                     /protein_id="BAJ50328.1"
                     /transl_table=11
                     /translation="MSETRNIGIPVNPPKTSCNDPDCPFHGKLSVRGILLSGVVYKKK
                     MNKTVVVENEHIVYVKKYKRYMRRRSRISAHLPPCIDADVGDRVRLGECRPLSKTVSF
                     VVLEKMG"
     CDS             441902..442336
                     /codon_start=1
                     /locus_tag="CSUB_C0468"
                     /product="large subunit ribosomal protein L14"
                     /protein_id="BAJ50329.1"
                     /transl_table=11
                     /translation="MAKRTRAVAAVGVLERRPNIPRTIVPGSLITCADNSGAQILKII
                     QVHGVSTRLRRVPAAAVGDKVSVTVKKGSADLRKKPMHAIVIRQRKPYRRSDGTWISF
                     EETAAVLVTPEGDLKGTEIKGPVAKEAAERWPRVANAASMIV"
     CDS             442347..442706
                     /codon_start=1
                     /locus_tag="CSUB_C0469"
                     /product="large subunit ribosomal protein L24"
                     /protein_id="BAJ50330.1"
                     /transl_table=11
                     /translation="MSSASPRKQRLRRYNAPKHILGKFLSAHLSPELRNKYGRRAVRL
                     RQGDTVKVIKGTFKNIEGKVKRVDVKRQMAYVENVSIKKADGSTVDVPIRIPNLMITQ
                     LNLDDKYRKEKLEDEKA"
     CDS             442703..443419
                     /codon_start=1
                     /locus_tag="CSUB_C0470"
                     /product="small subunit ribosomal protein S4e"
                     /protein_id="BAJ50331.1"
                     /transl_table=11
                     /translation="MTHLKTLAAPRHYPKKATVFTVAPSPGPHAKKKSIPLLIAVRDL
                     LNYADNAHTARRLIKQGKFMVDGRVVKDPRFPLGLMDVLSIPELGENYRVLIKPGKGL
                     TLAKTSSEEAGFKICQVVRKNHVRGGALMIGLHDGRTILFRGEMLDKGRAIKTLDTLK
                     IAVPSQEILETISLDNGVYAYIHSGARAGLHGKIMRIRREVVFPDKPTATVETGQGTV
                     TTLLRNLMPVGGEAPWITLL"
     CDS             443401..443925
                     /codon_start=1
                     /locus_tag="CSUB_C0471"
                     /product="large subunit ribosomal protein L5"
                     /protein_id="BAJ50332.1"
                     /transl_table=11
                     /translation="MDNASVELLRRPRIEKVVVNCAVGEGGARLERAQKILESLVNQK
                     PEVRKARKTIRGFGIHKGEPIALRVTLRKAAAEEFLRKGLAAVNNRIKKSSIDSMGSF
                     SFGIKEHLDIPGTRYNPELGIIGMDVTVHLVKPGYRVSKRAYRRSKIGMGQRVSVDEA
                     IEFLRQMGVEVVEE"
     CDS             443922..444083
                     /codon_start=1
                     /locus_tag="CSUB_C0472"
                     /product="small subunit ribosomal protein S14"
                     /protein_id="BAJ50333.1"
                     /transl_table=11
                     /translation="MKHKPPKQRKFGKGVHVCRRCGTSVGVIRKYGLYICRRCINEIA
                     PKLGFVVYD"
     CDS             444095..444478
                     /codon_start=1
                     /locus_tag="CSUB_C0473"
                     /product="small subunit ribosomal protein S8"
                     /protein_id="BAJ50334.1"
                     /transl_table=11
                     /translation="MTDLVSALFTTLQNNEMVRNRECIVKASNLVAEILKVLQRTGYI
                     GAFEYIDNGRGGLFRVQLLGRINRSAPIRPRMSVKANQFEMFEQRYLPARNVGILVVT
                     TPKGVMSHEDAKKMKTGGRLLGYVY"
     CDS             444468..445010
                     /codon_start=1
                     /locus_tag="CSUB_C0474"
                     /product="large subunit ribosomal protein L6"
                     /protein_id="BAJ50335.1"
                     /transl_table=11
                     /translation="MSTKFIEEEFQIPDKVNVRIDGKTLVFEGTKGRVLKDISHIPAE
                     VKIEDGKIVFRVPGRSRKAKALLGTLVSIARNAATGVTKGYVYKMKVVSSHFPITVKV
                     VGGEVHITNFIGEKYVRRAKIVGDVKVQVKGDEIIITGVDRESVGQTAANIENATRIP
                     RKDPRKFLDGIYVMEKAVGE"
     CDS             445003..445389
                     /codon_start=1
                     /locus_tag="CSUB_C0475"
                     /product="large subunit ribosomal protein L32e"
                     /protein_id="BAJ50336.1"
                     /transl_table=11
                     /translation="MSSMLPAKVLRKRRKTPKFVRQESWRYVRLETGYRRPRGKDSRM
                     RLQKSGSPPLAKIGYGSPKTYRGLHPSGLRDVLVASVAELERLSPERDAVRISGRLGL
                     RKKQEVFEAAKSRGFKVLNPPAKQGG"
     CDS             445392..445832
                     /codon_start=1
                     /locus_tag="CSUB_C0476"
                     /product="large subunit ribosomal protein L19e"
                     /protein_id="BAJ50337.1"
                     /transl_table=11
                     /translation="MTLEMQKRLAADLLKCGVTRVRFDPERLEDIESAITRDEIRGLI
                     KDGAIYKVPEKGVSRARVERGRKRGEGSRKGAKHSLVPRKRMWMTRVRAQRRFLKQLR
                     EKGLIDSRGYRLIYSFVKAGNFKSVASLREFIKSKGLLKEVSTP"
     CDS             445829..446407
                     /codon_start=1
                     /locus_tag="CSUB_C0477"
                     /product="large subunit ribosomal protein L18"
                     /protein_id="BAJ50338.1"
                     /transl_table=11
                     /translation="MTEVLQRVKPRRRRQGYTDYRKRLKLVKSGLERLVIRRGSRRIV
                     VQIVKSKAGGDETLVTVGSEVLRKYGWRASLKSVPAAYLTGLLAGKKALEKGVEKAIV
                     DIGVYRSVKGSRLYAVVKGALDAGLEIPVSEEVLPDDDRIHGKHISDYVAAIGDSPVG
                     FQFIASDKEYLRKLGEEVERIKREILGGGEDE"
     CDS             446400..447014
                     /codon_start=1
                     /locus_tag="CSUB_C0478"
                     /product="small subunit ribosomal protein S5"
                     /protein_id="BAJ50339.1"
                     /transl_table=11
                     /translation="MSEWVPRTRLGRLVQEGKINSLDQIFQMHGRVLEPEIVDRLLPN
                     LEQEVIDVKLVQRQTDAGEKTRFKALVVVGNRDGYIGIGTGKSTQVVLAIEKAIRNAK
                     LNIVPVVRGCGSWECACGEPHSLLVKSEGKYGSVRVQLLPAPRGLGLVAGESQKVVLA
                     LAGVKDCWTRSFGETRTSLSVVGAVYEALKRTAEAVLPSLWRTV"
     CDS             447017..447427
                     /codon_start=1
                     /locus_tag="CSUB_C0479"
                     /product="large subunit ribosomal protein L30"
                     /protein_id="BAJ50340.1"
                     /transl_table=11
                     /translation="MALVAVIRIKGHVGIKPEIKKTLESLKLDKAFKAALFNESDTLN
                     GMLKKAQRYLTWGRPNKHTILTLLKKAGVGGEDVETFAEKLEKGEEKLSQPVYVSLHP
                     PSQGFKNTVKRSYKYKGEYGDRGEAINELIRRMV"
     CDS             447482..447904
                     /codon_start=1
                     /locus_tag="CSUB_C0480"
                     /product="large subunit ribosomal protein L15"
                     /protein_id="BAJ50341.1"
                     /transl_table=11
                     /translation="MKIMPTRLRKVRKHRGSRTHGWGQIGQHRKTGAKGGRGMAGGHK
                     HKWTKLLNTDYFGKNGFAPLVRREEKTANLLTVSMLAEKSGNNLINLVEAGYTKLLGD
                     GKITTPLTIVVEKWSKKAEEKVKQAGGNLVKPAELVQR"
     CDS             447901..449334
                     /codon_start=1
                     /locus_tag="CSUB_C0481"
                     /product="preprotein translocase subunit SecY"
                     /protein_id="BAJ50342.1"
                     /transl_table=11
                     /translation="MSEKSATRTLIEKVSKILPEIKKPGRKVGLGEKLVWTALALIIY
                     TWMGHTILYGLPQGTQVGQSPALLNVVFAQKTGTLITLGIGPIVTAGLILQLLVGAEL
                     IKLDLSKPEDRGLFTSTSKLLGIVIALFQSAAYVYAGFFGPTNATQNIAIFIQLVAAT
                     ILIMLLDELVQKGWGLGSGISLFIVAGVAEEIFVALFSPIILPDQAYQGIILASIQAI
                     FTGNLPSILVRQSGYPDLVGLFSTIFLVLALIYIEAIRVEIPISYAKFQGYRAKYPVK
                     LLYVSNVPIIFATTVFSNIFYLGSLVWSRFNPNNDNIFLNLIGTYRFDEQLGTVVSTG
                     GLAYYVIGPRGIASVLQDPVRAVVHAALLIVFAVLFAKFWVQVSGLAPEKVAEQLIQA
                     GMQVPGFRRSPEVIAAVIGKYIGTVTILGGLIIGLVASVADYVAVFGSGIGLLLTIGI
                     LQQYYQLLIRERISEMYPGLGKLLGRE"
     CDS             449336..449878
                     /codon_start=1
                     /locus_tag="CSUB_C0482"
                     /product="hypothetical protein"
                     /protein_id="BAJ50343.1"
                     /transl_table=11
                     /translation="MFLDMLLLSSLAAAISASTTAIRKIVFKKEDLAKMAEIQSYNRE
                     LMNATRKKDQKTIQKLQKKQDYIRQINAEVTKKNMITMFASLLIFFTIYPTLGGFFGT
                     QMLGYVPAGLDIPFVTDSGKLYFYGWFILSFFGVSSPITKIFGLGLAGMPVSGGGEDE
                     KKAEDKKQEEKAGKNTERRK"
     CDS             complement(450034..450636)
                     /codon_start=1
                     /EC_number="2.7.4.14"
                     /locus_tag="CSUB_C0483"
                     /product="cytidylate kinase"
                     /protein_id="BAJ50344.1"
                     /transl_table=11
                     /translation="MSGKPVICLAGFAAVGKSTVGKIVAKRLGLKYVSGGDALKELAA
                     EMGYRPGGPGWWETAKGIEFLSLRARDPSFDRKVDRKLLEICRRGGVVVDSWVMPWLY
                     KGRAFKVWLTADYRSRAERMAKRSKISVKQASRLLRSRDRKSAAIYERLYDIRIGRDF
                     SPLHLIVDTSGLSPKQVAEVVVQTARNFFKAPTRRRRRQE"
     CDS             450700..451023
                     /codon_start=1
                     /locus_tag="CSUB_C0484"
                     /product="large subunit ribosomal protein L14e"
                     /protein_id="BAJ50345.1"
                     /transl_table=11
                     /translation="MVDESFVGRVVVKTRGRDAGLKGVVVSVYGDGYVLVTGPKPLTG
                     LRRRRVNASHIIPTPHKLSITKEASDEDVMKAIKEAGLEKYMAEPHAIKQSALEAELR
                     SPRQT"
     CDS             451270..451992
                     /codon_start=1
                     /locus_tag="CSUB_C0485"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50346.1"
                     /transl_table=11
                     /translation="MFMHGGKEYVGLMELHGDVSDDKLLEAFKIFTGDVYQVPPVRAS
                     VARRPRIRRVYYFDLLERDGRYILFRIGCSGGTYVRKICHDMGLYLGVGAHMEELRRT
                     RAGSLEEKNSVTLLQVYEAFEKYRETGDEEAVRKVVYPVEKCLELLPKVYILDTAVDA
                     VCHGADLMVAGVSMIDSDVAENSEVAVMTLKNELVALGKAAMDAQSILEASEGMAVDV
                     TRVIMHKSTYPPVWKGGLQRVQ"
     tRNA            452026..452112
                     /locus_tag="CSUB_T15"
                     /product="tRNA-Ser"
     CDS             452200..452586
                     /codon_start=1
                     /locus_tag="CSUB_C0486"
                     /product="signal-transduction protein"
                     /protein_id="BAJ50347.1"
                     /transl_table=11
                     /translation="MLLKQLVRRGPITIDSSATLYDVVRIMAEQNIGFIVVLENGRMV
                     GVLSERDVVRTLAERRDFGVKVGEICKRDIITLPADASVEDAAEEMGRHRIRHIVVVD
                     NAGKLVGVVSARDVLQELYAQESGTD"
     CDS             452651..453607
                     /codon_start=1
                     /locus_tag="CSUB_C0487"
                     /product="peptide/nickel ABC transporter ATPase subunit"
                     /protein_id="BAJ50348.1"
                     /transl_table=11
                     /translation="MVVLENVTASYNMRRGLLGSRSVKVVDGVSLSIPENEAVALVGE
                     SGSGKTTVGKLSIRLLKPLTGRIFYDGLDVTRLPENRLGKLRRETRMIFQDPYASLNP
                     YMSVGEFVEEPLLIHGVEDKAERVEIVYKALEEVRLTPPQDFAQKYPHMLSGGQRQRV
                     AIARAIVLKPRYLVADEPVSMIDASSRAEVLEVLKTLQKDYRMAILYIAHDLATTRYF
                     ADRVAVMYLGRIVEMGEVEEILSEPLHPYTQGLIASIPEPDPGNRFVERETIQGEPPS
                     PQNIPSGCRFHPRCPKAFERCRVEDPPLREVRRGRWVACHLY"
     CDS             complement(453599..454279)
                     /codon_start=1
                     /locus_tag="CSUB_C0488"
                     /product="hypothetical protein"
                     /protein_id="BAJ50349.1"
                     /transl_table=11
                     /translation="MVPRVALAAWLLALMFTSSAYGQGLVPGTGFSSALELTPGSYSF
                     ALAPGEIHFFKIMLEPGDILVAKVRMAANQDFDLYLLNPLREIVGQSVRATGLTDAVE
                     YTAVEKGPHYIVVLGFGDSAGVYSLTISVIRPKTVTQTVTAVVTERVTETVTTHVFNT
                     NTVVSERIVTVVDTERVEVEKAPWTAAGLAILAAALLYTGHAASEALKSRHKQPPEEQ
                     KPPSTTSV"
     CDS             454509..454751
                     /codon_start=1
                     /locus_tag="CSUB_C0489"
                     /product="hypothetical protein"
                     /protein_id="BAJ50350.1"
                     /transl_table=11
                     /translation="MAKEFQAVQPTGLEPSFKMREFEGFALPSVTDAAKPMGPLINIP
                     YRSPTAKFSRNIMLTYDIGNRPYQNEPHVAVKPQQP"
     CDS             454845..456566
                     /codon_start=1
                     /locus_tag="CSUB_C0490"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50351.1"
                     /transl_table=11
                     /translation="MPSPGPEDTFCSDPVVDFGRDGTVYYTLLSIGARPLRIGRLLYE
                     TEVASVTVSVSKDGGLSWSAPHVASRGRVVPQADRASVSFLDKPWMDVGPDKNDPAKD
                     AIYVTYTEFRIIYPFLDFYPFVGEPTIEVSIKLVKSTDGGLTWTSPVAVSPVYSGLAG
                     DEEARLVQGSHVHVAEDGTVYVAYYDSRDDGPFKGLFTPMVTVSRDGGRTWSKPSPVI
                     PGGTWEQPFFLTPTYFRSWSSMFPVLKTNPANSNEVYIVFGATGTNSGDLSDVYFSKS
                     VDGGATWSKPKRVNDDLTLRNQFFPTMAVSPNGTIHIIWGDMRDDPDNYRYHIYYTRS
                     TDGGATFMENSRVTDYPSNPAYGIPQFVGDYWGIVATNTDVFMVWTDSRAGFRGAPNQ
                     DIGFARQRPVKSPSIFISPPQGPAGQVITIIGDGFAPRQREVFIEFDGVVVSSFATDS
                     VGRFTATIYIPVSGEGAHLIRAIDVLGNVAEATYYTSFGFNNINDQLRAARDEVVKSV
                     EEKLSALTPSIDVDRLADALTERLKPQLSQTGSSAMLDIVLGLAIVALAAALISLVIS
                     ARKVRKQ"
     CDS             456563..459079
                     /codon_start=1
                     /locus_tag="CSUB_C0491"
                     /product="peptide/nickel ABC transporter
                     substrate-binding protein"
                     /protein_id="BAJ50352.1"
                     /transl_table=11
                     /translation="MRKALTLLLLLMLSTATAWGQEYNPPHDKPGPATDVIRVRAYAE
                     EIAPQVLEKGDIDLYLYNMRVSRVQALENNPGIKMVKAPSLLLSIILNPAPDPNGLNP
                     FSIKEVRKAFQYLVNRDYVVKELYRGYASPMTTPLSPYDYDYAQFFESILETGIRYDP
                     EYASRLITAALTSAGAEKRDGKWFYRDKPVSVKFVIRTEDERRELGDLVASELEKTGF
                     TVERIYLPFAQAIARVYTTDPSEFTWHLYTEGWGRGALEKYDSTSINQFCAPWLGNMP
                     GWQEFGYWQYSNPLLDDLGQRIFKGQYSGKEERNQLYLRALSECMSESVRVWVAVVLQ
                     STPMKAEVRGVSEDLAAGARGLWTFREAYIPGKDVLNVGHLWVWTPRTVWNPVGGFGD
                     VYSADLLRAVSDPSLTRHPFTGLPMPFRASYKVETAGPSGKLNVPPDAFVWDPVSKTW
                     KNVATNTVAISKVTFDYSLYTSSKWHHGIPITMADILYRIYQTFDLAFDETKSRIEFA
                     IAYTSRPVLETFKGFRIVGDSLLEVYVDYWNFEPDYIAEYADVFGGGMPWELLAVSDD
                     LVFNRRLVTYSDTAAARFRVDQLNLVLREQVSLVKTALNDFITRNIFPANVFTVGDKR
                     YETLENAQTRYKALLNWVNTYNLAVVSNGPYILAAFDPASQFAELRAYRDPSYPFKPG
                     KWFFGAVEKPRITRIQGSVVVGADSSVTVSVAGPDDTAIAYRVVDPVSGKTIVSGRER
                     ATGGVVEIRLPSTVTSTLAPGLLELGIVVYSDKVAQSFNVVEKLEVRRTAATQITTIT
                     PIITTTQQPTEQPIIPTWLVIAVVGVAAVVATAFMLTRRR"
     CDS             complement(459076..459951)
                     /codon_start=1
                     /locus_tag="CSUB_C0492"
                     /product="hypothetical protein"
                     /protein_id="BAJ50353.1"
                     /transl_table=11
                     /translation="MGESRHLLSAFSHQLFRNVPRDEAGKCFSWVFKNCYKQGLRVVI
                     GMKAILVAAVVVSLFLGAAAAAVAYSFVLGETEARYQKLLDDLKSQNLDLSNRLTEAE
                     NTVNKLRSDITSLQTSLQTADQRAQQLSEKVRLLENRLNQLSSELEAANTEVKSLRTN
                     MESVKDVLSLLENDRVLISWLRSEPPGTREGDREYWNETRALAVKSDPNLVLTIDKIL
                     DNLDLYYDWVEQFPQLTDVTRDELIRWCPLYIDWLLNAPPGVDEYNNAVNQLREEVLL
                     TVIAHIDSLSRVLES"
     CDS             complement(460000..461046)
                     /codon_start=1
                     /locus_tag="CSUB_C0493"
                     /product="peptide/nickel ABC transporter permease"
                     /protein_id="BAJ50354.1"
                     /transl_table=11
                     /translation="MNLLRSLVTQAVTLVFVLLSVLLMVAVVLGATGVSDKILLAYVN
                     EELRAVRQSLSQRIKDPVELEKALEQVRLELEKSYGLDRPWYERIPSLILRVLTLDLG
                     YSRTITSFDGSRKVADIIMERLPYSLLLVTTAVVISAVAGINFGLRAATRRGSLFDKL
                     VSYTAAASYGLPSWWTGLILLLVFYFYLRLLPPGGIMSTPPPTEPVAKVLDMLWHTVL
                     PLMTLVVVIVGGWAYVTRTIVLNITQEDFVTVAKAKGLPENLLRRRYILRPAAPPIAT
                     NIVFAIAGSLGGAILTETVFNWPGMGRLYYDAITAFDEGLVVALTFVYTLIYIAARFI
                     IEVLVAVLDPRVRV"
     CDS             complement(461043..462008)
                     /codon_start=1
                     /locus_tag="CSUB_C0494"
                     /product="peptide/nickel ABC transporter ATP-binding
                     protein"
                     /protein_id="BAJ50355.1"
                     /transl_table=11
                     /translation="MLAVMDLVVYYGLGGKVVKAVDGVDFSVGEAEALGLVGESGCGK
                     TSTGLAVMRMLPPNVVKLGGKILFEGIDILSMNPRDFAEEYQWRKISMVFQGAMNSFN
                     PVLKVGLQVAEPLMVKEGASKTEALNRVKQVFRQVGLPPEYVDRYPHELSGGMKQRAL
                     VAMALIMQPRLIILDEPTSALDVSIQTQIMNMLKRLKREHGLSMIFITHDLALVSDIA
                     DDIAVMYAGKVVELGPSEKILRTPLHPYSSKLLSSTPRLKGPRKLDYIPGAPPSLTDP
                     PTGCRFHPRCHRVFEKCVKEEPPSFVQDGVGVRCWLYQSDEAEKT"
     CDS             complement(462011..463411)
                     /codon_start=1
                     /locus_tag="CSUB_C0495"
                     /product="peptide/nickel ABC transporter permease"
                     /protein_id="BAJ50356.1"
                     /transl_table=11
                     /translation="MSLSESSWRVFWSSNMSKAGVVLLILYLVISVYVVVSYPLDFGT
                     RFWNNPSYWADNPKEAPPEWIAFFTAPSPPRHMVFRLENPSEYTIQRFSYGYSDYPSF
                     ISITVSGVTYASRPPTLLFELVRPDGKVVPFYVLSVSRPLPGEQPPYRRHYEAPLRVF
                     VSGDPEAASFVSRFLRNEYGLEIGPEDILRIGVERYLFGEFVEGRLVPLTGDYVLAVT
                     VNRADEGDAVDDVRVVFGGRVYGVLGTDRLGRDLATGLLFGFPISLLVGLVTATLTTA
                     IGSLLGMLSGYIGGKTDTIIQRTCDILNNIPLLPLLIFFTFILRPSIWIIIAILVAFG
                     WSGLAIVVRNIVMQAKTAQFVESAESIGVPRGRILRRYIFPQIAPFLIAQLIFSTPSA
                     ILAEAALSFLGLGDPSLPSWGQILEYAFRSGGVNLGLWWWVLPPGALIALLSFTFVML
                     SMGLEPVVSPRLRRMV"
     CDS             complement(463435..463755)
                     /codon_start=1
                     /locus_tag="CSUB_C0496"
                     /product="hypothetical protein"
                     /protein_id="BAJ50357.1"
                     /transl_table=11
                     /translation="MNTLPPRHPLEQALKTYQHIRVVKTLAEHGKPATKYALAKFTGL
                     SLQRLDKILRELITQRWVNRHSTTPPKYSLNKDNQMLGKFLTFLSEANYLTMGEWVED
                     RGVG"
     CDS             complement(463752..464891)
                     /codon_start=1
                     /locus_tag="CSUB_C0497"
                     /product="archaeal cell division control protein 6"
                     /protein_id="BAJ50358.1"
                     /transl_table=11
                     /translation="MPMPVFMDRTRLSPAHLPKRLLHREKEFSLLRKFLEAGVERGDD
                     VFYSRVQVVGPVGAGKTTLCLMAGQEMQRKHRNLTHAYVNLRRFTSSKVSIYRYLVKS
                     VAEEAYSVSLSAEELLENLLHFLKNTGQRLIITFDDADYHVSMSRGRETVVYDFTRLH
                     EFSSVRPLNVLGVVFVSRESGYGGYLDRAETSSLGASVLRLEPYTREQLIDILADRVS
                     EAFVRGAVPDNVVEYVADVVSKPPYSGDVRLALDLLLYAGNLAENDGRDVVKVDDVRY
                     ALSETISVSRAAEYADLPEKPKAVLLSIAKVLQRRDEQTAELKEIREMFSLFCESHGL
                     SESGFDKALSYLAERGYVEKHGDKVGLVGVDARRLSLLLEQSLKR"
     CDS             complement(464921..465187)
                     /codon_start=1
                     /locus_tag="CSUB_C0498"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50359.1"
                     /transl_table=11
                     /translation="MHFVTLIRFKKKLTKEDVDRTDRIIRENPSVKVREMLWTFGHYD
                     GILVAEAPDAETYLKFILQFTDYLSTETLAAFPREQALKLAGLR"
     CDS             complement(465513..465806)
                     /codon_start=1
                     /locus_tag="CSUB_C0499"
                     /product="hypothetical protein"
                     /protein_id="BAJ50360.1"
                     /transl_table=11
                     /translation="MPDEAVERARNSRKTVRISYWKKFGDDPPGWLVGVGRIEGNRFI
                     LEEEFVAKELLLKTDAYGFVGFQRPEQGEAVDRGWIIAFAGEVKYDGQRCVIS"
     CDS             465900..467078
                     /codon_start=1
                     /locus_tag="CSUB_C0500"
                     /product="FAD dependent oxidoreductase"
                     /protein_id="BAJ50361.1"
                     /transl_table=11
                     /translation="MRFDVVVVGGGSTGSSIAYYLASRGAGKVALVEKQRVGWGQTGR
                     STAVVRLHYSTEPLIKMALESWKILRNMEKVVGGPSGFTEVGFLIFAGHEDLNGLKRN
                     VELQKKLGVETRLLGPEEVREILPQTSTDSLAAAAYEPFSGYADPVTTAQTYASAAVR
                     EGVALLEDCEVHSVRRDGRRILGLETSKGLLEADVIVNATGVWCNRFFEMTGVQMPVK
                     IYKEEIVVWKRPSSFEGNHPVVGDLPNNYYMRPAGETQTYMGSINPDLSNPRRYATDF
                     DLEERVGIETATRYGEAVSKRFPVMAEAGFVGGWVGLYDVTPDWLPVIGFSQDVENLF
                     NAVGMSGHGFKLCPAIGILASDIIMGKKTSIIDPQFLHEKRFTEQRYATSSYRYGVIS
                     "
     CDS             467835..468848
                     /codon_start=1
                     /locus_tag="CSUB_C0501"
                     /product="hypothetical protein"
                     /protein_id="BAJ50362.1"
                     /transl_table=11
                     /translation="MGMKYERKALELYRRLERLLLPRFEGACIDFHWERPATVFLPHI
                     PTVVQVGNGKLPAFLVSHGVNRVLVDALWPTNVEVLMKLIEDGVEVWVLTRPSALHGW
                     RRKSSGKPRGLVEWLMRHHPDVVKGFKTEIKNDVYDAVLLRYVKPKYHRKMTRVFLMC
                     WPKMVLFRTARKNNQRLLQQLSALPLPEEENTTRLQISENFLTTEANLFVRVLKKEYS
                     EIDKLFTELGIDDVISKAFASEVFLELDETKSLSENRRKFGLIPKKHQDKLIYDGAAK
                     YSLVQLAVKRFGAIPKYLTEEDRKRFSMELGKTLDAIYRWKKTYRRETQERLAGIPAQ
                     QQG"
     CDS             469516..470076
                     /codon_start=1
                     /locus_tag="CSUB_C0502"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50363.1"
                     /transl_table=11
                     /translation="MMNFNFGIGFWTSMDASSFLMGLAYIFPAYVANASPVVAAKILR
                     KTRPIDCGRVFVDGRRVLGDGKTVEGFVVGVLAGFLTGFVMSFLWSWLFGLFEVFLLS
                     LGALLGDVGGAFVKRRLGLKTGSPAPVLDQLSFLTAALLLIHLFHGLPPWMDTATLAS
                     LFLFTIFMHIATNSFAYLVGLKNKWY"
     CDS             complement(470073..470528)
                     /codon_start=1
                     /locus_tag="CSUB_C0503"
                     /product="hypothetical protein"
                     /protein_id="BAJ50364.1"
                     /transl_table=11
                     /translation="MRSQKIGPHIYFLELKTSGDGLEAALREIRLLGETGGGRVFRGD
                     EKTFLRSFLKFCMDVDIFVTWGGESFAFPLLTAKIIRNRLDPAPLYEAYHLDLKTFFG
                     KTFSLDVSDVSEASALLGLRKRRGTLENVRAVFMALRSILRVTRPELAL"
     CDS             complement(470525..471832)
                     /codon_start=1
                     /EC_number="3.3.1.1"
                     /locus_tag="CSUB_C0504"
                     /product="adenosylhomocysteinase"
                     /protein_id="BAJ50365.1"
                     /transl_table=11
                     /translation="MTEPFHVKDLSLAEKGASRIMLAESMMPVLSLLRRKYADEKPFE
                     GYRVSMCLHVTKETAVLCRVLREGGAKVALCASNPLSTQDDVAAALAVEGFNVYAFRG
                     MSTQEYYGALGKVLSHGPHLLVDDGADLITSLHRLIHGLPDVHLEDVRRGMDGADVPR
                     VWGATEETTTGVTRLRALDGEGLLAFPVIAVNDALSKSLFDNPLGTGQSALDGVLRAT
                     NLLLAGKTVVVAGYGRVGAGIAERAKGMGARVVVVEPDPIKALQAYMNGFTVTSMSKA
                     SEIGDVFITATGNIDVIRGEHFEKMKDGVFLANAGHMDVEINKQDLKQLAVSVETIRE
                     NVTLYRLRNGRKLFLLADGRLVNLVCAEGHPSEVMDLSFSLQAESLRYLIKNVEKLGK
                     HVYTVPREIDEAVAALKLAAFGVELEKLTPRQLDYMRSWMAGT"
     CDS             471898..472332
                     /codon_start=1
                     /locus_tag="CSUB_C0505"
                     /product="translation initiation factor eIF-2 beta
                     subunit"
                     /protein_id="BAJ50366.1"
                     /transl_table=11
                     /translation="MSLDLKSKEFYEMLLDNVLARVTRGSSATAGDRVLEISPNLVID
                     AKNTFFTNLGQVAKMLNREPAHLARFLLKETGRAGAVSDDKLVIQGRMMHDEVKRLLD
                     LYIKEFVRCPVCNGIDTRIVSEKRFRFLVCDACGAKSPVRRI"
     CDS             472419..472706
                     /codon_start=1
                     /locus_tag="CSUB_C0506"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50367.1"
                     /transl_table=11
                     /translation="MKTHRSKTGEVVVAICDEMLLGRKLRLSTGVSVEVQESFYKGVL
                     VCETDLEDYFRMGTIINLLGENAVKAAVKLGYASEKSIIYVDGVPHIQLFL"
     CDS             472716..473057
                     /codon_start=1
                     /locus_tag="CSUB_C0507"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50368.1"
                     /transl_table=11
                     /translation="MRLSELQKRVEEFEKARGWDSFRESLIYAHLIEEITEIGRFILE
                     KEGYKRSGLGHSSPGEDLDSEFAQSLTLFVQLANRFGVDLEKALAKEMAKMEKRFNAE
                     EWRKALGRDGS"
     CDS             complement(473011..474309)
                     /codon_start=1
                     /EC_number="1.1.1.34"
                     /locus_tag="CSUB_C0508"
                     /product="3-hydroxy-3-methylglutaryl-CoA reductase"
                     /protein_id="BAJ50369.1"
                     /transl_table=11
                     /translation="MTKSSRIPGFYTLKPEERLRVVAEFAQLTDEEKKLISSCGLDIA
                     TASRMIENVVGVFPLPLGIAANFLINGRDYLVPMAVEEPSVVAAASNAAKMARDGGGI
                     FSFQPSQLMIGQVQLVEVSNPFHAKMEILRNRDEILARANECDPVLVNLGGGAKDVEA
                     RVLETELGPMVVVHLIVDVRDAMGANAVNTMAESVAPFLARLSGGKFRLRIISNLADK
                     RIARAYARVPAESVGGVEVARGIVEAYQFAKADPYRAATHNKGIMNGIDAVAIATGND
                     WRAIEAGAHAYAARNGRYEPLTIWEQTPSGDLYGVIELPLAVGIVGGAVRTNPVAKTC
                     LKILGIKSARELAEVMAAVGLVQNLAALRALAAEGIQAGHMSLHAKNIAVMAGATGEE
                     IDLVAEEMVRQKTIRVDKAEEILAELRSRRGQGPSATPRR"
     CDS             complement(474334..474954)
                     /codon_start=1
                     /locus_tag="CSUB_C0509"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50370.1"
                     /transl_table=11
                     /translation="MEALRKILSVKEGKGPSPTFTEPQLVYLIFLIGSEPYIGRKRLK
                     ELLQLGEGSVRTMVSRLMKRGLAVSTRGGVALTEKGEEVYERLKKLVSPLRKISFKMP
                     WEAPANYGLVVKGLAERISTGLEERDEAVRHGASAAMVLTFLSDGVHMPRVSNLSVER
                     PEFAEQVKSFFKPEVGDVIIITGAEDEPRAMYSALAAALKILLGKR"
     CDS             complement(474989..475897)
                     /codon_start=1
                     /locus_tag="CSUB_C0510"
                     /product="signal recognition particle receptor"
                     /protein_id="BAJ50371.1"
                     /transl_table=11
                     /translation="MLKTVAKIFSSFIETVKTAKPSPKEVENVLSDFYLQLVEADVAV
                     ETADAIVNSLRHTLLEMDVPRFGDREAVLKEALKKAIEPLIKVADVNLVLKRVDEARK
                     QGRPAVILFVGPNGSGKTTTVVKLAHYLRKRGYSVILASADTFRAGAIEQLETLGQRA
                     GFMVVSQSYGADPAAVAVDALNKASSMRVNVVLIDTAGRTELDRGLLEEMRKLKRVVK
                     PDFVIYTGDALAGNAAVQQAKMFDEVVGIDYVILSKVDADAKGGSAISISHSTGKPLL
                     FLGVGQELDDLVDKPAEKLLEALGFA"
     CDS             complement(475904..476344)
                     /codon_start=1
                     /locus_tag="CSUB_C0511"
                     /product="prefoldin subunit alpha"
                     /protein_id="BAJ50372.1"
                     /transl_table=11
                     /translation="MNLFSAMSEAEVAQALEELQLLERLVADLQARILTLQRSVAEHE
                     EAVKLIEEIRKSGGSMKILVPIGSGTFAEASLQSVEKVTVSLGAGVYAVKALEDTQQL
                     LTKRNQALQAYVDALAKRLSEYAGRAEELRRFLNRALTSQQRQG"
     CDS             complement(476378..477046)
                     /codon_start=1
                     /locus_tag="CSUB_C0512"
                     /product="translation initiation factor eIF-6"
                     /protein_id="BAJ50373.1"
                     /transl_table=11
                     /translation="MEIRLETVLGSAEVGLFALPTDRYVILSKEINPSKVRVFQQVLK
                     VDTILTSLADSILVAPFAAGNSNGLLLSKLVVDEELKKIKAALPDLNIHRLDTKYTAV
                     GNLILCNDRGAVVSSLLGKNVAKVVADVLGTETVSSTVANRSYVGSLVAATNVGALVF
                     VDAEDDELKLVEDVLHVNVDTGTVNGGVLFPRSGIAANSSGAIVGALTTGPELMTISR
                     VFQR"
     CDS             complement(477058..477339)
                     /codon_start=1
                     /locus_tag="CSUB_C0513"
                     /product="large subunit ribosomal protein L31e"
                     /protein_id="BAJ50374.1"
                     /transl_table=11
                     /translation="MSQHSPRVHVIPLGDAWKASRLRRTDAAVRLVKEYAMRHGKASV
                     VKISPKVNEILWANSRQSPPRRIRVVLEKEDEDTVVVRLENEASAEEKE"
     CDS             complement(477430..478683)
                     /codon_start=1
                     /locus_tag="CSUB_C0514"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50375.1"
                     /transl_table=11
                     /translation="MKEEIERANQKTLELMMETKPVLTDLVEARKSIQFLRKDYHLTH
                     AGPPISWERASGPLRGAIIGAALYEGWADNEQRAIRLAETGEIVLEPNHHHSAVGPMA
                     GVISPSMKVFVVSDGEVKAFSNLNEGLGKVLRYGAYSEDVLKKLKYLNGPFADVLADA
                     IRDAVKEKGGIDLRNIIAQAVHMGDECHNRNIAATSLFFREITSHVVKVADTKTAQEV
                     LTTINANNLFFLNLAMASCKLMTDKAHNIKYSTIVTTISRNGTDLGIRVSGLGDEWFT
                     APAPVPKGLYFPGFTENDSNPDIGDSTITETAGLGAAAMAASPAIVKFVGGDVKLALE
                     ITNRMARICYGRHRYFTIPYLEFEGTPVGVDIRRVLRLGLPPVADTGIAHKNAGVGQV
                     GAGIVEIPIEPFKQALRKYAERYGV"
     CDS             complement(478696..479562)
                     /codon_start=1
                     /locus_tag="CSUB_C0515"
                     /product="cyclase family protein"
                     /protein_id="BAJ50376.1"
                     /transl_table=11
                     /translation="MSPSSCDGEYLYHPTHISLSVSSSSVLDLSKVKIYDLSQPTSTK
                     APPFMWYPPFKATWIKRLSEHNVNAMYIEGPLHHGTHFDGQLHFMTGGKDIASIDINY
                     FIGEGVVVDISRKVGDYDIYTPETIEGAAKEAGLEIRPDDILIIYTGYSRYAWCGQEP
                     DEVRYICKHPGPDVRFAKWCIEKKIRWLGVDAASQDHPLNTIIRRARPDLVAEAEKKW
                     GKKIDELMPWPENYQVMHTMLFPKMILHAENLGGDIDKVANKRCLIMAPPFKFEGGES
                     AYCRVIAITPAK"
     CDS             479561..481111
                     /codon_start=1
                     /locus_tag="CSUB_C0516"
                     /note="bacterial FdrA protein"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50377.1"
                     /transl_table=11
                     /translation="MAVYKVANLVVSGVYRDSVQLMEVSESIKRLKGVVDAAVVMGTV
                     SNKESLKPLGLLTSEGEKAGPNDIIIAVKAAGNIEEILETSKKLLFETHVTAPKYISI
                     EEALNANPDVKFASISIPGGYVEEVAVKLIEGNVNLFIFSDHVPIETEVSLKRKASSR
                     DLLVMGPEAGTAFVAGVGFGFANNVMRGNVGVVASAGSGIQEFVTLLDAYGIGVSHAI
                     GVGARDLTEKVGGIMAQKALRLLNGDSDTKFIAFIAKHSDINVVKRILEEEKISKPLA
                     LCLLGVSQPITDQPQSHTLHGLVMHIASQLSRGKRDEMINSLLREADMLKKMVSHEPG
                     FPRGFYSGGTLATETAYVWNKAGLEIYSNIGLSWTRRLDNPYTSIGATIVDYGSEEFT
                     EGRPHPIIDPTLRNRRIVTELESDSTNSIAMDLIIGYGAPDNIVSKVFDEIGEAVLKN
                     RKKRLAVRVVGTDKDYQWPQVSGIEKFGVLTSSSNAMAAVFTAACGKNDPSLVDFLIS
                     ELILEVEK"
     CDS             481108..481263
                     /codon_start=1
                     /locus_tag="CSUB_C0517"
                     /product="hypothetical protein"
                     /protein_id="BAJ50378.1"
                     /transl_table=11
                     /translation="MKIESINKVLCIGISILSDSLRRQGVEVVDVEWHPPVEIEEDLK
                     KILDKLL"
     CDS             complement(481246..482052)
                     /codon_start=1
                     /locus_tag="CSUB_C0518"
                     /product="hypothetical protein"
                     /protein_id="BAJ50379.1"
                     /transl_table=11
                     /translation="MKFTSTVMQTFVVAKAGSEVGTIFKDGEKYWIESVGERSAYIKT
                     TSGDVVILSRKLFTPYSIVFGEAWESVRKRLAVKHSVLYNEPFLEIGDGLKICVKVGE
                     DSPKITFNGKPDVERLRQVYNVYMIIASVSELDGYVECLRSVRVFDTQDVLNCLVDVV
                     GRGPGLTPAGDDFVSGVLLGLRLLGLKADASELFQKARKSSRWPSWKMMEHAHHGCTF
                     SPIYNLCREILMGGDCVEHVFEAVRIGGSTGLATLAGLLETLRIFSEQLV"
     CDS             482116..482856
                     /codon_start=1
                     /locus_tag="CSUB_C0519"
                     /product="hypothetical protein"
                     /protein_id="BAJ50380.1"
                     /transl_table=11
                     /translation="MVKPVVPISFEEFKFGVDEIEEFLRGAPPDERFQKPYPPKTYKL
                     KTGEPVIIRPADKSEAPAILSTLKRLIDPAYDKDYYHLVAVRTYSEVLAWVQNRIKDT
                     YVIVATNREGELMGLVNHRFADENICISLHTIVFKRAERLGIMLYASKIEHAFDVVGA
                     KEWWATFESPFGYRMGFRLQHAMKPWPEIQHELGGGRVFYLTRDRWEKVVKPDLIQRG
                     LMGERPVPEDLLAKSKPLKPTEKLEIEL"
     CDS             483002..485224
                     /codon_start=1
                     /locus_tag="CSUB_C0520"
                     /product="molybdenum hydroxylase family protein, large
                     subunit"
                     /protein_id="BAJ50381.1"
                     /transl_table=11
                     /translation="MHAAVLRSPYAHARITKIDKTRALALKGVVAVYTADDLGQLNGP
                     LPPSVSPLPQYPIPYMRTHYALAKEKVRYVGEPVAFIVAENKYVAKDAAEMVEVEYEP
                     LPAVVDVEKAIQQGSPLVHEDVPNNIAAHHIIRVGDSTLAGNADLVIREKFVFNRGAG
                     ASIETRGVVAHYDAKTGQLTVWDSTQAPIPIRNTLSKLFNIPLHLVRVIAPDIGGGFG
                     PKIMLFYPEEILTTFAAIKLGRPVKWIEERREYMVATNQQRIQVHYVEAAFGRDGRLL
                     SFRDRFLVDTGAYTPYGIMVPIITSGTMPGPYKIPAMEIEFMSVYTNKTVVSPVRGAG
                     RPDAVYVMERVMDIAAQKLGLDRVEVRRRNLIKSNEFPYDTGIIYQDGGPVKYDSGNY
                     ESLLNLLLEKIHYKSWPERKQRYRAQGRYVGLGLALYVEGAGVGPYEMAKVTVTPSGR
                     IVVATGVGSQGQGHFTVLAQIAADVLGASVDDVDVVVGDTAHMPWGVGTFASRSATIA
                     GNAVHLAAMDVRKKAAEVAAKLFEANPEDIEFQGGRVFVRGHPDKSYTLGELAVYAHP
                     IRGLIKREPGLEATRFFSPEQSVFASGGHAAEVEIDPETGKLHILRYVIVHDCGPMIN
                     PLIVEGQIHGGLSNGLGGAVYEEIVHDESGQPLATTFSDYLIPSATEMPEKIEIYHLE
                     TPSPLNPLGVKGVGEAGVIPVAAVIASAVQDAFDGKVIPTQSPLKPNTLKELLKVTGQ
                     "
     CDS             complement(485274..486677)
                     /codon_start=1
                     /locus_tag="CSUB_C0521"
                     /product="propionyl-CoA carboxylase beta chain"
                     /protein_id="BAJ50382.1"
                     /transl_table=11
                     /translation="MSSGSVFDRINSLLDAGSFRPILSGVEQHGADMPHRPGDGVVAG
                     FGKIGGRNVAVFAHDPAFAGGSLGEVGVRKIAKLYELAARFGYPIIGLADSSGARIQE
                     GARSLIAVGELIKTANKAHGKIPQINVIIAGGVGGAAFTAAVGDVVIGVAKTGYMFLH
                     GPRAVKHATGQDVSIMELGSVKTLAASSGLIDFVTEDEAQAISLVKKLLSYLPSNYLA
                     TPPTSIATESTIKQDLESTETRRLIAEIIDPGTFLEFKADYARNLITGLGRVDGLVVG
                     VVANEPNVFKGYIDGKACVKLSRFVDFCNSFNIPVLTIVDTPGFEPGVAAEHGGIIRE
                     GTWVYRSYLNATVPKVTLIAGKAYGGAYIAMCSKGIGADYVLALPDAEVAVQPLEVSA
                     EILFRKELEKLPDDQKAAAFAQYVEALRTKSRGDALLSIGVADVIVKREEVKKTVSSV
                     LHSLYDGYVKNSSLNRS"
     CDS             486809..489172
                     /codon_start=1
                     /locus_tag="CSUB_C0522"
                     /product="molybdenum hydroxylase family protein, large
                     subunit"
                     /protein_id="BAJ50383.1"
                     /transl_table=11
                     /translation="MISQFGGFKYVGKPLPRVDSYPKVTGVAEYAGDIELPGMLYAKL
                     LLSPYPHAKIVSINVEKAKRCPGVVGVAVGEDFPFRVGLYVNDRYILAYKKVRWAGEP
                     VAAVVAESLEQAEEAVELIDVNYEPLPAVLDVREALKPGAPLVHEELGEYAHSPAFRP
                     IPGTNIANKFTLRKGDVEKGFRESDVIIENEFSMPQVSHTQLETHVTIGQYLPDGNVK
                     IWTSAQSPFTVRHILSVSLGIPEHKISVYVPYVGGAFGGKAGINFEPLVVMLSKIVGG
                     KPVKLELTREEQFTTAPVRQGMYAKVKTGVKRSGEIMAEKLFYVYDAGAYADYGVNIG
                     RAAGYSCTGPYYVPNVEADSLTVYTNHPWGTAFRGFGHFEFLWAIERQMDIVANELGI
                     DPVEFRLKNALLPGLTTPTGEVLRQDAGRIDECIKAVASAIGWGKKSENITGKPRGKG
                     IAALWKAPAMPPNASSSAIIKFNEDGTAELLLGITEIGQGSETALAQIAAEELGIPLE
                     KIKVVPFRHTDVSPYSWQTVASRGLFMDGKAVQMAARDAKNQILEIAAQVLRVQKDDL
                     VLENERVFVKGRPEVGLELRQIVNGYTYPNGNVVGGPVIGRGFYSASRLTYLDPETGQ
                     GLPALKWTFGAHAVEVEVDPDTGMVKVLKLVSAFDIGKAINPLTVKSQIYGGAVQSMS
                     LGLYEGYVYDENGRLLNYNLTDYKIARARDIPVEHEAIIIENPQLDGPFGARGIGELS
                     MLSVEAAIANALYDAVGIVLKDLPINAERIWRAIEAKKQKRVVEVIS"
     CDS             489175..490044
                     /codon_start=1
                     /locus_tag="CSUB_C0523"
                     /product="molybdenum hydroxylase family protein, medium
                     subunit"
                     /protein_id="BAJ50384.1"
                     /transl_table=11
                     /translation="MVSKFVYHAPKSLQEALDLMSSYGRDAKPLAGGTDLLVDLREKK
                     SKPKAVIDLKNIKELNKLSYERGSGLVIGATVTYEQILSFEPIRRRYTVLWEAVKTIA
                     DEIIRMRATLVGNICTSSPAADTAPPLLVYDAVVKTLSKNGAREIPIEKFFIGVKKNV
                     LEAGEIVESVYLPEPLEDARGAYLKAMRTWSEDLALVGVAVLVADRGRDVRLAYASVA
                     PTPVRARKAEDVFRGDGPLREKIEQAVEIAAASVSPITDVRASKEYRLHLVKTFTRNA
                     LLKLLGTEVVNVA"
     CDS             490034..490501
                     /codon_start=1
                     /locus_tag="CSUB_C0524"
                     /product="molybdenum hydroxylase family protein, small
                     subunit"
                     /protein_id="BAJ50385.1"
                     /transl_table=11
                     /translation="MLRRIQVTVNGVERFAEVEDHKTLLWLLREKFKLKGTKHGCDRG
                     DCGLCTVLLNGKPVKSCLVLAAEVDGSTILTVEGLARNGELTPVQKSFIKHGALQCGI
                     CTPAFVIMGHWLVQNEKKLDRERVADALDGILCRCTGYRQIIDAIIDAASGTG"
     CDS             complement(490504..490833)
                     /codon_start=1
                     /locus_tag="CSUB_C0525"
                     /product="molybdopterin converting factor, small subunit"
                     /protein_id="BAJ50386.1"
                     /transl_table=11
                     /translation="MKCHIDLLEMALTVNFYSSYLRRAAGGETIRLEESPRTVRELLD
                     LLAAKLGKSFEELVYDPRQKTLKRAIVLLVNGHSIKMLKGLDTPLHPDDNVSIDTVEV
                     IEVVGGG"
     CDS             490896..492149
                     /codon_start=1
                     /EC_number="3.5.4.1"
                     /locus_tag="CSUB_C0526"
                     /product="cytosine deaminase"
                     /protein_id="BAJ50387.1"
                     /transl_table=11
                     /translation="MCEKFWTMFDIVVRNARLRGWDCLVDIGVEDGKIAEISSLGLRG
                     ERVIDAGGRLVTEPFVNPHLHLCKVYTFHMIGDQALQFYQEEKMTKASEAIFAASEIK
                     KRYKEDWVYANAKKALFEALKHGCLFLRAFVDTDTIARLEAVKAVLRLKQELADVLTI
                     QVVAFPQEGVVRDPGAEELVWKAVEMGCDVVGGIPWIENSPKEQRLHVDKMFEIAKAF
                     NRDVAMLTDDAGDPSLRTTEMLVRKALEEKWVGRVSAHHSRAMALYEEGYLEDLIQLL
                     RMTEANIVSNPHTGPLHAPVKKLIDRGVNVALGQDDVADAYYPFGRNKMLEVAFLASH
                     ILRMLSKSDIMKLFNMITFNAAKAMRIPRYTVEKGSDATFIILDAESIHHAFATQADP
                     LYILRRGEIILERHEEIRLDLRPHG"
     CDS             492183..493742
                     /codon_start=1
                     /locus_tag="CSUB_C0527"
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="BAJ50388.1"
                     /transl_table=11
                     /translation="MLGMASQINNNVILEVRGLVKKFPGGVVALDHVDLEMKAGEIHA
                     VLGENGAGKTTLMNILFGMLQPDEGEIYLFGEKVRFRSPLDAINKGIGMVHQHRKLIS
                     AHTVFENIILGHPRVGRLIKKSEARAEIEELCRKFGFKIDLDARVWQLSAGEKQLVEI
                     VKNLYRGARILILDEPTSVLTPPEIDAFLDSLRAVSKEKISLMPFVTHKLPEVFAVSH
                     RVTVLRKGKVVKTLYISEASLKSLAEYMVGKDVELSLERPAVPVGKEIIRVENLSALN
                     DKGLVAFKNINFSVYEGEIFGIAGVTGNGQQELVETIYGLRKPLTGRILFQGKDITKT
                     SVLERMKMGIVYIPPERLNFALIGELSLVDNVLMTTYFNQGMSKRGLINYKTAKEYCE
                     RVISEFNVVAPSSSTKAAYLSGGNQQKIVLGRVLLSSPKLIIANLPTQGLDIAAENFV
                     RRKLLESKTHGISTILVSEDLDEIMELSDRVAPIYEGVFVKVLQNIDLKKEEVGAMIA
                     GAYSERRGVLA"
     CDS             493735..494811
                     /codon_start=1
                     /locus_tag="CSUB_C0528"
                     /product="sugar ABC transporter permease"
                     /protein_id="BAJ50389.1"
                     /transl_table=11
                     /translation="MLSHTKLKRERLVTISGIRGVQISIYSTIASFIVFSIVLSVEGA
                     DPLTAYQNMFSFALDPQLGLPLTIHRSMLILFSTLAFIVPLRAGFWNIGMEGQFYLGT
                     IGAFFVAYSLPDYPPEVLIPLMILSGMVFGALYGALAGILRGKFNVNEVVVTLMLNNI
                     AFWMVYLLTVGGPWAGTAESTSRPLPKNAQAPFILGTPFTTFLAIAFAFILYFFLSKT
                     VAGFKIRILGHSPTAAKFVGIDEFKTAVLVMSLGGALAGVAGYHMWAGDPAYLRIPRP
                     DAYKAVGDLTYWGIIIGLVCLLNPIPAMPASFFIGSIIVGSTVLVRRFRLPFGLDFLF
                     LGIISIIFATFQFFLYYRIKVKGK"
     CDS             494808..495701
                     /codon_start=1
                     /locus_tag="CSUB_C0529"
                     /product="sugar ABC transporter permease"
                     /protein_id="BAJ50390.1"
                     /transl_table=11
                     /translation="MIEGTTPLWPFITRFLEVSTILLLAAMGELLTQRSGVINVGIEG
                     LMLAGGASAFLTAQLYGPLAGFVVGTFVGTLLGLFHSFLSVSMRVNQIISGMGVWLFA
                     VGFVTYWADRYTGPLRYSIPRINGLSPALFIALGSLIVIWYVLSYTHFGLKIRSVGEN
                     PAAAEASGVNVEKIRYLCTTIGGSLGGFAGAVLLLSYLGAWSHLPTKGLGWLAFGLVM
                     FSLWRPGILLAGALSFGFVWQFGISPETIYPGFPAPLPVNRMMPFLLTIIILTIISTE
                     RFRRRWALLKPEALGQPYIKE"
     CDS             complement(495716..497125)
                     /codon_start=1
                     /locus_tag="CSUB_C0530"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50391.1"
                     /transl_table=11
                     /translation="MMTEKISRRKALSTAGKVAVGVVGAGIVAGVGGYFAGASTAGGV
                     KTVTETRTLGAATVTVPTTVTRATTVTQATTVTKEVPAGQKIVLGMVLGGFIEGSTWD
                     GRQVRAAERLKKFYPWFDYAYDEGVVLKGKDPISSARDLIATAKANIVFGSWEPAAIP
                     GFHTLANEFPNVYFLGIVGSDVSSERNFMRVFVRQYQAMYLEGLVAGAITQSNKIGIA
                     VGPLAVQNLRRMAAFYLGIKDANPDAKLYIKYVGEWFDPPKEREVSLSLLDQGIDVLT
                     HYTDSVEPLKVAEENKIWFVGKDTDIVGLYGWSTTDTVAVSFDTRWEVMFDQIIKEYL
                     AGTTNPDRIFLIGMNKHISTPENNPFMPGLTTIPAVDLQNNNKVGLDAISPKAKTRIP
                     ENILKLIEERRAAMLSGAWDPFYEHQLVSSGEGVEIPELNLKVPPKGTVVKPAKQMPS
                     DEWLLGRLNFMLDGIILLK"
     CDS             497405..498427
                     /codon_start=1
                     /locus_tag="CSUB_C0531"
                     /product="basic membrane lipoprotein"
                     /protein_id="BAJ50392.1"
                     /transl_table=11
                     /translation="MPTTITQTVTTGVEPRRQLTVRAVFQTPISEPWDGAIHAAILAV
                     ADEFKTKGINVDYQFVDRKIDPRDYELALRDAARVADIVFLDAFLKEDIARRVAKEFK
                     NVAFAAGSEFLPAQPNFSVFDNWLHQPAYLAGIIAGKITKSKRIGAVAAMDINEVNRI
                     VNAFIAGAKSVNPDVKAKVVNLLGNIPPGESPWYHPATAKRLAKALIDLNTDVIFAER
                     VGAEEAAVEAKAEGKDVWIIGNMADQYSRAPTVTITSLVWDMRPTVRIAFQRVLANAW
                     VADNLGTYSWMSFGGSYLADFHEFGKPSPPLTTEILNLVNEWRNKVMDGLTWIPINEM
                     PPVSEF"
     CDS             498452..499984
                     /codon_start=1
                     /locus_tag="CSUB_C0532"
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="BAJ50393.1"
                     /transl_table=11
                     /translation="MGKGMPPAVRLQNVSKTFVGGVRAVDSISFELSPFRVYGFVGPN
                     GAGKSTIMNLISGYLFPDSGEVWVNGIQVTDFHQALNVCGVVKVEQHPNLSPYLTPAE
                     HLSMLLPKFIPTKSLNHLAHELLRQLGVEVDLERRVEELPIGHLRVFEIVKALIQCEI
                     LHKKGLSPVLILDEATTFLPQHHKNTLKLILRKLTSKQHTVLVVSHDLHEIIDVADEI
                     LVMVGGRVATRHSSTDLDVSTLVKSMFDTEVRYESSRRAFQLNSVDALVISNLFIRDD
                     RGNLVVRNFNLSIKSGEVHGIAVIPGTGEKELVEGILGVRRIERGEILVYGHVVKNPT
                     VTTMRRRGVAVLSDDRIRDGLITDASVFDNLTLGLFDKYCKAKGFFIDSRLRTELAKS
                     LVRDFSIVVKDLRGPVTNLSGGNMQRVYIARVLGTEPKILLALHPTVGLDPMGASMFF
                     QKIDERRERGLTSVIFSPNVRELLATCDRVSVMRDGEIVGTYQANAVSVEQLGMSLSG
                     VV"
     CDS             499989..502136
                     /codon_start=1
                     /locus_tag="CSUB_C0533"
                     /product="sugar ABC transporter permease"
                     /protein_id="BAJ50394.1"
                     /transl_table=11
                     /translation="MKLTLIPREKPSPGVRIILPIIATGLALLTSSIYVALAGADIVD
                     VYYYLITWPLANPSEIFVTATPLTLLAFSILIAFRARFWNIGAHGQFIIGGLMSAWLG
                     VVLGSVPQYLLIPLMFTCSWLAGSAVALISWWLKTKKGQDEVLTTILIWSAILLINAG
                     LLTGPLRSPYTTYPQSQEISINAKLPVLIPDTRLHAGVIAPFIIMLLLWFLMSRTTFG
                     VKVTAVTNPRAAILEGIDVSRVYFWVCFLSGGIAGLAGAIELMGILFYMTPFVGPNYG
                     LVALAIAMLGNLDVIGATIASLFFSIIINGANAMAWSTGVPSFLADLIQAQTLVFFIV
                     LSRLVGFRLRIFKQKEYKIKHNKTPLKLDYSQQPKLRTFNVSRKLRLRIIFFILFLAV
                     LYSLEVFPQSNETQFVRSVLTSVLALTITITTPITLASVGETLSEKGGSLNLGILGIM
                     ISGAAWGFMGAYFFNDIFVGILLAIAVGALLGLLLAFLIVTLGAQQHIAGIAVTFFSM
                     NLAYFFHRILIGSPLVEPKVPLIPVLRIPLLESIPVVGVIFKQNIFVYFGIFIIPLII
                     YLVFTKTRWGLVITAVGENPKSADALGVRVHFTRYLAIMFGGILMALGGSFYSLVDIR
                     AFNLNVGGEWSWIALALVVLGNWKVQWVWVATLLFGLLNAVQTWLVTVVVQIPYQFFQ
                     AIPYVLTIGAGAFLGKRVRPPKALLTPYRREGN"
     CDS             502395..503435
                     /locus_tag="CSUB_C0534"
                     /note="Probable gene remnant of cytosine deaminase"
                     /pseudo
     tRNA            complement(503442..503515)
                     /locus_tag="CSUB_T16"
                     /product="tRNA-Thr"
     CDS             complement(503726..504592)
                     /codon_start=1
                     /locus_tag="CSUB_C0535"
                     /product="hypothetical protein"
                     /protein_id="BAJ50395.1"
                     /transl_table=11
                     /translation="MTRFYADIHRKKDDSGYRITYTTDGEAFKHVDSPTKIPAEAGDK
                     VYVDVIPIMHTDGFIELLKTGVEVYYLRRLTLIKKMREKLGITSKSARADVRVLMAIE
                     ERWFKAVDETYLIMREKASTFRSLQKTIEQYSNRLDSASEDEREDLLDMVKIAEKKLH
                     RQAKRIVEEAERRYSAYSILVDELRIYGDNHLLSQEALAEIMMYVNPRWGWRKTANFF
                     GLFKNTNKKKKKRYNGQARKALQRLTIAVYNIKPKELTAKMQKTLLRQIWLTIRREAQ
                     ERLAGIPAQQQG"
     CDS             complement(505177..506412)
                     /codon_start=1
                     /EC_number="1.4.1.3"
                     /locus_tag="CSUB_C0536"
                     /product="glutamate dehydrogenase (NAD(P)+)"
                     /protein_id="BAJ50396.1"
                     /transl_table=11
                     /translation="MSFSAYDVWSLADEWGPEKVVFAYDPDTGMRGVLVIDNTAIGPG
                     KGGIRFTPTVTPVEVFRLARVMTWKCALAGLPFGGAKGGIMGDPSKVDRVAWMRSFAK
                     AIKPYVPLQYVAATDMGTTELDMAVFAHEVGDVRACTGKPSEMGGIPHELGTTGYGVA
                     VATDLTLKMLNKFGSLSLDPHEAKVAIQGFGNVGSFTAKFLDELGYKIVAISDITGCI
                     YNPEGLDIPHIMRELQTAGSIERLSRYEIYHKEKIFDVKSDVFIPAATSDTINSETAP
                     KLIKAGTKLVIEAANIPTTSEAEKMLIEKGFWVVPDFVVNSGGVIGSFVEYKGGTEKE
                     AFDLINYKITTNVKLVITLAQQNGSTPRKIAQEIAKTRVKRAMLLRRGAIDVAREYFA
                     RQKPLYEFMVPDLRKTTHT"
     CDS             506500..506937
                     /codon_start=1
                     /locus_tag="CSUB_C0537"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50397.1"
                     /transl_table=11
                     /translation="MMDKFFSNRLFDVLRKRILLVSDFICYVIKTKRVYEPPSPEDGC
                     RVLVDRLWPRGLGKNRAAVDVWLKEVAPSGSLRKWFGHKPERWEEFKRRFFMELSRQP
                     DGVRKLLELEEKHGTVSLLYSAKDTVHNNATALKEYIEQMKKG"
     CDS             506972..507442
                     /codon_start=1
                     /locus_tag="CSUB_C0538"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50398.1"
                     /transl_table=11
                     /translation="MEFKVVGYVRVDFDDEYVKQNAGAVSGRVEILPEYEEALDGVEK
                     YTHLFIIAVFHKSKPEHRSLLKVKPRRLLRMGLREDELPILGVFSTDSPVRPNPIALT
                     LVKLVRRERNVLFVEGLDLFDGTPVIDIKPYRPDYRAENYGYPDWVKLDARASI"
     CDS             complement(507593..507994)
                     /codon_start=1
                     /locus_tag="CSUB_C0539"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50399.1"
                     /transl_table=11
                     /translation="MFALIAFLCLGLTDFFRKKGAAAGANSFSYLLVETVVLLALLPI
                     VAMVYSGKLTLSFSGAIPYALLSGVTITVALVAMLSGLSIGEGSLVIPISRLGLALAT
                     LLSLFFLNESITLTKVLGIGLAVAAVFLLSR"
     CDS             complement(508073..509305)
                     /codon_start=1
                     /locus_tag="CSUB_C0540"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50400.1"
                     /transl_table=11
                     /translation="MKNLHASSEKNEENVCNVCHGIARLCKLSTCPFYRDLFKEALAA
                     KLSGRQLSGPSPPTFLVGEKGYPRVALGSALVYADDINPALLESPSKWLDFSVNELLR
                     LRLSLLLGLTITHVKTPIQRRDPFTALQESAASIKPVDFEITTAGAVKTMPGFSIRTA
                     PYGPSARVEKVKLTGNVSIPRKVDSYLNDPYVKAEETLTSLYKTGHDEYYLTRLFSAG
                     LLGIASQRKLVPTEWSITAVDDILSKQLYNQVRQYSIINEYRVHSYSAVENSATVVLT
                     PTPWMYELLEGWLRYRDKPPYSDHEIIRPRKTYAENTGGAYYAVRFSLLRHLADRREQ
                     SGAIVFFEIKPGWVPLGVWRFREIVKKALEQRCERFQSLDEALAHVRPRLSIPLHNYL
                     KQSSLIPFLRRQQKIDTP"
     CDS             complement(509305..510906)
                     /codon_start=1
                     /locus_tag="CSUB_C0541"
                     /product="ATPase"
                     /protein_id="BAJ50401.1"
                     /transl_table=11
                     /translation="MGSNPTPRMALAVINLLTGFSDFLQVYWLGMSGLRVVVDESALR
                     LGVVGEFVERGGRVLVHRALLKHLQERAFSGDLAAMDGLRNLMASRGEYVEFVGEAGG
                     VGWREAVLEYCRSNRETLLTSDPLVARVAESMGVSYRYTVPEPPLQLESVFSGDVMSL
                     HVKEGLEPKIKRGHPGRWVFESIREKPMSRTEIEALVSTIMKTAFDVFGTEAFVEVDK
                     PELTILQLGQFRIVITRPPLSDGMEMTVVKPVLRVRLDDYRLPPKVLERLEKRAEGIL
                     IAGPPGMGKSTFAQALAEYYRNMRKVVKTVESPRDLNLPPDITQYSKSAAKDGEIHSV
                     LLLSRPDYTVFDEMREARDFEMYIDLRYAGIGMIGVIHASTPIDALHRIANKVDIGIL
                     PSIVDTLIFMDKGRVASIHTLEVVVKVPAGLKRADLARPTVVVKDFLNDEPVYELYVF
                     GERVFFVPVKVSEDRGGELAVMRRIIGKHLSDFSVDRVGDRVIVAIGPGEMRTYFKKC
                     QNKVLRMAKHMGLEVEVVPKQGPEG"
     tRNA            complement(join(510882..510942,510974..510997))
                     /locus_tag="CSUB_T17"
                     /product="tRNA-Leu"
     CDS             511314..511721
                     /codon_start=1
                     /locus_tag="CSUB_C0542"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50402.1"
                     /transl_table=11
                     /translation="MKRVLKRGVDVFELEGVKVVSVDEFFFVVGGEWVVPALVEGNKP
                     LLERLASVWVDMGAVPRVASGADVMRPGIVKMDVFRTGDVVLVRDVTHSKPLAVGQAL
                     MSSEEASTLSKGKVVKNLHHVDDIVWRMLKQVL"
     CDS             511759..512832
                     /codon_start=1
                     /locus_tag="CSUB_C0543"
                     /product="ATP-binding protein involved in chromosome
                     partitioning"
                     /protein_id="BAJ50403.1"
                     /transl_table=11
                     /translation="MLIDEQTVLNALRQVIDPDLKIDIVTLGMIKNLVIKDGDVSFTL
                     ELTTPACPYNKSIEDSARAAVESIPGVRSVDMRVTARVWSAKPMASTYPDVKNVVAVA
                     SGKGGVGKTTVAINLACSLALSGARVGLVDADIYGPTIPKIVKIVEPPRLRPDKKVEP
                     AKMMLGIKVMSLGLFVDEGTAVIWRGPLVASAVKQLLTEAQWGELDYLIVDLPPGTGD
                     ASLTLAQTMPLTGVVIVTTPQQAASVIAAKALSMFRRLGVTIIGIVENMSYYVCPECG
                     KESSLFGQSHTDKMAAELDVEVLGRIPMSPDVSVNHDQGVPIVLAAPSSPAAKAFDEA
                     AKKIAAKISILAHAAGAAKAGAK"
     CDS             complement(512996..514159)
                     /codon_start=1
                     /locus_tag="CSUB_C0544"
                     /note="inosine monophosphate dehydrogenase-like protein"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50404.1"
                     /transl_table=11
                     /translation="MDKKAGDIMAAEFVSVGDDEPFTKVIGLFTDRKLDVVVVKDSRS
                     GRLVGVVTKRAALWPNVNPTKVLARTLAVKTPKITPEDTLPHVASAMVEKNLKAMPVT
                     EAGKPVGLVAAADLILNSREIIKNLTVQKIMTKDVITINADDTIGKAISIMRDQGVSR
                     LPVVNNGYLVGIVTVTDVAEKIIKPRTRPSLGEVAGEKARTLSNPVKSIMTREVVTAR
                     GNETVVEAVERMKQYGFSSLVVTERNRVVGIVTLMDALSPIARVAGEQQNNIVVEVSY
                     KMSRIDVEDKERVMEVANRFVQRFRKALGTGVLTLYFKEHREKHGDMRLIHCRARLNS
                     DRYQFVGVGEAWRADLAARSALKTIERQFLVRKELASRYPFGPEFLTSLAEYY"
     CDS             514334..514981
                     /codon_start=1
                     /locus_tag="CSUB_C0545"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50405.1"
                     /transl_table=11
                     /translation="MMLSTKTITSGASMAALALILAFLPLSIPFPPIPYLRIDPAEIP
                     VFISLLGFGPWPALITNLVYYFVLLAVGEFTPVGPTMKFLAVASSLLGFWLGSRMVYA
                     KGFKPMLAAGTFLGTVLRVLAMTAANYVVLLILFPDFLSLATSLLGAFLGVDISSGQA
                     GFFLVLVFTAVYNVLHMGFSLIPTILLLKAIQKTRALGSKWTPWMIQASTGKRQP"
     CDS             complement(514959..515972)
                     /codon_start=1
                     /locus_tag="CSUB_C0546"
                     /product="Zn-dependent alcohol dehydrogenases"
                     /protein_id="BAJ50406.1"
                     /transl_table=11
                     /translation="MRAAVLRGVFDVAVEDVPVPECVSDSVLVRVKACGVCPVDVRVY
                     TGENVWVPLPSVGVSGHEVAGVVEKVGENVSALKPGDRVAGTLSKPCGTCRYCVKGYE
                     NLCTNSLKPKVFGFAEYVVAYPGHVQRFRETIDFEEAVFTEPLAACINCVERSGLHTG
                     DWALVVGVGQIGLMQVQLLKLMGAMVVAVDYSEERLRLAEMLGADVVVDAADKSVVEK
                     VRSLAGGEGVDFVSLTVGEGKAVETGFRCLAKRGVLNIFASLHGDGVVGVNLNKLHFG
                     EYTLTGTYASTRGHINRAVQLIEKGLVKVRPLITHRLPLEKLVEGFEIHRERKGVKVV
                     VFP"
     CDS             complement(516334..516711)
                     /codon_start=1
                     /EC_number="3.6.1.7"
                     /locus_tag="CSUB_C0547"
                     /product="acylphosphatase"
                     /protein_id="BAJ50407.1"
                     /transl_table=11
                     /translation="MKAYLMKVVGRVQRVGYRRHVLELGQELELAGYVRNEKDGTVTI
                     FAQGDEETLNRFMEALKTPPPPAKIKKNRDSRDTAQAKPQTLPNTLQQTGRRAPGRLR
                     SHAGNILHILGGIPRLQGRIQRF"
     tRNA            complement(join(516756..516802,516815..516853))
                     /locus_tag="CSUB_T18"
                     /product="tRNA-Ser"
     CDS             complement(516880..517716)
                     /codon_start=1
                     /locus_tag="CSUB_C0548"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50408.1"
                     /transl_table=11
                     /translation="MKKFAVFLPHSFTAEVPSFREATMKIGFVGRVLATFRVDELVLY
                     PDEPGAPRLRNALLIKELLDYLVTAPYLRSRVYPLKPSLRYAGLLPPLNIPTHPEADA
                     LKKEGTHYRQALVTASGQTSLLEAGMGKPLKIPRKLPKNTIVTLRVRVKEGRVKYSVV
                     GKKSGETYTGFRTRVVKSLEEALKPYTFRLATSRLGEPINQVYATVAQRLKESTQTCV
                     VFGAADKGLHEIARAHGLEYNRLFTHTVNTAPNQGVKTIRTEEALAYTLAILNLAKTS
                     TI"
     CDS             complement(517759..518181)
                     /codon_start=1
                     /locus_tag="CSUB_C0549"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50409.1"
                     /transl_table=11
                     /translation="MSRKGFHQLPHMADIYIEAYGSSLEEAFEQAGLALFKTLVLNAS
                     EKTVSLSVEARGQDLMELLYDWLEKLLHKFEIDNIVATEIKVNKIMRNGEYRLEATLW
                     GENYNREKHQTGTAVKSPTYALMEIDTEKNKVRFVLDI"
     CDS             518266..518634
                     /codon_start=1
                     /locus_tag="CSUB_C0550"
                     /note="HEPN domain"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50410.1"
                     /transl_table=11
                     /translation="MLRRRGVEFLEMAEKALADKKVDFMLEQAAQLYLKSALLKLVGE
                     YSRTHSLRRLVWELAEASRDDELRKFGEERRSVLSSLEDVYIMARYFPKEYSEMDAAE
                     FLEVVRELFRLVGRVAGFPA"
     CDS             518631..518966
                     /codon_start=1
                     /locus_tag="CSUB_C0551"
                     /note="nucleotidyltransferase domain"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50411.1"
                     /transl_table=11
                     /translation="MIETARRRAEMVRRWREFVGMLAEAVRKVLGDADVYVFGSVVTG
                     ECVASSDVDVLVVSDRVPESMLERGALKVEIEDAAGLPVYHPFELHFVKPDEAMHYFK
                     KIGRNILRV"
     CDS             complement(518963..520021)
                     /codon_start=1
                     /locus_tag="CSUB_C0552"
                     /product="hypothetical protein"
                     /protein_id="BAJ50412.1"
                     /transl_table=11
                     /translation="MRETTALLTIVVLLAAFTAVSAQTSDPCITTDKRINLAGDTLPP
                     IEATLAGRLREDFYRFENLRPGERLVLRVTVTTNTSTGFNTLLMWEIRPSQFSRIGGV
                     QTIQAGGPLEYVYSWAHSNFGENTSTTLCFKIGIFSEARPAKADYVITLGIERLVDTG
                     GREAADKLEKATPLGALRTGETTIISGYLTNSSEGLDYVDTYVLTAVLGKGKQLTATL
                     TTQPGNIYELVILDQTGYGLRSNRTNTSGEAAVSLETQDAAEKTYYIRVSNQGGVGGG
                     GPYTITLSINEATTSTTTTTTTTPITTEITTPSLSHETAQLIVYGTVTGIAVLAVAAT
                     VIMRRRSQTVVGEEDQWY"
     CDS             complement(520156..527916)
                     /codon_start=1
                     /locus_tag="CSUB_C0553"
                     /product="hypothetical protein"
                     /protein_id="BAJ50413.1"
                     /transl_table=11
                     /translation="MLALLLALPTAFLGAAIVTPAFAQPNYTAWLKIVTASWDGAPYV
                     AGAPPVQPTGVGFADRYNVTNVCVELYKFKNPSGASTAPLDSWEGPIRAGSPNGTGFI
                     RVSWPAGWENVTIIVKAKSYQGECIGEGNPFRGIIVYWLTVNPTPSFLSKFGFSAFNS
                     TINDDGIEDTHGGPFNWNIFPPLGSGPVDNVNYASGPITFQINHNDPQRAWLARAAYI
                     FKLFHEHTWYATNDVLTYATIFIYDTDHTDASSTQSLIQAAITGDDGQSRYTREIYPR
                     SAGVGSGKFAQNRLVPIPLQSINLGTREPFEGGIPDPEDNNGFIEAPHLNATKRVWWE
                     TVLVNQTFYVGNEYNQTGGPNAPEYATDPATGKIRPLFGAYPSNPSVNPTITQGGITG
                     VPAGPFSLVLNETVYIDPPRPLLPTWEGTDTTANVETVGPSIANFENNTVFYARFCVQ
                     DADLAIQHPWIGDKMVGAEVTLNFKTSADVPYYLAHSIHTTGSDGCTNDPHKWPGYLG
                     QYSKFARFPNGTNWGLRGSLNASYFFNPADDVSPAWRPGGYFEQAWGGSWQGPWINAG
                     MNWSALIPEITYMKTRQLSDDPRWGGFEIQVKWKGGARNGYGGSAVLVDSVRVRNPYA
                     IAATNTTTYNGWIVPNVVLGNNTVLIKIHNEVTVTLSRGPLGTPRPIRGPVTLMISSN
                     TPIGMRLQNYNPLTGTFDIFVNYPPGVDLRVDIVENATHGGFIRTPFTFSGVIASIKY
                     HDAATNQPIVGNISYALAGWQDIGPDGVIDSTSIRRFNVTTTGETGAAEVEIWPGPPG
                     SQTIRTLVSSNNTDIQTLDPAFTYNDFVGGMLFSGQPQSGTFAILNATKRQVVILQSL
                     APHKAPDIALARAGLVYITANVHDLAYRLVDNLGNPAPAANTAITLQRGNGPPITKTG
                     ASLIPDFFPSTGSLQWSYDQHGEGWAVFYQLPEDLAYMVTVTFDGTPVGEATVDKLTH
                     TIMEDLVLRIYKVKLVFVDCENSPLSREAFVKVVPPSPATPYVTQLDSTGALDFGYLA
                     GGQYTIDGVWWKGVWVKFTDARIGDDTLPLNPDGSLTFTVDSNIDSPIKLTALINDFI
                     FTTWDYNQDNRIPRLNITLTWVGVHPLTGSRLYFLETMDPTGDTNTDKFNTTLAFSQF
                     FRYRIDHFFGGISRSNGLKTYGDVRYVFYKMPSALYNITVTTVTTGDPETQQTPGNSK
                     WPGRTVPVDYEIKIDWTSHSSPPSIRKTPAGQVNDRVVLRVYMTWNGEFVTDPNLNPI
                     GNATLYKTCGPVRIDLLTWAHTFKQRIVDGDFDYLNEARRIGNATYHIVNDNGVNMEM
                     FIPEDGVFSSLFVSKWTEDTLLTTWLKADSQHSSNIWWNGTYRKQDLTFYSYVYPLEF
                     TRGEQPWARFYDKAGLTGSGWLTTQKGPLTSPGGDVRPGDSFLIREFFNPAVNETANG
                     KWPTHNFTVVGNEGLWNQQRWRWEQAVAAGAVEEISTPFKGKRYIEVPTRPTTLVFEK
                     EVVTVPIPVGFITLNLKDEDLARPIPYAVVQLDVYYDDSGTVDRSSSVLYKTGRDGNL
                     TLLYPTQEAMENILGTNVVNYTLTVYWYLNSSIVYKDAFNLTKRGYSVDKVAIADVTF
                     VLAISANKDRPVKDLYARIWWLNVTDGNTVFPGRITVDHARRTWTYTAVPETRGAAKW
                     TTGQLTLPWLPTSERFTKSDWDLVFDSSAGRWVYDDVTRSWDIPYPSYEDGRMIDGWP
                     YNPVPTGYDRRHPHLTNQENSRIQYRISVWSDQLPIDPSSPKYNNGAWQRDHYELVWR
                     IPAQFPDAWMLFGHPPFDITFYRGTTGTGQFQPIPGYALTRTWTATPTPGSKVVAIKL
                     NATDVDIPVFWQVGDYELGSYDCGPLLGYIVKGRIVPPLGATFAPKPIDAVTTAGTIT
                     VGDKTVNICISGKPVGLVTVTSGDTPSTVIWGGSTLVIDEVSPPPSIWYNDGTGQAGA
                     DNPNRGTTSNYWRNWVSQAIDPLTGQPVNLHVGDQLQVPGVDLGIQYMGYGRPYEGVA
                     RTATVTVVSNDPDNRAHRPFIKMFEFQNVSARITDFNGRPLPGAFYQIIDAQTGKSAA
                     WSYAGPDGRIVPMPIRKPGGVFIQRVLYLGQGANGEPTWPVNSFARWPIAYDSRDDET
                     TQETQKPDIPLGFAYTAEAGPWPTGDGWFRADVCRHAGDGSYNYTAGVLEALASCPPA
                     GWGRSFDVITRIFDLRIRFVYGDAQRPADPAYVFSAPSLALPDDFIIRGQGAIFEAKR
                     LARSSYDIVALWPDANGEEVGRRTFDVSRTNVGTVEGTVVLALRDLSFNVVDRQGRPV
                     AGARVSVSPNLVREQDIQLRPDSIFTILRVPDGRTYDFTVEWTSPYGTTARAAVRDTP
                     AGLQSRGSIVIPVDDVTLTVVDFDGRPVAGAAIRFGGQQVGSTDSQGVVIIGQVPLDN
                     EYQIEVSKDGTTIGGDRVRFTASRTSATIQAGIYDIAVIVKGAAGQPIQGAIVELVRG
                     GTTIATAATDASGSAVFSKVVGADYSVRASYEQFSNSANVARGVRSATIVLDLYTILF
                     GVPMTLATFLALIIGLILLVIVVVVIVSEYIRWRGRRLGIYPAAPPKK"
     CDS             complement(528713..529165)
                     /codon_start=1
                     /locus_tag="CSUB_C0554"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50414.1"
                     /transl_table=11
                     /translation="MAEGGEGKEIKLVIDASVAVKWFIPGEPWEEEARVLKNSIALDR
                     VKAYAPTLIIYELASVISKAVKNSVLTLEDGVSALKSIGALGINMVPVLWNEASEVLE
                     IAVTSGLTIYDSAYLWLSRKLGEKLVTADKDLRQKGKVVTDVSLLGEL"
     CDS             complement(529135..529377)
                     /codon_start=1
                     /locus_tag="CSUB_C0555"
                     /note="PIN domain"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50415.1"
                     /transl_table=11
                     /translation="MVSCLGKLVNVSVKVPEELRQLMRRVKVDWSEYIRGAIEAKVKE
                     ELAKEAAVKLDEIRSKAGVVPTEVIVRWLREEREKR"
     CDS             530151..530375
                     /codon_start=1
                     /locus_tag="CSUB_C0556"
                     /product="hypothetical protein"
                     /protein_id="BAJ50416.1"
                     /transl_table=11
                     /translation="MTKVISLSDEAYAALKRIKREGESFSDVVLRLVGQAKYRPLSEF
                     AGRWAGDDIDKVFEEILRERERAESREVSI"
     CDS             530376..530768
                     /codon_start=1
                     /locus_tag="CSUB_C0557"
                     /note="PIN domain"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50417.1"
                     /transl_table=11
                     /translation="MVCLDTDIIVALLRGDNKAIETIEELQRMGMQFKTTIITVYELL
                     KGAAISSKSSENIKTVKELLHNVTILGLDIDACGKAGLIYSDLRRSGKMISEFDILIA
                     AIVQHNRETLITRDKHFQEITTINIRQW"
     CDS             complement(531117..532208)
                     /codon_start=1
                     /locus_tag="CSUB_C0558"
                     /product="hypothetical protein"
                     /protein_id="BAJ50418.1"
                     /transl_table=11
                     /translation="MIAEVHGDVCRLGYLKLIACILEDGSPRSPDYLASVLLETCRSL
                     VNDVGEMPGMLRTEVNARNYVKLAAQLGFYDRASGRPGLYGAAYICLNSSEALRRHVS
                     GEGMANLSEVLTLTDVEKTLFLHALLNRDYIFSGMLKWLAGMREFSRLEAMYAVMEEV
                     YPEALRRMLRRMPERRRASVQRELEQASGFREERLKYASQAEWIKSRLYAKYRHFVPP
                     RLEWLVDVGFLERVKRARYSVSQRFLKNVRELSDVFEKPLERVDQTFFTAFVPLFHGL
                     RIGGQQAESRALLDAYRVLHRALGKVKLNVLCLAAAYRLLEEGYRSTPASVSRTFSYL
                     SLIHSDRVFTSISDDGSPEVTLLDIPTVE"
     CDS             complement(532205..533401)
                     /codon_start=1
                     /EC_number="2.1.1.72"
                     /locus_tag="CSUB_C0559"
                     /product="site-specific DNA-methyltransferase
                     (adenine-specific)"
                     /protein_id="BAJ50419.1"
                     /transl_table=11
                     /translation="MNDYSVEQVGPSFLMTEIAYISSGEVSDSWKGFGRSWGHSLHRI
                     MSRTGSFPPALARWVVTRFSERGDLVLDPFSGKGTAPLEACLTGRVGVGNDLAPEAYV
                     VTRAKVKPAMFRDVRSWVEKASRVMRPDAVSVYDVDEDVRAFYHPQTLKQILAVRELL
                     LDSEDDVTNFVKACMLGILHGSSEISLSVPCSHSFSMAPRYMRRYVAEHGLKKPVRNV
                     LACLLRKAESVLADGLPEARGAAFNMDASALPIADESVDLIVTSPPYLNLQTYAWDNW
                     LRLWFLGHDYRVVGKRLFATQSVKRYVEFMGRVLDEFFRMLKPGGYCVLVVGDVKSGG
                     RRVDLAELLVEPAEKSGFTARAIISDGIRRGHKYLMYLKSWQGVDREKVLVLSKGEPR
                     RMVRIA"
     CDS             533583..534155
                     /codon_start=1
                     /EC_number="2.4.2.7"
                     /locus_tag="CSUB_C0560"
                     /product="phosphoribosyl transferase domain protein"
                     /protein_id="BAJ50420.1"
                     /transl_table=11
                     /translation="MSSTVLEYDGRAFYELVVKEFRRQLPLIQVSPDTWIAYFDSLGD
                     REFIAYCAKILADHLRDCEILVTSESKGIPLVHEIASTLGHPRYIVCRKERKAFMKDP
                     IIVTYRPITSAKDLELVIDGRYVPYIKGKKVGIVDDIVSTKNTMEAMEKIVNLAGGIV
                     TKKATVLVEGEHHKDVIYLGVLPIFKKTRQ"
     tRNA            join(534190..534204,534225..534248,534270..534304)
                     /locus_tag="CSUB_T19"
                     /product="tRNA-Gln"
     CDS             534667..534948
                     /codon_start=1
                     /locus_tag="CSUB_C0561"
                     /product="hypothetical protein"
                     /protein_id="BAJ50421.1"
                     /transl_table=11
                     /translation="MGNLLFCGKNSMSVVSIDKRGRVILPKGIREMGDRAVVISAGSF
                     AVVIPIAKEPASVAEGWLKSKRGRKELGLVAEKRAKADAVARARRRRQL"
     CDS             534945..535160
                     /codon_start=1
                     /locus_tag="CSUB_C0562"
                     /product="PilT protein domain protein"
                     /protein_id="BAJ50422.1"
                     /transl_table=11
                     /translation="MMIESDVIYAYVKSSDWLKPAANKLMSRITRGEFGTVYSSREIL
                     HELYYVSLEEGVSIEEFIRRAATVFDV"
     CDS             complement(535174..536136)
                     /codon_start=1
                     /EC_number="2.7.1.45"
                     /locus_tag="CSUB_C0563"
                     /product="2-dehydro-3-deoxygluconokinase"
                     /protein_id="BAJ50423.1"
                     /transl_table=11
                     /translation="MSPTVVTLGESLIQLNAVTRGPLRHVTLFERHVAGAETTVAVCV
                     RRQGLDSGLITRVGDDEFGKCIINWVRGEGVDISHVKIDPEAPTGIYFVQRGFPIPAR
                     SKMFYYRTGSAGSRLSPEDIDPDYIGSAKVFHVTGITPALSETAKNATYKALEAAVSN
                     DVTISFDTNIRPVLWKTNERAVKTLMPIIEKTNILFTDPTDASILLGTMDQDTIIKTF
                     LNMGVDIVVLKMGERGALAADRNNRAFAAPLPVYVEDPIGAGDAFAGTFITSILKGRS
                     LNKSLQRATIAGTLVVTVRGDEEALPTEEDIDTNIKHINIHPKE"
     CDS             complement(536139..537026)
                     /codon_start=1
                     /EC_number="4.2.1.52"
                     /locus_tag="CSUB_C0564"
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="BAJ50424.1"
                     /transl_table=11
                     /translation="MELEKFEGIVSALLTPSTAYREKMAELIEFHLKHGVNGFFVLGT
                     TGEGVKLGPSARQEVAEAAVEYAGSRGLVIIHVGASDMDTVKQLTRHASRIGAHAVSA
                     VAPFYYRYDPDSLTSFYQSIADISSVPVLVYNNPGRQGYSIPLEGLQKILETVKPTVG
                     LKESSGDPDTLLQVFKRFKGSRFLGAGGDHLMVYSFIIGYRVHVSSLSSIYPEIAKQV
                     FDCVKNGKLDEALRLQTILNKVRAALKKIGPDMASNRYALKLRGIDIGGPIPPTRDLT
                     PEEKNTLENLLPKEQELRA"
     CDS             537219..537995
                     /codon_start=1
                     /EC_number="1.1.1.100"
                     /locus_tag="CSUB_C0565"
                     /product="3-oxoacyl-[acyl-carrier protein] reductase"
                     /protein_id="BAJ50425.1"
                     /transl_table=11
                     /translation="MKPGRRFEGLNVFVTGAGRGFGRLIALGFAREGGNVVVHYNKSA
                     ESALQTAKEIEQMGVRAYTVKADVTKWDEVKQAVEKTWREFGPIDVLVNNVGDTAPGQ
                     MSWREITEERIDHVLAVDIKGTLFMTHEVGSRMLERKKGVIVNICSNVITTGSPRAPQ
                     YAASKYGVLGLTKSYANAFAPYVRVNAVAPGYMETESLLSRPDWTAGRRKWVIEHTPL
                     RRIAKPEDIVPVVLFLASDDSIHMTGNVVICDGGFSMPGA"
     CDS             537996..539285
                     /codon_start=1
                     /locus_tag="CSUB_C0566"
                     /note="peptidase dimerisation domain"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50426.1"
                     /transl_table=11
                     /translation="MTATIQDVLAKIDVEKTIKRTLDLANIESPTGFEGECAEAYARM
                     MEEVGMRVKLQEVEPGRLNAVGVLPGKGGGPSLMFNGHLDTSFSPREPAEILKAISPV
                     YRLEPPWAYREGDWLYGMGVFNMKGALAAYVSAVEALQNAGVELKGDIMIAGVVGEIE
                     KTQVDQYRGAQYRGYGTGTAYLVTHGGVTDFAILGEPTGLRLMLTHFGSVWAKMYLKG
                     QMVHTAHSTGVTNLILRMNRVLNVLEEWIPKYQERFSHQGVKPTVNIGSIEGGWPWRC
                     SRTPWFCNLYVDLRYPPPYSAVDVKEALEEMLNEVEKRYGFKPMLDIYVSDAWATVPE
                     DSAVVKAIDEGHKAVFGTPAERVVFSWSSDANVLTRNGVVAVNYGPSGGPGKEMRGTL
                     YIPNLIACTKVYTVASMNLCNMDRKKVKQRFTITYGE"
     CDS             539288..541627
                     /codon_start=1
                     /locus_tag="CSUB_C0567"
                     /product="molybdenum hydroxylase family protein, large
                     subunit"
                     /protein_id="BAJ50427.1"
                     /transl_table=11
                     /translation="MMSKYVGKPIKRREDPILLTGRGRYVDDIKLPNMVYAGFVRSPY
                     AHGRIVSIDLSEAQKHPDFVAALLPEEAAPLPSWMKYKGLRDVPRFSLARGKVRFVGE
                     PVVGVAVKDRYSVEEVVSLVNVEIQPLPPVVDAEEGLKPGAPLLYEEWGDNIIMNYSF
                     KAGDVEAAFASADLVLQRRYVNQRYAPTPIEGRGVVADFDKSRGELTVWDSTQFPHVL
                     QTYLSQALNYPENRIRVIAPDVGGGFGPKSSVWPEEVSTIQLAMKLGRPVKWVETRSE
                     HMLVCGHERQQVHYVEAAFKRDGKLLAIRDKVIADIGVYGAFWTETQPVMVTMAAIPG
                     PYRFDAYQYEVFCVATNKAPYSPHRGFGRPVAAFVMERLMNDAAANLGIDPVEIRRRN
                     LIPAEAMPFKNIHNIVYDSGDYPKALEEALKLAQYDRLRRMQAEARKQGRLIGIGIAM
                     YVEYTTPSSERLDKGLGWEVGGYDSATVRIEPEGKVVVLTGTASQGQGHYTVYAQLAA
                     DYLGVNMDDVTVFEGDSKTCPYGFGAWASRSTVAVGGAIIKACETLLAKVKHIAAHML
                     EASPEDIEASDGKLYVKGSPDKYVTFADVAKIAWRQPTRLPPDTEPGLEATAHYEPKA
                     FTTCSYAVHIPVVEIDPETGQMKVLEYHIFDDSGRVLNPLTLYGQIHGALAHGVGGAI
                     YEELVYDENGQLLTSTFADYLIPSAVEMFNMNIGHMETPSPQPGGFKGMGEGGAIGAP
                     AALANAVQDALAHLGVIVDQTPLKPEYIRNLIAKARKPV"
     CDS             541684..542874
                     /codon_start=1
                     /locus_tag="CSUB_C0568"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50428.1"
                     /transl_table=11
                     /translation="MERLEQKLLVQKIERGVVIDHIAPCKGFLIYSILNPDPGSTAVI
                     AKNVPSTKLGRKDLVKIEGEYITSSLVNVIALISPTATINIIADWSVKSKERVNPPRE
                     VVGVIDCRNPLCSSKGPNSRFYVNLNTENLELTTLKCGSCGYVYYYEDAVKEISQRAS
                     SGILVSRTRVQRELLDLLVKKGGLRYHQKFRLKSGRVSPYFINMGALNDGESLSKLRW
                     IFASYIALLLKENILEDFDFVFGPAYKGINLASLVCEGLKEYYGINKRFLYDRKEVKE
                     YGDVRMDGSIVGSEYFQPGQKILIVDDTVTTGRTKVASIKKLDSLGSHRVVAVVVAVD
                     RQETSEEEGISAVEYLEKTLGVRVHPILTASSIYEMIKSGLSQEEQEEWVRYYRDYGV
                     VKLS"
     CDS             542871..543659
                     /codon_start=1
                     /locus_tag="CSUB_C0569"
                     /product="orotidine-5'-phosphate decarboxylase"
                     /protein_id="BAJ50429.1"
                     /transl_table=11
                     /translation="MSSNPLERFRKALEQRGSVICLGLDPNPDLHPQTTEKLRFCLNM
                     VDAVEPYIAAVKVNENFVRDFSLADHRRLTEKIRGVGLVSIYDCKMCDIDNTVKAGIK
                     LVSEMGYDFITFNPVMGTLSTAVKHGSANNVGIIVLLHPSNPESSKYFRAKLDDGRKV
                     YEKILDEFVENDAEGVVVGLHPELNEADVRAVREVIGDGKIVLFPGVGAQGGDLATAV
                     KAGGSAILINIGRSIIYSSNPRQAVINMYNRIQEIRQIHGEKHF"
     CDS             543687..545264
                     /codon_start=1
                     /EC_number="1.5.1.12"
                     /locus_tag="CSUB_C0570"
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="BAJ50430.1"
                     /transl_table=11
                     /translation="MTEKKITYVSLFADESLHPAYEKALKTVEQNYLGKHYPMLIGGR
                     EVFSEKGEFETRSPIDTSVVVGYFQKGDAGHMRQAIAEAKKRFREWADTDWRERVRVM
                     RRAAQLIDERKFEIAAVITYEAGKNRLEALAEAWEAIDALKYYAQVMEKNNGYEMEMG
                     PGGPGEQCRMVARPYGVWVVISPFNFPFMLANGMMLGALITGNTVVFKPTSETPLSGL
                     MLYRVFVDAGVPPGAINYVTGPGSAFEDEIVSNPDVAGIAFTGSKDVGMRLYRRFTSS
                     QPYPKPILLEMGSKNPTIVTKNADIGKAVLGVVRAAFGYGGQKCSATSRVYVQREVKN
                     RFLDELVKETSRIKIGDPRLREVFLGPVINKRAVENFRSYIDTARRDGGEIVYGGEVL
                     GGGLFDKGYYVQPTIIDKLPRSHPLFKQELFLPILLVAEFDTLEEALREANNTEYGLT
                     AGIFSEDPREVEYFFNNIEFGVTYANRKGGATTGAWPGAQTFVGWKASGATGKGVGGP
                     HYLLTFLREQARTNVVD"
     CDS             545328..546329
                     /codon_start=1
                     /EC_number="1.5.99.11"
                     /locus_tag="CSUB_C0571"
                     /product="coenzyme F420-dependent
                     N5,N10-methenyltetrahydromethanopterin reductase"
                     /protein_id="BAJ50431.1"
                     /transl_table=11
                     /translation="MEKWLGIGLGYDPSMTVREMTLYAKKAEQLGFDMVFFSETLQTF
                     RDAVTTLTSFALTVEKPLLGCTQVVRLRSPLVLAQTFATLDELSGGRVVLSLGACTKQ
                     HMAKHGLEYADPAETLIEYITLFKKLLTNEKITYESKHFRLSESGLGFKPLRSNIPVW
                     VAATSAKGLRIAGEYADGVLLNATTSVEYCRNAVKIVRKAAEEKGRDPDELQIAGLIV
                     TAVDAEKPAVEYVRREVASKLSPLMVDFAMKPRLKVGEPYITPQLIEKMLEAYNAGGF
                     GKLMSEIPVEVLKGLTAVGTAEEVRRKIDQYREAGVKYPIIRPADKSIIDMVLNVFR"
     CDS             546363..547610
                     /codon_start=1
                     /locus_tag="CSUB_C0572"
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="BAJ50432.1"
                     /transl_table=11
                     /translation="MNIKAVSTTLVVAVLVIAVVAGVGVYLAIQQLSAPTVAEKPLVI
                     GFSISISGDFAVPGRKQLEGIELWKDWINSKGGIYVKDQNKYYKVELKYYDDKSSKDE
                     VIRLYEKLINEDKVDILLSPYSSTLALTAAGITEKYGRLMVVVGANSDTIFKQGYKNI
                     VGTYTPASKMLTQAIDILLEKVQNPSVAIIFKDDAFAKSVAEGAKAYAEQKGVNVVAF
                     EMYPRDAKDLSPILTKIKGLNVDAILGGGHYEDEVLLVRQAKELGINVKLMSLLVSPS
                     LPAFYDALKETSEGILAPSHWEPQTKPKITYGPTIDEFMTQFRQKWNSEPSYHSAAAF
                     AAGLYITAAIEKAGTLDNAKLRAAFNDLDITTFYGRLKIDPATGNQVGHELVLLQWQG
                     GKKQVVWPREVATAQLIFPKPSW"
     CDS             547611..548465
                     /codon_start=1
                     /locus_tag="CSUB_C0573"
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="BAJ50433.1"
                     /transl_table=11
                     /translation="MFNPEIFFQALVNGLLMGAVYGIAAVGLSLIWGVLGVVNLAHGS
                     FIILAAYIAYVFFSAAGAPPLLTAPIAVAMGFAVGYLLYKGVGRKVVTLDPSTSLLFF
                     FGLSLLISNSILNIWGPDVRGIPWLIQSLELGGTRIPIARLIALVSTIISFMLLYMLL
                     QHTYYGKAIRAVVANRVGAASVGIDVDNVFAISMGIALGVTFFSGTMISLVNPFTPSS
                     GDGYLMYSFASVVLGGVGNIIGTLLAGIFMGLVESLVGVYFSQSISPAVAFIILVIVI
                     MVRYRGGR"
     CDS             548452..549399
                     /codon_start=1
                     /locus_tag="CSUB_C0574"
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="BAJ50434.1"
                     /transl_table=11
                     /translation="MEAGRQRLKIGLILYILLLSIASLPPLTGNTALIAYFWSFLQML
                     ALVMSLNFITGFTGYVNFGHIAYYGVGAYTVAYLTTTTRVDPYVFVPAAAITSAAVAY
                     LIGRPILRIRGPYFAITTLGLGEAVRVIIVNIPAFNYSEGLPIAAYFTYNVTGSYIAM
                     YTTVATLFILTLYLRRTRFGYMLESIREDEDAAESMGINTAKAKLAAYVLSSACAGVI
                     GGLTAITHVYAHPGFFSITLNVSVLASLLMGGGGTLLGPLVGAGLFFFISDALLIRFP
                     YLHLVIFGAVVMTVTLAMPRGLSHLIYRYPKISRKIADA"
     CDS             complement(549400..550095)
                     /codon_start=1
                     /locus_tag="CSUB_C0575"
                     /product="branched-chain amino acid ABC transporter
                     ATP-binding protein"
                     /protein_id="BAJ50435.1"
                     /transl_table=11
                     /translation="MLRAENLSVAYIGDILVLDGVSVQVEQGKVYAVIGPNGAGKSTL
                     LKTLFGFLKPKSGEILLDGRKITSTAPHERIRMGVFYIPQESGIFGSMTVKENLELAA
                     WLFRGNKALVTERVEAVLNQFPRLRERLYTKAGKMSGGEQKFLELAKAMMNEPRYLLI
                     DEPTVGLSPAMADMVYEELRKLTGKDIGILIVDQYVDQVLEIADYVYYVELGKIKAEG
                     SVDYIRRGEFLFE"
     CDS             complement(550082..550840)
                     /codon_start=1
                     /locus_tag="CSUB_C0576"
                     /product="neutral amino acid ABC transporter ATP-binding
                     protein"
                     /protein_id="BAJ50436.1"
                     /transl_table=11
                     /translation="MAMGPDVSGSKAVLRAVEVVKRYDELRALDGLSLEMYEGEVLGL
                     IGPNGAGKTTFINVVCGLIRPDSGKVYYYGENILEKNVYELARAGIVKTYQIPRVFGN
                     LTALDNLVASASWLKMSVEELRKAAYDSLRLVKLDVKADLLGSQLSGGERKLLEFARA
                     MMLKPRLLLLDEPFAGVNPVLKSILIDALKRVNTQGLSILVVSHDMAEIRRLCKRVVF
                     MAAGSKLLEGSPDEVLRNEEVVRLYLGVKRHAAG"
     CDS             550985..551371
                     /codon_start=1
                     /locus_tag="CSUB_C0577"
                     /note="HEPN domain"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50437.1"
                     /transl_table=11
                     /translation="MSADDAELMKARAIAFLRNADRLMEEHEWDLAMFNLEQYCQLML
                     KYKLLVQRGIYPKTHSLRTLIRILGENNPGLLTMVEDSSKLHYVARLEEAYIVSRYMP
                     YRFEEKEVRDVYRFVVEVFKPFVEKL"
     CDS             551355..551675
                     /codon_start=1
                     /locus_tag="CSUB_C0578"
                     /product="DNA polymerase beta domain protein region"
                     /protein_id="BAJ50438.1"
                     /transl_table=11
                     /translation="MSRSYEERLLEYMRRYREVGAEVKRILRKIDPDVRVFVFGSVVR
                     GRYTAASDIDILVLTDDLSKKYEMMVEVYRSVEAPVELHITTPQKYRSWYSRFIPLDE
                     LVEI"
     CDS             552778..552945
                     /codon_start=1
                     /locus_tag="CSUB_C0579"
                     /product="hypothetical protein"
                     /protein_id="BAJ50439.1"
                     /transl_table=11
                     /translation="MDKLDSIRLELLRLRASLLPEEELSEEEIKELEEAKKEVSQGMY
                     VKLEELLKEFD"
     CDS             552945..553208
                     /codon_start=1
                     /locus_tag="CSUB_C0580"
                     /note="plasmid stabilisation system protein"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50440.1"
                     /transl_table=11
                     /translation="MLFQVIISNRARKSLKSLVKQHRRRVLELLLILRENPVPTDYFD
                     VKKLKGLIYTYRVRIGDIRIIYEVSWNAKTIKILLIEWRERAY"
     tRNA            complement(553233..553305)
                     /locus_tag="CSUB_T20"
                     /product="tRNA-Gln"
     CDS             complement(553331..553633)
                     /codon_start=1
                     /locus_tag="CSUB_C0581"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50441.1"
                     /transl_table=11
                     /translation="MNTRKMPDKHELVLTRLVLDVLKPHKPGMVEFAQALTGLRGVTK
                     VEVSIIEVDADTETVKLTVEGNNINFEQIANTVKQLGAAVHSVDQVTYSHPTKQQT"
     CDS             553854..555332
                     /codon_start=1
                     /EC_number="1.14.99.-"
                     /locus_tag="CSUB_C0582"
                     /product="phytoene dehydrogenase"
                     /protein_id="BAJ50442.1"
                     /transl_table=11
                     /translation="MRRLRIVVVGAGVGGLAAAALLAREGHEVTVAEKNNNVGGRAGV
                     LSRDGFTFDMGPTWYLMPEIFDRFYSHFGKKTSDFYNLLKLDPGYRVFFDDGVKVDIS
                     AELEENIRLFDGLEPNGGEKLRRFLAKCEELYNSISKTLYLDLDSPFSFLNPEILSQG
                     IKINIFESVESYVKKWFQSDKARKLLLYSIGFIGTPPSKAPAFYAILNYVKLVQGVYM
                     PEHGIRQVVDTLYGLAKQENVEFLLGHEVSKIEVTNSKAERVYLNDSSMKVDAVVVNA
                     DYAFFETRVLEPRYRTYDVDYWSKRMFTPSALIAYLGLDKKVENIIPHNVFLEKDWGE
                     NFYQIFDPRYAKWPEYASYYVHVPSKIDKTAAPPGGEAVFILIPVANGIEDDDKKRET
                     LFNNVLRDLEQKTGENIHENIVFKQLFSIRDFSARYHAYRGSALGLAHTLGQTAFWRP
                     VHRSKKVKNLYYTGQYTHPGIGVPMVLISAEIIRNKLRKELM"
     CDS             555333..556217
                     /codon_start=1
                     /EC_number="2.5.1.32"
                     /locus_tag="CSUB_C0583"
                     /product="phytoene synthase"
                     /protein_id="BAJ50443.1"
                     /transl_table=11
                     /translation="MLIPKPPRVQKTLFNLFHKGSTTYFNSTLFFPDNVKKDVFKLYA
                     FLRKADNYVDLIPQDVEGFYAFKEEYERAASGYQSSDIVINEFVELSNRKKFEQEWIT
                     AFLDAMESDLYRKTYYTLDELCVYMYGSAEVVGLFMAKILDLPEESYIYARFLGRAMQ
                     YINFIRDIREDYELGRQYLPYEEMRMHGIEDFEPARFCGKHESFARFIRLQIERYLEW
                     QRFAEQGYKYIPYRYLIPIKTAADMYKWTAKIIHRHPSIVFMRKVKPRKRRVVYGANV
                     NFVLALRHKIFTGGLVWP"
     CDS             556208..557074
                     /codon_start=1
                     /locus_tag="CSUB_C0584"
                     /product="UbiA prenyltransferase"
                     /protein_id="BAJ50444.1"
                     /transl_table=11
                     /translation="MALEAVQKVLKVSRFRFWIYVAGPYVVGYTLGATGFSDFLRPEY
                     YIYLIYFFIPANILVYGVNDYFDVETDALNPKKSSKELRIVGRDRVRLRRLLLGVLGI
                     SFALMLFQDNVARILFGGFLFLSIFYSAPPLRFKSKPFLDFASNYLYIMPGVFGHYIA
                     SGSLPDTLILLAGFLHISAMHIFSAVPDIEFDLAAGIKTTPVVIGRKNALILVTVFWA
                     GLAYLAIMLTGFHPLSFLALIYPMVPLSVLVFGRDINRVYWSLPYINTSLGGLLWLGL
                     VNHKIIPFFPNF"
     CDS             557084..557611
                     /codon_start=1
                     /locus_tag="CSUB_C0585"
                     /note="adenosine specific kinase"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50445.1"
                     /transl_table=11
                     /translation="MQIFRPYVDWARSAAVLDDLRLGKQRVESKQVLNVFLRKAGILR
                     DGLRGWLNHPIVLLYYNDGRPYVDDVVGMFIACVKEWVRRGKQNSINLDDIKHLLDQL
                     EKTPGTPITHLHEIEYRRILLLKNPSHYIKTFTEEEVREVLETEPVKISGINSWLFDD
                     MRRYRRLLKKIRARL"
     CDS             complement(557606..558094)
                     /codon_start=1
                     /locus_tag="CSUB_C0586"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50446.1"
                     /transl_table=11
                     /translation="MSVKIEVVGVEIPEGCNVVFGVSHFIKTVEDIYEAVVNTVPGAK
                     FGLAFMEASGECLVRHEGTDPELRKHAAETMLRIGCGHTFILFIKGFYPINIMQRLKD
                     VPEVCTILAATANPLQIIVAETEQGRGVLGVVDGHKPKGIETEQHIEARKQFLRKIGY
                     KL"
     CDS             complement(558127..559191)
                     /codon_start=1
                     /EC_number="2.5.1.-"
                     /locus_tag="CSUB_C0587"
                     /product="octaprenyl-diphosphate synthase"
                     /protein_id="BAJ50447.1"
                     /transl_table=11
                     /translation="MMSLEDEVLSILSEYVEPVEKAVEKLTPRMFDTGFLVKEFGEPV
                     YRYSPESFTEGLAKPFWELFRRGGKRWRPALTVIVYEALGGGDPGIYILAAVPEIIHN
                     ATLIVDDVEDGSLMRRGEPCIHRIYGIDIAINAGNAYYYIPAYLAAKKLPKNMATLFL
                     EKYVETMTRLSLGQTMDIVWHRGLVTDITEEHYLQMAAFKTGALSRFAVELAAIYAGR
                     GDLLEELGRFGEAVGTAFQIQDDYLNIFGDEARYGKEIGGDITEGKYTLMTVYALTHL
                     SSEKAKRLRQILHSHTSDKQELKEAINLIRESGADKYAREVMRRSVHMAWSRVEPLLA
                     DTPAKTKLKKLATFLVERTL"
     CDS             complement(559227..560000)
                     /codon_start=1
                     /locus_tag="CSUB_C0588"
                     /product="NADPH-flavin oxidoreductase"
                     /protein_id="BAJ50448.1"
                     /transl_table=11
                     /translation="MKRRVEQSVLGLLASRRSIRRFRKSAMSEEVLGMIVESGQSAPS
                     YFQAYSIIWLRSDQLVEAVYDVCGSEAIKQASAVLLICLDFNKLTVFAETVSPEHFLK
                     LDTYPAETLLSVLELGLVVENMVIASEALGYGSLLLDCGIYECERLSALLKLPTGVVP
                     VILLLIGEKDETPPPRPRWPLQNILHIDGYKPVTGEEARKYIENADQILSSENYLKKY
                     ANFSGTYFEYLAEQLRANKEIKQSYSALSAFLRKQGVKV"
     CDS             complement(560037..561122)
                     /codon_start=1
                     /locus_tag="CSUB_C0589"
                     /product="cell division protein FtsZ"
                     /protein_id="BAJ50449.1"
                     /transl_table=11
                     /translation="MSSVEDFVQTTEEIRIKLIGVGGAGCNTVNRLNALGLTGVYTIA
                     ANTDLQHLDMVRADKKILLGKSVTRLRGAGGDPVRGRKAAEESEEEIRRALEGADIVF
                     LAAGLGGGTGTGAAPVVARVAREEGATVVGVVSLPFEFEGMVRKRIAQAGLEELKNYT
                     NTSVVVDNNKLLDLYPQHNLRRAFSLADEIISNMIQSITESIAKPGLINIDYEDFKTV
                     VSRGKLASLGVGRSSTPNRAEEATFNALQSPLLDASYENLSGAIVHVCGGEDMQLAEA
                     ARPAEIISELMGEDGLVIWGARIDDTFSSTMQVSLILTGLSSTEQVVEINEITPTSVD
                     QRIGEENGEEIDKILEQLGIKPVSQLP"
     CDS             complement(561115..561423)
                     /codon_start=1
                     /locus_tag="CSUB_C0590"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50450.1"
                     /transl_table=11
                     /translation="MIILWFLTSRNCNFLHMSWPKMASETRVDTYVRITFSYNYLSHQ
                     HGANGGDGWEMKVVTVHLPEPYLQAIDELVKRRLYPNRAEAIRMALRDFIRTEVQISE
                     "
     CDS             561456..561824
                     /codon_start=1
                     /locus_tag="CSUB_C0591"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50451.1"
                     /transl_table=11
                     /translation="MVDEMHYEEFRKTLENLVAEAVEDVVVLVEGARDEKALRLAGVR
                     AKIVYVSRFREAVEMMPRPRKIILLLDFDSEGMKTVKRVSRLLRQMGYEVDESYHRRL
                     RVLKRFGITTVEALAKLLEV"
     CDS             complement(561821..563866)
                     /codon_start=1
                     /locus_tag="CSUB_C0592"
                     /product="glutamine amidotransferase class-II domain
                     protein"
                     /protein_id="BAJ50452.1"
                     /transl_table=11
                     /translation="MSMEPRREISACGILGILRKQDAEKVSVEEAVSSIECVRYRGSR
                     LGAGFAAYSLDGNNGMHRLKIFIDSETTLSHVKKILKTRVNGGFYELGFDSLPASRFA
                     SWSAYVETSEETLRKLVDSINYELWNAGMRGRVYSWGRFVEVFKGVGYPLDVSQMYGL
                     TEKNLEADMWIAHTRQPTNSPGVYPIWSHPFASQEWAIAHNGDISSFGANMEFIRFRG
                     YRSFVGTDSELIAYLLDYLTNIQRLPILHAAQLLVSGFEDDLDKVDEYVRWRGAGLDG
                     PFSVVAGYCDGEDIYMLALADRSKFRPLVVGYDEERIYVASEEAEIRQNSPEAVVWPV
                     KPGGIFLASLKKGIIVSGRENITLYQPRIEKPPYPSRVVDAAGLDYRRVNKIVAELFA
                     KGAEKVDVVNVNGHRYLGVNVPPGRFLNIYGTAGNCLANFNRGGVITVYGNAEDDVAD
                     AMVGGRVIIHGNAGDVLAQAFQAGEIFVRGSAGNRVAIQMREFREHKPYLIIGGRVDD
                     YLGEYMAGGVVAVLGVDSFDSDECLVGRCVATGMVGGVIYIRGRVDRWRIGLQPPRED
                     VKRYLRGLLLEGQIDQQTYTKLSTLKKITIQDLRENLPPEPFKRISKLYTSKYYREHL
                     VSYRRLGETDLKLLSDALQSFCREFGLGRDVYERLLEEKYTVIRVAGGFSDLLPEEG"
     CDS             complement(563863..564813)
                     /codon_start=1
                     /EC_number="1.4.1.13"
                     /EC_number="1.4.1.14"
                     /locus_tag="CSUB_C0593"
                     /product="glutamate synthase (NADPH/NADH) large chain"
                     /protein_id="BAJ50453.1"
                     /transl_table=11
                     /translation="MLRGWTEDRVKHLREMAGVIGRQPAEPPIVSMGSTAPPYVDAPF
                     FIRDHIVIDGAQVTRPSIDPYREPVETHVYLRGGRLRLSMPVAVKLGAHLPRVFIEGV
                     VRACYCMGVLMMLENPAELENYGEALVVDPAYRGVFAGYFAEPTRVSDVGGPFFAHVG
                     SSTDFSWLPPVLEHVSGVVVDEDLGGDAELEVVVALLDRELRRHGVRNTVGLVAGGWS
                     VRGADDVFKLVALGADAVLLSACVEEALEPVKTQTVSIVQEKMENLLLGLQREIKLLA
                     GAAGVSSVFNTLVGNRELLRAIELGREVRALLGVKMAGEG"
     CDS             complement(564806..566041)
                     /locus_tag="CSUB_C0594"
                     /note="Probable gene remnant of glutamate synthase
                     (NADPH/NADH) large chain"
                     /pseudo
     CDS             566217..567044
                     /codon_start=1
                     /locus_tag="CSUB_C0595"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50454.1"
                     /transl_table=11
                     /translation="MVDLLTVLAISFLAGLVGSITGLGGASITTPLLTLAGVPIKYAI
                     AAGIVSIIATSSGAAASYVRGGLSNVKAAMFLEMFTVVGAIIGAIITIYVSARLLYFL
                     FAGFLLTSFIGIRRHLGEELPTNVNQDRAARWLSLEGVYYDHALGREVSYKLTRPLAA
                     GGGMFIAGVAAGMLGIGAGAFKVAVHELIMRMPSKVSSATSTFIIGMTALAGASVYFS
                     SGLLYLTLAAPMVLGTTLGAVVGSRILGHISNRVTRLFFLAVVFVLFLQMLLRGLLA"
     CDS             567065..567397
                     /codon_start=1
                     /locus_tag="CSUB_C0596"
                     /product="hypothetical protein"
                     /protein_id="BAJ50455.1"
                     /transl_table=11
                     /translation="MMISWILVAGVAASLAVTTWALASYYLSNGPALALSDEYRVSSK
                     SFFDYLLHIHKGGVAGAMAVGVAALMLTPYIRALASLIYFIAKRDIKYILITAFVFTI
                     LTISLLTS"
     CDS             567434..568291
                     /codon_start=1
                     /locus_tag="CSUB_C0597"
                     /product="Rieske (2Fe-2S) domain-containing protein"
                     /protein_id="BAJ50456.1"
                     /transl_table=11
                     /translation="MLRFISSAKTFKHMAERRRTLLKATLGSSLLVTLAPFLSWGGFL
                     FRPEATSGQIRQRLINLKDFPVNSKLTFPFPATGDPTVDSDPFRQYILVHLPSGDLKA
                     YSKVCVHLWCLYDYFPDKRQFQCPCHGSIYNPDTGVAIRGPAALQPYPTNSLPELNLE
                     VDPDGTIYATGLRGRIGYGREWRAEAAWIQQKQSSSPNTPVTGYVVFRDPLPPDDTLS
                     LIRGVDAKIVKWYGYFDKSPTEREWLTGEGEQNITTATAVYGLDASATPSSHLKLLEN
                     PKIIIILPR"
     tRNA            568325..568409
                     /locus_tag="CSUB_T21"
                     /product="tRNA-Leu"
     CDS             complement(568391..569032)
                     /codon_start=1
                     /locus_tag="CSUB_C0598"
                     /product="hypothetical protein"
                     /protein_id="BAJ50457.1"
                     /transl_table=11
                     /translation="MLSVGEYFGRGRNRRRILEVVRLSNGWILLKTEDSKSKRDFKVR
                     TVYQLEPRIRSYTPKHAHFAIDFYGKLCADKEKAMQVLKAIVEVWQGANIATVVERFR
                     HAVEGLPGYDLEYILYALAWIFQQEDVNFARRPESRQRELDETLSLLSIKVPKYRYGS
                     QLAVALLCNIANGTHPVDALLRANLDILPIKRGKREGVNMLWNCVVAHAGGGI"
     CDS             complement(569035..570012)
                     /codon_start=1
                     /locus_tag="CSUB_C0599"
                     /product="DNA methylase N-4/N-6"
                     /protein_id="BAJ50458.1"
                     /transl_table=11
                     /translation="MSRMFGTLLDTGSSQFVLTSMRPVTWEDYRRYVAEKGYVEVEDV
                     RIEIGKPHKINSYSPPASYNLEATTVWSFPDRGDWATHSGDYRGNWSPYVPRNLILKY
                     TKPGELVLDQMVGSGTTLVEATLLGRNAIGVDINYEACILTLDRLNFEFHPLDEQQEP
                     VIKVYHGDAAKLNIIEDESVDLIATHPPYWNIIPYSRKRPEGDLSAYRKLEDYLGKMM
                     QIARESYRVLKPGRYCAILIGDTRKHKHYVPISTYVMLKFLQAGFVLAEDIIKLQHKM
                     KTTREKWSGKNFEQYGFHKIAHEHLYIFRKPENEEERGRLSLSGWLTQI"
     CDS             complement(570074..570355)
                     /codon_start=1
                     /locus_tag="CSUB_C0600"
                     /product="thioredoxin"
                     /protein_id="BAJ50459.1"
                     /transl_table=11
                     /translation="MPHRLELFISNCPLCRKTRAMIELGKCAGCSFTIHDLSKNFYAV
                     EELVKKYQIRSVPTLIIDGKIKIEGVPTFTFICDENLYRILEEKYAFNP"
     CDS             complement(570381..571013)
                     /codon_start=1
                     /locus_tag="CSUB_C0601"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50460.1"
                     /transl_table=11
                     /translation="MMDIFSQAFWEGLTAYGYIGVLAASFLGSLLPFVSGPYIPPIII
                     AVMAGRLDPLPTALASAAGAASAKLVLFRFFKGGRVLISDETRRRIQPLERLVARHGW
                     FAVLAAAATPLPDDIIYILLAIANYSSKLFLPTVFAGKLLITTIAAYTALYWSTLACT
                     IIECTAGQLNPLQTILLAAASAAAAMTLIYIITRLDWQKILTKLGERAQR"
     CDS             571069..572421
                     /codon_start=1
                     /EC_number="1.1.1.81"
                     /locus_tag="CSUB_C0602"
                     /product="hydroxypyruvate reductase"
                     /protein_id="BAJ50461.1"
                     /transl_table=11
                     /translation="MCGGCFLLRVVGLRGVGDVAAGLRSGLAAVEPGALIRRVVKRRG
                     GCLQIGGKVVELRRFRDFVIVGGGKAAEGMAAEMLRLLDGLDVRGVVVVPRGYRLRRR
                     LKPLEVLYGGHPLPDSMSEEAGRLILEMASSCSGDSLAFVLVSGGFSALAAVPAEGVS
                     LQDKVEATSALLRAGASIDELNTVRKHLSAFKGGWLAKSLRCRAFSLILSDVVGDRVD
                     VIGSGPTAPDPTTFRDALDVLRRRGVEVSENVWRRLRRGAEGIYPETPKQGDPCFRRV
                     VNVVVGGCVDSVKAAALEMRRRGYSVVALTSGVVGEARTVANLFAAVARDVVRHGVPH
                     APPFALVAGGETTVTVRGRGRGGRNQELVLATLHLLRDVPRFVFASIGTDGVDGVTDA
                     AGAVATPQTLRNAAKEGLDPLPFLEDNDSYTFFSRVGGLVLTGPTGTNVGDLMILAIR
                     "
     CDS             complement(572414..573451)
                     /codon_start=1
                     /EC_number="2.5.1.46"
                     /locus_tag="CSUB_C0603"
                     /product="deoxyhypusine synthase"
                     /protein_id="BAJ50462.1"
                     /transl_table=11
                     /translation="MQHEIQIDQLLRTPLQAVEVGEKTIAQLLDQMKLTGFQGRNLAL
                     AAETWAKAAQAKDTVIMLGYAGSLSTTGQWKIVKWLIEKRFVDVVVSTGANISEDLIA
                     AMGYNYYIGTSYIDDDLLRRLRIYRFHDVFVKEEDYIKMEGMLADFMLTLDNMNPISS
                     AEFLHLFGKWLDQRNIHGIVQAAYRAGVPVFSPAIEDSGYGVAYIINRHRKPGYRLVL
                     DHFKDYEQLVRIRGRHRDSAAVFIGGGVPKDFIQLSAVAVDILEKGDALTTRPHRYAV
                     QITTDNPHWGGLSGATLEEGKSWGKETSEGVGVQCFCDATIALPLIAHYLHEKVGERK
                     HRPDLSWVFST"
     CDS             complement(573474..574028)
                     /codon_start=1
                     /locus_tag="CSUB_C0604"
                     /product="oxidoreductase"
                     /protein_id="BAJ50463.1"
                     /transl_table=11
                     /translation="MLQIGVGCSSDREPLPGAVEKARRFAARLGVYRDEVVLLTGGDG
                     GLMRVVCEEFVRRGGITVGVIPYEDEFIDKTHPRYNPYNTIVFRSGQTYQARSIGLVR
                     SSDSFVILGGGSGTIIEAHLAYIYRIPLIILTETGYPSDILAQMHPDGHLDHRKINAA
                     HYINDPEAAADKAVALARQKTQKL"
     CDS             complement(574363..577890)
                     /codon_start=1
                     /EC_number="3.6.1.-"
                     /EC_number="5.99.1.3"
                     /locus_tag="CSUB_C0605"
                     /product="reverse gyrase"
                     /protein_id="BAJ50464.1"
                     /transl_table=11
                     /translation="MKSIYASLCPNCGGAITDEELIGNGVCSRCVSQDGRLKPGKYTK
                     ALELEERYREFADFFSRVVGSPPWSLQRTWIRRTFLGRSFSIVSPTGTGKTTFFIAMA
                     IYQASKGKKSYIIVPTSLLAQQIHERALSMAAKHGEKAPKIAGYFSGMKKSEAEEMLQ
                     KIRDEEFNILVTTDRFLNTRFELLRGKKFSFIFVDDVDSFLKSARNIDKVLLLMGFDE
                     EEIERQLSLVSRRSEKNEAGEHASREIAKPDSILLVAGATAKGRRTKRIQLFRRLLNF
                     EPGGSIEFVRNISNMYLRPSKNMWEQVAELVKTHGGGCLIFVPQTAGVESAKELAKFL
                     NSQGISAYAYERMDAKMLGRFELGEYDVLVGVASRRSPLARGIDLPERIRYVIFAGVP
                     RRELNVSWREHRPSMLLSLLRNLYSILREKNESELVQVTGMLKKCVPTDREVLEIVRE
                     GLESSRQPEGFAGYVYSAVTRAHQLLKTYIGEEELRRVAENLDMRLRVDENGVSIILP
                     DIDGYIQASGRSSRMYAGGITRGISILIVDDEKAFRGISRALETIYEETFQEYTLEQA
                     REEFKQCDRDRQFLREIRTGSARLESLDILSSSLIVVESPTKARTLAYFFGKPARRVV
                     DGLTVYESVGEGYVACLTACQGHLVDITTSQGFHGVWVHDGEFVPMYVDIRRCSKCGE
                     QFTDSEVCPNCRSDKYFTKLSIIESLRKLALEFDRVFIATDPDTEGEKIGYDLYVSIW
                     PFNKRIERLELHEITRKALRDAFKSPRSISLPLVEAQVVRRIEDRWVGFELSRRLWEF
                     FGEKHLSAGRVQTPVLGWIIQRMEEAKKKRLVASMTFEDGSELMLDSIEDVDVVKRLY
                     AEGVLNVEVADVKYVETVVPAVKPYTTDSLLRDASIFLRLSAAEAMDAAQTLFESGLI
                     TYHRTGSTYVSSTGLSVARNYLEENFPGLFVARHHGEPGAHECIRPTKPLSRKQLELY
                     LQSGLIRVPMRIGDREFMLYDLVFRRFMASQMKDALVQRQICKLMILGKTYDIERIVD
                     VIEPGFLHLYQVIKTVKALEPGVHRVLNLQIKSMQAVPFFREGDIIALMRERGIGRPS
                     TYAQVLNLLYKRRYIFNDNGRVLATKLGKTIYGYLVSNFGSFVSEALTRRLEELMESI
                     ESGKVSYQEVLKELYRETLQISKTPARAA"
     CDS             complement(578169..579596)
                     /codon_start=1
                     /EC_number="4.2.1.33"
                     /locus_tag="CSUB_C0606"
                     /product="3-isopropylmalate/(R)-2-methylmalate
                     dehydratase large subunit"
                     /protein_id="BAJ50465.1"
                     /transl_table=11
                     /translation="MFWRGMGYTVFEKIWNSHALAEREDGQTLLYIDRHLTHEVTSPL
                     AFEGLRAAGRRVRRPDLTFAVMDHNVPTGDRLEPVRDPMSAAQMQALSRNAREFGITL
                     FDYFSPFQGIVHVIGPELGFTIPGITLVCGDSHTSTHGAFGALAFGIGTSEGEHVFAT
                     QTLWLKKPKQMNIRLMGKLGENVTAKDVILYIIRKLGTGGCIGHVVEFTGDYVRSIGV
                     EERMTLTNMSIEGGARTAIIEPDEKVFNFLKDAPYSPKGREWDEAMEYWRTLKTDPGA
                     KYDTVHEFDVSRIEPQVTWGTNPAMTVGVTENVPSPDDFDDPSDRKAVERALQYMGLK
                     PGMKVSDIKVDTVFIGSCTNARLSDLIDVARLVKGRKKAEGVRVLVVPGSQLTKRRAE
                     RMGLHRIFMEAGFEWRNSGCSMCIAMNEDRLRPGERCLSTSNRNFENRQGVGGRTHLA
                     SPLVAAATALTGKITDPRQFPLQDL"
     CDS             complement(579627..580436)
                     /codon_start=1
                     /locus_tag="CSUB_C0607"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50466.1"
                     /transl_table=11
                     /translation="MKTMSEVVYIETTRLRKSRYNPRMVHDPERHKILLESIRRNGVM
                     EPLLVYQVDDGYEVLDGSRRLEAAVEAGLDTVPCIIVRREEAPRISLAIHFSQDDLTE
                     SELVLYVERLVAEEVFKSVEEVCRFLGVSKSWFYTLRRAARLGPLDSGASATTLAMVE
                     KTRVEPEKKKRIVEALDNYPLPRPMLREALREIEEKPMEEPERVLERFYWASPRRSGE
                     DAFTASGVYEYVLRRLGGVVEFLARKGVETVWRVEVPAQDLMVVKLMWQRL"
     CDS             580545..581492
                     /codon_start=1
                     /locus_tag="CSUB_C0608"
                     /product="hypothetical protein"
                     /protein_id="BAJ50467.1"
                     /transl_table=11
                     /translation="MDFPRLFCLLSSIRSSPLPTTISLNPFSSASFANSSPTRIIVSN
                     ALVLENILGISPTSHDVSEKQTKVNRDRYAMFISILAEPAVDIMGKPQRHPLNLIPES
                     VFTRHLRDTSYVQLLHEKGALSALSGTSHRYMQASWRKPEGGGIKKMGEIDSKVTHEK
                     SSDESSAKQSKAYCTVKIPAALAEVIDSYLMEHEAQVRGFRSRADVVVRVLTEFLEEQ
                     GRLRPLVKRRLEHVNVYESFVLVRDNLLNVSVEVAVQPPQLFCRYCLSDECVHVLFAA
                     SIPGVRRRFAELGLRAPETGEDVGGYVVFFGGVAYPYTE"
     CDS             581511..582968
                     /codon_start=1
                     /locus_tag="CSUB_C0609"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BAJ50468.1"
                     /transl_table=11
                     /translation="MGGVAVFRVPVVFADYGGKRGFGFAGLRTRVTRVFGGVVKRSRR
                     VGEVASLMGLGLEDVVMPVFLEAVVEVEKGDVVYVTGESGGGKSLLLRHLAEEMSRLE
                     EFAPVACSWKIMDNIPRRRPLIDCVGRDVKEAVEILSAAGLSDVYTWFRCFDELSDGQ
                     RMRFIFAKALDAGAKTVVLDEFCSALDRETAKATAYTMQKLARRRGITFIAATAVDDL
                     GEDLNPSLLIVKHMGPHLVVKRLNPVPRPCSLLEKVVVEEGSVEDWRLLSFLHYRSHR
                     VAAAVKIFRAVLNGRVVGVVVYAKPYLQAAGFAQFFSHDWYRRERMNHVLRIQRVVVH
                     PSFRGIGVARKLLQESMPRLGVPFVEILSAMEKLIPFTRGIMTRWTVVEPNREKRALL
                     EEFSQRFGIDVMKHGVVDVLLYAEKRGLLRGMRSWLIANRHRYGDTSLKQRDAAKLLR
                     TLKSSCAAKVYGLWINPEKKFRKIVEEAMSAPRVL"
     CDS             582974..583354
                     /codon_start=1
                     /locus_tag="CSUB_C0610"
                     /product="hypothetical protein"
                     /protein_id="BAJ50469.1"
                     /transl_table=11
                     /translation="MERSFSSADEPIFSSAMMMSLVFAMTSSRALASVSMSLAEAPLL
                     IFSSATVSSSWYIFSRLFNNFSSISAAFSDVSSTTAPISLCIDALFLAEASRFRVLPI
                     LWMIIVDMRAAAAATSARNEPMSM"
     CDS             complement(583425..583844)
                     /codon_start=1
                     /locus_tag="CSUB_C0611"
                     /product="hypothetical protein"
                     /protein_id="BAJ50470.1"
                     /transl_table=11
                     /translation="MRKLLIAAAATLLVATIIHTTSSLKLLLLIASATVFIIATTLTP
                     IHYRKAGWTETRATYLTLGVQTAASFISTAINTANILDTFQTILLFAANTYLLIRVIA
                     ESLAVNKTSNAAATASTLLGLSSYITYVISTLEALRT"
     CDS             complement(583841..584977)
                     /codon_start=1
                     /locus_tag="CSUB_C0612"
                     /product="hypothetical protein"
                     /protein_id="BAJ50471.1"
                     /transl_table=11
                     /translation="MSSASPSQLNSLRELRKRSLASDMAFFRKILSRPRAFASTMPSF
                     YGRLGEPKPLDQLKLLELAEGDTDVRACLDAVVDAVTANGWYVVGEENARKTVEEWLQ
                     RREDDFFFFLRNLVLTTLIFDEAYIECVSDFPRVIAPWTMQVVRDDYGVVKEYVQQTS
                     RVVRFSPDEIVHVVLHPLADRTYGTPKLASLARILLAKREAELFLFQVFMRKGVLSKA
                     IVLKHGDETTFNRLKAVLESARPGDNLLLMGEIDVKTLSQPVEDLRVVELLEEFRQRI
                     LAVLRVPPIVYGVVQGLNLETSRNQMTTFAQYIKSLQRIFGASVTLALKRIMGIDGFS
                     FRLVEWMNPEQETAMHVERVKAGIETVEEARRAMGLGTIGGEKP"
     CDS             584976..585227
                     /codon_start=1
                     /locus_tag="CSUB_C0613"
                     /product="hypothetical protein"
                     /protein_id="BAJ50472.1"
                     /transl_table=11
                     /translation="MELVYAFAGILLYILSGYLKSGEAFDPVKALRTAVVGLAAVVAN
                     MVLGVELPVPELETLLTAGEVTFVENLAKTLWRRVFSTL"
     CDS             585243..585872
                     /codon_start=1
                     /locus_tag="CSUB_C0614"
                     /product="phage head maturation protease"
                     /protein_id="BAJ50473.1"
                     /transl_table=11
                     /translation="MDAVRWITCIQVRPCLEKTLDDEVFAGYLEGVAATSDIDLEGDI
                     FSEEVFKANAANLVGKPILLQHGRSQAIGEQAVGQIIDAKHIPGKGLWIKAGIYKAFG
                     DVWRMVKNGFLRFLSIGGYVKRVRFHDKYREIEEAEITEVSLTHRAANPRAQIITVFS
                     KSWPTAPKSIVSGNEAIAKPAAQELDTPYFRKYWSRLGSHRIKQEPLHR"
     CDS             585877..586827
                     /codon_start=1
                     /locus_tag="CSUB_C0615"
                     /product="hypothetical protein"
                     /protein_id="BAJ50474.1"
                     /transl_table=11
                     /translation="MNFREAQQEYLRFGKALLSGDSNFPEIPPAVASDVFDTFIEESI
                     AAKVFRFITMGSDVVKFYVKGAALNVYAPTEASPVPETKLTFEPPVVLEAREVRAVSR
                     ISDVAEEESVVDLVAMTVEDMARSIADAVDKNVFRGAGDGSDAYNLFTGLRRSHTLPG
                     SQTQTLDIAKAPLTVEHINKAVAALGELGYRDDLVMIIHPKTALHLRNDLAEKGLETI
                     SGDILRTGEVNAIFGLKKVYVTTHLEKRSYSGSDGTKVSDVIVCSSRDAGVGGYRRAL
                     RIERDRDVEAGLTKVAASIRFAWRIAKTDAIFLIQNALAE"
     CDS             586866..587687
                     /codon_start=1
                     /locus_tag="CSUB_C0616"
                     /product="hypothetical protein"
                     /protein_id="BAJ50475.1"
                     /transl_table=11
                     /translation="MRYVSVKDVRLYNGWLPIEEKKQPLKKIGETVFQTPHAPLVDAD
                     WDGSVYDDVLVYLGGEHVEPESIDPSTGLISIHPPPSQGTSVEADYFWHPIGDEDIIL
                     AVEAAEGLVEALTGVVYVPHQRVERRRIERNGLVALSEPVITVQSVKLYDSFGNFLGE
                     AEATLVDRAAGILKIRVVSQEPRPPWYLPSYVEAEVEYVGGYESVPAIVKHAVLALSS
                     HNLLTRFQQRLALAPDYGGGVSTVFVAEDLEKRLRFLRNEVEKTVNSLPRRVEKA"
     CDS             587684..588052
                     /codon_start=1
                     /locus_tag="CSUB_C0617"
                     /product="hypothetical protein"
                     /protein_id="BAJ50476.1"
                     /transl_table=11
                     /translation="MTWLTSLVEQLVQTIRGEAGIPVYVGWRPATTLPMATLQIRNCE
                     ITPLDLSANIHLITADVQIDFWHSSAKACDETVEKTLAALEQARGSLGIFFLGVEGLA
                     DVGDEKAFRKMLLLRLKTVK"
     CDS             588285..589208
                     /codon_start=1
                     /locus_tag="CSUB_C0618"
                     /product="serine protease"
                     /protein_id="BAJ50477.1"
                     /transl_table=11
                     /translation="MSTALVKGLGNGFEKALSLVKFPEVADEFTGAGVKVVFIDSGCS
                     PEHPLKDCVNLTETSRIDTESHGAYVHAVLASMLPDAEFYLVKVPDPLTDNLLITALS
                     EASRLSPHVINLSITSEVPSDGTDPASTYVNHVARRSVVAVAAGNGGPKMMSIGSPAV
                     AEKALTVGAVDTRGRLWKRSSRGPTLDGRWKTEIVAPTGYKPPKSSEEVWGTSFATPI
                     AAAVAAHLNKRLNNPYTATRVMMLTAAPVNIVQAPATTLTGLRKAALIRKLVATWPRI
                     YDPRNLAGMGLVDAAAAAALLKQLAQTFSTL"
     CDS             589231..590121
                     /codon_start=1
                     /locus_tag="CSUB_C0619"
                     /product="hypothetical protein"
                     /protein_id="BAJ50478.1"
                     /transl_table=11
                     /translation="MVFRKLVTYGEETSYGQTPADVSRWIGGVTSFSGGVEPVSEEVP
                     TLSGSRVFQTLVHGLDVSPNMEFYVQNPRILKYAFGKVTNTGASPPYTHLLEIKEDYE
                     LPSITLVEHRLGAGGHGYVYNGCRVDKLSLSWEEDNFLKTSMDFRATRVTKTTALPTP
                     EEETKSFYSSSSKTVEINGVEIGYVVSGSVTLSNNIVAFPRQGDFHQKHVAGNAQLEA
                     ELELYYLDSSIVDLMIGKTRFDVKIRFSRGSDDYLEIRLDDCVCGVESVLEAEGEMMQ
                     TVSLKPSNMSILVVDDVEAY"
     CDS             590126..590482
                     /codon_start=1
                     /locus_tag="CSUB_C0620"
                     /product="hypothetical protein"
                     /protein_id="BAJ50479.1"
                     /transl_table=11
                     /translation="MSKQVPPPDELKKKTSPTELFKKFEEFEAFGHRFRIRRMTLAEE
                     LEWYGERDKILAENGFSQAEKLAKIWERLLQRVVESPRLENYVDELPTPVLARLIQAI
                     TELHLWNMDFRSSPQA"
     CDS             590628..590951
                     /codon_start=1
                     /locus_tag="CSUB_C0621"
                     /product="phage-related protein"
                     /protein_id="BAJ50480.1"
                     /transl_table=11
                     /translation="MIRVLGVEAASRGLEKLGEDAVKHVEKVLAAAAEECMSRARENA
                     PVRTGRLRESIAVSRQDKLAYVVEASAPYAGYVEFGTSRQRPRRYMQTALLQTLQTLR
                     RRLQP"
     CDS             590987..591550
                     /codon_start=1
                     /locus_tag="CSUB_C0622"
                     /product="nuclease"
                     /protein_id="BAJ50481.1"
                     /transl_table=11
                     /translation="MRVSPVTILAVFIIGFFTGYLVYSSTAPSPPTITKTTTAPTTIR
                     QTFTTTILSTQTTTITSSYKVGGKPVDLVATVYRIVDGDTFDAFPSGRVRLADINTPE
                     RNEPGYNEAKEALRRLVEGKQVFLDVDNVNVMDSYQRLVAVVYVQHNSTHVLNVNLWL
                     VTNGYAVFRDFNNEFNPSTWSLYLPFS"
     CDS             591817..594180
                     /codon_start=1
                     /locus_tag="CSUB_C0623"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50482.1"
                     /transl_table=11
                     /translation="MFLCFRDKFCVSELDNFFQRWVSVPLPNFSVKVLLEAEDNLAKT
                     LAYARSQLESFGDAGVREAGRLGSAFEVLGSALSRALGIAFYQAGAYLQNFLRGSIQA
                     FTEFEAAATRLASLTASAGESVNMLAYAFRAAASAAAREMSVSGAEAMKALEALVKAG
                     LSGADALQALRYSLALARIEGEDYGKAASNLVQVMAQFGVEGSRAAVAVDVLVNASRL
                     GIGSATDFAQGLANVGSTARAMGMSLQETTAWLVALERRLGSAEEAGTQLARLLINLY
                     EVAAKLGVPVRDSADHLRTASEIMLDIIARVRELGGDFEALQSRLAGVDTRAVKALFT
                     LSQMNESFTELVAGVSEAGTALRTFEEYLGTAEGRAAALRAETDRLQRMVGESLSAIY
                     YMVGPYVLKAFDAVVTAWRGIIAAAVDSRFDQRLAYIETQLRILGRISEEEASSFIRS
                     WVEMGDISLEEGLRIAEAVAIYDENIQTLVERARVAGVEVPDSFRQMADAVGSAVSDS
                     VSRMSELNLALGRVEQVVKDLGLASKGLAAGLDFYNVLKQVHEALGVAEPLTEEQAKS
                     MEYLAAAQSVVNYTSQLLSLQQQALQLYMMGATEAGNMLTAMMQGLSQALADGNITQS
                     EFIALLGTLGVNAGNVAGSLHGMLVKALETTRQAVEGNVSSVQSLINYLNTLNGQVIR
                     YTIVEERVTIHSSTGGGSGAEIVHETGGRFFEEYQRGAWYVPNTGPAILHEGEMVLPR
                     SVAEWFRRGGVSTVVNINMSVNFSGERGADAAEVLSRELVKRLRAAL"
     CDS             594177..596042
                     /codon_start=1
                     /locus_tag="CSUB_C0624"
                     /product="hypothetical protein"
                     /protein_id="BAJ50483.1"
                     /transl_table=11
                     /translation="MILEVYRGGGWVDFSDTVTSLRWRLESRSLEALEVDVLAHVEVG
                     ERVRLRRGSTILFEGVVYEVGRKHQRGDIARCSFTSHSDLILYDRHVVFREYPTGTTA
                     GAIIRDLASLEQGVDVTEVSEGPALTSNWSIENVEALKIMQDIAKATNHWLRMKPGKK
                     LLYKPKTTSSPTASIDMEKILSAEYSEDRWRLRNRVIYVGAGGEVLADVYTGLGDLPL
                     VVHDPFLTDSSEAMRRAQTRLNMASEYGRSLRLQMHQQIFSTLGLDLGDTVTVNLPSL
                     GIDNENLHILEIRYETDKLFYEVVLGGRLELLEDLLDEKFGGDPAARFGQRMSAAEAA
                     GNAIALSQSIAKRFTTQLIPRLFMTTYVPPIPYASGQNITYNDVGEVVLASGFTSGLF
                     TLEFMPSSENVEPKTLKFDYSSGGGGVTVNLKRGNGSVIKNSITSPYNFPYIPQRKTL
                     AEKDASKWNISGGTLSDSNISIISRYSLKAQGTAAMTLTYPATGSLAWNLSECSYFNI
                     YVYPYADTTIEVRALTNPSNYYSSQVTTSAEKFQKYVKKLSDFVATGTPSWSNINQLQ
                     IILPAGTYYIDFDHVFTAITYEKLVIEVNMNRPNASSTSPTFKRALLFWSEVTQA"
     CDS             596039..596707
                     /codon_start=1
                     /locus_tag="CSUB_C0625"
                     /product="hypothetical protein"
                     /protein_id="BAJ50484.1"
                     /transl_table=11
                     /translation="MSVTLRIGDVGRRCNLYWNIPVYNTSASQTGTWYTNSTSFVLAT
                     SGSININGFVNTLPNFYDTVRISYSFGHSVSSTGVGEAYMKILGVNGTTFSISSGSVT
                     QSETVHRNMPTNGVITWELWHRKLGATNYVSNPSLTIYLLNRNKTSIMAGELDIGQLF
                     VTGYTLNPQTTFIFDDNAFYMFSNESTTDTLTETFDTPVAVNKVSIIKPTSTSGGVLY
                     LIAV"
     CDS             596720..597265
                     /codon_start=1
                     /locus_tag="CSUB_C0626"
                     /product="hypothetical protein"
                     /protein_id="BAJ50485.1"
                     /transl_table=11
                     /translation="MFLDPESGLPTEAAKKLKALESENQLLREENSMLRARIELLESV
                     VQKTVDGALVANVKITPTRIEAQQPYTLTIGSTENPAAEIVTANITIPSTSSDKTDIT
                     EIDEQELASLQLPKPKKYRRGGRWEIGFLAEEMAPELRASDGGLDFKALVVCLAVKLM
                     SLERVVLGRGGVDELASKNRG"
     CDS             597237..597449
                     /codon_start=1
                     /locus_tag="CSUB_C0627"
                     /product="hypothetical protein"
                     /protein_id="BAJ50486.1"
                     /transl_table=11
                     /translation="MSWLLRTGGKKGGETDKPSETVMGVSCVVRSVGEDLVVEGRART
                     KRDADRLKRIIDEMLNEALGTGDETK"
     CDS             597433..598752
                     /codon_start=1
                     /locus_tag="CSUB_C0628"
                     /product="prophage MuMc02, terminase, ATPase subunit"
                     /protein_id="BAJ50487.1"
                     /transl_table=11
                     /translation="MMKRSDVVQLLLHAAGFDIRLHPWQKRFIDDPSRFRIILKHRGA
                     GATFTIAAEACAEALTHPASTILLISYSLRQSLEIFRHVRTILSRLENKRLKHGHSIY
                     RLAAKIGARTVELGNGSRIISLPNNPESLRGYRADAVYVDEAAFFRGDTNLKTAIMFT
                     TVARNGRVTLVSTPKGKRGWFHEAWTTDNTWSKHLVKLGDSPHITMHDLEELRKTMSP
                     LEWRQEMMCEFLDEVNAFIPYEKILECVEDYVPARVVGGRVYVGVDFGRFRDSTVIIA
                     VVEDGERFRVCYVEELRQKPFAAQLEAINRANMVLHPAIVAVDSTGMGAPLAETLAKT
                     IPHLQPITITSSTKQTLVNNLRNNILNKKLIIPADEKTLINQLRLYQEINTGHSIKYE
                     APAGEHDDYVMALALACYAAQTTQAQKTEASLFWRWSSAPQLSAEKQ"
     CDS             599051..599896
                     /codon_start=1
                     /locus_tag="CSUB_C0629"
                     /product="oxidoreductase"
                     /protein_id="BAJ50488.1"
                     /transl_table=11
                     /translation="MEKKHLGKSGEWVAAIGLGTWGIGGRETPDYSQDDQAIEAIRYA
                     VELGMNHIDTAEIYGGGHSEELVGKALKTIPREEVFVATKVWPSNLRYDDVLKACRRS
                     LERLQLKYVDLYMIHWPNPRIPVSETMHALEKLVKDGLVRYIGVSNFDVPLLQEAMEA
                     CRSEEIVSNQIIYSLENRENEREVIPFCEKNKITVVAYTPLGKGRIAAEAEKNTERGR
                     ALATLAKKYGKTPTQVALNWVIWKPHVITIPKAIRREHLEENAGGAGWRLAEEDYQLL
                     SRAWR"
     CDS             complement(599893..600765)
                     /codon_start=1
                     /locus_tag="CSUB_C0630"
                     /product="ABC-2 type transport system permease"
                     /protein_id="BAJ50489.1"
                     /transl_table=11
                     /translation="MREILGEIGVLTMREVRKWLRSPFLMFFTLVQPVIWMGLFGKAF
                     NITGFLRIPEEMLQNLPPYVTSQLAEIFNNVMTRFFGTADIDYFSYIAVGMLSITVLF
                     SSMSSGMGIAWDRRLGFLNKLLAAPIWRGSIIVSKVLSGVLRAIMQAALLLLVALAFG
                     ARFHVLFPLGPLAAFAALFFLALGLTSLFIALGLRLKSWESQAAVMNLLNLPLMFASN
                     ALYPIALMPSWLQAVAQANPISYAVDAVRQSFILGSAANTAALLTDLTVTTGFGIGLL
                     MLSAYLAGTALQKS"
     CDS             complement(600762..601760)
                     /codon_start=1
                     /locus_tag="CSUB_C0631"
                     /product="antibiotic ABC transporter ATP-binding protein"
                     /protein_id="BAJ50490.1"
                     /transl_table=11
                     /translation="MMASIVVEGLVKKFGDFTAVNGVSFSVGEGELFGFLGPNGAGKT
                     TTINILTTLLKPTAGKATVAGYDVSTHPHEVRKQVGLVPQELTVDDDLTGMENLMLQA
                     GLYHIPRSEARRRALELLDLVGLREFADKRVETYSGGMRKRLDLITGLLHEPEVLFLD
                     EPTLGLDVATRAAIWDYIRRLRKETGTTVFLTTHYMDEADSLCDRIAIIDRGVIKAID
                     TGEGLKARLGGDIIELELVENGLDAVRLLEGVEGIRRVYLDGGVYRLTVERGDKTLPH
                     VLEVLIQRGVSVKRVSMKRPSLDEVFLEFTGRKLREESGSWEETFRRRMVLRRMRA"
     CDS             complement(601757..602281)
                     /codon_start=1
                     /locus_tag="CSUB_C0632"
                     /product="transcriptional regulator, PadR family"
                     /protein_id="BAJ50491.1"
                     /transl_table=11
                     /translation="MFLCRVFILVVFRYIVMRRIWPSHGQFFAMKRGGIRLLILRALS
                     QRPMHGYDVAKEISRMFGGLYEPSAGTIYPTLQWLEDEGMVATEVVGGKRVYSLTEAG
                     ARYLEENRDKLEGLMSLWNSECGSEKMELLKTGRRLAQAFMIVMAENDAEKLRAAAEI
                     LEDARRRLSELVMR"
     CDS             602477..602785
                     /codon_start=1
                     /locus_tag="CSUB_C0633"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50492.1"
                     /transl_table=11
                     /translation="MSSTIKVAKQTKEMLVRFAATLQKRYGRRVDLDEAIRHLLLRQE
                     KKPEVLDSIIGSVPMMSTAELYEERRLDEEKSASVPRELYTNVLKVSTGVMGQVFHRR
                     "
     CDS             complement(602864..603253)
                     /codon_start=1
                     /locus_tag="CSUB_C0634"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50493.1"
                     /transl_table=11
                     /translation="MVLDENVRRIVRGRNFGFLATVNGDGSPQVSPVWVDEADGYVLV
                     NTAVGRVKERNTRRDPRVALAVPDWQNPYEYAYITGRVVEWVTGPEAEEHIDKLAIKY
                     TGEKFKWRTPGVKRVILKIKPEKAGIY"
     CDS             603513..605006
                     /codon_start=1
                     /locus_tag="CSUB_C0635"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50494.1"
                     /transl_table=11
                     /translation="MGDVFTVSNTSLGKAILDAASRYSVPTILGGLAEKILPHLLNPT
                     RLTDLAQLTGLSESALRKTLTTLMERGAVKREGWHYRLADDETLQRLAQLLKEKNLLK
                     KVEPNASILYTNSFIIKAVPKGEKALGELTAFSRFPQYGVQFLTDRDYYVYPPTKIGP
                     EKVLVHALLSSKSSYERSMCALFFLVNRTRIDIFEARKTAKHTPALGLLLDLENYVAG
                     LPVSKPELFLPWNEFSDLCAVYGVKVEPAPSAVEIISNIEGWARKLKESVTAYLLGGV
                     NMVLRQIKSSTKDIDLLVENSREYELIAEALQASGYEKAVEWSPGDRDAGPSNIFIHP
                     TMLRVDLFTSKVGGIPVSDTVKARASSGMSLGKLRLMLFSLDDVAYMKLLTTRERDVS
                     DAAEIIRRHGINWETFREEVEKIPPDILKRKAFVILENLDVLRMSYGLRIPRKLYSWL
                     RRMAIDSGIKEFWKRGVDNASIIARDMGVHPSYVRRKLAELRRKRQV"
     CDS             complement(605003..605734)
                     /codon_start=1
                     /locus_tag="CSUB_C0636"
                     /product="nucleotidyl transferase"
                     /protein_id="BAJ50495.1"
                     /transl_table=11
                     /translation="MKPVVLCGGEGSRLRPLTYYFQKTMIPVGREQKPLLEYILMHLK
                     AYGFSEAVLLVGYKGEQVVNYFGDGERVGMRLTYVWDREDAKGTCGALLNALREKAFT
                     MDDTLLIYYGDILTNLSLSELVEQHRREKATATLAVSPRYQLPVGVATIENNRLTEMR
                     EKPFININVTIGLLVLEARALAYAENASDIMSDLIPRLIEKKEKVAAYITEAFWYDVG
                     STEKYEKLTHEIVEKYLEGLYQTSR"
     CDS             complement(605929..607140)
                     /codon_start=1
                     /locus_tag="CSUB_C0637"
                     /product="iron ABC transporter ATP-binding protein"
                     /protein_id="BAJ50496.1"
                     /transl_table=11
                     /translation="MGLMRVFSLSAGYGGVPVVSDIDLELLAGEFVVVIGPNAAGKTT
                     FLKTLAGLAKPVTGVIYLAGEDMRVLGLRQRARNVAAVLTGRPDVSGMLVEEVVGLGR
                     YAWTGPLHMLAPVDKKVVDDAMAKTGVAHLRGRRVSTLSDGQLQRVLIARALAQHPRV
                     LILDEPTTHLDAKSRLEIITLLHSLAHRENLTVIASTHELELALRFADRLILIADGKA
                     IMADDPAELIKDQRFIKAFGLADGVTLSHTTLSIEYRPHRNTGVAPVFVIAGAGTGAA
                     FYRLLLKTGYDVATGVLHENDVDHHVAASLGLDIVSERPYTRISWEKLNQAEEKMCNA
                     SAVVYTSPPLGEQNMGNYILLEKAIEHGLPTYVVGGVHSGAETIHTPRELVAKLNTGL
                     RKRGLEAFSSP"
     CDS             complement(607131..608132)
                     /codon_start=1
                     /locus_tag="CSUB_C0638"
                     /product="iron complex ABC transporter permease"
                     /protein_id="BAJ50497.1"
                     /transl_table=11
                     /translation="MRGWAFPLLSTALFASFLSSVFLGSVRVPPSDVLMYLLGWRGEV
                     HVFDVVVDMRLVRGVAAVLTGASLGVAGAVLQSLFRNPLADPFVLGISSGSSLAIALT
                     LVAGLGAGLIQAYDPYALYMAAAAGAALTSLAVVIFSTIAKTAIGLILAGVMLGYLNA
                     GLTTLLVTLSPVETMRAFSFWTLGTFSAAKWSLVEPVLPLFAVGLVASLLVAKPLNAL
                     AFGEEVAASMGAWVRGARVAAVAASSAVVALATVVAGPIGFIGLAAPHVARLLAKSVD
                     NRVVIPLSGLAGATLSITADIAARNIMPPLDLPLTAITSLFGAPIILLLLLRGGKWG"
     CDS             complement(608133..609371)
                     /codon_start=1
                     /locus_tag="CSUB_C0639"
                     /product="iron complex ABC transporter substrate-binding
                     protein"
                     /protein_id="BAJ50498.1"
                     /transl_table=11
                     /translation="MDYPTNIMNKTTTILSILIIIGLVGGFLLGQSIAQPVVRTVYVT
                     SVETRVQTTVETRSIATTVTEVVERHGPEVRYAKLFALENRGGYVLLRDGLNRTVLAV
                     PRDAPLPDLRVDLVVRTPVERAVLMSATHVALVERLREYEPELLGRVVGLMWGGSYAW
                     FFPEVDRLLQRGVISDVGAAWSPDFERLVALQPDLVMIYTYPGDPVVSKLEELKLPYV
                     VVSEYLEDDLLGRFEWIKFVSVFFGLEDVADKVFSYVEQSVLLTSLRAKALVAHGVPA
                     PKVVWFSVYRGTVYVAGGGSYVAKALKDLGASYVFSDIASSGSATVTPEELVARALDA
                     DVIVLSTDLITTREDLLKELPQLAESKAFRENRVYRYSSDIFQLGYYASEEWFRDLAK
                     MLYPGAFDGGGGPRFFVEVR"
     CDS             609443..610279
                     /codon_start=1
                     /locus_tag="CSUB_C0640"
                     /product="molybdenum hydroxylase family protein, medium
                     subunit"
                     /protein_id="BAJ50499.1"
                     /transl_table=11
                     /translation="MKSVNEVFLVPETVNKALQLKRLYRDSALVVSGGTASVQLVTKM
                     LVSPTAIISLEKLPLNYVKKKGNTIEIGATTTAAEIIESGEVPTCLLEAAKGIHGLAL
                     KQNATIGGNIFTPAPGGDMATALLSLDAQLILNSTQGMRTVPLAKFYKGPLTYNIRSN
                     ELLTAIRIRNPPQHSMFMKQTFYRYGGQTLASVSVALDSVDKVKRVGVAVGGLTPHPY
                     RASKVEKMLMGQKISKELIETTAQNIVEEASDTGLVSGEYLSHLAGVLYKRILTRLTS
                     SR"
     CDS             610287..610742
                     /codon_start=1
                     /locus_tag="CSUB_C0641"
                     /product="molybdenum hydroxylase family protein, small
                     subunit"
                     /protein_id="BAJ50500.1"
                     /transl_table=11
                     /translation="MMIRFYLDGQLVEVDVKPTDTLLKVLVDKLGITSVHYGCGEGSC
                     GACMVMVDGKLRYSCLTFAASVNDKKITTVAGLLSDHELSPLQKKFVENNAAQCGYCT
                     PGMVLVAKALLDKNPSPSDEEIFDALAGNLCRCTGYVPIVKAVKSAARR"
     CDS             610739..612094
                     /codon_start=1
                     /locus_tag="CSUB_C0642"
                     /product="molybdenum hydroxylase family protein, large
                     subunit"
                     /protein_id="BAJ50501.1"
                     /transl_table=11
                     /translation="MNMATYSVVGKRVQNTSIINHVTGATQYIDSISFPGMLWIKAVR
                     SPVPRGKIKKIDYSKAEKLPGVAKIITAKHVPNNYHVNLAGLGVGPPDEPVLPEDEVN
                     YKGEAICLVVARDEETAAKAANLVEVDIEELPPVLDMEEALKPGAPAIKKWGSNVFMF
                     GGGTDGATPPGSPKRPYFLVKRGNVEQAFANAYEVVEGSYMIPPIEHAPLEPHICVVK
                     PEPSGKLTIYTPTQSPYFVRDNVATILNIPASNIRVVSPHVGGGFGGKVDPEFEMQVA
                     VAAMVVGRPVKWRWTREEEFTVSTTRPAVKIELKDALSREGRILGRKARLLHDAGAYA
                     RTSPYGVIKSTVNLSGPYNIENLRYEGYCVFTNRQPSSAMRGYGVFEVSYAVELHMER
                     AARKLGIDSWEFRFINAYRNNQVTATGRPVDDAYLIEVMKEAAALAGVKLPPHLLQLS
                     S"
     CDS             612106..613116
                     /codon_start=1
                     /locus_tag="CSUB_C0643"
                     /product="molybdenum hydroxylase family protein, large
                     subunit"
                     /protein_id="BAJ50502.1"
                     /transl_table=11
                     /translation="MAKLRGRGIAAINYPTGMNLGGDPSQVVIVAQPDGRLVVNVASV
                     ELGQGIKTVLAQIASEITGVSVEDIEVRFGDTESAPHDTGTFASRSTHRMGNAVVKAS
                     EEIREIVLNTAAKMLEVSPRDLEIREGRVWVKGVSDKSVEVKQVISQAQFTYNTPVVG
                     KGFYVKPKSSVDPETGASDPHSTMAHGCTVAEVEVDTETGFVTVLKVYTVYEVGKAIN
                     PQLVESQIIGGIVMGMGAALTETVYPRYPALDFQTTSFRDYILPTAGDIPEIVAKIVE
                     SPTPTGPFGAKGVGEMVVNSIAPAIVNAVYDAIGVQITDLPITPEKVLKALKQKEAAA
                     KS"
     CDS             613143..613955
                     /codon_start=1
                     /locus_tag="CSUB_C0644"
                     /product="metal-dependent hydrolase"
                     /protein_id="BAJ50503.1"
                     /transl_table=11
                     /translation="MSEIVINFIGHASFSIKWRNEVIYIDPWLKTPLESGAGNSPVSP
                     IGLEDVKNATVVLVSHGHIDHLGHAIEIVKKTGACLVCTPEVGMYADIYGIPYDSEPD
                     EKAGRKYWMYPINVGGSCTINKVTYTAVPAFHSSSIMHYDYIKNKTRYPDAPVGYIIS
                     PEDGPVIYFSGDTGVSMEMHMIQELYSPEICIMTAGGQYNMGVREFAYACKILKPKLA
                     IPCHYDTFPRQRLDKEKLKQAVSVMSPSTKLVFLNPGESLRYAAEHSWVVER"
     CDS             613955..614335
                     /codon_start=1
                     /locus_tag="CSUB_C0645"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50504.1"
                     /transl_table=11
                     /translation="MSMELEPFYELEAQIVRTEEIGETPYGRRSNFHMKGVVKGKING
                     TYEGIDYGTIVKTEVGDVVYVYVRETITTDRGIISGIRQGYAVPTQGGLAVRLFIFFH
                     TQIPEYRFLNWTLGVAEGKAGPKA"
     CDS             complement(614332..614889)
                     /codon_start=1
                     /locus_tag="CSUB_C0646"
                     /product="hypothetical protein"
                     /protein_id="BAJ50505.1"
                     /transl_table=11
                     /translation="MTQVPPWWRVYLEPKPGWDTDDYEEVLKELEKRPPNRQLLSPIL
                     AGFIAGVVQGNGSLGYLKVLQNPETYTPFTEIKCDVETLDFIVRQINDGWGFADRGGA
                     RLVVLGLRCVLLLKIIGPYLRGWKYRAYDAIVANGYKVSGQVLEKILQSYELDYGLRT
                     VSIEGKKFRMYVFREKLSKQGDLKP"
     CDS             complement(614896..615987)
                     /codon_start=1
                     /locus_tag="CSUB_C0647"
                     /product="maltooligosaccharide ABC transporter
                     ATP-binding protein"
                     /protein_id="BAJ50506.1"
                     /transl_table=11
                     /translation="MVSVEAKGVSKFFKTTRALDNVSLHVDDGSFFCLLGPSGSGKTT
                     LMRIIAGLETPSSGSVYFGGEDVTELSPSERNIAMVFQFPSIYPSLNIYDNIALALRR
                     ETTDRNEIRERVMQVASLLKIEEHLNKKSHQIDFGILQRVSIAKAIVRRANVYIFDEP
                     LSNLDTKLREALRSEFQRIHSEVRGTFLYVTHDQLEAMAIADKIGILNNGKLLQVGSP
                     EEIYSYPANKFVAYFIGSPTINLIESEVKLVENIVYASVGDGHIHLGNKALELFQTSR
                     EPRKIILGIRPHEITLSREPVGNALPAEISFIESLGTAQVIELRNGSTVLRSYVDSLS
                     DFREKEKVFAVFNTESIHGFDPQTEERVF"
     CDS             complement(615993..616256)
                     /codon_start=1
                     /locus_tag="CSUB_C0648"
                     /product="hypothetical protein"
                     /protein_id="BAJ50507.1"
                     /transl_table=11
                     /translation="MNLKNIIERIGLALSFAGLALLFQPFMDKLLLYGFIIMSIGGFM
                     YVYTTYIPDEANGKTMAKWLVVLVGTVVFFVALSIYLVPILVV"
     CDS             complement(616257..617339)
                     /codon_start=1
                     /locus_tag="CSUB_C0649"
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="BAJ50508.1"
                     /transl_table=11
                     /translation="MTRVEVKSLWKSFGKVQALRGVDVTVESGDIVALLGPTGAGKTT
                     LMKCIAGVERPDKGDIMFDGESVVDTPPWERNVAMFFQTYALYPHMSVYDNIAYPLRE
                     RKMAENEIKDIVHRVAEKLRISHLLSRKEPATLSGGEMQRVALARALVREPRVLLLDE
                     PISNLDAKLREEMRAEFKRLHRELKRTLIYATPDYLEAFAVAEKIALINEGQVIQYDT
                     PINILRNPRNKFVATFVGSPTANILRGVIKLGKDAIFLDTGEFQLTLNKTGLRNIDGK
                     EVEVAIRPADVVLEPVHGQNLLIAKVVSSERLGTHTIVTVKVSGIEMKTVVKGMKTYQ
                     YGEEVKIGINGNKPLLFDAATGEVLG"
     CDS             complement(617340..618248)
                     /codon_start=1
                     /locus_tag="CSUB_C0650"
                     /product="multiple sugar ABC transporter permease"
                     /protein_id="BAJ50509.1"
                     /transl_table=11
                     /translation="MANNNRRGNRKARKIIKSIATYAAVIVTVGFFIFPLFWLIATSL
                     KTRAQAFSTPPLFIWEPTFRNFIDIFLKRQTEIEAITGQELELATGAEIFFFNSFVVT
                     SFSIALAIVIGVLAAYSFSRYKPLGTNTLMFFILSTRMLPGIVVAIPIYFFYRSIGLY
                     NTYLGLILLYTMFNLPFAIWMMKSFFDDIPKDIEQAAFVDGSPPLRVFRKIALPQVAV
                     GLGATIGFLIINVWNEFLFALLLTERTTRTVPVLIASTRGEVGINWGLIAAIETLYIL
                     PALVLIFLLQRYLLRGMTFGTVRGGQ"
     CDS             complement(618251..619126)
                     /codon_start=1
                     /locus_tag="CSUB_C0651"
                     /product="multiple sugar ABC transporter permease"
                     /protein_id="BAJ50510.1"
                     /transl_table=11
                     /translation="MGRRDLRPLSYRTFPVILITPAVALVIFLVIFPLIWALGLSFYS
                     YNALRGDPPVYVGVDNYSRLLNSGEVWRRFITTGQFVLYAVVLEFLVGFALAHLFYTK
                     FKGRRIAITLVTTPLLIAPVAVGIFFRYIYDATFGVFTYFAELLTGQRVRMLSQQPML
                     AVVFMDVWQWSPFMMLFILAGLEAIPKHMLESSEIDRLSWINKFRYVVWPKIKPLVAL
                     ALLFRTMDAFRTFDTIFTLTGGGPGTLTEVLSITIYRTAFQFFRTGEATALAFIFLII
                     IILLTNLYLRLSRRE"
     CDS             complement(619162..620838)
                     /codon_start=1
                     /locus_tag="CSUB_C0652"
                     /product="multiple sugar ABC transporter
                     substrate-binding protein"
                     /protein_id="BAJ50511.1"
                     /transl_table=11
                     /translation="MNLEKYNVTRRKALSTGAKVATAAVVTGVVGGLAGYLAGTSGQQ
                     AATVTRTVTAGGGGQTVTVTNTVTNTATVTSTVTRTVTGETGPITPEVSLTFASPEWL
                     PGRLTGLIAQDFPAWSKANIGKAVEVKMDLIPWDVIFERLSTTLIARSKEPTLLISDS
                     QWLGQFYVGGHIRRLNDYIARDPELQQLLNRFDPALVYFYMTFPQGNYNNIVGFAHEG
                     DVLLFVYRHDLFTHPTERENFKAEYGYDLPANYEDWYPNQLDWYQIRDIAKFFTRKAG
                     DELAGKRLEEDFYGIAVHMSRAYDAIACPFGSMLYCHGEYWWDPETGEVDGYINSERA
                     VKALEFYASLVQYSPPNALEIWFDESNAVMQAGRVAMIYNWAGFLPSLFDPAASKVHN
                     LIRVVPPPGHRGDDGIFRRYSGIGGQPMCINAYSDRVVEALAFIKYWFQPQNQRKWAE
                     GGGGVCIKDIVQTEWFRNLTPYNRAYADSIPFQVDFWNVPFFAEMLTAVQEEIHSALA
                     GAVSPRTALDNLARRHKEIIERENYPQAFAQYGKPAKNVAQLIRQGLPIS"
     CDS             620927..622405
                     /codon_start=1
                     /locus_tag="CSUB_C0653"
                     /product="aldehyde dehydrogenase"
                     /protein_id="BAJ50512.1"
                     /transl_table=11
                     /translation="MLVCVVGFMASVYPCIINGERVQAGGLGVFEDRNPADVEEVVAV
                     FPLLSREDAKNAIDSAEKAFEKWAALSPLQRGKYLVKAAQIMENEAEELARILTREEG
                     KTLNESRAEVARAIDIFRFYGVMGSRLRGEFTPSTDPRTHLFTLREPLGVVSIITPWN
                     FPIAIPSWKIAPALICGNTVVFKPASYTPLIGYKIVEALHSAGIPPGVVNFVTGSGGE
                     VGAELIINDKVDAISFTGSAEVGEEIKQYACRSNIRVQLELGGKNPSVVLEDADLGKA
                     VEMVTRAAFGLTGQACTATSRAIVVEKIAKQFEEKLVERVKQIRVGNGLADGVEMGPV
                     VGEKELKKILSYVDIGLREGAKLLIGGKRLTSSEHAKGFFLEPTIFTNVTPDMKIAQE
                     EIFGPVLSIIHVSDFDEAVEVANKIDYGLSASVFTTSLPRAFEFIHRVQAGVVKVNKP
                     TTGLEFQVPFGGYKRSSYGDIKEQGETALDFYSKLKTVYLGY"
     CDS             complement(622380..623306)
                     /codon_start=1
                     /locus_tag="CSUB_C0654"
                     /product="fumarylacetoacetate (FAA) hydrolase"
                     /protein_id="BAJ50513.1"
                     /transl_table=11
                     /translation="MKIARIMVPRLGKRLAIVDDEEALVLSNPRYGGPRGFLTLFKEA
                     QSKKVSIEQYVRDVVKKDRRIRRVRLPQQLGEVDKSPRLLIPLLPPEVWGAGVTYLRS
                     REAREYETVAKGIYDRVYEAKRPEIFFKATPSRCVGPGEDAFIRSDTNWSVPEPELAL
                     IIGPRHEILGYTIGNDLSARDIEGENPLYLPQAKIYRGSCALGPVISTQESVGDAKNL
                     TITMAIYRGGEKVYEGSTSTARLKRSFEELIHYWVLDNVIPAGSVLLTGTGIVPPDDF
                     SLQDGDVVEIEIEKIGVLRNRIRRLSSRGKQS"
     CDS             complement(623313..624275)
                     /codon_start=1
                     /locus_tag="CSUB_C0655"
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="BAJ50514.1"
                     /transl_table=11
                     /translation="MTVLVTGATGFIGAWVVRNLHQKGVKFILSDIRFDTSRLKYLID
                     NPESLPFTTLDLRNASDLDKVLRKHDVERIIHLAALQIPQCRADPVNGGLVNVVGFLK
                     IFEAAKKYGGVKNIVYASSFAVYGPQELYGEKPLNEDAPLKPTTHYGAFKVCNELSAY
                     AYWVENGIPSVGLRPHTVYGFGRDVGVTSDVTTALKAAILKKPFKIRFGGKVSMQYAA
                     DVAESFVAAAFANPSGAKVYNLGGPVVSVSEVVDTICKIVPDACDLISYADSPLPVAY
                     AVDDTAFRRDIKDMHYTSVKDGLMETYQIYQRVKAAGELALPQQ"
     CDS             624368..625123
                     /codon_start=1
                     /EC_number="4.1.2.-"
                     /locus_tag="CSUB_C0656"
                     /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
                     /protein_id="BAJ50515.1"
                     /transl_table=11
                     /translation="MKEKLRMGKQCVGLFATIPSPAIVELAAVAGFDFVIIDLEHGVI
                     DYETMENMVRAADVHGLTAVVRVPESFEDAVLKALEAGAHGVEIPHIGSAAEAEKAVK
                     AVKYAPEGMRGVSPYTRAAWYSSVSPREHFATSNRETMVVLQIEGVEGVENMEAIASV
                     KGVDVLFVGPYDLSQALGVPGDVDNEKVLAALKKLVQICMQKDVSAGSFAPTIEKARQ
                     LISQGVKYVAYSVDTGIIYKSFKQAVDEIAGKS"
     CDS             625177..625941
                     /codon_start=1
                     /locus_tag="CSUB_C0657"
                     /product="hypothetical protein"
                     /protein_id="BAJ50516.1"
                     /transl_table=11
                     /translation="MVLETRIDVVDGVEIDGAIFIEGSPTAGAAGILAVNYLREVFDA
                     VLVGEIVSPHFPQISIIDDDGIASRPKLELYLVNLKGLRLLLLSRVFPVESNEGSYEL
                     ASKLYQFLSRHNVNEYLVLASGRVTGDGSVFVSTTSLDQSKALLDAGAKRSPSLETLP
                     VDRVSGFLMLFFARDGKKVSMLFSDSASYIPDHLAARRLLEVVSRYLGIEVDFKALDT
                     EIEKQAKAMQEVEQLGLTGRKIASDEKPSKEPFYIG"
     CDS             complement(625954..626193)
                     /codon_start=1
                     /locus_tag="CSUB_C0658"
                     /product="hypothetical protein"
                     /protein_id="BAJ50517.1"
                     /transl_table=11
                     /translation="MALIQLVFAVALALFSITVAINILNRVTKDVNEFEEIRKKNLAG
                     AYMLFGTFVAISLVISQGVSFLSEPIASALASLLS"
     CDS             complement(626270..628486)
                     /codon_start=1
                     /locus_tag="CSUB_C0659"
                     /product="hypothetical protein"
                     /protein_id="BAJ50518.1"
                     /transl_table=11
                     /translation="MGKKGWGVSLLLMVLLTIYPTTADPAYGLLRTYVFDKTLLSGAI
                     DIEVDDGGIYIVGYTASDSGLPSSSLTILEPDHSHRCSTMIEFPVDPSFVFGAATAVE
                     ANETHVLVAGTYWTSRLGDIVVYVAAFLKSDCRLTGVYRFYVTGYEEIGLWPFLYGEG
                     VDLAVDETGVYLLVGLFMPENWGFLVMRLDQYLQPGPYDFYYINNPRTDFALSIALGD
                     TSVYVAGVTDFNQLGRNEGLNVFILELDKTSLTSSNVTLIQPVEEYFPNLEIVVDENN
                     DIYLIQTSQKYRANNGIVVDKFDRRMNSLWRQAYAVWNVYMDSTREHVPEWFTFGVAA
                     AVSRSHLFIVGYILNDYLGSGNEAPYHGLLLAVNRVDGEALFGFRIRARESPGFNVLG
                     TGVDTYGDCVYLAGASANYRLEYVFLDVFNVTFPLLASPGSSTSLGLKPDERFDSFDE
                     TIWDPVFDQDLGATRYAFYGVFCPGSFIVATTTTSTSTVTSTSTVTRTATSTSIIPST
                     TTLTMTRISRFTETTTSTEIVRQTATVPSIVYTTQTQYSTERVSQTVFETVRTTVIDR
                     MQAPQIITVYDGAAATTATVFRNTTTTATLQLTTTVEGEVNWLELPPWFYLPFLLLPI
                     PLIAVLFDNRRVKIIINKSDGPLTVWSQGSGPLVEDIYMKPSVASVKKGAKITFVNKD
                     NVSHVIEAYEGPAEYLFVSEEIKPGKKWRYKLEAPGVYRVRSMTKPYMGCIIRVED"
     CDS             complement(628557..630668)
                     /codon_start=1
                     /locus_tag="CSUB_C0660"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50519.1"
                     /transl_table=11
                     /translation="MAGTGLSVGRVLSGLRRVDRVLGGRHRLAELGILLLLLSTAFVL
                     RVLPLRWGVALSEFDPWVQYKEALFVIERGWGGFSEFFNWHDTMSWYPWGRDMGRTAF
                     PGIPFAMAFIYLTLKSLGITVDTLELAAVLPVVYGVLTVVAIYFLGKRVGGTSTGLAA
                     ALFMAISTAHIGRTHLGWFDDESLSLPLMLGGYIFYLAAISEKRSLRGTVVFSLLSGL
                     FLGFMAASWGAHKFPLAFIPLFSVFLAVIGRYRRSLLVATAVAFAIYTSIAVSVPKLG
                     PGYIREITIFSGFIALFILGVFEAASRIKQPETRRLTIFTVLLLSAVGFFALLGLGVL
                     GVPGLKFLSVILPGLRDALPIVESVAENQVPTWSIMFSDFGLTLALVPIGVYQLIKTR
                     RDPDLFIVLFLLFSAYFASSMVRLSLLASPAVALIAGHGYAFVFSRLGDLIAQRRVSK
                     KRGEEVNIGLAAFTPVLLVLLLLISIVPSVYGGLGSRVTLSPIDQGYQPATIVTSSFP
                     ARQSVPDWVRALAWMRDNLPKDAVVASWWDYGYWITILGERITLIDNGTINSTQIGDV
                     AHAFMSDERTAMEIFRRHNVTHVVIYVTHQFVVQGGQAYGRLLGFGDEGKWIWMLRIA
                     NQTGHFYRESDYVDQNFQPTQRFWQTLLGQLIPYKPTQTAFGPGHLYNPSQLNYFRLV
                     YQSSPPYQSLAYVYIYEVIYP"
     CDS             630794..632509
                     /codon_start=1
                     /locus_tag="CSUB_C0661"
                     /product="hypothetical protein"
                     /protein_id="BAJ50520.1"
                     /transl_table=11
                     /translation="MKTSLAVFLLTALTLVGMLSVSAEVVSFRRSYGGSADDITMDIY
                     VDSNGIYTVGVTSSFGPNTPNAFLTIFNSDNSHRCSVALDLGSAEEARALTVYGGRII
                     MLGETSFGPTPPNHFVALFDANCNFDSLKLIDIGPGEEVTDIAVDPGGGPAFYIVGYQ
                     IGSGAYVSKLDSGFNVVWAKTFRVRGGDDVANAVVFSAGRVYVAGTSNDGSSLEMFVS
                     VFDINGNHLATREIGGAGNDEAHDIIISGGNIYLAGKTVIAGRMDEAVLARLDSSLAL
                     QWVRAFGTSTGNEIAYGLAAAGGTIYLAGYTTGYGTRDVLLAAFAPDGTFSHSFFITG
                     GPTGDDQANAAASLGACVYLAGQHVNLPLFYVINDLQNAQATSVSLTVEAVTPSVANL
                     SPSSISPPPSIATYTPSIDTPGAINSFYSRFCPDNLVSTSTTTVTSTVGTTTTATATA
                     TTTTTAYAIATTTITQTSSVILVSTATSTTTIPVTTTQTQTQTTTNTQTVTTTTTATT
                     TSTALTTQTQSTTQTLTQITTVAFPEPVSTYILPMLLILIAVLIATAIIVGRRRQPQP
                     QQPTF"
     CDS             complement(632598..632999)
                     /codon_start=1
                     /locus_tag="CSUB_C0662"
                     /product="translation initiation inhibitor"
                     /protein_id="BAJ50521.1"
                     /transl_table=11
                     /translation="MHTIMPKKVVFTNKAPRPMGQYSQAVKAGGFLFISGQVAINPET
                     GKIEEKDVRGQTRRILQNVKAIVESQGGSLSDVVKVTVYLSRPEDFQDMNEVYSEFFT
                     QDPPARATVAATIPGEGALLEIDVIAYLGDR"
     CDS             complement(633023..634156)
                     /codon_start=1
                     /locus_tag="CSUB_C0663"
                     /note="metallopeptidase family M24"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50522.1"
                     /transl_table=11
                     /translation="MPWSEGPRLRWRRLLQWMERQQLDMVVLGSQKNIYYITGYITAR
                     IFMPAFLFIPIDGEPLLVTGKSDSEQAAKTFGGEIVEYVNYNLDNVMRPYPIHGVEAA
                     VKTLRSRQPKIKKLGYEGWALDAVILHEMLKMYPTAEFTDVSENILLMRKSKDEDELQ
                     NLREAAKLNDYAYRVAKENTTVGRSEAELYTIIHSELVKKKSGFQFFSGDFVSGERCL
                     QIGGPPTNRRLQMGETLILDLWVTHQEYWSDTCRTFVVGSVPSALQKKVFEVLKEALK
                     AGEAALKPGATGSDVYRAVYGAIDRHGYGKYFPHHAGHALGLEAWEPPYFIPGDKNII
                     TENTVCALEPGIYFGDVGGVRLENNYVVKRGGVEVLNEFPLDP"
     CDS             complement(634240..635331)
                     /codon_start=1
                     /locus_tag="CSUB_C0664"
                     /product="maltooligosaccharide ABC transporter
                     ATP-binding protein"
                     /protein_id="BAJ50523.1"
                     /transl_table=11
                     /translation="MVTVKLDNVTKRYGNTLAVDGVDLEIKDKEFFVLLGPSGCGKST
                     TLNMIAGLETVSSGNIYFDDQLVNDVPPEKRDVAMVFQSFALYPTMTVFQNIAFPLRI
                     RGYDKVEIMRRVRETAEMLRIVHLLEKKPHELSGGEKQRVALARAVVRSPKLFLLDEP
                     LSNIDAKLRVYMRAELIRLQKDLKTTTIYVTHDQVEAMTMGDRIAVMNAGKIMQVGEP
                     MEVFKKPANLFVAGFVGSPPMNFFECSARIEGTNAVLDCGFFEVRLDSQYAEALSRLS
                     GSELVLGIRPHHIKIFKNKEPNTTFDGEVFAVEPLGTETVVDIRVGDNIYKAVTDPYF
                     SARIGDRIYVWLDINQIHVFDKESGIAVI"
     CDS             complement(635649..636524)
                     /codon_start=1
                     /locus_tag="CSUB_C0665"
                     /product="multiple sugar ABC transporter permease"
                     /protein_id="BAJ50524.1"
                     /transl_table=11
                     /translation="MSMRLKTALVYLAGVVIAAYSIAPIYSLAIISFMDVRDVVAGNI
                     YPVNPNINAYLRILGYDVQGPYGLLRAYGGYEGLLRGLVNIMIIAPIVMVITITTAVP
                     AGYALGRLKVKARSILILFLLASRSLPPVSVALPYFFLFSQTGLRATLLGMIIIHLTI
                     TIPIVTWILMGFFAALPRDLEKAARLDGCSRLGAFYRVVLPMAAPGIAATAVIAFLFS
                     WNDFFFSWLLSQGTPAATYNAQLSGFFNFQNEPAMFAAAVMLQISLAAVVAIALQKYI
                     VRLRIVDPGAVVIEQ"
     CDS             complement(636521..637387)
                     /codon_start=1
                     /locus_tag="CSUB_C0666"
                     /product="multiple sugar ABC transporter permease"
                     /protein_id="BAJ50525.1"
                     /transl_table=11
                     /translation="MRLSDTGVALLLVVPLIILVFSINIYPIAYSFWLSLNDVSLFKQ
                     TVTFVGLQQYAKAFADQLFANSVLVSVRFVIESVLLIMLSSIGIALVLNEKTALTPVL
                     KVLVILPWALSEFAVAIAGRFFLDRNYGFLNALLLHLGLVDKPIYFLNPVNAVDWLAI
                     FYAWNITPIGAYFILSALQTIPEDLYRQAQVDGASAFWRFRIITFPFIRYAVLITTVL
                     ATILSASSLVLAFALTGGGPGFASTPATLYSFRVFFNAQDFGYGAAMSWLLLIFVMIG
                     SIFYFKLLTFRR"
     CDS             complement(637401..638924)
                     /codon_start=1
                     /locus_tag="CSUB_C0667"
                     /product="hypothetical protein"
                     /protein_id="BAJ50526.1"
                     /transl_table=11
                     /translation="MKDEIDQNVLNKKITRRKAVSNAAAAGLAVGVGLVAGLGGYFAG
                     FSSAGVNTVTQTVTVGGQTVTVTGGGQTVTRTVTQTVTGTPTVSGPPLQFVHWHYRDD
                     IVTSYVKKFEEYFGEKVTEIHLANENYNPLLEAKFQAGDIIDMCYANFFEAARLIQLG
                     FTRDVESFPEIKQIKSEMYPSIVEAYSTVDGKLAGLPYFWSARSAPVVNDSILEKAGM
                     AGERPGTWDELWDMARDIKAAGAADTPVMPHWFNANYGITWDFLAEMSNVYNDPDLTQ
                     TLFNKKFEPVFDANTEVGELLRTWQQVFKEGLVDPTVLAQAGDSDHVSAIVTGKYAFT
                     PTALYYFKVLNDPSQSRIPVGKANLVPVTKSGWGVIDTGLYCWPNKTTDDFRSQRLIK
                     FLGWRTPDGERLTATAWAITDALGSGYTDTLRHPDVQEGFRQWLGDRAPETLKIFDDI
                     ANTMGRPFVFKSPLYTEWADISFPIFSAIVAGTTSVEDGVTRLRNESDRLYRKFHGG"
     CDS             639045..640145
                     /codon_start=1
                     /locus_tag="CSUB_C0668"
                     /product="alanine racemase domain protein"
                     /protein_id="BAJ50527.1"
                     /transl_table=11
                     /translation="MLMFSSMRRGDIDTPALIVDVKVLKRNITEMADFARSLGKKLRP
                     HVKTHKTPEIAWMQMEAGADGICVQKLGEAEVMAEAGLDDILVSNEVVGVQKMHRLVK
                     LAEKVKLSVAVDDVENVSELGRFCRENGVEVGVYVDVDCGMHRTGVPPEKAWLLAEKV
                     TRTEGVYLVGLMGYEGHAGSPTSREERHKLIEEAVKATLHAAKLMKNNGIEPGEVSMG
                     SSATVRVSGRYEGVTELQPGMYVFNDWYLVEREAATQETCALHVLTTVMSKTSPERCV
                     VDAGSKAFHLDMGRYPVCVGVEGVEIYKLSEEHGWVKLSGKAVDKVKLGDRLEFIPYH
                     VCPCVNQFDIMYGLEGDSVTKIWEIKARGKVT"
     CDS             640399..641397
                     /codon_start=1
                     /locus_tag="CSUB_C0669"
                     /note="F420-dependent glucose-6-phosphate dehydrogenase"
                     /product="F420-dependent alcohol dehydrogenase"
                     /protein_id="BAJ50528.1"
                     /transl_table=11
                     /translation="MKKTMVKLGVDATFWMDDKYEMRFLGLCEKAGFDSLWFGDHFLP
                     WHHSFKHNFFVWPVLAAAAERTKKILLGVDVTVPIGGRYHPAIIAQAMGTLDNMYPSR
                     FLLGVGTGEAMSEKRFMGRWPPWRERMERLVEALDLIKKLWSSRDYFDFDGKYFSMSK
                     VYLHLKPKKSIPIYFSAIGEKAATYAGKYGDRLITANTLENCRDKIFPAFEKAAAEAG
                     RNPRRIEKAVLLEGAVVDIDKTIKRIKRIHAGATIMENFNEEDPRKIEESGLRLSDEA
                     IRNYYLLYEDVDDLIDHLDQFRKIGANHLIFTDFSPRPEKTIEIFRRKIIPYFKGG"
     CDS             641456..642358
                     /codon_start=1
                     /locus_tag="CSUB_C0670"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50529.1"
                     /transl_table=11
                     /translation="MPRIEYLYLAIASILWGSGHPVIRYILADVNSQMNSLHVAFLST
                     VVGMVILSVVLASRHGLKRLKMLGRRGLAIAGAVGCLQYGLYPILSYTALSYIPASLN
                     AIIVGSSPMLIALLSRAVLREQLKMVGYGGILLAFASLFILVGGYGAGSISFLGLVLS
                     SAGALVASIYAVAGRYLMRSHDAFAVSQFGTSVGLLVLTSVTYSQSGLGGLLNSDVMD
                     LLLVTYWGIAVTTGNLLFYLALKKLDAARAGSFFFVSPMAAATLSVIFLGEPLTVLMV
                     LGMVATLMGIRLTQMAVVRKDVVG"
     CDS             complement(642369..643442)
                     /codon_start=1
                     /locus_tag="CSUB_C0671"
                     /product="N5,N10-methylenetetrahydromethanopterin
                     reductase"
                     /protein_id="BAJ50530.1"
                     /transl_table=11
                     /translation="MNRLREFGCHIITSQHTIDEILRLAILADKLSYDHVRIGDHVIV
                     PNAEVSYPNAQTLLAAFGVLTKHVRISTAVTDCYRRHPVEIAQAIATLDVLTHGRAVL
                     GIGAGEMMNLSPFGIEWTKPVKRLREAVEVINLLLASTPKSPATYEGEIFSLKKAYLQ
                     IKPVQKPRPPIYIGAAGCKTRELVGMVGDGWLPVGVESPQTLKKHLLDVKNGAERTSR
                     QISNIDIDVTVYTAVDEDIENAYRVVSPAVKSMLVQQREVLRELTGLEVPENLSLQRI
                     DPTDKERLMSFEEMVKQVPRSAVEDVAAFGPIDSVIGKLEEFLGAGATSLTICIIGLD
                     HEKTLRTYAEKIIPYLKETYGSH"
     CDS             complement(643467..645053)
                     /codon_start=1
                     /locus_tag="CSUB_C0672"
                     /product="thermosome alpha subunit"
                     /protein_id="BAJ50531.1"
                     /transl_table=11
                     /translation="MRITTGYEVLKENITAAKLVADLFSSSFGPAGMAKLLLMDNGDF
                     KVTRDAEIISSEVAFVHPVAKLLMEAGTTCRKEGGDGFITTVVLAALLVERGWRLANN
                     GIHPALTATGYQLALKEALKIIDIESSHIDFHDYSTLKKIAKNHLATKLPLSWAEHLA
                     PIVVSALIGVSESVNGYTKFDLDMIKVDGRRGASVEDSELVDGVILHKKGVDRLMPKT
                     ITDAKIAFIQEKLGIKRPDMFTKVVLSTPNKIKDFYSERLSYLRDFLDPLLRIGVNVV
                     LCGGDIAEELRRPLANCGILAVRNVALEDMKRLRMAVGGELVMRPWDLNSQSLGYCGR
                     IDQRIVAAHDEWLFFKNCRNPHFKSILVRGTGDFVVDEVKRAIINCLKLLQSLLKNGA
                     VVAGGGFIEYKIAHMLRKLALSYPSKIQQTVQVFADALEELPLWLVRNTGGDPANVKG
                     KLRSGIAANMLCSIDGYTGEVIKSSITEPAIVKIQCLKSATETAVTILRIDHVFQQPP
                     KPQEKKSPIPLPVRMVRGWK"
     CDS             complement(645218..646516)
                     /codon_start=1
                     /EC_number="4.2.1.11"
                     /locus_tag="CSUB_C0673"
                     /product="enolase"
                     /protein_id="BAJ50532.1"
                     /transl_table=11
                     /translation="MKRITRVDTYEVLDSRGLPTLKTRVWVDHEFMGEAMVPAGASRG
                     RHEAVELRDGGARWMGKGVSRAVENVKSVIAPALINVEADVAKVDNILLDLDGTENKS
                     KLGANAILSVSLATARAIAAYEKIPLYYLIGRLAGVEKDIIPTPMVNIISGGHHAAWN
                     LDIQDLLIIPIGAKNFVEALENVGAVYHNLKQLLMKKGLTTLLADEGGFSPDCRNHRE
                     AIELILAAVEETGLTPKTDIALALDVAASHLFKDGSYMLSREGLTLSSHELVDFLVDL
                     CETYPIVSVEDGCGEDDLDGWQYLFQKLSGKVQIVGDDLFATNVKRIRMCSSLSLATA
                     SLIKPNQVGTLTETLEAIRLCKQLGIKPIVSARSGDTEDSFIADLAVGAACPQIKIGS
                     IARSERTVKYNRLLEIEREQMGKAVYMGEKALNLCNNRCE"
     CDS             complement(646566..647546)
                     /codon_start=1
                     /locus_tag="CSUB_C0674"
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="BAJ50533.1"
                     /transl_table=11
                     /translation="MAISEIRELVMRWGLTGGEEPELKPLGGGVSCHVVLVTSSKGKW
                     VVKKALPRLMVKDEWLADRWRIFRETGCLKVIRELVDKNAAPRVLLEDRESYSCVLEY
                     GEGGVTWKKLLMDGVVDNEVTIRVASILAKIHTKTSNRSEIVSDFWDDTNFIQLRIDP
                     YINHLAKKHLDIAPHLYKISQILTSRKLSLVHGDYSPKNILILPDSRIWVLDCEPAHY
                     GNPVFDIAFCTNHLVLKAIHLNSEAHLNAAKLLWKVYWSTARWENFHTLEEEATLTLT
                     AHMLARIDGKSPVEYLNEEKRAKVRILSKNMIIKAVNEFEKLCEEVRGSL"
     CDS             complement(647557..648558)
                     /codon_start=1
                     /locus_tag="CSUB_C0675"
                     /product="oxidoreductase"
                     /protein_id="BAJ50534.1"
                     /transl_table=11
                     /translation="MRVLRAGVIGVGSFGVLHAEAYRDNPLTELVAVADIDIGRVSEV
                     ASKLGVRSYSDFHDMLRREKLDVVSVATPDDKHTEPAVAATEAGVNILLEKPIATDLQ
                     EAKKIIAAVEKNNVKLMVNFILRFDPRYRRAYELVSEREIGEIVTIWARRSTLLETAK
                     KYGKFSNLLYDVIIHDIDMCNLFTMSEPKKVYCVGVKKVLEKTGLEDAYLAIIQYSGG
                     SAAALETSWVLPSTSPHWLDSRFHVIGTEGAVYVDLQSHGLEIVSSKGVFRPDLSNWP
                     KVGGRLVGNLREAVNYFAECVIKDVSPSPSATDGLKALEVASALFRSASIGQPIELG"
     CDS             complement(648688..649557)
                     /codon_start=1
                     /locus_tag="CSUB_C0676"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50535.1"
                     /transl_table=11
                     /translation="MWQSPLGWRNPLVDTMPNPNHEGAFLDYYGGGWQDIVPSAGGHP
                     TTHRGASMGVHGESSMLPWTCILEEESDDKVTAYMRTDGVRYPFKLEKRITITKTENM
                     IYFWEKLTNTANQPLEYSWLQHPAFGEPFIEPGVKIELSGGCKVIVPEEHHNPLGRLR
                     TGEYEWPHVLDRNGVEVDLSIIPSRQIVAEETSFIHGLSTGRYLIWNRRLGLGFEMIW
                     DVSIFRYLWFWQNYNTPDYPWYGRAWNIALEPCTSYPAGLPEQVKHGTHVTLDGGASL
                     ETKYSVGIIWRKP"
     CDS             649772..650539
                     /codon_start=1
                     /EC_number="3.5.2.10"
                     /locus_tag="CSUB_C0677"
                     /product="creatinine amidohydrolase"
                     /protein_id="BAJ50536.1"
                     /transl_table=11
                     /translation="MVILWAEKSSPELGELCSQKRVAIFPIGSTEQHGPHLPTGTDHI
                     IAWELSKKVVEDVDALLLPLLPYGFSDDHFPMPGTISISSETLKAIIRDVADSLSRYG
                     IRHLVIVSGHAGHLGQISDITYRLNLSYPVQSLRVHNISPYNTVPVERLATVLEEDMF
                     IHAEELETSIMLYLHPHLVDMSKAVKEHPPFIPKGLTTPNFLEAIRIVTTSKFLGRDF
                     KTGVCGDATLASREKGEKLFKILVEGLVETIKHVTSE"
     CDS             complement(650543..651577)
                     /codon_start=1
                     /EC_number="3.4.13.19"
                     /locus_tag="CSUB_C0678"
                     /product="microsomal peptidase"
                     /protein_id="BAJ50537.1"
                     /transl_table=11
                     /translation="MLPPLVDLHEDISLYYVHAGAGLKFKPMGFDVDLSGRHGDIPKY
                     RRANVKLVFSSIAPLTPTISRMRVEQLARGYGGFYGAYRTRAPTLTTLEHIVTYNNLL
                     RQHSKDLRPVLTTSDVDELGKDGRIGFLIAIEGAEPLEDVEDLEIFYKLGVRSLQLTW
                     NFDNKYGATCMSKKDYGLTGDGEDLVRLCNEMGVIVDLSHASKRTTVEALSASKLPAI
                     VSHANAKSVRNHARNLDDEELEALKNNGGVVGATFIPPTISDHASLKGLADHIMYIYE
                     KFGPDILAIGTDFFGLLNVDEPDGLEDITKIVNLWNELLNRGVKESDVEKIAYLNALR
                     VVRENAKRWV"
     CDS             651763..653331
                     /codon_start=1
                     /locus_tag="CSUB_C0679"
                     /product="hypothetical protein"
                     /protein_id="BAJ50538.1"
                     /transl_table=11
                     /translation="MKKKSTQNKRGNEFPQILNTNMTRRHAISKVGAAAIGAVAGAVI
                     GGAGGFLAGSSQAGPARTETVTRTVTQTVTGTVTQTAAEKIEVTWGIWSWGVELVQDN
                     ANKFNQWNDDVYIKVVDYGLDTFFSGISAAYTAGNPPTIHYSTPDVTYIYQQNGWAID
                     MEQYFPEIRRYLDDIFPGFRTGFINPDTGLMSGLAYYGGAQPFMYNQRHLEEAGIDEP
                     PKTWEELEEQARKIKQRGVNDDPIGIWYGSWGFVEVGIYDFMLGMAENDRGPYMWDED
                     LNPIFNDKNSPLFRSLRWQLDMIHKEKLASTKGVLYDEAQAVNAFGSGAHTFFWMPDY
                     DLAFANTPPSKEAGNLRMGMNPGTGKVSAIYRTYLVSKATADKGMKHLEAAWRVMQFV
                     GGRTRNGKPDFENGEYYVCRRLNNEKGVGPIYISMWEDPKYADIRESIKKWVDPEIKK
                     QVLFNTYDFFNDPRMTTWWSEWWGYWQAGVARPAIHDLILGNVGTSDDDILRVLNRLA
                     DEWRKKKAESKTGK"
     CDS             653341..654228
                     /codon_start=1
                     /locus_tag="CSUB_C0680"
                     /product="multiple sugar ABC transporter permease"
                     /protein_id="BAJ50539.1"
                     /transl_table=11
                     /translation="MQKGDVKFLLIGLLPALSFIFPFTFYPIAYAVYVSTLRYDLKYP
                     DQIGFAGFDNFIEVLTSYYMADSVQATVIFVAIAVPIVVLLSLGLAILLNQNFRGVGF
                     LQWLVLVPWAVPLVDSGAIWKWIFDANYGIFNAALKALGLIDSYVPWLNLRWPAMLVL
                     VMAFIWVQLPLPTLLFLAGMQSIPQELYEAAVIDGAGAWAKFKTITVTWLRPFMLIVA
                     VYTSLMAIWTFDLVYVITAGGPGNFTAVISYYTWSEMFTFLNFGRASALSVLVVLVSI
                     GLIIAYFRALRIGRLRLRA"
     CDS             654225..655127
                     /codon_start=1
                     /locus_tag="CSUB_C0681"
                     /product="multiple sugar ABC transporter permease"
                     /protein_id="BAJ50540.1"
                     /transl_table=11
                     /translation="MIKMDTGYKLAIVVSSVVVAAWILFPILWMFSLSLQTEPEIHSA
                     PPTLWPKNPNIFNYWFIFDTSSAIEARLQESGRLSFLPAVARWFPNALVNSVIIGLVV
                     TVINIIAATLASYTFTRIRFKGSGLLFYMSVAGRLIPPVAIVVPYYIIIQNFFGLNLL
                     DTLFAVILVHAAFTLPINIWILNTYLSAIPSDIEDAARVDGYGRLETLFKVVLPVILP
                     GIVAIGIISFMVSWGEFFFAFMVTQTQQSRTLPVIVGFMAAQPYKPVGILMAGGLVAM
                     LPALVMIAVFRRYLLKGLVAGAVR"
     CDS             complement(655131..656219)
                     /codon_start=1
                     /locus_tag="CSUB_C0682"
                     /product="maltooligosaccharide ABC transportor
                     ATP-binding protein"
                     /protein_id="BAJ50541.1"
                     /transl_table=11
                     /translation="MARVFLENLVKIYGKTRVVDDITLEVKHGEFVALFGPPGAGKTT
                     ILRMIAGLEEVTSGKIWIGDRVVNDLSPAERDVAMVFQTFALYPTMTVYENLAFPLRK
                     RRLANDEIDRRVKEVATILNISHLLEKKPGTLSGGERQRVALGRAMVRNPQLFIFDEP
                     LTNLDAKLRLHMRVELRKIQKEMGQTAIFSTPDDAEAMSMADKIAVLDKGRLVQYDAV
                     DSVYHRPKSLYVAMNLGSPQINTVKGELSVDGGKTLLDLGFAKLDLSFLSDVLTKFSG
                     KKVVLGFRPHYVEISKEGLGGLSIKGSVEAVEYMGSESYAIVSLGSSEASVLLPPNMR
                     VEPGSEVWLNINTSRMHLFDASSGETIV"
     CDS             complement(656212..657306)
                     /codon_start=1
                     /locus_tag="CSUB_C0683"
                     /product="maltooligosaccharide ABC transporter
                     ATP-binding protein"
                     /protein_id="BAJ50542.1"
                     /transl_table=11
                     /translation="MGEVKLVNVSKTFGKQEAVKNLSFEVPDGSFASLLGPSGCGKTT
                     TLRMIAGLEKPDKGDILIDGVRVNDVPPHKRDIAMVFQFYAIYPGMTVFDNMAFPLRQ
                     RKMSKQDIQRRVKEIAEILHISHLLDKDAMGLTVGEKQRVALGRAMVREPKVFLFDEP
                     LTNLDARLRAKMRVELKKLHNRIKITTIYVTHDQLEAVTLADKIGVMNLGVLQQFDTP
                     QNLYNKPINTFVAGFIGTPTMNLIDCRVSNSGQKVFLQFDGFSLSEEFLGKNLRALPD
                     GMELVFGVRPTDIEAELGEKGGVLRGKINVIESLGDRYILDLSVGNTIFRVVSREAAA
                     TIGDEMAIYIDPDKIHLFDKQTGKRLNVVG"
     CDS             complement(657350..658441)
                     /codon_start=1
                     /locus_tag="CSUB_C0684"
                     /product="oxidoreductase domain protein"
                     /protein_id="BAJ50543.1"
                     /transl_table=11
                     /translation="MTKKLGVLVHGAGWVSTQHIKAFQNNPHTKVVAISSRKIESARK
                     RAEEAGLKDVKLYDDLHKALENPEVDIVSVCTPQHVHAENTIAAAKAGKHIVIEKPIG
                     NSLEEIKNMRDAVRKAKVKTVVSFVLRWNPLFTILKRIIADGMLGNIYYVEADYQSAI
                     AAWWSGYEDARKKSTGVSAFLVGGCHAIDAVRWFAEKQNYKAADPVEVFAYSGGLRKG
                     KIRQWNYYTQRWEDMPPLEYDDLEVALIKFNNGVIGKVSVNFGGVQPYTFPMEIFGDE
                     GTVKDNRIWSTKFQGQRDWITIPTILPDSADVTHHPFQAQMDHFVECILEDKESHCNL
                     EDAIKTHEIAFAALECYKTAKPVRLPLLT"
     CDS             658528..659547
                     /codon_start=1
                     /locus_tag="CSUB_C0685"
                     /note="myo-inositol 2-dehydrogenase [EC:1.1.1.18]"
                     /product="oxidoreductase domain protein"
                     /protein_id="BAJ50544.1"
                     /transl_table=11
                     /translation="MKKLGVAVLGYGFMGTTHLSAWKLVEGCEVVGVWGRNRKKLDET
                     ALHYEVKPIYELEDVFRDNRIDIVDICTPTYTHHELAVKALEAGKHVIIEKPMALSLE
                     AADAMIKASRKTGGKLMVAHVLRFFPEYMKAKELIDMGMVGDIASIRMWRGGPAPEWS
                     PWFMNREMSGGIAVDLAIHDVDYAIWVNGGLPSRVYAKVENLVHGKYNVEDFALITLR
                     FPTGCIAIIEANWALPKTYPFTMKMEIDGSKGVIQLDNQSPIPMRMWTNEDMQSFSPE
                     TLPWKPGVHPFPLDPFYRELKHFSECVRDDRKPLTDGEVSKMSLATCLAAVESSKKGS
                     AVSLA"
     CDS             659544..660551
                     /codon_start=1
                     /locus_tag="CSUB_C0686"
                     /note="NADH dependent"
                     /product="oxidoreductase domain protein"
                     /protein_id="BAJ50545.1"
                     /transl_table=11
                     /translation="MTEKIRVGFAGVAHFHADSYVQCFKMIPNVEVVGAFERNRELAI
                     QFSDRFGTQLHESLQALLRDVDAVVVASENAFHFEYAAEAVENKKHVLCEKPMTIDLE
                     QADKLVKLVEKNGVKFQMCYVMRYHTVTSLAKGLVDEGKIGKLLSIIGTNKLNRYLVL
                     LRNWFTDKRLSGGGAVMDHTVHLSDLIRWYSGSEIEEVYTEIGRNVNENLSVEDNFLT
                     TVRTQNRVIGHIDGSWTYSSGHYTWGDVTLELLGTDGVIYVDAFRQNINFIGNEKPSD
                     RLSWHYYGCNADLSLVKDFIRCIVEDTQPLADVYDGRQGVAVTLASYESSRTGRAVKP
                     K"
     CDS             complement(660544..661203)
                     /codon_start=1
                     /locus_tag="CSUB_C0687"
                     /product="dimethylmenaquinone methyltransferase"
                     /protein_id="BAJ50546.1"
                     /transl_table=11
                     /translation="MSRLSERLFSLYVPAVADVLDDMGYTNQVLNCMPRPLYPDVKLA
                     GPAVTVSTYWYSSYKSGERDVESLASIFDVCYDGCVVVVATGGRKDAACWGELMSNAA
                     RAKGAVGAVLDGAIRDVPKIYEIAPPFQVFSTGFTPADSKGRVEFGEKQIEIVVGGVR
                     VRPGDIVFGDFDGVVIIPQEIAEEVVAAAEDKVRRESGFREAIRRGEDFRKSVERYKV
                     I"
     CDS             661316..662293
                     /codon_start=1
                     /EC_number="4.3.1.12"
                     /locus_tag="CSUB_C0688"
                     /product="ornithine cyclodeaminase"
                     /protein_id="BAJ50547.1"
                     /transl_table=11
                     /translation="MILSLVTELLVLSKTDLEKVMSMKETIDAVEKAFKGLALGEVVM
                     PMPYIIEVHKHNGVWGVKSALINTQDVVAVKLSSGYFDNPAKYNLPSITGVVVVADAR
                     YGVPLAVMDASIITAYRTGAVAGVAAKYLARKDSEIAAIFGAGVQGRTQLLAIAEVLK
                     LSEVKVYDVAPAYAEKFVKEMKEKTGLDIRKASSVEDALKEVDVVSTATPSKTPYINL
                     EWVSKGTHITTVGSDHKGKQELENKIYDVAKVVVDKREVALEKDYLKPHQIYAELGEI
                     VAGVKVGRTSPEEITVMDSSGLGIQDAAAGLVAYQLAKKKNIGKVVEFF"
     CDS             662457..662849
                     /codon_start=1
                     /locus_tag="CSUB_C0689"
                     /product="hypothetical protein"
                     /protein_id="BAJ50548.1"
                     /transl_table=11
                     /translation="MSDRVRRLMDAVVELVSRPGFQELVAWVAVVVSSVVLAGVVYNV
                     ASRVVIGVAFIGDSVRVFYPDTRVQTVAEMMVVATFYILGFVGLLLYGVAFSKRFSPR
                     ASRYMLLFSTLLITLAALGLIGGYLSKS"
     CDS             complement(662838..663482)
                     /codon_start=1
                     /locus_tag="CSUB_C0690"
                     /product="DNA repair protein RadB"
                     /protein_id="BAJ50549.1"
                     /transl_table=11
                     /translation="MTAAGIRDFFTADFKPTASYLLYGEEKSGKTALLLTAAAKIAEK
                     GGKVVWIDCGARLHPARLRQIFPVERLSQLYISQPRTFREQFETLLNVHDFPPSDASL
                     IVCDDFTYLHKLELSGKPSTDLPVYRALSLQAALLKNLAIARKISVVLVGLVHSIPAI
                     DAQEPVAARIVTYWSDVVAKVQKGRDASVVMQEKPVAQKIYFKIVEKGVEVLRF"
     CDS             663566..663874
                     /codon_start=1
                     /locus_tag="CSUB_C0691"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50550.1"
                     /transl_table=11
                     /translation="MRRIIRFKPEYLDLILKGLKTSTIRPGDGGEYAKELILTDGNRR
                     IAAELLAVEVMTLREAVNTRYRLEGYSSPEELYQSIKKIYNSLGPDDPVTIIHFDPKT
                     "
     tRNA            663904..663977
                     /locus_tag="CSUB_T22"
                     /product="tRNA-Gly"
     tRNA            complement(join(664069..664129,664163..664183))
                     /locus_tag="CSUB_T23"
                     /product="tRNA-Leu"
     CDS             664648..664896
                     /codon_start=1
                     /locus_tag="CSUB_C0692"
                     /note="SirA family"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50551.1"
                     /transl_table=11
                     /translation="MVFAKPVLTVDVRGAMCPWPVLKTREAVQRINVGEVIEVLATDP
                     ASKPDLEAWARKTGNRILSVEESGSDPVVYRFLIERVK"
     CDS             664897..665319
                     /codon_start=1
                     /locus_tag="CSUB_C0693"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50552.1"
                     /transl_table=11
                     /translation="MSEEKTRLVIVASRGTADGLYPALILATTAVAQGKEAAVYFTFG
                     GMKLLTKQMAETIKPSLDLGVSKEQLEQLLAKGGMPSLVDMLKMAKQSGVKIYACSPT
                     MNLFGLRKEDLVDVVDDIIGASTFLEIASDPKTLALFI"
     CDS             complement(665320..665760)
                     /codon_start=1
                     /locus_tag="CSUB_C0694"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50553.1"
                     /transl_table=11
                     /translation="MKTALIISAAATAFALAALVILAMSTSSQPFGTAPPAKEIFLVL
                     DKTELYKGQRTLTYTIINNTPETIGFGEPYDIQKKQDGEWVSVEWMKDRAWILIYYNL
                     EPGKSLSKRVELPVDIEPGDYRLVKEVDVGGEKRVLTATFTVLE"
     CDS             complement(665806..666756)
                     /codon_start=1
                     /locus_tag="CSUB_C0695"
                     /product="hypothetical protein"
                     /protein_id="BAJ50554.1"
                     /transl_table=11
                     /translation="MKWVFRFEYVVPRPVEEVYEFFRNVENMGKVWPTELGMKLVSQD
                     KDVYTVSFRLLGQLYQTRFRIIERSSTEQYHETLDFPFGKLYHTITTTPADGGTKIVE
                     DMVLESSNPFAGRFFKKILTYRHEAIKHSLGAGEKPTYKDPFKISLTAGNLISILGIA
                     AAYVLLWLQPLQIPGGRLITGLISFLLLWFFTHDLAHYVVGRLVGIRFSNYYVGLSNI
                     VRLNILPKPFKTLPVALGIKIDRANTQASPRGYAATYAAGPIASMLFPLTVPVIMLAN
                     NFTSLAGQILLLIAVANIIFTSIFSPKEGCIAKARKALRK"
     CDS             666878..668191
                     /codon_start=1
                     /locus_tag="CSUB_C0696"
                     /note="CRISPR-associated (Cas) DxTHG family"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50555.1"
                     /transl_table=11
                     /translation="MASSAVLQVIGEPKNYKKARYVYENQAREALLAATAVADITGGE
                     AILLAPESLVTSLESDRDEARKLLEKPEMLEQKVLEQLERMGENHPKPMVKILPSIGS
                     FSQHEKGWRINAQGSFAVIEAALFLIMRKLVNEGKNITMVVTSGLNIYPALALRTLNH
                     ILTYQLLSNYPLDTNQTPQHKLAFHTIPTQEKEEIQIETHTIETRVFNIFPLTIDEID
                     KEICKLYQHEMRSNLRWHLSNGMRAFNCITRNTPLPLYYEKIINKIDPREISFLEEKV
                     AEDLKNRYKPEIHVVNNEILIKRPSELGLSLIRRAMMSLALTRVLMRLVDEARREVDD
                     DGWVPLEAIEKMFIDKIYDDKREFKLNKFLLESELYKIREGGGDVYGSSINGHRVGGS
                     SNEKRNFFAHSGFLRDMTIVRKDGEKILLKYCEEKMERVKGWLLD"
     CDS             668231..668800
                     /codon_start=1
                     /locus_tag="CSUB_C0697"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50556.1"
                     /transl_table=11
                     /translation="MAGVETRPSGMAVLDEELRVRTWVRFLDAEILADVDELRPVAVG
                     IDAPLGLPRGRASLETRGPPHFRICDNELRRRGIRFFPITIGAMRKLTARGIRLAEEI
                     RRRNIPVYETFPGGVQDLLGLPRKHHSLKGLVKGLRKLGVKNLPPKISADEADAVTCA
                     YAVYLWWRGLCEEVGVPDEGVMILPKRRP"
     CDS             complement(668801..669826)
                     /codon_start=1
                     /locus_tag="CSUB_C0698"
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="BAJ50557.1"
                     /transl_table=11
                     /translation="MENLVKGLHHITLVTGSYLVNNRFYTEVLGLRRVKLSVNQDDIY
                     HRHLFYANLDKPTGSAITFFEWPELPRGYPGYGSPHHLAYRVGSAEALAKWFHFLRER
                     NIAAKGPYVYGGLVSIYLRDPDGVLLELTTSYPEADPGYLKELFKKTSTPTAISQDMR
                     LTAFDHASPIISDPGLTSRFLEKFLDIVDVEISNGVLRILNMDGDVYLRCIVDPLNLD
                     GYVARGSVHHIALCVESEETQRLVMRRLNSVGWSNSGIVDRFWFKSLYFRDPDGNLLE
                     LATQGPGYDVDEPRETLGSRLVLPPWLEPLRQQIEKKLAERDAGNAVEWPTVFEEPPE
                     PPEPLAQ"
     CDS             complement(670282..670794)
                     /codon_start=1
                     /locus_tag="CSUB_C0699"
                     /product="hypothetical protein"
                     /protein_id="BAJ50558.1"
                     /transl_table=11
                     /translation="MTECSSGRPIVGATVTVQLSDTASVSTVTNATGYAAFSIAPGTY
                     GYVVDMMGYWIRYGEGRFQPGGVVATCLFRATGGCWRVVAEILEWCGDIHAGGRGWAM
                     LRLKNLEEGVFNITRLKMHVAGYDKPVAVYQGVVLEKVFNVTVAPPQHSVGKAFDDDS
                     MVEVSHWGWV"
     CDS             complement(671215..673200)
                     /codon_start=1
                     /locus_tag="CSUB_C0700"
                     /product="hypothetical protein"
                     /protein_id="BAJ50559.1"
                     /transl_table=11
                     /translation="MAQDLYDSSAKIGRREFLALTSAQVAGVAAGAALAGGVGGYLMG
                     RKLAEATVTLTSTETVVSERTLFKTETVTSTSTKTSTYTATVTQRIYDAKLDEASFQK
                     SYSTESMNLSARLKFNPRSEVTTASLKIIYPYSLEIPLRGSGSEKNVFIGGYRIENPK
                     PVDHYAVWDAVTKEGLKASEVLSDEQRTLVISMPLRRDEYEKSKDLADYLFGYTLSLD
                     TLNSENTFKIAFDALVSTGNIRVGEEVRKAIVKYALNITKNNLQPFETSSLAPFISSL
                     QTLVTQHPEILNRETSILANLSEPAEYLTKEYLTKYYFYPYLIYNIPELQKYPFFANS
                     AALQAARIINNYLSLYLNYSSDRVRAFWVLDEVIIPRVRARINWFEKGETVLPITGKE
                     IVDLMGREDVALIKLADSIVSHADFQFYLFRDINVNDTLYLWPIRPSITGIKNEFIQN
                     AIYNTKIMINENSSINHDYVWEDINNPERKKIYIEGNTYIPEPDHPRYELYKYWSEIY
                     VPDILKYGSNYDKIAMLWFRFGVLNKPKRPNGEYIHEENRKLISQLAAESLGESVYNV
                     FMNSRWHPDWAHGDIMISLSNNMWQIILSNKERYKTPIQVKEVNGIPNVYGIKELYDY
                     SVMRAGEIWEREGKGKKEDFKPWMEWYTSIANRIKIF"
     CDS             complement(673531..674226)
                     /codon_start=1
                     /locus_tag="CSUB_C0701"
                     /product="hypothetical protein"
                     /protein_id="BAJ50560.1"
                     /transl_table=11
                     /translation="MESSSVLDLALRSQHAVQVFTPYITNVGFHNKINELDILASLVM
                     EDANLYALSGLVGAVLRLIVVISTVSVSYVAINPKGVIQVLAMLLSSQAFIGLLFILG
                     PAQTLSTNQRSNIFLVFFTLFIWFAFYVAIAALATGVKAEEKVSLAEVLLSINLMGGV
                     LLILFLLVARVYSLLPKHATPAQVDFWSTLFSKCVYGSICWQGSLPFIYLLVAGVMTL
                     IFARLAARVGEQV"
     CDS             complement(674833..675375)
                     /codon_start=1
                     /locus_tag="CSUB_C0702"
                     /product="thiamine S protein"
                     /protein_id="BAJ50561.1"
                     /transl_table=11
                     /translation="MAVKVYLPTPLRQYADGRDMVELDGSTVGEVLNKLVSRYTALQK
                     HLFNENGAIRSFVNVFVNNEDIRFLEGVNTKIKDGDVVYIIPSIAGGLSIAAPAAVAK
                     KLGRTVKQHGRITVPAKLLKKAKKNEVTVIIDDVKYIFEPDRYNRIYLPPTLREKIAH
                     LSSFEFTLSDGELILRFRRF"
     CDS             complement(675430..675852)
                     /codon_start=1
                     /locus_tag="CSUB_C0703"
                     /note="Mov34/MPN/PAD-1 family protein"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50562.1"
                     /transl_table=11
                     /translation="MKLVVKRLVFEEIAKRCIEGYPYETAGLMFGDLGNRLVLDIYPV
                     QNIHEQDRRVRYRIDPMEYYRAEKTAEEKGMTIVGVYHSHPNVAARPSAYDLEYALPP
                     WSYLILSINHEKVLEYTSWRAVQNNGEKKFIQEEVVIE"
     CDS             complement(675849..676757)
                     /codon_start=1
                     /EC_number="2.5.1.47"
                     /locus_tag="CSUB_C0704"
                     /product="cysteine synthase B"
                     /protein_id="BAJ50563.1"
                     /transl_table=11
                     /translation="MTVVGAELLRTESEGLWHLVGKTPLLRLRSFEKPGVKLYAKCEM
                     FNPGGSVKDRPALSILLDGIRSGRLSPGKSILDATSGNMGVSYSMLAASLGYRAVMVS
                     PSNISSIKLRKMKAFGAQVILTDALEGIDGAIRKVREIYEQEPEKYFYADQYSNPANP
                     RAHYETTGPEVWMQTGGKLTHFVAGVGTSGTLQGTASFLKEKNPRIKVVEVQPEDEFH
                     GIEGLKHMASALRPSLYREDIADNRYFIRTEDAAETSRRLAQSEGLLSGYSGGAALRA
                     AVELMEELDEGVVVVVLPDGYGDSGR"
     CDS             complement(676768..676983)
                     /codon_start=1
                     /locus_tag="CSUB_C0705"
                     /product="conserved hypothetical protein"
                     /protein_id="BAJ50564.1"
                     /transl_table=11
                     /translation="MVKHILVTLSDEQYKCVSFLRNKMGSSDAEVLRNIFLSWLAEKA
                     MIGCWETERAVEEFQKKWMEKKEKSTV"
     CDS             complement(677033..677641)
                     /codon_start=1
                     /locus_tag="CSUB_C0706"
                     /note="bacterio-opsin activator HTH domain protein"
                     /product="DNA-binding protein"
                     /protein_id="BAJ50565.1"
                     /transl_table=11
                     /translation="MKAQPHQLTVVVRNSTCRVVQTLFQKGVEGSFRSIRVGDKLSSH
                     LIQLSKPVSQELLHIPDSIVYTMGRRFIWVDSPSCIACQTLSNNSAIPLNIMFIRGVG
                     VVFTFLTPGRLVSRKILDQMRERGLDVEVLNRKVFNLRAVLTPKQQQVLYTAFMMGYF
                     SPSRETSLSEIATRLGLSKSTVSRHLRTAMRKLAVTAPQASV"
     CDS             677735..679192
                     /codon_start=1
                     /EC_number="1.7.2.1"
                     /locus_tag="CSUB_C0707"
                     /product="nitrite reductase (NO-forming)"
                     /protein_id="BAJ50566.1"
                     /transl_table=11
                     /translation="MNKMLLLAAIAALFALAAPASAIVYAPGVPGNPPPNAVPNKSFT
                     LIASEADVVIDDGVVFRAFVFNGTSPGPLIVVEEGDVVEIIVKNVGQYTHGLSFHAAN
                     TQTSKFIGNIPPGGEGRLVFKADFPGVYMYHCAPGGHGILTHTLAGMYGMVVVEPKKG
                     SYLLEKQLGREPDIKIYLIQHEVYMNGRDFYDGKPLYVMFNGRVFRYLTEPIQARPGD
                     YVRFYFLNIGPSLVSSFHAVGGIWEYAYRNGNPENVEVGLQTVNAAPTESYVIEWRVP
                     AEGNFLIVSHAFGTQAIKGAAGYIAASVNATPQPVILPNGPVAQPPANPKRVVAPFEP
                     TSPDESKTFLPGEKVMIQIVGNSFYPKIARVPVGSTVTWINEDVLSIGSGEITGQHNV
                     AAIQGPVSFASQLLKNAEQFSFKIEKEGEYNYICGIHPYMKGTLVAYAAAGLPSSAGQ
                     GIGFTFDLTAFIVFFGGLGALSLLVYVGEKTSKKT"
     CDS             679189..679779
                     /codon_start=1
                     /locus_tag="CSUB_C0708"
                     /product="electron transport protein SCO1/SenC"
                     /protein_id="BAJ50567.1"