LOCUS       BA000016             3031430 bp    DNA     circular BCT 10-MAY-2017
DEFINITION  Clostridium perfringens str. 13 DNA, complete genome.
ACCESSION   BA000016 AP003185-AP003194
VERSION     BA000016.3
DBLINK      BioProject:PRJNA79
            BioSample:SAMD00061119
KEYWORDS    .
SOURCE      Clostridium perfringens str. 13
  ORGANISM  Clostridium perfringens str. 13
            Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
            Clostridium.
REFERENCE   1  (bases 1 to 3031430)
  AUTHORS   Hattori,M., Yamashita,A., Oshima,K. and Shiba,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-FEB-2001) to the DDBJ/EMBL/GenBank databases.
            Contact:Masahira Hattori
            Graduate School of Frontier Sciences, University of Tokyo; 5-1-5
            Kashiwanoha, Kashiwa, Chiba 277-8561, Japan
REFERENCE   2
  AUTHORS   Shimizu,T., Ohtani,K., Hirakawa,H., Ohshima,K., Yamashita,A.,
            Shiba,T., Ogasawara,N., Hattori,M., Kuhara,S. and Hayashi,H.
  TITLE     Complete genome sequence of Clostridium perfringens, an anaerobic
            flesh-eater
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99, 996-1001 (2002)
COMMENT     This work was done in collaboration with Tohru Shimizu, Kaori
            Ohtani, Hideo Hayashi (University of Tsukuba), Hideki Hirakawa,
            Satoru Kuhara (Kyushu University), Naotake Ogasawara (Nara
            Institute of Science and Technology), and supported by the
            Research for the Future Program of the Japan Society for the
            Promotion of Science.
FEATURES             Location/Qualifiers
     source          1..3031430
                     /db_xref="taxon:195102"
                     /mol_type="genomic DNA"
                     /note="anaerobic pathogen for gas gangrene"
                     /organism="Clostridium perfringens str. 13"
                     /strain="13"
     CDS             410..1783
                     /codon_start=1
                     /gene="dnaA"
                     /note="457 aa, similar to sp:DNAA_BACSU CHROMOSOMAL
                     REPLICATION INITIATOR PROTEIN DNAA from Bacillus subtilis
                     (446 aa); 60.7% identity in 448 aa overlap"
                     /note="CPE0001"
                     /product="chromosomal replication initiator protein"
                     /protein_id="BAB79707.1"
                     /transl_table=11
                     /translation="MDAQLNNLWEQALNIIKGEISEISFNTWIKSCTPISISDNILKL
                     SVPNEFTKGILDTRYKDLLIQALKIVTSRKFKIEFYLESDLEEEKENEEKQKEEKKEN
                     TNDVDGSIVVSDEMSATLNPKYTFQSFVIGNSNRFAHAASLAVAESPAKAYNPLFIYG
                     GVGLGKTHLMHAIGHYILQENPKAKVVYVSSEKFTNELINAIKDDKNEEFRNKYRKVD
                     VLLIDDIQFIAGKERTQEEFFHTFNALHEENKQIILSSDRPPKEIPTLEDRLRSRFEW
                     GLIADIQPPDFETRMAILKKKADVEGLNVPNEVMVYIATKIKSNIRELEGALIRIIAY
                     SSLTNRDVSVDLASEALKDIISNKESAPVTVKTIQESVANYYNLRIEDLKSQRRTRNI
                     AYPRQIAMYLSRKLTDMSLPKIGEEFGGRDHTTVIHAYEKISENLKTDEGLQSMINDI
                     TKKLTQK"
     CDS             2078..3178
                     /codon_start=1
                     /gene="dnaN"
                     /note="366 aa, similar to sp:DP3B_BACSU DNA POLYMERASE
                     III, BETA CHAIN (EC 2.7.7.7) from Bacillus subtilis (378
                     aa); 39.9% identity in 361 aa overlap"
                     /note="CPE0002"
                     /product="DNA-directed DNA polymerase III beta chain"
                     /protein_id="BAB79708.1"
                     /transl_table=11
                     /translation="MIFTCDKNKLQESIAIAQKAITGKSTMPILEGLYIEASENIVTI
                     IGSDKDVSIETKFEADVTEPGKLVVDAKIFGEIIRKLPNDKIKIETVSEEAIRITCQK
                     SVFDLLHMNAEDFPSLPKINENMIFSINQGILKNMIKGTSFAIAQDETRPILQGILFE
                     IKDSKLNLVALDGYRLAIRTENIDTNNTINAVIPGKTLNEVAKILEDSEEIVNITFTP
                     NHILFNMGDTKVISRLLEGEFIKYDALLPKEHKLQIEVDKQTLQNGIERASLMAKEGN
                     SNLVKFDITDENIVITSNSQLGKVREEVTIKLQGDEIQIAFNSKYLLDVLKNMEEDKI
                     ELRMTSSISPCIIRNKNNDLCEYLVLPVRIAR"
     CDS             3304..3510
                     /codon_start=1
                     /gene="CPE0003"
                     /note="68 aa, similar to pir|H75402 conserved
                     hypothetical protein from Deinococcus radiodurans (strain
                     R1) (104 aa); % identity in 57 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79709.1"
                     /transl_table=11
                     /translation="MQEVKINTEFIKLDSFLKWCGAVSLGSEAKMFIMDGEVLVNGEV
                     CTQRGKKLRVDDTVEFNGEIYKLI"
     CDS             3566..4651
                     /codon_start=1
                     /gene="recF"
                     /note="361 aa, similar to sp:RECF_BACSU RECF PROTEIN from
                     Bacillus subtilis (370 aa); 41.2% identity in 359 aa
                     overlap"
                     /note="CPE0004"
                     /product="DNA repair and genetic recombination protein"
                     /protein_id="BAB79710.1"
                     /transl_table=11
                     /translation="MYIKSLQLINYRNYENLSIKLCPNVNVFIGDNAQGKTNVIEAIY
                     YCGFAKSHRTNRDKELIEWNKDRAFIRLDVHKDRLDKIIDVNILKDGKKAISINSIKI
                     SKIGELIGTFNVVMFSPEDLKIVKESPGIRRRFIDMELSQLNKRYYHNLVQYNKVLHE
                     RNLVLKNKNINEEMLDIYDIQLAQYGENIIKTRLKYIEQLNKYSKEIHKEITSGKEEI
                     EFKYISTVKDLDNIKDSMIKLLEQNRKKDIDKRATSIGPHRDDFNIYLNNIDAKIYGS
                     QGQQRTSVLTIKFASLKIIKEITGEYPVLLLDDVLSELDFNRKRYVLTSIKNIQTVIT
                     CTGIEDLTSYLDENSKVFRVINGRIQC"
     CDS             4665..4925
                     /codon_start=1
                     /gene="CPE0005"
                     /note="86 aa, similar to pir:T46554 hypothetical protein
                     X from Clostridium acetobutylicum (87 aa); 78.6% identity
                     in 84 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79711.1"
                     /transl_table=11
                     /translation="MFLHLGENVVVPVKDVIGIFDIQTAMYSSDTIQFLRMAEEDGFV
                     ERITDEKPKSFVIAEIDKMSKVYLSPISSSTLTKRTDINYNP"
     CDS             5162..7078
                     /codon_start=1
                     /gene="gyrB"
                     /note="638 aa, similar to sp:GYRB_CLOAB DNA GYRASE
                     SUBUNIT B (EC 5.99.1.3) from Clostridium acetobutylicum
                     (637 aa); 68.6% identity in 637 aa overlap"
                     /note="CPE0006"
                     /product="DNA gyrase subunit B"
                     /protein_id="BAB79712.1"
                     /transl_table=11
                     /translation="MLEQNNQNYDASQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVY
                     EIVDNSIDEALAGYCKNIKVYIHKDNSVTVVDDGRGMPVGIHPKMGKPTVEVIMTVLH
                     AGGKFGGGGYKVSGGLHGVGASVVNALSELCEVIVTRDGYVWKQSYKRGAVLTGLERI
                     GEAEGSGTKVHFKPDHEIFEETEYDFEILSQRLRELAFLNKGINITLIDEREDEVKEE
                     VYHYEGGIKSFVSYLNRNKEVLHDEPIYVEGLKDGIAVEVSLQYHDGFNENIFTFANN
                     IDTVEGGTHLAGFKTALTRVMNDYGRRFGHLKESDKNLSGDDIREGLTAVVSVKISDP
                     QFEGQTKTKLGNSEVRSAVDSISGEGISTFLEENPEVGKIIIEKALLASRAREAARRA
                     RELTRKSVLERSSLPGKLADCSSKDPKECEIYIVEGDSAGGSAKQGRDRKFQAILPLR
                     GKIMNVEKQRLDKILGSDTIRSMVTAIGAGIGPEFDIEKIRYNRIIIMTDADVDGAHI
                     RTLLLTFFYRYMRDLVEQGHVYIAQPPLYKISKGKQERYAYSDAAADEIIEEFGGKDS
                     SVNVQRYKGLGEMNAGQLWETTMDPESRILLRADIEDAMVADEIFTILMGDKVEPRRE
                     FIQKNAKNVSNLDI"
     CDS             7100..9391
                     /codon_start=1
                     /gene="gyrA"
                     /note="763 aa, similar to sp:GYRA_CLOAB DNA GYRASE
                     SUBUNIT A (EC 5.99.1.3) from Clostridium acetobutylicum
                     (829 aa); 70.7% identity in 758 aa overlap"
                     /note="CPE0007"
                     /product="DNA gyrase subunit A"
                     /protein_id="BAB79713.1"
                     /transl_table=11
                     /translation="MSLNEGKVIPIDINKEMKKCYIDYAMSVIVGRALPDVRDGLKPV
                     HRRILYSMQELGLYPERGYRKCARIVGEVLGKYHPHGDSSVYDALVRMAQDFSLRYML
                     VDGHGNFGSVDGDSAAAMRYTEAKMNKIASEMLRDINKNTVDFIPNFDGEEKEPVVLP
                     SRYPNLLVNGSSGIAVGMATNIPPHNLGEVIDGTIALIDNPELTSLELMTYIKGPDFP
                     TAGIIMGKSGIRAAYETGKGRIVVRAKAEIEEENGRHKIIVTELPYQVNKAKLIEYIA
                     DLVKDKKITGISDLRDESDREGMRMVIELKRDANPNVTLNLLYKHTKMQDTFGVIMLA
                     LVDNQPQILNLKQVLVHYINFQKDVITRRTQFELNKAKERAHILEGLIIALDNIDEVI
                     NIIRSSKTSEIAKNTLIERFSLSEKQAAAILEMRLRRLTGLERDKIENEYNELMKLID
                     YLNAILASEERLLEVIKEELLEIKAKYSDERRTQIEKQENEIDIEDLIQEEDVVITLT
                     HTGYIKRISSDVYSAQKRGGKGIQAMTTKEDDFVENVLVTSTHSNLLFFTTKGKVYKI
                     KAYEVPDAGRTAKGTNLVNILPLEADEKIQTVLSFKDVQEDGYLFMGTKLGIVKKTPL
                     KDFKNIRKNGLIALNLREGDELLRAKITYGDADIIFVTQDGNAIRFNETDVRPMGRTA
                     SGVKAISLREGDVAVCMDIAVEDEKLLVVSENGYGKRTNLDEYKVQNRGGIGLITYKV
                     SDKTGKVVGATVCKEDDELMHYK"
     CDS             9369..9620
                     /codon_start=1
                     /gene="CPE0008"
                     /note="83 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79714.1"
                     /transl_table=11
                     /translation="MSLCIINSQGVAIRINVSDISVTSRSAMGVKLMRTLEDEAVVTI
                     AKISGDTNEEEEEITLLDESEDTNIIVEEVATEVKDEEN"
     rRNA            10173..11680
                     /gene="rrnA-16S"
     rRNA            11869..14773
                     /gene="rrnA-23S"
     rRNA            14868..14982
                     /gene="rrnA-5S"
     tRNA            14992..15065
                     /gene="trnA-Met"
     tRNA            15074..15146
                     /gene="trnA-Ala"
     CDS             15422..15625
                     /codon_start=1
                     /gene="CPE0009"
                     /note="67 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79715.1"
                     /transl_table=11
                     /translation="MSYRIKQFLWAISANFKELDYSYVISILNDYEFSLFKRLKKGEQ
                     LHSIKVSKDCVNLAKRKGINLEE"
     CDS             15633..15926
                     /codon_start=1
                     /gene="CPE0010"
                     /note="97 aa, no significant homology. ATT start"
                     /product="hypothetical protein"
                     /protein_id="BAB79716.1"
                     /transl_table=11
                     /translation="MFSKLGLLHDIGKLYYPLNIITKSFLVLGKKISKNRISKFQNIK
                     PIYIYYNHGDKAFDYLREDDYDKEFVEAIRGHHSIKSSENILLCILKEADDMN"
     CDS             16277..19033
                     /codon_start=1
                     /gene="CPE0011"
                     /note="918 aa, similar to pir:D69427 conserved
                     hypothetical protein AF1421 from Archaeoglobus fulgidus
                     (880 aa); 31.7% identity in 881 aa overlap. Putative
                     N-terminal signal sequence and 6 putative transmembrane
                     regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79717.1"
                     /transl_table=11
                     /translation="MKNKILNTVLISILLLVVVFFVSTNFIINVQWFKEVGYLNVFFT
                     KLIAICKLFVPIFILYFCVIAIYLFTLRKSIRSLVGDTKFKSVKKYFLLSNLVISILG
                     AGATATTQWYKILQFTNAVPFGEVDPIFNKDISFYVFKLPLVQSLFSTAISLIIILVL
                     ITVIIYLALGFKDKIYQNKDNVININSKTYGIRKFAGKQLAVLASVLSLLIGCSYLLK
                     SYNLVYSTRGVSYGAGYTDVKITMIFYKVIAVACVISSIVVFISILKLKFRPIIISIA
                     SIAVLIVLEPVVAIFTQQFVVKPNEMELEKPYISYSIDATKKAFNIDEIEVKEMEPNE
                     NITSEKLEDNKDIIENLKVNSTGPLLSFYQQVQLIKNYYEFNDADTDRYNINGKYTQV
                     FVSPREINRDSMTTWQNKHLRYTHGYGLAMSRVNSVTEFGQPDFVMKDIPTVNTTDIN
                     LENPRIYFGESDNDYVIVNTEGGEFDYPTGDTENTFNYNGTGGLKMTPFNRVLFSIYE
                     RNPKILMSSSITSESRIILNRNIVKRVQEIAPFLTYDSDPYIVVHDGRLVWMMDAYTS
                     TDKYPFSEPHEGVNYIRNSVKVVIDAFNGNVDFYVTDENDPIINCYLKIYKGLFKPLS
                     EMPEDLKEHFRYPQDLFELQSKVLTKYHVDDPIKLFTEEDLWDRSLEVVKHGGENLSQ
                     GDEVKEESILNKAKENKNNEAENEGLYLMTKLPDEENVEMMLLDYFNMRGKQSMVALL
                     GARMDGDNYGELVMYKFPPQRTIYSPILFKNRIQQDPNISKEISLWAGKGSEVIYGDI
                     IIVPIEDSLLYLNTIYLKANSENSMPEMKRVILSNGDKIVIEENIEKALLKLFNYNSS
                     EENKNSNKDETPKTEITSDKSGVKEAADLFNKAIEAQKNGDWATYGEFINKLGDVLNK
                     ISQE"
     CDS             19276..20670
                     /codon_start=1
                     /gene="CPE0012"
                     /note="464 aa, similar to pir:E72254 conserved
                     hypothetical protein from Thermotoga maritima (strain
                     MSB8) (479 aa); 31.4% identity in 455 aa overlap.
                     Putative N-terminal signal sequence was found by PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79718.1"
                     /transl_table=11
                     /translation="MDYDVLILGGGIIGCSVAYELSKYNLNIALIEKDFDIADDVSFV
                     NTAIVYDGSECKDNLMSYLENMGNMMLPEITKKLNVPFKRVGHLTIADNDETVRIIEE
                     NYKRAKSRGINNIYLIDEKRAREIEPNYKGEIKKAMYSENIAVTSPYDLAIGFAEIAY
                     DNGVSFRLEEIVLDIQSIAKGFKVTTNKNKFTCRFVINTTPGEHYTIDQDKDYEQKNA
                     LKTYYLLLNDEIKEKTSNIVVKLKNEEEFIIQKNTVNGDTLIGINSNNSLGFMKSLKI
                     AKEMINSISRKHVKDIFYDNHNQDRLIIDDSRKNKGYIKVMGNHYGEVTIAPAVSKII
                     CDEIIDKLNCSLNKNFVDKRREFYRFRELSNEERNELISLDKRYGKIVCLCNGISEGE
                     IVDCIRRPLGARTVEGVKRRTGATFGTCHGAYCISKIINILARELEKKPTEIVEDSKN
                     SKVLASRIKEFDRV"
     CDS             20683..20916
                     /codon_start=1
                     /gene="CPE0013"
                     /note="77 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79719.1"
                     /transl_table=11
                     /translation="MHKDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRL
                     YVGVPTKSGNVVCKNIMNTGVDIICTKNLPKDS"
     CDS             21262..22545
                     /codon_start=1
                     /gene="serS"
                     /note="427 aa, similar to sp:SYS_BACSU SERYL-TRNA
                     SYNTHETASE (EC 6.1.1.11) (SERINE-TRNA LIGASE) (SERRS)
                     from Bacillus subtilis (425 aa); 63% identity in 419 aa
                     overlap"
                     /note="CPE0014"
                     /product="serine-tRNA ligase"
                     /protein_id="BAB79720.1"
                     /transl_table=11
                     /translation="MAMLDLKKLRSNTEEVKKALSNRGEDFDVNVIDEVIALDEERRK
                     ILVDVEALKKQRNEVSAEIPKRKKAGEDVTEVMAEMREIGDKIKADDAKVAELNDKIN
                     YIMLRIPNIPNPAVPEGETDEDNVEIKRWGEPTKFNFEPKAHWDLGTDLDLLDFERGG
                     KVAGSRFTVYKGMGARLERSIINYFLDKHTFENGYTEVLPPYMVNRDSMTGTGQLPKF
                     EEDAFKVENNGYFLIPTAEVPVTNMYRNETLEGDKLPIKHAAYSACFRAEAGSAGRDT
                     RGLIRQHQFNKVELVKFCKPEQSYEELDKLVQDAESVLQGLGLPYRIVRICKGDLGFT
                     AALKYDIEVWMPSYNRYVEISSCSNFEDFQARRANIKYKNSPKEKPQFVHTLNGSGVA
                     IGRTVAAILENYQQEDGSVVIPEALKEYMRCDLLK"
     CDS             22722..23141
                     /codon_start=1
                     /gene="CPE0015"
                     /note="139 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79721.1"
                     /transl_table=11
                     /translation="MDNCKYNYKCNCECNWDKYEDNCHKCRKLEKVAEELTRESAELN
                     EAVEEKLEGVKYIQKEIDELEERLECLRKKQKSLFCEAMELDRELDKTVFEAFKHLFA
                     TIECYKKCKNNERPERPEKPDKPGRPGCGCKYCCKDR"
     tRNA            23283..23370
                     /gene="trnA-Ser"
     tRNA            23407..23494
                     /gene="trnA-Ser"
     CDS             23757..24023
                     /codon_start=1
                     /gene="CPE0016"
                     /note="88 aa, no significant homology. 2 putative
                     transmembrane regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79722.1"
                     /transl_table=11
                     /translation="MKGSSGPVRPKKPKRSTAYTLSLYLGWSSIFAALYFFIVGLPFS
                     IPGIIAGYIAFKKHNEGKLPLILNIIGFLLTVFTWVLFMKIPLK"
     tRNA            24132..24219
                     /gene="trnA-Ser"
     tRNA            24228..24315
                     /gene="trnA-Ser"
     CDS             complement(24353..24535)
                     /codon_start=1
                     /gene="CPE0017"
                     /note="60 aa, no significant homology. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79723.1"
                     /transl_table=11
                     /translation="MSTFLYFIFFTFIIYILLTGFFKKVFKEAFIELLNEDNEKLKLF
                     IKECLREHDFSKRNKN"
     CDS             24773..25654
                     /codon_start=1
                     /gene="CPE0018"
                     /note="293 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79724.1"
                     /transl_table=11
                     /translation="MKVEKLNDIKNNSKEIIFNSNSKIVLFSDCHRGDGTYKDSLAPN
                     INIYLSAIRYYYKNKFTYIEVGDGDELWKFKDIQEIYDMNYEIYEVLEEFKEKNRLYM
                     IYGNHDKDKSKIKFLRKNKRRNRFNHSASDFYSTLEIYESLVLVHEESKKDFFVIHGH
                     QIDFLNNELAFLSKFLVRYVWAILEAFMGFKDPTSPAKSNNKRNLFDEKISKWAEENK
                     TRVILGHTHKTLFPKSRNESTYFNIGCCVLPRTITAIEIERGEISLIKWTIKADEKGS
                     LFVGRDIIGGPIRIENY"
     CDS             complement(25743..25907)
                     /codon_start=1
                     /gene="CPE0019"
                     /note="54 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79725.1"
                     /transl_table=11
                     /translation="MKIGDTFKKFMDTTAEIETKLGNPMACFLEEQEREEKEKKAHHK
                     EVKAKGKNDN"
     CDS             26116..29592
                     /codon_start=1
                     /gene="addB"
                     /note="1158 aa, similar to sp:ADDB_BACSU ATP-DEPENDENT
                     NUCLEASE SUBUNIT B from Bacillus subtilis (1166 aa);
                     32.7% identity in 1153 aa overlap. 1 putative
                     transmembrane region was found by PSORT"
                     /note="CPE0020"
                     /product="ATP-dependent deoxyribonuclease chain B"
                     /protein_id="BAB79726.1"
                     /transl_table=11
                     /translation="MGLKIIYGRAGTGKSTFCINQIKKKINNSPNNKLILLVPEQFTF
                     QTENKVLSAIGERYVLNAEVLSFKRLAHNVFNECGGATRTIMGDAGKSMLIFKVLEDL
                     GDNMTVFKNASRQKGFIDIASKTITEFKKYNVNNEVLDLTINEIEDENLKMKMEELKD
                     VFNEFNSRLHEGYVDEEDQLLLLNEKLDGCSLYDGAEIWIDEFSSFTPNQLSVIGKLL
                     KRAKSVNITLSIDEVNSLKGESDLFVATKNTEKRLMNLIQEEGIAFSGYINLNEDIPY
                     RFKENKELAHIERQLYAYPFKQYRGKNNSLRLYRANNNYDEIEFVAKDILRLVREKQY
                     RFKDISVICRDVDNYEKVVSAIFSEYEIPYYIDKKIDIASNPLIVFINSAVDIISKNW
                     TYESMFKYLKTGLIKEFRGIEGAELIDELENYVLAYGIKGKKWMEEWVNYSSSILKEE
                     EISEENKQRLERLNDIRETIVTPLDEFNKQCKGKKTLKEFATILYEFLDSKLDIMDTL
                     DKYVDYFKENDMAIEAKEYSEVRDIFIDVLEQAVDVLGNEVMDLNEFMKVLNIGLSQY
                     EMGLIPVALDQVNIGDITRIKSRGTKALYIIGVNDGVLPSASKEEGILSDNDREILLE
                     KGISLASDTRTKIFEEQFLVYTAFTIAEEYLVVTYPLADFEGKSQRPSIIVHRLKKIL
                     PNVKEESEGFKLVDDKYEKISAKIPTLNELMIAIRKNYDGAEIEDYWKYVYDWYLREP
                     KWKERIEYVRKGLEYTNLENNISKEKAKKLYEDNKNKISLSVSRLERYAQCPFAYYIQ
                     YGLKAKDRKIYEFTAPDLGSFMHEILDEFTNEIKEKDLKWSDLSKENCRNIINSLVDN
                     QVKNNKSSILNSSKRYSYFTDRFKRILTKSVMVISEQMKRSDFEIYKNELAFGFSKDV
                     NSIKLDLPSGESFYLNGRIDRVDKLNLDGETYLRIIDYKTGSKKFDLNKFYNGLQMQL
                     LVYLDALINNSENIVENQAMPGAILYFRIDDPILKSKGDLTEEEIKSEVLKELKLEGL
                     LLDDVKVVKAMDNTLEPGTHSLIIPANMKKAGDLGKNKALITMEQFELLRKYVNEKMV
                     EICQNMIEGKIDIEPCKENKNIVCDYCNYSHICQFDSSLEDNRYKVIPKKKDEDIWKS
                     INEKVGGEVNGD"
     CDS             29582..33388
                     /codon_start=1
                     /gene="addA"
                     /note="1268 aa, similar to sp:ADDA_BACSU ATP-DEPENDENT
                     NUCLEASE SUBUNIT A from Bacillus subtilis (1232 aa);
                     39.9% identity in 1256 aa overlap"
                     /note="CPE0021"
                     /product="ATP-dependent deoxyribonuclease chain A"
                     /protein_id="BAB79727.1"
                     /transl_table=11
                     /translation="MGTKWTEEQELAINTRKCNLLVAAAAGSGKTAVLVERIIKMITE
                     GENPVDIDKLLVVTFTNAAASEMRERIGDAISKALEKDPSSKVLQRQLALLNRASITT
                     MHSFCLEVIKNNFHLIDLDPGFRIGDQTECELIKQDILADLFEDMYAKDDECFKDLVE
                     AYGGSKSDDNLNSIILKFYNFIMSGPWPEAWLKDKVEEFNINSIEELEGKKWIEVLKE
                     SIILDLNNAYSMLTQARDIAEMGGGLEPYLVNINPEIIQVEELKIALSEGIVKFYNNL
                     MGASFGRLKSVRKASVDDERALEKTKSLRDESKKIIENLRDNVFETSLEEAVLGMKKM
                     YPLMKCLSGLVIEFSNRYRDKKREKDILDFNDLEHLCLEILIDKDEEGNIKPSQVALE
                     FKDRFEEVLVDEYQDSNTIQETIVGMVSRRDIENPNVFMVGDVKQSIYKFRQANPELF
                     LEKYINYREFEDSNRKIMLYKNFRSREEIINGVNYIFKTLMSNTVGELEYDEKEALNL
                     GASYGELNEENVEKEYIDEIENLKVAGDIELNILNKAGNKDYSDEDELGEEEEDLDSI
                     QLEARIIGKKINELMNPEDGSHYMVFDKDLGKYRKIKYKDIVILLRATKNWAETFVDE
                     LGTYGIPVYADTGTGYFQTIEIRTILALLHIIDNPMQDIYILSALRSPIFSFTSEEFA
                     DLRLLNKDKYFFEIIKEVVDGIYDESISKDLKGKCKYFLDYLNKWREKAAYMPIDEFI
                     WFLYSDTSYYGYVGTMPNGVQRQANLRILFQRAKQYESTSFKGLFNFINFINKLKKSS
                     GDMGSAKILGENENVVRIMSIHKSKGLEFPVVILGGTGKQFNKMDLREDILLHETLGI
                     GTNCIDIKKRIKYDTLQKHAIKKKCELEVLSEEMRILYVAFTRAKEKLIITGAVSDLE
                     KSCENWCKASASSEDNRINPGNVLKGKSYLDWIGMALTKHKDGDAIRNIGNGDITLNL
                     DDKSNWSFKSWDRSELLETNNNKKEKNNIDIFESNNWIESKKDIKEVIEIRDRLGFKY
                     KYIESCNTPSNISVTELKRAHQEEEFMQESYNIIDNESNEENKKEKIKRKPRFMEERQ
                     EEFSAAKKGTITHFVMQHIDLDKVTYIDEIREEVLKMVKKELLTEEEGKVVNVFKIQK
                     FFKSDLGQRMLSSYKSGKKVYRELPFITEIPSSIIEKNLDPKIYGEEKVRLQGIIDAF
                     FKEEDGYVLLDYKTDYVKEGEEENFINKYKIQINLYKDTLNKILGEEVKEAYLYSFYL
                     EKELKI"
     CDS             complement(33646..34920)
                     /codon_start=1
                     /gene="papS"
                     /note="424 aa, similar to pir:A70188 polynucleotide
                     adenylyltransferase (papS) homolog from Borrelia
                     burgdorferi (410 aa); 38.2% identity in 411 aa overlap"
                     /note="CPE0022"
                     /product="probable polynucleotide adenylyltransferase"
                     /protein_id="BAB79728.1"
                     /transl_table=11
                     /translation="MLMKLPNNVQYILEKFNSNGFEAFIVGGCVRDSLLNKKPQDYDI
                     TTNAFPEKIEELFDKTIPTGIKHGTVTVLIDKNPYEVTTYRVDGEYLNNRKPKDVKFV
                     SNIEEDLSRRDFTINAMAYSPYLGFKDCFNGKEDLKNKLIRCVGDPDKRFSEDALRML
                     RAIRFSCQLNFKIEKLTAESIRKNFKLIKNISMERIQSEFTKIILSNDPDRGLMLLRK
                     LGFSDFLVEEFKNLKLINCYDLYDDIHDTYGLINSLPKKLHIRLAGLFYKVFNSENAV
                     EKCRTILKKLKYDNNTINDTCNLVENINNISCNMTRKKLKLLINAVGTENIFDLLDLQ
                     KSYLSYMDEYDTECIDILKNRVSDILASKEPIFIKDLAITGNDLITELNFKPGKNIGV
                     ILNFLLENVMQTPELNNKEDLLNLSKQFYSYN"
     CDS             35030..36022
                     /codon_start=1
                     /gene="CPE0023"
                     /note="330 aa, similar to pir:G69818 CMP-binding factor
                     homolog yhaM from Bacillus subtilis (314 aa); 41.2%
                     identity in 301 aa overlap"
                     /product="probable CMP-binding factor"
                     /protein_id="BAB79729.1"
                     /transl_table=11
                     /translation="MERKDRLMEIPVKKIGEFVKGERVEGFFLLKSVTLKTTNSGGKK
                     YLDLVLSDKTGDILGKVWEIKPEHEELKSNTVFKIRGTVNSWQGTLQLKVEHASKVTE
                     EDNINLDDFVQSAPYTSDEMFNTIKDTVHNMNDVDIKNILNRVLEINKDKLMYYPAAK
                     SNHHSIKGGLLYHITTMLKLADNICGIYDFLNRDLVYAGVILHDMAKIKEMSSNEMGI
                     VDEYTLEGTLLGHITQGIKEIEVIGKEVNADSKIIMLLQHMVLSHHYEPEYGSPVKPL
                     IPEAEMLHYLDVMDARMYDMKKAIKETKENEFSERIWSLDSRRIYNHGMYEKNN"
     CDS             complement(36054..37214)
                     /codon_start=1
                     /gene="CPE0024"
                     /note="386 aa, C-terminal portion is similar to
                     pir:A69760 conserved hypothetical protein yciB from
                     Bacillus subtilis (194 aa); 33.9% identity in 165 aa
                     overlap. Putative N-terminal signal sequence was found by
                     PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79730.1"
                     /transl_table=11
                     /translation="MKNKKLLISISSTILILLIIIVAYFILSFSNNLNKFKEDLALNN
                     YEAASNCFNNGTKNIILRKTFLKSSDSVIIEKLSEIENDYYSGDISEEETVEDLNGLL
                     SLNTSNEEILNFKNTLPLIKDSKDSFDIGISKLDEENYLEALNYFKSVHNLSDCKAQA
                     LEYEETCLDKIREPILETVDEYISNEKYSKGIEYLDSKINSLPDDPKLQKKRDELENL
                     RLEHLEDYSQKNIDKATARTAPVMEYYKKLNEDTINQFDITSNTNYLVFVNIAEQKTY
                     VYEGSKNDWTLDKTFTCSTGIEGKETPVGVFTVQNRAPWFFSPKYGQGGKYYVQFMGN
                     YLFHSIPFDSDKTTVSDPTLGVPSSHGCIRLSVEDSKWLYDNVQNGSKIIIY"
     CDS             37407..38627
                     /codon_start=1
                     /EC_number="3.4.11.-"
                     /gene="pepT"
                     /note="406 aa, similar to sp:PEPT_BACSU PEPTIDASE T (EC
                     3.4.11.-) (AMINOTRIPEPTIDASE) (TRIPEPTIDASE) from
                     Bacillus subtilis (410 aa); 59% identity in 400 aa
                     overlap"
                     /note="CPE0025"
                     /product="probable aminotripeptidase"
                     /protein_id="BAB79731.1"
                     /transl_table=11
                     /translation="MKKVHERFLEYVKVDTKSDETTRVTPSTKGQLELGKMLAEELKE
                     IGVDEVRISEEGYVYACLKSNCNKDIPKIGFISHMDTAPDMSGKNVNPKIVENYDGKD
                     IELGNGYTLSPSFSPELPMYKGQTLITTDGTTLLGADDKAGIAEIVTAIEYLINHPEI
                     KHGDIKIGFTPDEEIGEGADHFDVEGFGADFAYTLDGGRIGELEYENFNAASAKVEII
                     GKNVHPGSAKGKMINSILVAHEFVSMLPLDEVPEKTEGYEGFSFLLDIQGEVEKTSLS
                     FIIRDFDKEGFKNRKERFNEIAKELNKKYGEGTVTVTLKDQYMNMKEMIEPRMHIVET
                     AEKAMKQCGIEPIKNPIRGGTDGARLSFMGLPTPNLFTGGENFHGRYEYISINSMEKA
                     VEVILNIIKIYAEK"
     CDS             complement(38733..39608)
                     /codon_start=1
                     /gene="CPE0026"
                     /note="291 aa, similar to pir:D69841 hypothetical protein
                     yitS from Bacillus subtilis (283 aa); 36.8% identity in
                     280 aa overlap. 1 putative transmembrane region was found
                     by PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79732.1"
                     /transl_table=11
                     /translation="MKKFVIFTDSAADLPKSMVKDLDINYLGLICNIDNTEYIDNIDS
                     ELTPKAFYNKLREGIMPSTSQVNSFRFVEAFEEYVKQGISILYLAFSSALSGTYNSSL
                     IAREELLEKYPDADIKIVDTRAACLGQGLLVYYAAQMKKDGKSIDEIYSWVEENKNKL
                     CHYFTVDSLDHLKRGGRISSTAAAIGSLLSIKPMLYVNDAGELHNFAKAKGRKKSLKM
                     LFQELEKRIVNPNEQTIFIAHSDCVEDAETLAEMIREKYPVKDILIDYIGIVIGSHTG
                     IGTLAVFFLGDTKEP"
     tRNA            39798..39871
                     /gene="trnA-Arg"
     CDS             40045..41184
                     /codon_start=1
                     /gene="CPE0027"
                     /note="379 aa, partially similar to gpu:AE004265_8
                     hypothetical protein from Vibrio cholerae (383 aa); 27.3%
                     identity in 161 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79733.1"
                     /transl_table=11
                     /translation="MNYDFIITILDEHNESSILLAEKLKPKEIIYLYKKDEELKVLNS
                     LRQFYLNKFPNCNFSDEKLGKDIISSIEEIIKRMKSKNTAICLNQGNKKDILIMYTLA
                     LKHNIDGFFLDIPKEELLKLNLESVQCEKCNFVDLDVEDIIDSIGASIVVDSTEISEI
                     NIIETMTNYIASNLDLWKKYKIRLSDNSVFIHDESNPRSIKIDKELLSREEVMLLDKI
                     LNFLEENGQIKVKELEQCLKVTFQNEFIKGFIFKSGTWLEVLTKNIIEEIKSIDDIKS
                     GLLFLWNDKESRVKNELDVVAIKDSVLICVSCKDSKKYDEVALNELNVYSEQLGGENV
                     IKILVATHHPIKSSISKRAKEMGINLVVFDGNKKAFKEELEKIIK"
     CDS             complement(41300..42184)
                     /codon_start=1
                     /gene="psdD"
                     /note="294 aa, similar to sp:DPSD_CLOPA PUTATIVE
                     PHOSPHATIDYLSERINE DECARBOXYLASE PROENZYME (EC 4.1.1.65)
                     from Clostridium pasteurianum (296 aa); 53.1% identity in
                     294 aa overlap"
                     /note="CPE0028"
                     /product="probable phosphatidylserine decarboxylase
                     precursor"
                     /protein_id="BAB79734.1"
                     /transl_table=11
                     /translation="MIKIYNRKTKAYDVEQVAGLKYINWSYASPIGKSFLELFIKKKM
                     FSKLYGNFCDSSLSKKKIKAFIDEFNIDMSLCNKNIDEFENFNDFFARTLTPEARPID
                     YSENILISPGDGRLSAFENIDLDKVVQIKGYTYSLKELIDDPKVAEEFEGGTCLILRL
                     CPTDYHRFHFVDSGTCSESKKISGFYYSVNPIALNNVSELFCKNKREWSIFNSDNFGE
                     ILHVEVGATCVGTILQTYSPEKRVKKGEEKGYFKFGGSTTILFFKKDTIKIDSDIVEQ
                     TKLGFETKVNMGETIGHK"
     CDS             42348..42917
                     /codon_start=1
                     /gene="CPE0029"
                     /note="189 aa, similar to pir:S38906 hypothetical protein
                     4 from Clostridium pasteurianum (190 aa); 45.7% identity
                     in 186 aa overlap"
                     /note="TetR/AcrR family"
                     /product="probable transcription regulator"
                     /protein_id="BAB79735.1"
                     /transl_table=11
                     /translation="MNRTKKAIFEAAINVFATSGYNGSTVDEIASKANVAKGTLYYNF
                     KSKEEIFNFVISKGLEIWHEKLTDIENLEDEPIEKLKKLFKMQFELLYENRAFFKMVM
                     SQLWGKETRQDELRNKITEYIEGIERILKEAISKKQIRECDISLLAHSLFGSLISTSL
                     YELSRDKEFNVNKVIDEITINILDGIVIK"
     tRNA            42972..43043
                     /gene="trnA-Arg"
     CDS             43192..44457
                     /codon_start=1
                     /gene="hlyA"
                     /note="421 aa, similar to pir:F72326 hemolysin-related
                     protein from Thermotoga maritima (strain MSB8) (455 aa);
                     34.2% identity in 401 aa overlap.Similar to many putative
                     hemolysins. Putative N-terminal signal sequence and 3
                     putative transmembrane regions were found by PSORT."
                     /note="CPE0030"
                     /product="probable hemolysin-related protein"
                     /protein_id="BAB79736.1"
                     /transl_table=11
                     /translation="MDPYTFQIVLLIILIILSGFFSASETALMALSRIRVRHMVDEEI
                     KGAKLLEKLLEDPNKLLGGILIGNNIVNIGASSLASTLAFRIFGDGGVALATGVMTIL
                     VLIFGEITPKSLAKQNAEKVSLAVAPIINIVVTVFKPLVWLFSSVSSLIVRLLGGDLN
                     KSEPFITEEELKTMVDVSEEEGVLEVEEKEMIFNVFEFGDLQVKDIMVQRVNVIAVNV
                     TATYEEVLKVIKEQQFSRIPVYNESIDDIVGILNVKDLILLDSDEENFNVTEYMREPF
                     RTFEFKKITELFAEMKTTRNHIAVVLDEYGGTVGIVTIEDLIEEIVGDIEDEYDERDK
                     DIEVIKENEFVVDGSTRLSDLSDMIGFEIESEEFDSIGGYVIGYLGRMPKVGEEIKTN
                     DFRVIVEELDRNRVKKVRVYTYKREKEES"
     CDS             44460..44891
                     /codon_start=1
                     /gene="CPE0031"
                     /note="143 aa, similar to sp:YAAJ_BACSU HYPOTHETICAL 17.8
                     KDA PROTEIN IN SERS-DNAH INTERGENIC REGION from Bacillus
                     subtilis (161 aa); 52.8% identity in 125 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79737.1"
                     /transl_table=11
                     /translation="MLSLALEEAEKAREKGEVPVGAVIVKDGEIIARAHNLKETLKDP
                     TAHAEILAIREACNKLNNWRLHGCEMYVTLEPCPMCAGAILQSRLSKIYIGTFDDTTG
                     AAGSVVNILQNHNLNYFLEVVWQNDEKCSKILTKFFKDRRG"
     CDS             44954..45412
                     /codon_start=1
                     /gene="CPE0032"
                     /note="152 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79738.1"
                     /transl_table=11
                     /translation="MSKLDMMVGYEMNFYEKKFEENIKKLSYYMHRCFNETIGEKVAG
                     IAIEENLLYAWSYYFVTIADEDPKMGDRIMMGLINHFNTLLEDENVRINGKEGAKLMI
                     DPSFCRVWFGTSLNVMLVKKYGEEDYKEVFNYIKDNYLQKECKIRSLKVS"
     CDS             45536..45901
                     /codon_start=1
                     /gene="CPE0033"
                     /note="121 aa, no significant homology. Putative
                     N-terminal signal sequence and 3 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79739.1"
                     /transl_table=11
                     /translation="MKINKRYLAIFLILLIIEIFIALFVHDNFIRPYIGDVLVVIVIY
                     TFIRGIIGRKIKNLPTYIFLFGVLVEILQYFRIVEILHLQNSRFFTILIGTSFDVKDI
                     ICYFVGTLILIFWEVINKE"
     CDS             46011..46673
                     /codon_start=1
                     /gene="CPE0034"
                     /note="220 aa, similar to sp:Y531_BORBU HYPOTHETICAL
                     PROTEIN BB0531 PRECURSOR from Borrelia burgdorferi (204
                     aa); 27.5% identity in 193 aa overlap. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79740.1"
                     /transl_table=11
                     /translation="MKEDQFNIETLIVAILVMLTIINIDVVHVTEAQSVKIEIETEED
                     IPIVSDVFITVDDAKKWAQGKGATKEFIELADLYWEYSDEHGDVNPALAYVQAAKETA
                     YGNFGGVLDSSYHNPCGLKTNKGGSDKDPKAHMKFKSWNEGVKAHLDHLALYAGAEGY
                     PKVETKDPRHFASIFGKANSVIDLSKNWAPSPTYGEEILGMYNEMMEGAGNKDIEVMN
                     IF"
     CDS             complement(46787..48259)
                     /codon_start=1
                     /gene="yplC"
                     /note="490 aa, similar to sp:YPLC_CLOPE HYPOTHETICAL 55.7
                     KDA PROTEIN IN PLC 5'REGION (ORF 2) from Clostridium
                     perfringens (490 aa); 98.8% identity in 490 aa overlap"
                     /note="CPE0035"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79741.1"
                     /transl_table=11
                     /translation="MDNKNFQSKTGFNLENTYLTLPNIFFSEQNPKGSKNPKLIKFNT
                     SLAEELGLNEEVLNSDFGLNIFAGNETFPGIVPIAQAYAGHQFGHFTMLGDGRALLLG
                     EHVTKDCKRYDVQLKGSGRTIYSRGGDGKAALAPMLREYIISEGMHGLGIPTTRSLAV
                     VSTGEEVLRERFEQGAILTRIASSHIRVGTFAYAAQWGTLEDLKSLADYTIKRHFPNI
                     ADNENKYILFLEEVINRQAELIVKWQSVGFIHGVMNTDNMVISGETIDYGPCAFMDTY
                     DTNTVFSSIDYAGRYAYGNQPNMALWNLARFSEALLPLLNPNLDEAVNIAKKSISNFS
                     KLYKKYWFNKMRTKLGLFTEKENDELLIEGLLSTMQKYEADFTNTFVSLTLNKFEDEK
                     VFSSDEFKTWYALWQNRLKEENRPQEEVRNLMMNNNPYIIPRNHLVEEALKNAEKGDF
                     TFMDNLLEALKNPYSYSKDLEKYTKLPEKSDTPYVTYCGT"
     CDS             48590..49786
                     /codon_start=1
                     /gene="plc"
                     /note="398 aa, similar to gp:CLOCPAA_1 alpha-toxin
                     (phospholipase C) from Clostridium perfringens (398 aa);
                     100% identity in 398 aa overlap. Putative N-terminal
                     signal sequence was found by PSORT"
                     /note="CPE0036"
                     /note="alpha-toxin"
                     /product="phospholipase C"
                     /protein_id="BAB79742.1"
                     /transl_table=11
                     /translation="MKRKICKALICATLATSLWAGASTKVYAWDGKIDGTGTHAMIVT
                     QGVSILENDLSKNEPESVRKNLEILKENMHELQLGSTYPDYDKNAYDLYQDHFWDPDT
                     DNNFSKDNSWYLAYSIPDTGESQIRKFSALARYEWQRGNYKQATFYLGEAMHYFGDID
                     TPYHPANVTAVDSAGHVKFETFAEERKEQYKINTAGCKTNEDFYADILKNKDFNAWSK
                     EYARGFAKTGKSIYYSHASMSHSWDDWDYAAKVTLANSQKGTAGYIYRFLHDVSEGND
                     PSVGKNVKELVAYISTSGEKDAGTDDYMYFGIKTKDGKTQEWEMDNPGNDFMTGSKDT
                     YTFKLKDENLKIDDIQNMWIRKRKYTAFPDAYKPENIKIIANGKVVVDKDINEWISGN
                     STYNIK"
     CDS             49974..50900
                     /codon_start=1
                     /gene="cobW"
                     /note="308 aa, similar to pir:H70313 cobalamin synthesis
                     related protein CobW from Aquifex aeolicus (292 aa);
                     30.7% identity in 261 aa overlap"
                     /note="CPE0037"
                     /product="probable cobalamin synthesis related protein"
                     /protein_id="BAB79743.1"
                     /transl_table=11
                     /translation="MKVDIISGFLGAGKTTLIKKLLDTLVKDEKVAIVENEYGEVGID
                     GDLLKDRRIEVKEINSGCICCTIKGDFKQNILDIISNYRPDRVIIEPSGVANFSQVLE
                     SIKEAHIEGLRINMKITMVDAQNVHMYMKNFGDFYRSQLVNANTIILTRVEKLSDKEI
                     THVCNEIKTINNKANIITTELSKLSPERIIQVSEKKVESLIENINIKKPKRIGLRRVS
                     APEFFENWGVETPKTFEYSELVKILNEFQNNKHGEVLRAKGIIKSKDNKWFKFDFVPN
                     DISIVNYKSDYTGRVCVIGRNLNKDSIDKLFS"
     CDS             50920..51504
                     /codon_start=1
                     /gene="CPE0038"
                     /note="194 aa, similar to pir:B69760 conserved
                     hypothetical protein yciC from Bacillus subtilis (397
                     aa); 28.2% identity in 174 aa overlap. 1 putative
                     transmembrane region was found by PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79744.1"
                     /transl_table=11
                     /translation="MKKCSVDLITGFLSSGKTSFINHILDDFSKEEVLVIQCECGQEE
                     LINCRKNVNIKKFYSMDELKEEDLIRSLKFYAPKRVFIECNGVSETKKFIDKVTNSKL
                     KEYLKLGIIVNLIDMTTFNMFLKNIPSMIIPNISLSNLIVLNKCNEISGNALKEYKDM
                     IEKFNHNAHIVNCIGKEGTNMNFNKERIINRMMG"
     CDS             51507..52400
                     /codon_start=1
                     /gene="CPE0039"
                     /note="297 aa, similar to gpu:AP001512_105 BH1518 gene
                     product from Bacillus halodurans (337 aa); 39.6% identity
                     in 283 aa overlap. Putative N-terminal signal sequence
                     and 5 putative transmembrane regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79745.1"
                     /transl_table=11
                     /translation="MELLNKFSIVFSSIVIEALPFILIGAVLASFMQVYISNNIFNKI
                     ISKNKLLGSIEAGIIGVFLPVCECATVPITKGLLNKKVPLNVAITYMLAAPIVNPLVI
                     LSTYYAFDGNIKVVLLRVGVGFSIAVIAGLLMLCLSGENNIFIDNGEGELQGKCLCGC
                     SEIDDNSSKLIRLLKHTSLEFYEIGKYFIVGATLAAIFQTFVPRDIIFYFENSAVLSI
                     IILMAFSFLISLCSEADAFVASTFMNRFSLGSITGFLIIGPMIDLKNTIMLFSIFKKS
                     FVIKLLFVVFSLCFIASALIF"
     CDS             52413..53132
                     /codon_start=1
                     /gene="CPE0040"
                     /note="239 aa, partially similar to gpu:AP001512_104
                     BH1517 gene product from Bacillus halodurans (321 aa);
                     26.9% identity in 108 aa overlap. Putative N-terminal
                     signal sequence and 2 putative transmembrane regions were
                     found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79746.1"
                     /transl_table=11
                     /translation="MRKFNFSEFIWFLILFCFEYLIVKMFMSEKIFLIISRDMKAYVI
                     LAIILLFLILVIQFFNIFKTSTRRSFKGGYLIFIFALVILNIANGLNINQVSLNLKGV
                     KLYHDRHKESEHNHLHSNEKLNSNEALVFTEKNFHSSLEELILHLEDFVGKEISIEGL
                     LYVSELYEKEEFAITQIDMTCCIADSVYLGVLCKGDLPDLKNGSEIKVKGLVESKKIK
                     NSAGEEIEIPFINVFYTDTLQ"
     CDS             53398..54186
                     /codon_start=1
                     /gene="CPE0041"
                     /note="262 aa, similar to sp:LGT_BACSU PROLIPOPROTEIN
                     DIACYLGLYCERYL TRANSFERASE (EC 2.4.99.-) (SPORE
                     GERMINATION PROTEIN GERF) from Bacillus subtilis (269
                     aa); 39.3% identity in 257 aa overlap. 7 putative
                     transmembrane regions were found by PSORT."
                     /product="probable prolipoprotein diacylglyceryl
                     transferase"
                     /protein_id="BAB79747.1"
                     /transl_table=11
                     /translation="MNPVAFSIGSFEVRWYGIIIALGILIAMTLVSINAKKKNLNFDV
                     ILDLFLWCFPFAIIGARAYYVLFELENYHSFWDMINIRQGGLAIHGGIIGAFLTAFIY
                     CKVKKVDFLAYADIVAPAFILAQGIGRWGNFFNQEAHGGQVTSEFISKFPEFIQRGMY
                     INGAYYHPTFLYESIWDIFVAILLMIILYNITDRYKGVVISAYISLYSLGRFFIEGLR
                     TDSLYFMNIRVAQLVSLLGIIIGIVAIIIIVSRGKKKRKGIFIN"
     tRNA            54437..54523
                     /gene="trnA-Ser"
     CDS             54959..55462
                     /codon_start=1
                     /gene="CPE0042"
                     /note="167 aa, similar to gp:CLOSERTRNA_1 Orf1 from
                     Clostridium perfringens (167 aa); 82.6% identity in 167
                     aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79748.1"
                     /transl_table=11
                     /translation="MGRKLLVGILWVTLSLFVLGCSTSGEKNTINIPIEKSREEEKSK
                     DEEEYIDKISSTIVNMSVDGSIKNMRTVSETGKLNNTMIEQLERSNNFFKCLIEDLKG
                     VKVPEKFASYNDDIINNLNKAKTSLEAMKNSHDEETIKSNAKIFVESNKEVSNLVDKI
                     LVYYAGC"
     CDS             55899..57185
                     /codon_start=1
                     /gene="brnQ"
                     /note="428 aa, similar to gp:CLOSERTRNA_2 sodium-coupled
                     branched-chain amino acid carrier from Clostridium
                     perfringens (338 aa); 95.3% identity in 338 aa overlap.
                     Putative N-terminal signal sequence and 11 putative
                     transmembrane regions were found by PSORT."
                     /note="CPE0043"
                     /product="sodium-coupled branched-chain amino acid
                     carrier protein"
                     /protein_id="BAB79749.1"
                     /transl_table=11
                     /translation="MNKKKDILVIGFALFSIFFGAGNLIFPPYIGLTSGGEWLISFLG
                     FIISDVGIIFLSIVAVSKAGSFQGVVGRAGKKFGITLEILMMLCLGPILVVPRTAATT
                     FEMSISPLLGNVNPYVFSVIFFLIVFVLTIKPNKVMDIIGKVLTPLLLISLAVLIIKG
                     IINPIGDLENVNSGKLFMTGITQGYQTMDALGTGGIVALVMASFASKGYKDKKENRML
                     TIKSALIACIGLAIVYGGLTFLGATSSTLYDSSISQTTLLMNITNAILGSTGTIMLAI
                     VIGLACLTTAVGLTSVTAKYFEDVSNKKLKYKYIVIAICVFSALSSNLGVDKIIEIAV
                     PILSLIYPVSILLVVMSIFEKFVPNNVVVKGATYATLLISLLTVIDSLGIKFEFVHKL
                     PLANLGFNWVVPAIVGGLIAGLVFRKREVVSLEESY"
     CDS             complement(57339..57824)
                     /codon_start=1
                     /gene="folA"
                     /note="161 aa, similar to pir:S52336 dihydrofolate
                     reductase (EC 1.5.1.3) from Haemophilus influenzae
                     (clinical isolate R1042) (160 aa); 40.4% identity in 136
                     aa overlap"
                     /note="CPE0044"
                     /product="probable dihydrofolate reductase"
                     /protein_id="BAB79750.1"
                     /transl_table=11
                     /translation="MFSIIVAKSINNIIGVNNKMPWNIPSDLKRFKELTMGKKILMGR
                     KTFESLPFVLPGRTHLVLTTKKDFSYNHKDIIIYNDLNKLIEEYKDSKEEIFVIGGGK
                     IYSELLKYTSKLYITEVLKEYKGDTYFPKVDYSKWIKTYESSIYEENDNKFKFFNYKK
                     I"
     CDS             58015..59658
                     /codon_start=1
                     /gene="dnaX"
                     /note="547 aa, similar to gpu:AP001507_34 DNA polymerase
                     III gamma and tau subunits from Bacillus halodurans (564
                     aa); 47.7% identity in 398 aa overlap"
                     /note="CPE0045"
                     /product="DNA polymerase III gamma and tau subunits"
                     /protein_id="BAB79751.1"
                     /transl_table=11
                     /translation="MAYKALYREWRPQTFNDVVGQEHITTTLKNQIINERTAHAYLFC
                     GTRGTGKTSTAKVMAKALNCLDLKDGEPCNQCEMCKKINEGLAIDITELDAASNNGVD
                     KIRDIIDDVQYPPQEARFKVYIMDEVHMLSIGAVNAFLKTLEEPPKNVVFILATTDPQ
                     KLPITILSRCQRFDFKRISRKDITGRLRKIVTEQGIFCDDKSLDLVARVSDGAMRDSL
                     SILDQAISIGDGKVDYDELVSMLGLVTNDNLFKIVDSIIKRDIESAMEIIEELVLTGK
                     DMTLFIKDLIVHYRNLLMIKVTSNPEEVLDTAEENIEKLKVQGSKLKVEEIMRCIRIV
                     QECDEEAKLSKQARVYLELAVIKMCKIEYDTSKEVMLARINKLEQAIRSGNIQVNTNL
                     EEVKSQVSNEASNNKTLNNKQQNAIKSSNNYEVVNENSTLTPEYLRKVWKDILETFKS
                     RGKYMVYIALAKGISKVSCNKGVVEFRYTYEYRHNKERLEKHDFSKIVNDIFSEVLKE
                     PVRVVYSVEQGTEEEKAEEADLEARLSGIMGDGLEIVEE"
     CDS             59770..60108
                     /codon_start=1
                     /gene="CPE0046"
                     /note="112 aa, similar to sp|P24281|YAAK_BACSU
                     HYPOTHETICAL 11.8 KD PROTEIN IN DNAZ-RECR INTERGENIC
                     REGION from Bacillus subtilis (107 aa); 60% identity in
                     50 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79752.1"
                     /transl_table=11
                     /translation="MARGGFPGGMGNMNNLMKQAQMLQKQMQSMQEEIEASEFEGSAG
                     GGAVVAKVNGKKELIALNIKPEVVDPDDVEMLEDLVFSAVKQALEKASEETSEKMGKL
                     TGGMGMPGLF"
     CDS             60206..60802
                     /codon_start=1
                     /gene="recR"
                     /note="198 aa, similar to sp:RECR_BACSU RECOMBINATION
                     PROTEIN RECR from Bacillus subtilis (198 aa); 63.5%
                     identity in 192 aa overlap"
                     /note="CPE0047"
                     /product="DNA repair and genetic recombination protein"
                     /protein_id="BAB79753.1"
                     /transl_table=11
                     /translation="MEFYPVAIEKLIEEFAKLPSIGKKSAQRLTLHILNLPKDEVEEF
                     ANALVKARGTIKYCSVCGNFTDTDPCAICSNPNREKDIICVVEQPKDIMTMEKVKEFN
                     GLYHVLHGTISPMQGRGPQDIRIRELVARMSGDVKEVIVATNPTIEGEATAMYISKIL
                     KPLDVKVTRIAAGIPVGGDLEYADEVTLSKALEGRTVI"
     CDS             61028..61306
                     /codon_start=1
                     /gene="CPE0048"
                     /note="92 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79754.1"
                     /transl_table=11
                     /translation="MDKKKISDYLIKKIDYSNQDEEILKAIEQTILEMEVARSAFQNA
                     CDDKLIESLIYKEQDINARYEYLIREAKKRGIKVSMEHIFKNARISII"
     CDS             61322..61600
                     /codon_start=1
                     /gene="CPE0049"
                     /note="92 aa, no significant homology. Putative
                     N-terminal signal sequence and 2 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79755.1"
                     /transl_table=11
                     /translation="MDIGALSLDDIILLIIGVLVAILILRLIFGSIGKIIGLVINSVF
                     GAILLMIVNYFGAYFGITIGINLLTALIAGILGIPGVVLMILFQVFVR"
     CDS             61875..63005
                     /codon_start=1
                     /gene="CPE0050"
                     /note="376 aa, no significant homology. 8 putative
                     transmembrane regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79756.1"
                     /transl_table=11
                     /translation="MKSNNLILDKYKSRGIRGLIVLGITYFFLMGNYSMIRYFFQAGQ
                     GDLDISIINKCFSMGSVDKFLLFLFLVWSVGFLFQDKEKELKENLAVGEENTKKYFFS
                     KVILIYGVSLIPMVINIFIKLIFYIPYRNSFSLDKLIISFLYFIALGLLFTSIIFTMN
                     LIVKDRMFAGVFPIFFMEGLILIFSVSKLLISDKLILVRNSLGFIGEKVLLIFNLLNL
                     DFDTNSFSLGRQFIFIIILVLISILLIYLSRLILKIMNFKYLDRPYFFEIPRYFIYIS
                     MSILIGFVFVNAVGYLIIMFIPSVSYVNGTLMVNIASLISMVLLFVFLEVLYRRKILN
                     KDLVEDNIEVCNEIQPCIGDFIEFDETTGFLDNKTIDKEENF"
     CDS             63169..63348
                     /codon_start=1
                     /gene="CPE0051"
                     /note="59 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79757.1"
                     /transl_table=11
                     /translation="MAVGTSINCKYCIDFKNDRCDGTEKNCLCRLCPRNLGQCICVKY
                     CRETESVLFWNDEEE"
     CDS             63417..63599
                     /codon_start=1
                     /gene="CPE0052"
                     /note="60 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79758.1"
                     /transl_table=11
                     /translation="MAISEEFIDIAENCVDYSARHREAVSSMNSCKSCLNCNEFHSGT
                     CEKEMENKFNILQDMI"
     CDS             63763..64839
                     /codon_start=1
                     /gene="CPE0053"
                     /note="358 aa, similar to pir:E71001 probable
                     transaminase (EC 2.6.1.-) PH1308 from Pyrococcus
                     horikoshii (386 aa); 38.6% identity in 342 aa overlap"
                     /product="probable transaminase"
                     /protein_id="BAB79759.1"
                     /transl_table=11
                     /translation="MHKKLFIPGPVEVREEVLEKMATPMIGHRSKEASQLQRRISDNL
                     RKLFFTNNEILLSTTSGSGLMEGAIRSCTLKKAAVFSVGAFGDRWYEMGISNNVPVDK
                     FEVPWGKSINIDLIDSVLKTGQYDLITVTHNETSTGVMNDLEAISKVIRKYPEVIFCV
                     DAVSSAGGSKIEVDKLNIDICITSSQKALGLPPGIAICTFSERARERSEKVKFRGTYL
                     DLLALYKYIKKKDYQYPSTPSISHMYALDYQLDYILNVEGLENRFNRHIEMSKIVREW
                     AEKYFEIYPENGYYSNTLTTIKNNKNIDIGALNKELGKRGFQISNGYGKLKDKTFRIA
                     HMADCQVKDIKELLSNINEILELE"
     CDS             64908..65813
                     /codon_start=1
                     /gene="serA"
                     /note="301 aa, similar to pir:B72257 D-3-phosphoglycerate
                     dehydrogenase from Thermotoga maritima (strain MSB8) (306
                     aa); 42.4% identity in 297 aa overlap"
                     /note="CPE0054"
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="BAB79760.1"
                     /transl_table=11
                     /translation="MLRILLNDGLDKKAISNLEFLGFDVDTNHYDIEDLKEKIKKVDC
                     IVIRSATKIRRELIDEAIKGGKLKLIIRGGVGVDNIDVQYAEQNGIKVRNTPNASSSS
                     VAEIILAHMFSLARFLNQSNITMKAGLWKKKDYVGVELEGKTLGIIGMGRIGSELAKK
                     CTALGMKIIYFDLMDIKNIDNNYRKVEFDELLRESDFISINISGTKSIIGSEELKKVK
                     KGVFIINTSRGKALDEEAIITSLNDGTLGGVGLDVFLEEPSKNLELINHPKVSLTPHI
                     GASTKEAQMKIGEEVINIIKEEMYN"
     CDS             65960..67216
                     /codon_start=1
                     /gene="CPE0055"
                     /note="418 aa, similar to pir:G72244 hypothetical protein
                     from Thermotoga maritima (strain MSB8) (406 aa); 41.9%
                     identity in 415 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79761.1"
                     /transl_table=11
                     /translation="MVNIKAFKALRPRKDLVEKVAAFPYDVLSRDEAKEEVKNNEFSF
                     LNIDKAETYFSENISEYSEEVYKKAGENLETFIQNNIFIKEEKDCLYVYELVLDGKAQ
                     RGIVSCLSVDDYLNNTIKKHEFTRAKKEEDRVKHIKACNAQTGPIFLTYRDSEKISNI
                     VSKIVLEKPLYDFISDDGVLHRVWKIEDKSIIDEIIKEFKEINSIYIADGHHRSEAAV
                     KVCLERREKGECLPEDECNYFLGVLFPKTELTVIDYNRVVKDLNGLSEEEFLLKLEEK
                     FQITKLNKEDNPKPKYKGEFGMYINGDWFKLEYKEKNESSLIEKTKTDLVKNLDVSIL
                     QYNILEPILGIKDVRNDERIDFVGGIRGLKELERRVSEDMKVAFALYPTSIEEVMKIS
                     DKGLIMPPKSTWFEPKLRSGIFIHKI"
     CDS             complement(67272..67967)
                     /codon_start=1
                     /gene="mtn"
                     /note="231 aa, similar to gpu:AP001518_69
                     5'-methylthioadenosine/S-adenosylhomocysteine nuclosidase
                     from Bacillus halodurans (233 aa); 42.8% identity in 229
                     aa overlap. 1 putative transmembrane region was found by
                     PSORT"
                     /note="CPE0056"
                     /product="5'-methylthioadenosine/S-adenosylhomocysteine
                     nuclosidase"
                     /protein_id="BAB79762.1"
                     /transl_table=11
                     /translation="MTLGIIAAMSEELEILLKDMEVKSKETKANMTFHQGTLWGQEVV
                     AVVCGIGKVNAAVCTQILISEYKVDKVINVGVAGGIGMEIYPGDVVIGNSLVQYDMDT
                     SAFGDPIGQIPRLDTFDFKCSQELVDLCEEACKENEEIKSFTGRIVTGDQFVASVEKV
                     KWLEEEFGASACEMEGGSIAHVCYLNNIPFLVIRSISDNANNGAHMDFAEFTAIGVKN
                     STSILKSMILKMA"
     CDS             68347..69108
                     /codon_start=1
                     /gene="CPE0057"
                     /note="253 aa, similar to gpu:AP001511_144 BH1255 gene
                     product from Bacillus halodurans (259 aa); 37.4% identity
                     in 246 aa overlap. 2 putative transmembrane regions were
                     found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79763.1"
                     /transl_table=11
                     /translation="MLQHSLSRTELLIGKDALDKLAKSKVMVFGVGGVGSFTVEALAR
                     AGVGNLILVDDDTVCLTNLNRQIHATYKTISKNKVEVMKERVLSVNRNCNVETIQVFV
                     TPDNLEEIIPDDVDYVVDAIDTVSAKIALAVYCEQKGIKLMSSMGTGNKLNPAEFKVA
                     DIYNTKVCPLAKVMRYELRKRGVKKLKVVYSEEMPRKPKVEDVVTCKTGCVCTGGTKK
                     CSAKRQIPGSVSFVPPVAGMIIASEVVKDLIKEYI"
     CDS             69399..70565
                     /codon_start=1
                     /gene="CPE0058"
                     /note="388 aa, similar to pir:S66834 probable membrane
                     protein YOL137w from yeast (Saccharomyces cerevisiae)
                     (497 aa); 25.2% identity in 262 aa overlap. Putative
                     N-terminal signal sequence and 10 putative transmembrane
                     regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79764.1"
                     /transl_table=11
                     /translation="MNSKKQNYVALAFLFIMMILAAIVENTKGIFIPVFKQEFGVNDN
                     TISNLLISTSAAYMVLTFIGGMLCEKFGQKKVFLAGLMVIFLSLIFLSFTKNYLMLYT
                     GMVISSAGIAMVAISCNTVLPILALTAQNVIMNVMHACYGLGSSVGQGLFGSLTARGV
                     NWRTMYFFVGLVYLAVFICFIFVKIPRTEIVKEKDKMTIIEALSNKVIVAYMLALGLY
                     VFTEQGISNWFVNYMKYGYNINEQKAGMYLSLFFAIFTIGRLFGGFVVEKRGYFNILY
                     KTLIIGAALCILGLLLGRNGMVIISVSGLFFSITFPTTVLTISKVFDKNVAYITGIVI
                     TSASLVGMILNKAIGLLNESVGPDKAFYIIPASAILSAILMFYLYLNTKKRLVK"
     CDS             70590..71528
                     /codon_start=1
                     /gene="CPE0059"
                     /note="312 aa, C-terminal portion is similar to
                     gpu:AP001509_23 ribosomal-protein (S5)-alanine
                     N-acetyltransferase from Bacillus halodurans (182 aa);
                     39% identity in 164 aa overlap"
                     /product="probable ribosomal-protein (S5)-alanine
                     N-acetyltransferase"
                     /protein_id="BAB79765.1"
                     /transl_table=11
                     /translation="MSFDKNVFIEAIRGNDREYVVKDKVGIILGRFFLKDLDSKNKKV
                     DVKFKFYKEDNYKLMKETLRKILKVLFAEKDIYKINLFVSDIKNFNAYLDLGFMLEGI
                     LSDNVCNNGIQKDEYIMGININDFNDKVKLVQFQLNTERLALRNLTPENTEEMLDYYI
                     RNEEHLRQYEPTRDSSFYTYEGQKEILTESFRQFIDGTSIDLGIFKDEKLIGKIKLSN
                     IVYGILRNAFVGYSIDKEYQGKGYMKKALNTVCSYAFEEMGLHRLEASTLMDNSRSQG
                     VLKACGFNELGISEKYLYINGEWRDHKIFYKVNDDL"
     CDS             71545..72231
                     /codon_start=1
                     /gene="dgk2"
                     /note="228 aa, similar to pir:B56168 deoxyguanosine
                     kinase (EC 2.7.1.113) from Lactobacillus acidophilus (224
                     aa); 44.2% identity in 199 aa overlap"
                     /note="CPE0060"
                     /product="probable deoxyguanosine kinase"
                     /protein_id="BAB79766.1"
                     /transl_table=11
                     /translation="MLSLNTKNNLYREILDRIDRGGNWEMIVVDGVVGVGKSTLMNIL
                     AERGLIAYEEPVVDNPILEKFYYDRNRYSFPLQVFFLNKRFKHIKEAGLVENSVMDRS
                     IYGDVIFAKMLCEKGEMTVEEFELYKELLENMLEHVKAPKLMVYLEISVDEAMKRIQK
                     RGRDYEQVVEREYWEKLNNEYREYFENYNVSPILRINVDELDFENVPEDREYVLNLID
                     EKLSELENNK"
     rRNA            72786..74291
                     /gene="rrnB-16S"
     rRNA            74480..77384
                     /gene="rrnB-23S"
     rRNA            77479..77593
                     /gene="rrnB-5S"
     tRNA            77603..77676
                     /gene="trnA-Met"
     tRNA            77685..77757
                     /gene="trnA-Ala"
     CDS             78534..79856
                     /codon_start=1
                     /gene="CPE0061"
                     /note="440 aa, similar to pir:T35220 probable integral
                     membrane transport protein from Streptomyces coelicolor
                     (474 aa); 28.8% identity in 427 aa overlap"
                     /product="probable integral membrane transport protein"
                     /protein_id="BAB79767.1"
                     /transl_table=11
                     /translation="MGKPKLKKEIGLFTATALVVGNMMGSGIFMLPASLASVSGPGST
                     IMAWLLTGLGSLVLALTFANLGSKIPKTGGTYEYSRLAYGNFMGFMTAWLYWNGSWIG
                     NATIFIVITTYLGEVITSLTNSPIIGFLFCSSILWICTYINIRGTKLAGRVASVITVF
                     KVLLFIFFIVVGLIYFDPSNLTPMFPDGKGVSTIPVAASLTLWAFMGLETASVAGGEI
                     KDPEKNVKRSTILGMLISTVLYILISVVAMGAMSQSELASSTAPISDIIVKVLNLKSL
                     NFLNIAIAISILGTAMGWLLSTARVGYAAGEDGIFPSVFAKVHPKYNTPHVALIIGSI
                     FINIIFLMNFTKGLAGAYSFIVVLATLSYLPIYAISTIAEIILMVKEEKKPTFKKHLG
                     LIIRCLIGFAFAIWAIYASGAEIVMYGFILILLGVPIYGYMSIKKHFR"
     CDS             79983..80132
                     /codon_start=1
                     /gene="CPE0062"
                     /note="49 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79768.1"
                     /transl_table=11
                     /translation="MAKVEALEEELVELKLKKRNFILANKDTKEIDNLIKNLEEEIMR
                     IKSNN"
     CDS             80480..82504
                     /codon_start=1
                     /gene="glgB"
                     /note="674 aa, similar to gp:A14658_1 amylase
                     (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from
                     Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa
                     overlap"
                     /note="CPE0063"
                     /product="amylase"
                     /protein_id="BAB79769.1"
                     /transl_table=11
                     /translation="MTLVEVKDDKLEIKPVRLRKEKYKTQLKNKIFNEDDLYLFHEGR
                     NYNAYNFMGAHFTSENRKRGVRFTLWAPRAKNIFLVGDFSNWETKEENKLERINETGL
                     WSIFIPRLKEGIKYKYYIEQEDGKAVLKADPYGIYSEVRPNTASILCEKTKIRWSDKK
                     WLNKREETNYFESPINIYELHLGSWKRKDEDEFLSYDELSIILPKYIKEMGYTHVEFM
                     PLNEHPLDASWGYQVTGYYSITSRYGDIKGLKRLINALHKEDIGVILDWVPGHFCKDE
                     QGLYMFDGTPTYEYEEKWKADNKGWGTFNFDLGKPEVKSFLISNAFYFINEFHIDGLR
                     VDAVSNMLYLNYGRNHGEWVPNIYGGNENLEAIQFIKELNEAIKTYSKGVITIAEEST
                     SWPNVTNDTEYGGLGFDFKWNMGWMNDTLEYNELDPIYRKYHHNKLTFPMMYNHSEKF
                     ILPISHDEVVHGKKSLIDKMQGDYWNKLANLRAYMAYMYGHPGKKLMFMGCEFGQFIE
                     WREYEELEWKLIDKFDMHRKTHNFFKDLNNFYKNNSELWELDYDQDGFQWIDADNNEQ
                     SIYIFIRKSKNIEKYKIFVCNFTPMVYYDFNIGVPEKGVYREIFNTDKEEYGGSGQVI
                     KGNLFSRKGWCHNQQYTLTIKVPPMAVSVFERIIEENKTEEKIVKEDKYI"
     CDS             82532..83980
                     /codon_start=1
                     /gene="glgA"
                     /note="482 aa, similar to sp:GLGA_BACST GLYCOGEN SYNTHASE
                     (EC 2.4.1.21) (STARCH [BACTERIAL GLYCOGEN] SYNTHASE) from
                     Bacillus stearothermophilus (485 aa); 54.1% identity in
                     464 aa overlap"
                     /note="CPE0064"
                     /product="glycogen synthase"
                     /protein_id="BAB79770.1"
                     /transl_table=11
                     /translation="MEGFKLIKVLFATSEANPFIKTGGLGDVMGALPKELKRKGIDAR
                     VILPKYSAIKGELLDKLSFKKWFMVPVGWRNQYCGVYQCEYDEVIYYLLDSEFYFHRN
                     GLYGEGDDGERFAFFDRAVLETLKEIDWCPDIIHCNDWQTGMIPVLHKLEYSKDPFYK
                     NIKTVTSIHNLLFQGNFSADVLPELFGYDYEPVRNGSLEFYGGMSFMKGAINYSDRIL
                     TVSETYAKEIKTPYFGENLDGLLRERGYALKGIVNGIDYDEFNPSKDSLIAKNFSVKT
                     IEDKVLNKLALQKELGLPINPDIPMISIVSRLTNQKGCDLIVNIANRLLQRNVQLVIL
                     GTGDYNYENHFKGLQELYPTKVSANIKFDNGLAHRIYASSDIFLMPSLFEPCGLGQLI
                     ALRYGAIPIVRETGGLKDTIHSYNKYTGIGNGFSFTNYNHNDLMHVIELALETYDDKE
                     IWRSLIIQAMDSDNSWNKSAEKYKELYEELIK"
     CDS             84010..86445
                     /codon_start=1
                     /gene="glgP"
                     /note="811 aa, similar to gpu:AP001510_259 glycogen
                     phosphorylase from Bacillus halodurans (815 aa); 53.9%
                     identity in 801 aa overlap"
                     /note="CPE0065"
                     /product="glycogen phosphorylase"
                     /protein_id="BAB79771.1"
                     /transl_table=11
                     /translation="MLSINKESFKRDYKKKFLELHGIELEEGKNFHKYEALGCLVRDY
                     IAEDWVNTKKKYESSKQKQVYYFSMEFLLGRLLGDALLNLGIRETCREALKELNIDLE
                     ELEEFESDQGLGNGGLGRLAACFLDSMASLNIAGHGCGIRYKYGFFNQKIIDGSQVET
                     PDSWLKNGNVWEFKKLDKSEVVKFGGNIKCENINGRLTFTHVNYEPILAVPYDTPIVG
                     YENNVVNNLRLWSAEPVDNEFDFCYFNRGQYLKAIEYRNSIEAISQVLYPDDSMYEGK
                     LLRLKQQYFFVSAGLQSIVRHYKKNGGKIEEFDEYIAIHINDTHPTLAIPELMRILLD
                     EEGLSWESAMRITTNTISYTNHTILSEALEKWPINMFKELLPRIYMIVEEMNERYCAE
                     LWHKYIGQWDKISKMAIIGDGFVRMANLAIVGSHSVNGVAKLHTEILKKKEMSDFYYL
                     YPSKFNNKTNGIAHRRWLLKSNPELTNLLKETIGDSFIKHPTDMENFEKYIDDEYVLK
                     RLGEIKRKNKENLAKVILDNQGIKVDPNSIFDVQVKRIHAYKRQTLNCLRIMELYNRL
                     LENPNLDIAPRTFIFAGKAAPAYYLAKNTIELINAVAKKVNNDKRINDKIKVVFLENY
                     RVSLAEKIIPATDLSEQISTTTKEASGTSNMKFMMNGAVTIATLDGANIEIRDEVGDD
                     NIVIFGLTENEVLDYYSRGGYSAWDVRNNDNRLIRVTDDLINGVYSKDRDKFRSVYDN
                     LLTYNDEFFVLKDFDSYLKAQDKVDLLYRNNKEWQRKCGVNIAHSGIFSSDRTITEYA
                     TGIWGSKVIYKNL"
     CDS             86541..88361
                     /codon_start=1
                     /gene="CPE0066"
                     /note="606 aa, similar to prf:2008115A amylopullulanase
                     from Thermoanaerobacterium saccharolyticum (1288 aa);
                     39.2% identity in 587 aa overlap"
                     /product="amylopullulanase"
                     /protein_id="BAB79772.1"
                     /transl_table=11
                     /translation="MGKAYIYHDSQDTFYREPFGAVSIGSKVSLRLECEECGEVFIEV
                     IKFDGSRYSIPMTIEERRNECIIYKGIIDTTNSLGVINYYFKYIKDGFTKYYGNNDEC
                     LGGEGKIYYDFPNYYQITVYEDNKIPSWYKEGIIYQIFVDRFFNGNKNSVILNKKKNS
                     FIYGNWYDEPMYIRDNNGSIKRWGFYGGNLRGVIEKLDYIKSLGVNIIYMNPIFDAVS
                     CHKYDTGDYENIDKMYGTNSDFKELCQKAEEKGIRIILDGVFSHTGSDSRYFNKYGNY
                     GELGAYESKYSKYYKWYRFYDYPNSYECWWGFENQPNVEELEKTYSDYIVNSENSIIA
                     KWLRLGASGWRLDVADELPDEFIQMIKERMKNEKEDSVLIGEVWEDASNKVSYSKRRK
                     YLLGDELDSVTNYPYRDIISNFLNEEISSKDFYKVIMSIKENYPRENFYANMNILGNH
                     DTERILTVLKENLNKLKLALCLQMTLPGVPLIYYGDEAGLLGNKDPENRKTYPWGREN
                     KEILSYYSFFGNFRKNEEVLRKGDFYIFKDTPEDVIAFKRVYKDKEMIIIVNRSNSRK
                     TITLDSEKGRYKDKFSKEEFYGDGSITLEVERENYKILTN"
     CDS             88416..88859
                     /codon_start=1
                     /gene="CPE0067"
                     /note="147 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79773.1"
                     /transl_table=11
                     /translation="MIRTIVCQRDGCNGNAFYINSHDGEMSVVCKECNSEYKYETENN
                     SLLMLSTCSNCNNDTFKVFKDTESNNIYAKCIVCGNPPENIFIDADGNQVSYESKILN
                     DIKDMVYRVEQRISDLEREAESLGSGQVLIEQSIAYINQFLSENK"
     CDS             89069..90250
                     /codon_start=1
                     /gene="glgC"
                     /note="393 aa, similar to gp:CCE277601_2
                     glucose-1-phosphate adenylyltransferase from Clostridium
                     cellulolyticum (426 aa); 59.1% identity in 379 aa overlap"
                     /note="CPE0068"
                     /product="glucose-1-phosphate adenylyltransferase"
                     /protein_id="BAB79774.1"
                     /transl_table=11
                     /translation="MEGRLVSKKEIVAMILAGGQGSRLGVLTKNLAKPAVPFGGKYRI
                     IDFPLSNCSNSGIYTVGVLTQYKPLKLNEHIGIGDTWDLDRRDGGVSILPPYQKEKGG
                     DWYKGTANAIYQNIEFIERYDPEYVLILSGDHIYKMDYDKMLEMHKQKEADATIAVIN
                     VPMHEASRFGIMNTNEDLSIYEFEEKPEHPKSTNASMGIYIFNWKILKKFLEEDELDQ
                     SSSNDFGKNIIPKMLNSGKKLIAYPFNGYWKDVGTIESLWEANMDLLKYEDELSLYDS
                     EWKIYSANPVRPAQFIGKDAEIKSSLTVEGCIVHGKVENSVLFQGVYVGKGAIVKDAV
                     IMPNTKIEDNVLIEKAIIGSEAIVCKGCKIGDGNKISVIASKEVVIGSKEVIEECAMV
                     K"
     CDS             90280..91386
                     /codon_start=1
                     /gene="glgD"
                     /note="368 aa, similar to gpu:AP001510_261 required for
                     glycogen biosynthesis from Bacillus halodurans (368 aa);
                     41.2% identity in 364 aa overlap"
                     /note="CPE0069"
                     /product="glycogen biosynthesis protein"
                     /protein_id="BAB79775.1"
                     /transl_table=11
                     /translation="MNNCIGIINLDENESKIGELAKNRPLAAVPIAGRYRIIDFILSN
                     MTNAGIESLGILSKNKSRSLVDHLTNGRPWDLHRKRDGLRVFNFGERDPYYDDITNLY
                     ENLEFLTKSRREYVIMSPSYMICNIDLKEALEYHKKNDNDITVIYKKVKDADSNFIDC
                     DVLNFDECGFIKSIGKNLGREEESNISLEMYILRTDLLIEIIYECIRRGSHRKFKSYL
                     KEFLDEIKVGGFEFKGYLSCVNSLKSYYKANMDLLEEKVYKELFIDNNPIYTKSRDEG
                     PTHYTKNSEVTNSIIANGSYIEGKVENSIIGRRVYVGPEAVIKNCIIMQETVIGENAH
                     LDKIITDKAAVIRDDEKIVGLEYCPMVLSKPNII"
     CDS             91449..91895
                     /codon_start=1
                     /gene="CPE0070"
                     /note="148 aa, similar to gpu:AP001519_222 acetobutylicum
                     phosphotransbutyrylase from Bacillus halodurans (146 aa);
                     43% identity in 135 aa overlap. Putative N-terminal
                     signal sequence and 1 putative transmembrane region were
                     found by PSORT"
                     /product="probable phosphotransbutyrylase"
                     /protein_id="BAB79776.1"
                     /transl_table=11
                     /translation="MENKRKRIIAWSLMILWMAFIFFMSSQPGEVSSKQSNFVVFLLD
                     MFGMDLNSRFGELSTYIIRKGAHFTEYMILYFLAFNLLRLYITKKKAYIYSLIIVFGY
                     ACSDEFHQLFVEGRSGQFKDVLIDTSGGIFGSLLVILKNKIFSNKA"
     CDS             complement(92062..93504)
                     /codon_start=1
                     /gene="clsA"
                     /note="480 aa, similar to sp:CLS2_BACSU PROBABLE
                     CARDIOLIPIN SYNTHETASE 2 (EC 2.7.8.-) (CARDIOLIPIN
                     SYNTHASE 2) (CL SYNTHASE 2) from Bacillus subtilis (482
                     aa); 39.4% identity in 454 aa overlap. ATT start.
                     Putative N-terminal signal sequence and 2 putative
                     transmembrane regions were found by PSORT."
                     /note="CPE0071"
                     /product="probable cardiolipin synthase"
                     /protein_id="BAB79777.1"
                     /transl_table=11
                     /translation="MINYTTTFLYLAFIINVILSVIIVVLERKQPEKTIAWLLILTLL
                     PPIGLILYIFLGRNWKRNKLNDRVNPEINELINPILDEYPEKQYVPLMELLAFNSDSP
                     IFVNNDIKIYKDGVEKFKDLKEELLKAKHHIHLEYYIVNSDEIGNEIKDILIKKALEG
                     VKVRFIIDKVGSSSLKRSYIKDLKKAGISVIMYSYFLAPLLKVINTQINYRNHRKIVV
                     IDGQVGFLGGINIGDEYLGRNKKFGYWRDTHIMIKGDFVLALQAVFLDDFITIEKANN
                     SYTFYDKEFDKYFPENIVAKERVLMQLVKSGPDSTFPAIMQSVLKMIMTARENIYITT
                     PYFVPPSSIIEALRIASLSGVDVKIIFPEKSDHFMVNKASKSYLAELMDCGIEVYFYD
                     KSSFIHSKTMTIDGKICTLGTANMDIRSFELNYEINTVIYDKEITCKLDALFFEDLLK
                     SRHFKIEEYEKSTKFDKFIEGFARIFSSLL"
     CDS             93936..95492
                     /codon_start=1
                     /gene="CPE0072"
                     /note="518 aa, similar to gpu:AP001513_25 BH1752 gene
                     product from Bacillus halodurans (514 aa); 47.8% identity
                     in 508 aa overlap. 11 putative transmembrane regions were
                     found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79778.1"
                     /transl_table=11
                     /translation="MKAVKEVNQKKSGILGFIETVGNKLPHPATIFVILCAGVVILSH
                     VLASRGVSVTYEGIDRATNEIKEITVSVQSLLTPDGIRYIFESLITNFTSFAALGTVL
                     VAMLGVGVAEGTGLIGTALRRLVLKTPKSLVTMVVVFAGVMSSIASDAGYVVLVPLGA
                     VIFMSCGRHPLAGIAAAFAGVSGGFSANLFPGPVDALLAGMTTEGAHMFDPSYSASPV
                     GNWYFIMASTVVITLIGTLVTEKIVEPRLGKYRGELIAGDEDAMKPLDEKEKRGLKFA
                     GLFALLGIILIGALVVPANGILRNPETGEILSSPFMNSIVVSIAFVFLLAGVGYGIGE
                     GKIKSDKDIIGEMGKTMSTMGSYIVLVFFAAQFVAYFGKTNLGTVIAVKGADFLKATG
                     IQGIPLLVGFILVTAFINLFMGSASAKWAIMAPIFVPMLMGVNISPEMTQMAYRIGDS
                     TTNIISPLMTYFALIVSFSEKYDKESGIGTMISTMVPYSVCLLIGWTILLMLWYVFKL
                     PLGPGAGIVI"
     rRNA            96258..97763
                     /gene="rrnC-16S"
     rRNA            97952..100856
                     /gene="rrnC-23S"
     rRNA            100909..101022
                     /gene="rrnC-5S"
     tRNA            101032..101104
                     /gene="trnA-Lys"
     CDS             101425..102009
                     /codon_start=1
                     /gene="CPE0073"
                     /note="194 aa, similar to pir|D69632 transcription
                     antiterminator glcT from Bacillus subtilis (285 aa);
                     35.5% identity in 169 aa overlap. Probably truncated by
                     frameshift mutation"
                     /product="probable transcription antiterminator"
                     /protein_id="BAB79779.1"
                     /transl_table=11
                     /translation="MIKKTEKAYEVKRSFNNNIVLVDDDEKEIILFAKGIGFNCKKGS
                     IIPENTNIEKIFTIQDENNIANFRRVVGSNDEKFIAFCEELILEISRDFSDELNEIIH
                     IGLIDHISFAIERMKKGEILRNPFLVEIETLYPKEFEAATKMVKKLEDFTGVSIVDDE
                     IGFIAYAYTFGKNNRKDFSYNKIYLYSKYCCRIY"
     CDS             101897..102274
                     /codon_start=1
                     /gene="CPE0074"
                     /note="125 aa, similar to gb|AAB38977.1| (U34873)
                     transcription antiterminator from Bacillus
                     stearothermophilus (277 aa); 31.9% identity in 119 aa
                     overlap. Probably truncated by frameshift mutation"
                     /product="probable transcription antiterminator"
                     /protein_id="BAB79780.1"
                     /transl_table=11
                     /translation="MMRLDLLHMHIHSARTTGKISHTIKFTYIANTAVEYIEDAFNIE
                     VDRTSLSYARFISHLRFAIERLINNTPVKNELLSIIKIKYPESFKVAEEIGKAINEDF
                     SLEVAEDEIGYLALHVERIRKNE"
     CDS             complement(102497..102754)
                     /codon_start=1
                     /gene="CPE0075"
                     /note="85 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79781.1"
                     /transl_table=11
                     /translation="MLLQLEKLLIYHKYQIKFSLEKMAGDGVAIEVTGDTIVAPADGE
                     LSLVFKTNHAFAMTLSNGIELLVHVGIDTVSLEGEGFERLT"
     CDS             103447..104664
                     /codon_start=1
                     /gene="CPE0076"
                     /note="405 aa, similar to N-terminal of sp:PTAA_KLEPN PTS
                     SYSTEM, N-ACETYLGLUCOSAMINE-SPECIFIC IIABC COMPONENT
                     (EIIABC-NAG) (N-ACETYLGLUCOSAMINE-PERMEASE IIABC
                     COMPONENT) (PHOSPHOTRANSFERASE ENZYME II, ABC COMPONENT)
                     (EC 2.7.1.69) (EII-NAG) from Klebsiella pneumoniae (651
                     aa); 46.7% identity in 366 aa overlap. Putative
                     N-terminal signal sequence and 8 putative transmembrane
                     regions were found by PSORT."
                     /product="probable PTS system enzyme"
                     /protein_id="BAB79782.1"
                     /transl_table=11
                     /translation="MSKKGSKVLGFLQRIGKSLMVPIAVMPALGLLLRLGDKDLLNIP
                     WISAAGGAAFGDNMAMLFAVGIGFGLSDENNGVGGLAGLLGFLVMKNVATSFDPSINM
                     GAFGGVVAGVVGGLLYNKFKDIKVPQFLGFFGGKRFVPIITSAVCLILGVFFGYTWPT
                     FQAGLDGFANIMVAAGAIGAGIYGILNRLLIPIGLHHVMNTVIWFQLGSFTDPVSGQI
                     ATGDIARFLAGDPTAGVYTAGFYPIMMFGLPAACLAMYVCAKKKNKAVVGGMFLSLAL
                     TAIITGITEPIEFAFMFLSPILYVIHAILTGISLAVAYALNVHLAFSFSGGLIDYILY
                     FGKGQNQLIILLMGLVAFVVYYFLFMFFIKKFNLKTPGREDDFDDENEDAETNSKTVS
                     KSEDNPSKGGTLS"
     CDS             104712..104897
                     /codon_start=1
                     /gene="CPE0077"
                     /note="61 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79783.1"
                     /transl_table=11
                     /translation="MKVLDNCITRLRLTLKDASKIDEVTLKKAGASGIMKLDGKNVQV
                     IMGTLADPLASQMKKLL"
     CDS             complement(104966..105484)
                     /codon_start=1
                     /gene="CPE0078"
                     /note="172 aa, similar to sp:YHGD_BACSU HYPOTHETICAL
                     TRANSCRIPTIONAL REGULATOR IN HEMY-GLTT INTERGENIC REGION
                     (ORFA) from Bacillus subtilis (191 aa); 30.2% identity in
                     126 aa overlap"
                     /note="TetR/AcrR family"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB79784.1"
                     /transl_table=11
                     /translation="MPKIIKNVKEDLLTEGKKQLLSNGYLNLNIRNITKECNIGTGTF
                     YNYFKNKEQLVIDILSNDWTSILKISNEIIEEDISFKEKLIFISNNINDFLKNYRLIF
                     SEMAKHTSKNHYVIEPMYETLEKLIEIHIEKGEINPPISSDKFAYFLLNNLILTSRSE
                     LTIDDLLLLLNI"
     rRNA            106097..107602
                     /gene="rrnD-16S"
     rRNA            107791..110675
                     /gene="rrnD-23S"
     rRNA            110728..110841
                     /gene="rrnD-5S"
     tRNA            110855..110926
                     /gene="trnA-Asn"
     CDS             111585..113675
                     /codon_start=1
                     /gene="fus"
                     /note="696 aa, similar to gpu:AP001507_131 translation
                     elongation factor G (EF-G) from Bacillus halodurans (692
                     aa); 40.9% identity in 677 aa overlap"
                     /note="CPE0079"
                     /note="EF-G"
                     /product="elongation factor G"
                     /protein_id="BAB79785.1"
                     /transl_table=11
                     /translation="MKEYKIENLRNIGIIGHSDSGKTALSEALLYYTKTTDRLGTCED
                     GNTISDYDQEEKKRKISLALSIIPFEYDGTKINILDTPGYFDFVGEQIEGVKAADSAI
                     INICGVTGVQVGTEKAWECCEKEKLPRAFFINKLDRENSNFDKVLENIRNIFGNKVIP
                     TQYPLGKEKEFKGIVNLITEEAFEYDKKSGKINKIEIPNEVKDKVNEYRTYLMESVAE
                     TDEELLDKYLSEGELTVDEIYKGLSIGFEEGDIAPVMCGSSVSIVGMKSLLDSIKGYF
                     PSPDISKAKVAIDSNNKEILVKPNKDMPFSAFVFKTIADPFVGKLSIFKVQTGELTTD
                     KIIINSKNNKVEKVSSLCFLRGKSQIQTSKIGAGDIGAVTKLQYTSTGDTLCESNFKI
                     AYEGFEFPEAVMTMAVLPKSKGDEEKISQGLSKLLDEDPTFKVSRDQENAETLVSGIG
                     ETHIEVLASKLKSKFGIDVILQDPKIPYRETIKGSSDVQGKHKKQSGGHGQYGDVKIK
                     FEPRRDGELDLEFVDKVVGGVVPRNYIPAVEKGLRDCLKKGVLAGYPVIGIKATLHDG
                     SYHPVDSSEMAFKVAASLAYKKGMENAKPVILEPIMKVEIIIPDEYMGDIISDINKKR
                     GRVIGMEPEGNNEKVIADIPLSEMFKYATDLRSMTQGRGSFSMEFEKYEEVPSTEVDK
                     IIEDAKKIKEAKEA"
     CDS             114098..114334
                     /codon_start=1
                     /gene="CPE0080"
                     /note="78 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79786.1"
                     /transl_table=11
                     /translation="MCNYRMDIKGKISLSDYSNIFDYINIVDVCDRFMIYMESLDDDN
                     IGIICSMLKDNNFNIKNQGYDNQGIYYINAKKIG"
     CDS             114586..115533
                     /codon_start=1
                     /gene="glcK"
                     /note="315 aa, similar to sp:GLK_BACSU GLUCOKINASE (EC
                     2.7.1.2) (GLUCOSE KINASE) from Bacillus subtilis (321
                     aa); 34.7% identity in 297 aa overlap. 1 putative
                     transmembrane region was found by PSORT"
                     /note="CPE0081"
                     /product="probable glucose kinase"
                     /protein_id="BAB79787.1"
                     /transl_table=11
                     /translation="MKNYVVGIDLGGTKISCALADLEGNVKAQHTTPTNAHEGEQAVL
                     DRIIGCVETVICEGKVTIDEVEAIGIGSPGPLDARTGIIITTPNLPFKNFNLVSPLKA
                     KFGIPVYLDNDANVAAIGEFMLGAGKGTENMIYITVSTGVGGGAILNGKIYRGSTSNA
                     LEIGHSTVAPGTVRCNCGNMGCLEAVSSGTAIGKRGREAVATNVETSLKDYDNVTSYE
                     VFVEAAKGDRVAKSIIDEALNYLGIGVANAIATFDPDMVVIGGGVSKAGEVVFETVQE
                     VVNERCFKAMAEHCKIVPAGLGTDAGVIGAVALALLECK"
     CDS             116074..116616
                     /codon_start=1
                     /gene="CPE0082"
                     /note="180 aa, similar to sp:Y746_METJA HYPOTHETICAL
                     PROTEIN MJ0746 from Methanococcus jannaschii (141 aa);
                     44.8% identity in 143 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79788.1"
                     /transl_table=11
                     /translation="MKKFVCTVCGYVYEGEKAPEKCPVCGVGADKFVEQGEDLAFADE
                     HRIGVAKGVDERIIEGLQANFVGECTEVGMYLAMSRQADREGFPEVAEAYQRIAFEEA
                     EHAAKFAEMLGEVVEADTKANLQARVNAEHGACQGKKDLATLAKQLNLDAIHDTVHEM
                     CKDEARHGKAFAGLLNRYFK"
     CDS             116949..117572
                     /codon_start=1
                     /gene="gpmA"
                     /note="207 aa, similar to pir:A70471 phosphoglycerate
                     mutase 1 from Aquifex aeolicus (212 aa); 30% identity in
                     200 aa overlap. (EC 5.4.2.1)"
                     /note="CPE0083"
                     /product="probable phosphoglycerate mutase"
                     /protein_id="BAB79789.1"
                     /transl_table=11
                     /translation="MKIYFTRHGETLWNLEHRFQGWKDSELTENGVKRAELLGKKFND
                     IKIDKIFTSPIKRAKRTAYLIKGDKDIEVEEVEGLKEISFGKWEGMTTEEIKSHDEYV
                     NELDNLFNKPFSYKSFEGENIKDFTERLFKTVDDIVKNNEDKDILIVTHGMCVRYLIG
                     YFKNEFEESKIIDYPIFHQASYNEVEWNGENFEVITLNNIDHYEYDK"
     CDS             complement(117931..118701)
                     /codon_start=1
                     /gene="iolR"
                     /note="256 aa, similar to sp:IOLR_BACSU DNA-BINDING
                     PROTEIN IOLR from Bacillus subtilis (251 aa); 44.4%
                     identity in 250 aa overlap"
                     /note="CPE0084"
                     /product="transcription repressor of myo-inositol
                     catabolism operon"
                     /protein_id="BAB79790.1"
                     /transl_table=11
                     /translation="MRSKRIDLVENYIINHKTVSIDKLCEVFDVSKNTIRRDLSVLVE
                     KGTIKKVYGGVTVNENQELVSFEERNVKNSNSKLALGKAAAEFIEDGDSIFLDSGTTT
                     VNIIDFLKDKKDITIFTNSVTAICKGIHYNNLNIICLSGILNRKTQSFTGLHSTDILK
                     SYNINKCFMACTGISLKRGVTNSTKEEFKIKKTAISRSAECFLLADQSKFDHVSLMTF
                     CEINDLNCVITDAKPSDEYIEYFNDNNVDLKICEKVIY"
     CDS             119183..120337
                     /codon_start=1
                     /gene="mdh"
                     /note="384 aa, similar to pir:A42952 methanol
                     dehydrogenase (EC 1.1.1.244) from Bacillus sp. (381 aa);
                     35.4% identity in 381 aa overlap"
                     /note="CPE0085"
                     /product="probable alcohol dehydrogenase"
                     /protein_id="BAB79791.1"
                     /transl_table=11
                     /translation="MANQFIMPKRIISGENALNESKAYLKSFGKRVLIVTDKVMTDLG
                     NVKVLTEVLDSENIEHVLYNEINSEPTDTMIEKGIKLYKENQCDFLIGLGGGSPIDST
                     KAIGAMITNEGKISDYMGREIEKELPPFAVIPTTAGTGSEATQFTIITDTKNDVKMLL
                     KGANLLPNLAIVDPRFTMTAPAKITAATGLDALTHAIEAYTSRKAQPLSDSFAVSAVK
                     RIFKYLPIAFDTPKDLKAREEMSIAALEAGIAFNNSSVTIVHGMSRPIGALFHVPHGL
                     SNAMLLEACFTYVVDGAYDRFAQLAKEINIANDNMSNEEAAKAFIDEVVKLMVKLEIP
                     TLEEFGVDKTKFFDNIEKMAADAMESGSPSNTRKIIEVDDVIKIYNNLWR"
     CDS             120344..121189
                     /codon_start=1
                     /gene="alf1"
                     /note="281 aa, similar to gpu:AP001520_10
                     fructose-1,6-bisphosphate aldolase from Bacillus
                     halodurans (287 aa); 39.1% identity in 281 aa overlap"
                     /note="CPE0086"
                     /product="fructose-1,6-bisphosphate aldolase"
                     /protein_id="BAB79792.1"
                     /transl_table=11
                     /translation="MALVKMTELLDAAREKNYAVGSFSIANMEMVKGALKAAEEMHSP
                     MILQIAEVRLTNSPLELIGPLMVSAAKNAKVPVAVHFDHGLTLENIEKALKIGFTSVM
                     IDGSHLSFDENVKITKRVKELADKYGAAIEAEIGQVGGSEDGSEDIKMKVTNVEDAKR
                     FVQETKVDALAVAIGNAHGVYKGTPKLRFDVLENLRENIETPLVLHGGSGITPEDFKE
                     CKNKGIRKINIATATFNSVEESVRKLYVDNEKKDYFTLQATEVQGAYENVKKHMDIFE
                     SVNKA"
     CDS             121203..122219
                     /codon_start=1
                     /gene="iolC"
                     /note="338 aa, similar to sp:IOLC_BACSU IOLC PROTEIN from
                     Bacillus subtilis (325 aa); 46.5% identity in 318 aa
                     overlap"
                     /note="CPE0087"
                     /product="myo-inositol catabolism protein"
                     /protein_id="BAB79793.1"
                     /transl_table=11
                     /translation="MRYIEFDEKRKFDIVPVGRVAIDFNPTDIHKPLSESRNFNKYLG
                     GSPANIAVGLARLGKKVGFIGKVSDDRFGEFVVNYFKKEGIDVSEISKAKNGESLGLT
                     FTEILSPTESSILMYRNGIADLQLDVDDIDEDYIKNTKAIVISGTALAMSPSREAALK
                     ALRLAKKNGTVVIFDVDYREYNWKNKDEIAIYYSIVGKESDIIMGSREEFDLMEGLIA
                     KDSTDEETAKRWLDYGNKIVVIKHGKDGSTAYTRDGKAYRIKPFPVKLLKSFGGGDAY
                     ASAFIYGILEGWDMMDALEFGSASAAMLVASHSCSEDMPTVEAIKEFIKKEKEEYGEM
                     VARS"
     CDS             122233..123000
                     /codon_start=1
                     /gene="iolB"
                     /note="255 aa, similar to sp:IOLB_BACSU IOLB PROTEIN from
                     Bacillus subtilis (271 aa); 24.6% identity in 244 aa
                     overlap"
                     /note="CPE0088"
                     /product="myo-inositol catabolism protein"
                     /protein_id="BAB79794.1"
                     /transl_table=11
                     /translation="MVENIGFSEDGKKIVTEINGKHSSMLMDIEVIKMKKGDKIVILE
                     PKKEVAVLLMEGKIKYLWENKEVEASRKNVFEEEGFCLHVCKNVEVKVEALEEAEILI
                     QKAENDKEFLAKLYRPEDVIIQESSLDKWDGTAARKIKTFFDYSNAPYSNMVNGEIVS
                     YPGRWSSYIPHEHPQPEVYYYKFDKPQGFGACFIGDEAYKVKDGGYAIIEGGYTHPQA
                     TAPGYRMYYCWMIRHLDGNPWTDRIDDPAHVWLLDEK"
     CDS             123017..124936
                     /codon_start=1
                     /gene="iolD"
                     /note="639 aa, similar to sp:IOLD_BACSU PROBABLE MALONIC
                     SEMIALDEHYDE OXIDATIVE DECARBOXYLASE (EC 1.-.-.-) from
                     Bacillus subtilis (580 aa); 53.8% identity in 586 aa
                     overlap. 1 putative transmembrane region was found by
                     PSORT"
                     /note="CPE0089"
                     /product="myo-inositol catabolism protein"
                     /protein_id="BAB79795.1"
                     /transl_table=11
                     /translation="MRMTTGQALVKFLDNQYVSFDGKEEKFVDGIFTIFGHGIVVGLG
                     EALYENPGELKVYQGRNEQGMAHVSTAFAKQNNRRKIIACSSSVGPGAANMVTAAATA
                     TVNNIPLLLLPGDSFATRQPDPVLQQIEQSYNLGITTNDAFKPVCKYWDRINRPEQLM
                     SAMINAMRVLTDPAETGAVCIALPQDVQGEAYDFPEYFFKKRVHRITRPLAVQEEFEE
                     ALDIIMNKKKPIIICGGGVRYSEAGEALVDFAEEFNIPICETQAGKSAIKSSHPLNLG
                     GIGVTGNLAANMIAKDTDLVIGVGTRFSDFTTSSKSLFKNPEVDFITVNVSKFHGGKM
                     DAHKIIGDAKVCIEELQAMLEANNYESSYEDEIVNAKKAWKEEMKRLTNIKYDENFEA
                     LIKPKREGCIEEFSVLTGGLITQTAALGVIRETIDDDAIVVGAAGSLPGDLQRMWETD
                     ARDSYHMEYGYSCMGYEIAATLGAKLAEPEREVYSMVGDGSYLMLHSEMVTAMQEQKK
                     INILLFDNCGFGCINNLQMSNGIGSLATEFRYRDENGKLEGGLIPIDFAKVASGYGLK
                     TYSVKTLAQLKEALEDAKKQKVSTLIDIKVLPKTMTDGYDAWWHVGIAGESEIDGVNK
                     AFENKEKNLKAARRY"
     CDS             125006..126013
                     /codon_start=1
                     /gene="CPE0090"
                     /note="335 aa, similar to sp:YRBE_BACSU HYPOTHETICAL 37.8
                     KDA PROTEIN IN CSBX-NADA INTERGENIC REGION (ORF1) from
                     Bacillus subtilis (341 aa); 49.1% identity in 318 aa
                     overlap"
                     /product="probable dehydrogenase"
                     /protein_id="BAB79796.1"
                     /transl_table=11
                     /translation="MVMINIGVIGAGRIGRIHAQSIQEKVQGAQVKTIADVFEESAKK
                     AAEEFKIPNYTGDYMEILNDPEIDAVIICSSTDTHSKISIEAAERGKHIFCEKPIDYD
                     VAKIEKTLEAVKKAGVKYQVGFNRRFDHNFAKLKELIEEGKIGNPHIIKITSRDPQAP
                     PIEYVKVSGGMFLDMTIHDFDMAAFLSGSRISEVYVQGACMVNPEIGEAGDVDTAIIS
                     LKFENGCIGVIDNSREAAYGYDQRVEVFGGKGYVMADNDSDTTVTIASVDGIVGEKPK
                     YFFLERYMDAYVNEMQQFINCLVNDTEVPVGANEGLYSVLVGLAATKSLKEGRPVKIE
                     Y"
     CDS             126132..127025
                     /codon_start=1
                     /gene="iolE"
                     /note="297 aa, similar to sp:IOLE_BACSU IOLE PROTEIN from
                     Bacillus subtilis (297 aa); 44.6% identity in 294 aa
                     overlap"
                     /note="CPE0091"
                     /product="myo-inositol catabolism protein"
                     /protein_id="BAB79797.1"
                     /transl_table=11
                     /translation="MFNSNVKLGIAPIAWTNDDMPDLGKENTFEQCISEMALAGFKGS
                     EVGNKYPRDVEVLKKALELRDMEIASAWFSAFLTTKPYEETEKAFIEHRDFLNAMGAK
                     VIVVSEQGHSIQGQMETPIFDGKYVLNEEEWKTLAEGLNKLGALAKEKGMKLVYHHHM
                     GTVVQTTEEIDKLMDLTDENLVYLLFDSGHLVYSGEDALEVLKKYVNRVKHVHLKDIR
                     KKKVEEVKRDKLSFLQGVRKGAFTVPGDGDIDFEPIFKVLDDNNYEGYLLVEAEQDPA
                     IANPLEYAIKARKYIKEKTNL"
     CDS             127107..128696
                     /codon_start=1
                     /gene="CPE0092"
                     /note="529 aa, similar to gpu:AP001514_228
                     Na+/myo-inositol cotransporter from Bacillus halodurans
                     (580 aa); 50.1% identity in 511 aa overlap. Putative
                     N-terminal signal sequence and 11 putative transmembrane
                     regions were found by PSORT."
                     /product="Na+/myo-inositol cotransporter"
                     /protein_id="BAB79798.1"
                     /transl_table=11
                     /translation="MFIFLSFAIFLVAVFAIAWYKAKGTDNTETATGYFLAGRGLSGP
                     VIAATMILTNLSTEQIIGLNGQSYATNMGPMAWEVTSCVALITLALIFLPRYLKGGIT
                     TIPDYLEERFDSTTKRIVSILFLVSYVVTYIPTVLYSGGLVLNQIFGISDLLGISTFQ
                     AVALTGFLLGVVGAIYTVLGGMKLAAFSDTVNGLGLLIGGLLVPILGILLLGNGDFVG
                     GFEIIIATPEKLNAINPANAQSPLIPWPVLFTGLLFNNLFYWCTNQSIVQKALGASSL
                     KEAQKGAILAGLIKVLTPAILVFPGIIAFAKYGDALPNADMAYPTLLLDVLPKPLLGI
                     FAAILFGAAMSSLNGAMNSSSTLFTLDLYKPIINPEASDKQLVKVGQKFIIVVSVISV
                     IVAPFILYAPSGLYNFLQECNGYFNVPILACVIVGFFTKRVPSLAAKVVFVVHIVLYT
                     LSKFFLSDIHFLYVLGVLLPIGVIVMLIIGKIKPRETDFVQADKALIDMTPWKYAKPA
                     SLAVVLVMAFIYLLFSPIGLA"
     CDS             128783..129832
                     /codon_start=1
                     /gene="CPE0093"
                     /note="349 aa, similar to gpu:AP001514_226 dehydrogenase
                     from Bacillus halodurans (345 aa); 62.5% identity in 339
                     aa overlap"
                     /product="probable dehydrogenase"
                     /protein_id="BAB79799.1"
                     /transl_table=11
                     /translation="MKKINFGIVGLGRLGRAHAENLAFKIPNANLLAICSIDKSQVDE
                     VQKAWNIPYGYTDFDEMLKNKELDAIFIASPSGFHCEQIEKALDAGFHVFSEKPLGLY
                     LDDAVRAMKAVNSHPNQIFMLGFMRRYDKSYAYAKKKIEEGTIGKPVLVRCYGLDPAK
                     ALPSFLKFAKDSYSGGLFLDMAIHDIDLARWYLESEADELWSIGGAYGHKEFDEINDA
                     ETGAAMVKFKNGTMALLVAGRNCAHGYHIETEIIGTEGTLRIGTTPDKNLVTVFDNKG
                     VNKECAGGFLERFEDAYLAEVKEFVDCVLENRKPAVTVEDGVLSTIVGYACKESFETG
                     ELVKVNYEGYDKLIK"
     CDS             130202..130960
                     /codon_start=1
                     /gene="CPE0094"
                     /note="252 aa, similar to sp:YWCJ_BACSU HYPOTHETICAL 28.4
                     KDA PROTEIN IN SACT-SACP INTERGENIC REGION from Bacillus
                     subtilis (256 aa); 35.1% identity in 242 aa overlap. 6
                     putative transmembrane regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79800.1"
                     /transl_table=11
                     /translation="MQKKDINLISDMAVNKFKFADRAPIKYFLRAVVAGFFLVVAIIL
                     SYTTGAVLNNSYPEMARIMVAATFSLALGLIAFIGGELFTGNNLVMAIGIYNNECTLT
                     MALKVWFMSYLGNFIGSILLGFLFVKSGASMDLIKDYAKGIVDIKLNLPALELFLRGM
                     LCNFMVCIAFLSTIKMKSETGKLIIMFWCIFAFVIAGFEHSIANMGIFSITYFASGDV
                     SLPLVFRNLFWVTLGNMVGGGVLLALPLKFMSME"
     CDS             131191..131967
                     /codon_start=1
                     /gene="CPE0095"
                     /note="258 aa, similar to gp:TTBCSOPRN_1 crotonase from
                     Thermoanaerobacterium thermosaccharolyticum (259 aa);
                     58.9% identity in 253 aa overlap. (EC 4.2.1.55)"
                     /note="3-hydroxybutyryl-CoA dehydratase"
                     /product="crotonase"
                     /protein_id="BAB79801.1"
                     /transl_table=11
                     /translation="MENIIFNESNGIAEVIINRPKALNALNNQTITELGEVINEISKR
                     KDIKTVIITGAGEKAFVAGADIVEMKDLNSMEARDFSRLAQKVFSDIENMPQIVIAAV
                     NGYALGGGCELSMACDIRLASKKAKFGQPEVNLGILPGFAGTQRLPRLVGKGIAKELI
                     FSTDMIDAEEAHRIGLANKVYEPEELMDKARELANKIMSKSPVGVRLAKAAINNGLNM
                     DTESAYNYEADLFALCFSTEDQLEGMNAFVDKRKADFKDK"
     CDS             132070..133620
                     /codon_start=1
                     /gene="CPE0096"
                     /note="516 aa, similar to gp:CPR276553_2 propionate
                     CoA-transferase from Clostridium propionicum (524 aa);
                     56.6% identity in 516 aa overlap. 1 putative
                     transmembrane region was found by PSORT"
                     /product="propionate CoA-transferase"
                     /protein_id="BAB79802.1"
                     /transl_table=11
                     /translation="MVRVSFLKPCEVAEFVKDGDTIVTEGFVASCCPESLTKALEKRF
                     LETGHPRNLTLMYSAAQGNRDGSGADHFAHKGMTKRVIAGHWNMAPKLGKMAVENEIE
                     AYNLPQGTLAQLFRDIAGKRVGTITHVGLNTFVDPRISGGKLNEVTKEDIVKLIEIEG
                     EEKLLYKSFPIDVCFLRGSSADECGNVTLDREVATLDVTSIAQACKNNGGKVFVQVER
                     VVSGGCLDPRLVKIPGIYVDGIVLAEPCDHEQCLGMKFNPAYTGEVRIPLSSIEKAPL
                     NARKIIARRAAMELKKDTIVNLGIGIPEVISLVANEEGIGDYMTLTVESGPVGGVPQG
                     GAAFGACINPDAILDQPYQFDFYDGGGVDLAFLGLAQADKNGNINVSKFGPRIAGCGG
                     FINITQNAKKVIFCGTFTASGLKVETGDGKLHIIQEGKSNKFLEDVEQITFSGEYANK
                     TNQSVMYITERAVFELRNDGLHLTEIAPGVNLEEDILAHMDFVPKIDEPLKLIDERIF
                     YDKLMGLK"
     CDS             133724..134860
                     /codon_start=1
                     /gene="acdS"
                     /note="378 aa, similar to sp:ACDS_CLOAB ACYL-COA
                     DEHYDROGENASE, SHORT-CHAIN SPECIFIC (EC 1.3.99.2) (SCAD)
                     (BUTYRYL-COA DEHYDROGENASE) from Clostridium
                     acetobutylicum (379 aa); 58.5% identity in 378 aa
                     overlap. 1 putative transmembrane region was found by
                     PSORT"
                     /note="CPE0097"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BAB79803.1"
                     /transl_table=11
                     /translation="MDFSLTQKQLDVQRAVKEFAERELKPFAIENDENSTFPIEAYKK
                     LGELGVIGLPYSTEYGGTGGDYLSYVLAIEEISKVDASMGIAVSVTTSLCAGGISNAS
                     EELKKKYLPDILSGKKLGSFGLTEPNAGSDAGGVITVAEKKGDNYILNGAKCFITNAP
                     LSGTFIVFALTDRTKGPKGLSAFIVEKDFPGISIGKIEDKCGIKSAQVSEVLFNDCVV
                     PASNLVGKEGDGFKIAMKTLDGGRIGVAAQGLGIAEGAFEIAKEYMKERKQFGKPLFK
                     QQYLAFKMAELAVEIEQAKYMLYKAAMDKQEGKPYSVSAAKAKLVCTDAAMHVTTEAI
                     QMLGGNGYMREYQLERMMRDAKITQIYEGTNEIQKLIISGSLFR"
     CDS             complement(135262..135612)
                     /codon_start=1
                     /gene="CPE0098"
                     /note="116 aa, similar to pir:A69364 hypothetical protein
                     AF0913 from Archaeoglobus fulgidus (112 aa); 43.1%
                     identity in 116 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79804.1"
                     /transl_table=11
                     /translation="MKIIFHIDEPNKWPMVLENLKNVLNNAKETNRKYELEVLANSMA
                     VFQLRELIARNTHLIDKIIEPAEQGVVFAVCNNSLNKFNISKDELFSFCKVVPAGIIE
                     LAEKQSEGYLYIKP"
     CDS             136190..137320
                     /codon_start=1
                     /gene="gldA"
                     /note="376 aa, similar to gp:AF136281_2 glycerol
                     dehydrogenase from Clostridium beijerinckii (352 aa);
                     46.7% identity in 353 aa overlap"
                     /note="CPE0099"
                     /product="glycerol dehydrogenase"
                     /protein_id="BAB79805.1"
                     /transl_table=11
                     /translation="MRKAFICPTKYVQGENELLNLGYFVETYGKSALLIAHPEDIKRV
                     KDKLDATAKKFNIEFVEGGFKGECSRQEVKRLQDLAKEMKCDCTVGLGGGKALDTAKC
                     VAEGEKLIVVPTIAATDAPTSHSAVLYTEDGSFDDYAYFKASPSVVLVDTEVIAKAPT
                     RFLVAGMGDALSTYFEARATSSSFTKVNAGLPCGVREEKCRPAIGTNASLALAKLCYE
                     TLLEDGKKAKDACDCNCVTKSLENIVETNILLSGLGFESGGLAAAHAIHDGLTILEGT
                     HGYFHGEKVAFGIIAQLVLENAPKEELYEVLDFCLEIGLPVCLEDIGVTEVSDEELFE
                     VAEKACIPEESIYSMPFGIEVSEVVSAIKLADKIGKDYKNRK"
     CDS             137346..139094
                     /codon_start=1
                     /gene="CPE0100"
                     /note="582 aa, similar to gpu:AP001518_228
                     dihydroxyacetone kinase from Bacillus halodurans (330
                     aa); 48.4% identity in 312 aa overlap"
                     /product="dihydroxyacetone kinase"
                     /protein_id="BAB79806.1"
                     /transl_table=11
                     /translation="MKKIMNSAETLVREMCNGMVMAHPELEFLNKYKVVKKKDINEDK
                     VTLISGGGSGHEPAHAGFIGKGMLDVAVCGDVFASPSQIQIYQAIKASKSNKGTLLII
                     KNYSGDMMNFKNAAHLATEDGIKVDYIKVDDDIAVEDSLYTVGRRGVAGTVLVHKIAG
                     AAAERGNSLEEVKRIAKKAASSVKSIGFAFTSCTVPAKGTPTFELGEDEMEYGVGIHG
                     EPGIRREKIATADELAERMVNQLINELDYKDEELVVLVNGFGATPLQELYLLNNSVFR
                     ELHKRGIKVCKNFVGNYMTSIDMAGASLSIMKLDDELKELMKDECDTLAFKVSNHMDM
                     NEYEEVVIEEKEIPVSYKVETCESFKEIKNEKISLENMIYILDKMSEVIIDNEVPFCE
                     LDSHAGDGDFGMSVAKGFRILKREWKDILEIENLNISEFLNACSLVIMEHCGGASGPI
                     WGSAFRAASKNVINKDELTVKDFAEMMQEAVLGIQKTGERSFGRGAVVGDKTLIDALV
                     PCADSWTNSAEEGLSFKEAFKNGAEAAVLGAKKTEEIVARMGRAGTVGERSIGYPDAG
                     AYGLGVIFTEISNDIK"
     CDS             139454..140887
                     /codon_start=1
                     /gene="CPE0101"
                     /note="477 aa, similar to pir:B69532 multidrug resistance
                     protein homolog from Archaeoglobus fulgidus (503 aa);
                     30.2% identity in 424 aa overlap. Putative N-terminal
                     signal sequence and 11 putative transmembrane regions
                     were found by PSORT."
                     /product="probable multidrug resistance protein"
                     /protein_id="BAB79807.1"
                     /transl_table=11
                     /translation="MEHVVKKGENAQEVKYNKWAILFCVVTMTFMSCIDGSIVNVALP
                     KISYDLNKPILDTQWIVTTYLMVISTLVLLCGRIGDIKGKCKVFKVGVLIFTIGSFFS
                     GLSKTLPLLIVSRAIQGVGGSCAMATGMGIITAFFNEKERGKAMGLSASAVAMGVMVG
                     PALGGILVSIRWDLIFWINVPIGIIAFLLSMVYLPKMETNSKEKIDIRGTIVFAIFIV
                     SSMLSITKGEVLGYTDKYIMLGFIVSIVSFTVFIYLQKTVESPVLDLNLFKTKLFSIS
                     IVCSALSFLAISSMNIIIPLYLEQALQMSSLHAGLFLMIYPLCLSIVAPLSGSLSDRF
                     NGRLISLIGISLLTVALFFMGRININSTLIYLGTCCAIMGVGNGIFKSTNNALVMEKV
                     PKHRLGIAGSVNSLVSNLAMAYGFTFATTILYGRMSYRLGYKVTNYIPGHEEAFLYGL
                     DCVFFSATIMCLIASVVAFIRYRRKDI"
     CDS             141164..141436
                     /codon_start=1
                     /gene="CPE0102"
                     /note="90 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79808.1"
                     /transl_table=11
                     /translation="MSKKVEELKNEVMADVEKSCVEDIKAHMIDKIEEDVKVLDEDSK
                     AYREDEKEAAKLGKAINKELDREIKEEAENAKEFAKELKADIESRE"
     CDS             complement(141837..142790)
                     /codon_start=1
                     /gene="ldh"
                     /note="317 aa, similar to sp:LDH_BACME L-LACTATE
                     DEHYDROGENASE (EC 1.1.1.27) from Bacillus megaterium (318
                     aa); 48.4% identity in 304 aa overlap. Putative
                     N-terminal signal sequence was found by PSORT"
                     /note="CPE0103"
                     /product="L-lactate dehydrogenase"
                     /protein_id="BAB79809.1"
                     /transl_table=11
                     /translation="MIREKTNKISIIGAGFVGSTTAFALMQDGLASEIVIVDINKDKA
                     HAEAMDLAQGAAFVKSVDIKSGDYADTKDSDIVIITAGVGPKPGETRLDIINKNLKIF
                     QSIVPEVVKYSPNSILLVVSNPVDILTYITYKLSGFPKERVIGSGTVLDTSRLKYMLS
                     EHFDIDARNVHTYIIGEHGDSEITAWSLTNIAGANVEEYCKTVCANCDGSFKKELPEK
                     VKNAAYEIINSKGYTNYAVALAVTRIVEAILRDENAILTVSSLFEGQYGIDNVYLAMP
                     TIVDRSGARQILDVPISNEEKENLIKSAEILKGHIANSELD"
     CDS             143416..144591
                     /codon_start=1
                     /gene="CPE0104"
                     /note="391 aa, no significant homology. 5 putative
                     transmembrane regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79810.1"
                     /transl_table=11
                     /translation="MIKIKKNINKDAEKKYEYRFYRYLGLVLIILFSCIVTVSNLINP
                     GETKKLISELVRKDYSDFFQYELQNSDKSLQEIYDSYSKNENIEVYKLMALNTIYFGG
                     DRNRYLEPYIRPYIDKYNLSQNDRLKLYEDVNKEIKNIENKYIFKLIVKRFSPYILAI
                     AFVTLIMGSASFIRKRNNVERIIINILIFLAGIYICYLSSISVKHGIWINLAIMLALA
                     EFIIENKTKLLEYIGGSIILIILVLSILGKFEYKSNELDKYDVNKLVLVNNFQGANFA
                     NEEHDIQRSGRALYSEIKKENMILIDNSNENINNLIENKEKIIFNNKENNKPVFYMCL
                     YNNIPVYRLALVKEGQIVKIYEGVLNPYMRSTLMKLERGKGHKKNKVCNIEMLKTIN"
     CDS             144710..145147
                     /codon_start=1
                     /gene="CPE0105"
                     /note="145 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79811.1"
                     /transl_table=11
                     /translation="MLFYGVISVEYKKEQFNEKVLTNHITKEQWIDILKNSNLIGLRD
                     MKILLNLYGSNGQPLKTSLIGEHLEFGDISARIQKMCKRIEEELGIGLDEKSEMGSWK
                     YKFRHWFIMLNGSKIYDEKEEKNYFTWTLKKELKEAIDSLLGK"
     CDS             145358..146098
                     /codon_start=1
                     /gene="CPE0106"
                     /note="246 aa, partially similar to pir:S32215
                     hypothetical protein 1 from Bacillus megaterium (226 aa);
                     29.9% identity in 67 aa overlap. Putative N-terminal
                     signal sequence and 4 putative transmembrane regions were
                     found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79812.1"
                     /transl_table=11
                     /translation="MNRKEIKSIAKSKLKGRWFNIVLLTLIIAIIEFGASEIIGRTEG
                     ITSNILNIANNFLLMPAITASGIIYTIKFVKSNEVVALSYAIPSVKTWGRFIMSMIVT
                     MIFSIPILLVVFLGNIFLVLSITSLHSAMLTGQISMNPMIGIWGVVFLIVILVLILAA
                     IVGILLFPLPYLMAEDTCGIWEAVKRSFKIMNGHKWELFIMGLSFLGWLILSALTLGI
                     GLLWLLPYIQVTLRIYYLSITGRESEIN"
     CDS             146210..147082
                     /codon_start=1
                     /gene="CPE0107"
                     /note="290 aa, partially similar to pir:S32215
                     hypothetical protein 1 from Bacillus megaterium (226 aa);
                     28% identity in 100 aa overlap. 6 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79813.1"
                     /transl_table=11
                     /translation="MTRKEIKSLSQDKLRGRWTNFLLLVLIVSVVQGLVTYLISNIES
                     IGVSSILNLGNSFLLGPFLESLLVVFVIKLVDRDDKIELKESIPSCKVWRNFIKKLLA
                     LILFELPISLIASVIAVVSLVSIISNHFYEYLFMASMNYEDILRDYIGIFIIIILIVA
                     IYNIIVSLFFFPVKYIIVEEPELGIWEAVGKAFKMMKGHKWELFVLILSLIGWAILAS
                     LPLVLGVIIILLMNISVYILPIFSIALLWFIVYRDTIYRVYYLSISERALEIGKDELN
                     QDIEVEEEDFEFRD"
     CDS             complement(147218..148582)
                     /codon_start=1
                     /gene="CPE0108"
                     /note="454 aa, similar to gp:CTH275974_4 putative
                     GTP-binding protein from Clostridium thermocellum (400
                     aa); 39% identity in 433 aa overlap"
                     /product="probaqble GTP-binding protein"
                     /protein_id="BAB79814.1"
                     /transl_table=11
                     /translation="MQFYYLHLAIVEKFMSNFNETPRGSRIHISLFGKTNSGKSSIIN
                     ALTGQNISLVSDFKGTTTDPVYKAMELLPLGPVVFVDTAGFDDEGEIGKLRVEKTEEV
                     VGKTDVALITLSLSEILEAIKSNIEFKDMLSKEILWLNKLKKAKKPAILVINKCDLVP
                     NKLIESKIDLKDIDKTTLSNKDCFVDSNLNNSLKEIGELLGIPCVAISAKNNLNINEL
                     KKELVNVSPSSITESPIIGDKIKAGDKILLVAPQDIQAPKGRLILPQVQVLRDILDYG
                     GIPTMVTLDKLDEGLRIFNGKPDLVITDSQVFKQVNAKLDRSVPLTSFSILMARYKGD
                     LDKFYSGAKAIKNLKAGDKVLIAEACTHHQLKGDIAREKLPTWLEETCPGIIVHNCSG
                     KDFPKNLNEYALVIHCGGCMFNKAEIMNRIGICDDALVPITNFGTSIAEINNILDRVM
                     EPLK"
     CDS             complement(149310..149594)
                     /codon_start=1
                     /gene="CPE0109"
                     /note="94 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79815.1"
                     /transl_table=11
                     /translation="MAVDQNSLERRTCCNIHKIVLTLEKGFSSMESLKYAVITHLQNE
                     GYRCNDTKNNIGDYPLLKINANDFLLTIKDIDENSLNFEDCSEVVLVPHH"
     CDS             complement(150273..151694)
                     /codon_start=1
                     /gene="CPE0110"
                     /note="473 aa, similar to pir:B72274 hypothetical protein
                     TM1267 from Thermotoga maritima (strain MSB8) (473 aa);
                     49.4% identity in 468 aa overlap. 1 putative
                     transmembrane region was found by PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79816.1"
                     /transl_table=11
                     /translation="MLKDNEKYNALDFIKDDEINSLIAKGKELVSDKELVREIIEKSK
                     SAEGLTPEETAVLLNLEDKELIEEMFKAARQVKEKLYGKRLVVFAPLYVSNYCVNNCT
                     YCGYKHCNDELKRKKLNKEQLIEEVKVLESLGHKRIALEAGEDPVNAPLDYILDCIKS
                     IYSIKFDNGSIRRINVNIAATTVENYKRLKDAEIGTYILFQETYHKPTYEKLHVSGPK
                     HNYNYHTTAMHRAREAGIDDIGMGVLYGLYDYKYETLAMLMHAMDLEETTGVGPHTLS
                     VPRIRPAENVSLENYPYLVDDEDFKKIVAILRLAVPYAGLILSTREEPGLRDEIIALG
                     VSQVSTGSCTGVGGYSESYIDPEEKPQFEVGDHRSPVEMIESLMEAGYIPSYCTACYR
                     EGRTGERFMDIVKSGELYKICEANALITLKEFIDDYGTDRTREIGDKLIKKSIDEIDN
                     ESFRKSVKEKINKISKGTRDLRF"
     CDS             complement(151800..152051)
                     /codon_start=1
                     /gene="CPE0111"
                     /note="83 aa, similar to pir:A72274 hypothetical protein
                     from Thermotoga maritima (strain MSB8) (82 aa); 34.7%
                     identity in 75 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79817.1"
                     /transl_table=11
                     /translation="MSTRIAVVGIVIESLDNIKEVNSILSEYDKLIVGRMGLPYKEKN
                     IRVISIVVDGTTDEISAITGKIGKLKGVSVKAAISKTSF"
     CDS             152495..154060
                     /codon_start=1
                     /gene="CPE0112"
                     /note="521 aa, N-terminal portion is similar to
                     sp:YPUA_BACSU HYPOTHETICAL 31.3 KDA PROTEIN IN LYSA-PPIB
                     INTERGENIC REGION (ORFX19) from Bacillus subtilis (290
                     aa); 32.2% identity in 273 aa overlap. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79818.1"
                     /transl_table=11
                     /translation="MKRNKLITAMILAGAISIGSFTTVFADTKEVVTLGANLNSSQKQ
                     EMFKEFGVKPNDVKVITMNVNEIREQLGLPKIVGEFKGNAYSSAFVKLEGKGYGIKVK
                     TNNLTEVTKTMLSNALLTSGVTDADIIATAPFPVTGTSALAGVLQAFEKATGENIPVE
                     NKEVARQELSITNNLAKAKNSEGQDIGRDGASAIVNQAKEEVIKDKPKNDKEVGEIVN
                     NITNNYNIKLTPTQEQELVALLANINSLGLDYSKLKGELDSLSNNIQEALKENGQELK
                     ESGTLDRILNKILGVCTDIKNWFVAHFGDGEVTINGVTYDKDGNMINKDQLNNIGTSI
                     SDEDNDTSNNESKNNIEDKSQKSDSKEKETDKANSNKQEDSNSQGELESKNNGSQNND
                     TKSNKESKNKDAQGAKESKNSKPNKNSVSSSKNNSNKNNSGSSNNSKDKGKETIKLED
                     GTVIPKYNSKGEEYNPVTGGYGHMQETEDVGKDYDQTIDYIIVDGKKVPLHDEQGREY
                     NPETGRYGDPDDN"
     CDS             154209..154436
                     /codon_start=1
                     /gene="CPE0113"
                     /note="75 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79819.1"
                     /transl_table=11
                     /translation="MAKAILTKKSLVLKYQKGVDDSGSPKFSTQKFSKIKVDAEDEKL
                     YEVGKALANLLSSRVNSVLKEDDFKFVDDTQ"
     CDS             154720..154944
                     /codon_start=1
                     /gene="CPE0114"
                     /note="74 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79820.1"
                     /transl_table=11
                     /translation="MEKELYLVLSFKNAGGSITKITLKNIKEDVTEEEVQNLMEKIVT
                     ANIFVSKGGDLVSKVKGEIVEKTTESFEMS"
     CDS             complement(155002..155943)
                     /codon_start=1
                     /gene="CPE0115"
                     /note="313 aa, similar to gp:SCC53_4 putative secreted
                     protein from Streptomyces coelicolor A3(2) (336 aa);
                     33.7% identity in 199 aa overlap"
                     /product="probable N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="BAB79821.1"
                     /transl_table=11
                     /translation="MKKFLRILSIIIISSLMLLGCGSNSTKPDINKDSNSINNSNEEN
                     NDTEKNNSNNENNNTEKNDSKEGNIDQEKEKNKIDSNTDKETDKKNDVEPYCENEPNK
                     ANKDITIVIDPGHSSTISNETEPECPGSQKRKLKDTLGATGVQSKIPEYTITHGVAEE
                     LKKLLISEGYNVIMTKDSPDKQLSNIERTTIGNDNNANLIIRIHCDGVDSPKACGASI
                     LVPATKGNVTKDISDISYSYGEKILTAYTKYTGLKNRGVVVRDDLTGFNWSKVPIVLI
                     ELGFISNPNEDSYLSNPDNYIKIATGISNGINYCFAK"
     CDS             complement(155956..157116)
                     /codon_start=1
                     /gene="CPE0116"
                     /note="386 aa, no significant homology. 1 putative
                     transmembrane region was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79822.1"
                     /transl_table=11
                     /translation="MKFCAKCGNKLSDSMKFCNKCGAKVKPVDKDTENNSNPEDAKNI
                     SNIENDIDKTIILDAPKIKKEINTDINENIKNNLKPIHNSNFNNKEKCLDASFDDDLD
                     ENFNDESCNNENTDNFKHSNTKKKILISIFTLVAFVIIGTSIYFLRSPLLYKYYYNSA
                     LKSSSVTEKLSYYNSALKYSKNDDLLNSIYTTLKSDSDFVDNSSILTNLNTSEKDNLM
                     SKLYVNKATVDFKNKNYTDCDSDLDLATKYGYNKENFSQYDDLQKKLNESKNSSSNDK
                     VDNIYSFTNENPSKFSGNIYDYPYDFIMPYSNSSYLSASDLSKYNKSTLALMRNEIYA
                     RHGYVFNTNPFKAYFNSKSWYHPDSSFKGDDSELNDYEVKNVQTIKSVENSK"
     CDS             complement(157128..158378)
                     /codon_start=1
                     /gene="CPE0117"
                     /note="416 aa, similar to pir:A70030 hypothetical protein
                     yvbJ from Bacillus subtilis (605 aa); 25% identity in 172
                     aa overlap. 1 putative transmembrane region was found by
                     PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79823.1"
                     /transl_table=11
                     /translation="MNFCNKCGSKLINGICPNCSKIKKNKKKSKIIIISLVFIVVIFS
                     GVFFYLKSTVKSEKEIALSFSNSISSSNPEELSKILYCNDSSLPINKSNSTILIDYFN
                     QNPSKFSSINDDFKKGNYKDTDSPLSIEEVRKDFFLIPVYKVVVKPSFIKVKTDLKDA
                     KVQIGDETFGDLTKKDELGPLMPGNYTIKSEISNSYLNKSENIEVNTFKSSNQEISIF
                     DNFIKVNITSDIPDAELYVNNKDTGVKIKDAKTFGPIDPNSIIYGVSTDGDKKIISNK
                     YDVNSSSNININFAEAKASEANFKKDLYVLLRNYSSDFAYAVNTNSFNYIENYLEFDS
                     PIYKKQKKVVPEIHSKDIRENFESTEILNYTFNNDTNTGEVTCNEIYSIGKGINVPKR
                     QEFKNTYTFKKLANGSLVLTDIKD"
     CDS             158494..159294
                     /codon_start=1
                     /gene="CPE0118"
                     /note="266 aa, no significant homology. 4 putative
                     transmembrane regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79824.1"
                     /transl_table=11
                     /translation="MFCSKCGKEIPNESVFCPECGNKCKGSSKSIPIDVNEHKGYIIK
                     SLCHPITSVKEHVFGVSSKIQLIYIAIITLIIPLVKTLLFKAFSFNLVKSVVGIILEF
                     SNVNTWDFNNMIKAKSQFDMIMENVFPTGNIYFLNLGSYIINYALILGIIYIIFKFLV
                     KEDINKDSLVNIMFVVSIINVFILIISSIALVLGGAIWMIVSIFSSILSVVLLYALFN
                     TLIKSKNKFIYIYSLTCMVVYSINAWFVFNNVSSIIYQIYYNLERYFI"
     CDS             159434..160114
                     /codon_start=1
                     /gene="CPE0119"
                     /note="226 aa, similar to gp:AF036964_1 putative response
                     regulator from Lactobacillus sakei (224 aa); 49.3%
                     identity in 203 aa overlap"
                     /product="two-component response regulator"
                     /protein_id="BAB79825.1"
                     /transl_table=11
                     /translation="MESKKIFIIEDEEKIREELTKFLEKYGYVVESSDDFENIVDISL
                     SCNPNMILLDINLPYYDGYYICREIRKKSQVPIIVVTSRQSEMDELMSMNLGADDFVT
                     KPYNTQILLARIASIMKRTYSGIEGETEIFNCRGLKYNMSTSEVSFKDEVEELTKNES
                     KILNILIRNKGKIVSRDNIIKALWQSNEFIDDNTLTVNVNRLRRKIEGIGAEGYLQTK
                     RGQGYILS"
     CDS             160111..161124
                     /codon_start=1
                     /gene="CPE0120"
                     /note="337 aa, similar to gp:AF036964_2 putative
                     histidine kinase from Lactobacillus sakei (339 aa); 38.2%
                     identity in 178 aa overlap. 1 putative transmembrane
                     region was found by PSORT"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BAB79826.1"
                     /transl_table=11
                     /translation="MNLRDFIKERIVFIIINSLILIFTALLLMVLKVDSFAILFIVII
                     NGTGILIYHIFDYLRKKQYYNEIKENMESLDKKYLISEVIEEGTFTESKLIYDVICKG
                     NKAMNDEIGEFKRGINDYREYIELWVHEIKTPIATCKLLIENNESPLTESIGEEVCKL
                     ENYIDQALFYTRSNTLEKDYIIKEMSLSSCVNKVLNNNADSLIKKRVKISLGDLEKGV
                     YSDSKWIEFILGQIISNSIKYMNKEHKELKIYCSESSKYVILNIEDNGAGISEKDISR
                     VFDKGFTGENGRKFGKSTGIGLYLCKKLCKKLGLDITLISEEGKFTRVSIIFPINRMM
                     IFE"
     CDS             161176..161373
                     /codon_start=1
                     /gene="CPE0121"
                     /note="65 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79827.1"
                     /transl_table=11
                     /translation="MGKKFLVVVIVCIFIRCLLNLIEAIMLNIEFLKNINFYYINTFV
                     NAFLVIILIGSYIYLYKNYEK"
     CDS             161923..162693
                     /codon_start=1
                     /gene="CPE0122"
                     /note="256 aa, similar to gpu:AP001508_9 ABC transporter
                     (ATP-binding protein) from Bacillus halodurans (259 aa);
                     52% identity in 252 aa overlap"
                     /note="ATP-binding protein"
                     /product="probable ABC transporter"
                     /protein_id="BAB79828.1"
                     /transl_table=11
                     /translation="MGKEVLKVSNIEKYYGKKGNVTKAINDISFTVSEGEFVGIMGAS
                     GSGKTTLLNCISTIDKVTSGHIYLEGEDVTSFSSKKLAKFRREKIGFIFQDFNLLDTL
                     TAYENIALALTIQRVNNKEIDKRVRLVAEALNISNELNKYPYEMSGGQKQRVASARAI
                     VTNPSLVLADEPTGALDSKAATMLLESLEDLNKNLNATIMMVTHDAFTASYANRILFI
                     KDGKIFNELIKGTDSRKEFFNRIIEVITLLGGDSNNVF"
     CDS             162683..164662
                     /codon_start=1
                     /gene="CPE0123"
                     /note="659 aa, similar to pir:G70032 ABC transporter
                     (permease) homolog yvcS from Bacillus subtilis (646 aa);
                     24.1% identity in 602 aa overlap. Putative N-terminal
                     signal sequence and 9 putative transmembrane regions were
                     found by PSORT."
                     /note="permease"
                     /product="probable ABC transporter"
                     /protein_id="BAB79829.1"
                     /transl_table=11
                     /translation="MYFKLAFKNIKKSYKNYVIYFLTLIFGICIFYTFNSIESQSVMM
                     ELNEQKQSAFMMAEQLIGYFSVFIAFVLGFLIVYANNYLIKRRKKEFGIYMTLGMENG
                     SLSKMIFLETLFIGAISLGIGVVLGIMLSQALSVLTAYMFQVDLTKFQFVFSPLGFKR
                     TVLCFSIIYLVVLIFNFISVRKIKLIDLLTASKRNEKPTIKNLWVSVILFLVSVGILG
                     IAYYKVIHDGIAFASFNALGLPILLGCIGTFIFFYSLTGFFLKVIQGNKKFYLRDLNM
                     FVMKQISSKINTTFVSLSFICLMLFLAICTFSGGLGINRAINADLKDLTKFDVTFWSN
                     SGENIENLLKEKNIDISNIAKEDSNMIMYDSGVKYSNFLSKEGMTAMKNYFPVANDND
                     ILVIGEKGYNNTLKLLGKEPVNLKENQYLAVGNIDEMKKWVNESLENGKKINISGKTL
                     ETENKKYENINLYNFTMKGDILIFVVKDSLLEGLKPVSSRFNMMLKDNSNTKEELENV
                     RDQLVESQVYSITKKEIYDNAAGLGATMAYLGIYLGLIFIITSAVVLAIQQLTESTDN
                     VERYRLLKEIGVDQKMINKAIFTQVGVYFMLPLSLAIVHSIVGLKISSTIVGVFGNAS
                     IMPNIIITAIIFVIIYGGYFLATYLGAKKNINERS"
     CDS             complement(164831..165400)
                     /codon_start=1
                     /gene="CPE0124"
                     /note="189 aa, no significant homology. Putative
                     N-terminal signal sequence and 5 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79830.1"
                     /transl_table=11
                     /translation="MVKQKEKNLESNRPLILAVMFLINFFIFILFIHNFNIFIYAYIF
                     IFNIFSLINLIFMKKLYSFIDLYTALSLSSFSLFLFLSGLYKLNEILSINKFINLSIL
                     FIIIYILIIILSINHIKNFYNSKSYKNKILKNYPNYGLIVVGSLLGLFLSKLNLNQDL
                     IIALGMVLLSCGFAVCYSHFYKFFYNSSH"
     CDS             165492..165704
                     /codon_start=1
                     /gene="CPE0125"
                     /note="70 aa, similar to pir:F69799 hypothetical protein
                     yezA from Bacillus subtilis (68 aa); 37.9% identity in 66
                     aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79831.1"
                     /transl_table=11
                     /translation="MEQLNRKEIIELVNIIRNPKEEWSEAMIDELIFKLKRNVIYPNP
                     SDLIFYTELSAEEIADKILAYKPILL"
     CDS             165999..166325
                     /codon_start=1
                     /gene="CPE0126"
                     /note="108 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79832.1"
                     /transl_table=11
                     /translation="MSKYIYDENVFLKIDNFDNIYFEEKDSVLNIRLVKIEDGLVKEF
                     FEDDLKFDLSKYNNTKKELNKSLVYELKNEFLDFMDNEKEKIFDVIINLKELKEELCS
                     KQISLV"
     CDS             166569..166763
                     /codon_start=1
                     /gene="CPE0127"
                     /note="64 aa, no significant homology. Putative
                     N-terminal signal sequence and 1 putative transmembrane
                     region were found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79833.1"
                     /transl_table=11
                     /translation="MKKYLDKLQNMPIGISGTCLAFITLSNSWKLKGINYFKPIAIFL
                     AVCMLSLMILRLIRFPKVIV"
     CDS             166956..167585
                     /codon_start=1
                     /gene="CPE0128"
                     /note="209 aa, similar to gpu:AE004302_6 conserved
                     hypothetical protein from Vibrio cholerae (322 aa); 28.8%
                     identity in 240 aa overlap. ATT start. Putative
                     N-terminal signal sequence and 3 putative transmembrane
                     regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79834.1"
                     /transl_table=11
                     /translation="MPTCFIVYTGMITGSVASKGMDGVIPQIPQIAHFMLMFGFIFYT
                     ILLPLVLYIVFKSEILDDHKLPTVGIICSPAPLGVVGILTIEPNPNPYMLAWLIITGL
                     ILLVVVYGYILKLFKEGFKPSYAAFTFPLAIATLSAFKLSTYFTGLGYAKMANLFKFL
                     GDVEIFIATYVIFFMLLNFLNMFFKAISPKLGEYVEEEEELIGGTLYSK"
     CDS             168100..169119
                     /codon_start=1
                     /gene="CPE0129"
                     /note="339 aa, similar to sp:YEIH_HAEIN HYPOTHETICAL
                     PROTEIN HI1643 from Haemophilus influenzae (338 aa); 28%
                     identity in 314 aa overlap. Putative N-terminal signal
                     sequence and 5 putative transmembrane regions were found
                     by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79835.1"
                     /transl_table=11
                     /translation="MRNKILKKSKSILPGLFICLIIGIIAEFLGKSFPTIGAATFAIF
                     MGIFLGNTLFKSDKYDEGTKFSEKDLLNYSIVLMGASLNIIDIMALGFNGVFYIAILM
                     TLTICTTYFIGRKLGFGEKYSLLMSAGNAVCGSSAIGSVSPVIKAKDSDKVIAITIVN
                     VTGTILMILLPLITSILYNNDVLQSSALMGGILQSVGQVIGSAKFIGDPVVELATVFK
                     IIRIIFLVVVVLVFAKIEVNEENKEEIAHHHKPTHKVRIPWFIIGFFIICILNSIGII
                     PGILGRTFKWISSNFEIIALAGIGMRVKIGDLVKEGPKAMLYGGLVGVCQIIFALSLI
                     NIFIK"
     CDS             169320..169472
                     /codon_start=1
                     /gene="CPE0130"
                     /note="50 aa, no significant homology. 1 putative
                     transmembrane region was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79836.1"
                     /transl_table=11
                     /translation="MIGEVLSFGYDQCAKLGYAMGFGAMEGLVIYLGLLAIIVLKLFN
                     SKSKAN"
     CDS             complement(169828..170721)
                     /codon_start=1
                     /gene="CPE0131"
                     /note="297 aa, similar to pir:B71256 conserved
                     hypothetical integral membrane protein TP0986 from
                     Treponema pallidum (294 aa); 33.7% identity in 270 aa
                     overlap. Putative N-terminal signal sequence and 8
                     putative transmembrane regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79837.1"
                     /transl_table=11
                     /translation="MNSKFKGIIFMILASAAFATMNLLSKLAVGVNSYQKTFLTNVVA
                     TLIVCFIIAYKKGSFFGKKESRKYLLVRGVTGTLSILTNYYALDKMFLSDATILTKLA
                     PFFTIIFSYLLISEKITKKQFTLLIVAFAGSLFVIKPQFSTAIIPSLIGVASAAFAGI
                     AYTMIRVIGDKEDFWTIILSFTSIATIVMLPSMFMNTDNLTLQNILLLVSAGIAFTLG
                     QVALTIAYKNAPASEISMYDYIGLIIAAIYGFMFFKEIPDFLSFTGYIIIVGSSILNI
                     LGNKKTSTKEINEDSSLVSID"
     CDS             171050..172288
                     /codon_start=1
                     /gene="cinA"
                     /note="412 aa, similar to sp:CINA_BACSU PUTATIVE
                     COMPETENCE-DAMAGE PROTEIN from Bacillus subtilis (416
                     aa); 43.1% identity in 394 aa overlap"
                     /note="CPE0132"
                     /product="probable competence-damage inducible protein"
                     /protein_id="BAB79838.1"
                     /transl_table=11
                     /translation="MKAEIMAIGTEILLGDIVNTNAQFLAKELANLGIGVYHQSVVGD
                     NSERILEAFDNAFKNCDTIITTGGLGPTKDDLSKELAAKYFNMEMCLREELLCDLEDY
                     FKKNNLEMTENNKKQCYFPKEAIILPNPNGTAPGAILEGENNKRIILLPGPPREMEPM
                     FTNHVVPYLSKFTDSVLVSKILRVFGIGESKMEDLVCDLLDNENPTVAPYAKNIDVIL
                     RITAKGKDKEEAEKLIAPMEKEIRKRLGDNIYGEGEVTLEEVVGKLLVDKKMTVSTAE
                     SCTGGMVASTLINYPGISEVFMEGAVTYSNEAKMKRLGVKKETLEDFGAVSEECAREM
                     AKGIAKNAGTRIGISTTGIAGPGGGTEEKPVGLVYAGLCIDGITKVKKFNFKADRQKV
                     RTRTMMNVLDWLRRELEKID"
     CDS             172988..173914
                     /codon_start=1
                     /gene="CPE0133"
                     /note="308 aa, similar to pir:S75835 hypothetical protein
                     slr1288 from Synechocystis sp. (strain PCC 6803) (194
                     aa); 30.2% identity in 126 aa overlap. Putative
                     N-terminal signal sequence and 7 putative transmembrane
                     regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79839.1"
                     /transl_table=11
                     /translation="MKPIFKVSLYFLIVLVLSIVGPMFVTPVLYKIGLVPPLVLMVIH
                     IIFFIVPAIIYIIVTKSNYKKVFSFKKPKGKDVFFSILIAALALPIMTFFSYTSSLFY
                     TNDVALVLDQMRVYPLWLMILVVGVTPAITEEITIRGIALSGFEFKSKNVAAIMTGIM
                     FGILHLNAHQFLYATAMGIILAYVVRATGSIFLSMLIHFLINSWNLIQQRIVSQGITT
                     EDLVHSMDSIKNISMELKIGVFLYYLIAAIVAAFLISYLIRKMEKRNFDITLDELDVA
                     TRVSYKEERVINVPFIISVIVFIVYTFFIMKG"
     CDS             174180..174389
                     /codon_start=1
                     /gene="CPE0134"
                     /note="69 aa, no significant homology. Putative
                     N-terminal signal sequence and 1 putative transmembrane
                     region were found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79840.1"
                     /transl_table=11
                     /translation="MSATILIPLSITTSSFSRCSSRTTSIFKPAHPEEQAFILRASLS
                     LLSSISLTLSKVFGCILTFIIKTSI"
     CDS             174742..175329
                     /codon_start=1
                     /gene="rubY"
                     /note="195 aa, similar to sp:RUBY_CLOPE RUBRERYTHRIN from
                     Clostridium perfringens (195 aa); 99% identity in 195 aa
                     overlap"
                     /note="CPE0135"
                     /product="rubrerythrin"
                     /protein_id="BAB79841.1"
                     /transl_table=11
                     /translation="MKSLKGTKTAENLMKSFAGECQARTRYTYFSSTARKEGYVQISN
                     IFLETAENEKEHAKRFYKFLKDDLQGEAVEINAAYPVELPTDTLTNLKFAAEGEHDEL
                     SNLYPSFADVADEEGFPEVAAAFRMIAKAETAHYNRFMKLAKNIEEGKVFKKDEVVLW
                     KCGNCGFIWEGAEAPLKCPACLHPQAYFEVFKETY"
     CDS             complement(175492..176037)
                     /codon_start=1
                     /gene="CPE0136"
                     /note="181 aa, similar to sp:Y099_PYRHO HYPOTHETICAL
                     PROTEIN PH0099 from Pyrococcus horikoshii (184 aa); 31.3%
                     identity in 96 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79842.1"
                     /transl_table=11
                     /translation="MLYYLVALFDKVSYAIIKPLQESISNEYKLYENLPMLHITLAVI
                     EDPDMDKLNEVVKNTLKSYKKFEVHLNGLIKFGEPYRSVNLKVDEESGVIKKLSRELY
                     ENLSKEGFKLTSNPDTWQLHVSLANPYFAQRVWGEDEFESAYTKLQDYNFDRELLIDE
                     IQFWRPINDESKMVVFSYPLH"
     CDS             176893..178449
                     /codon_start=1
                     /gene="CPE0137"
                     /note="518 aa, similar to pir:D69813 ABC transporter
                     (ATP-binding protein) homolog yfmM from Bacillus subtilis
                     (518 aa); 72.9% identity in 517 aa overlap"
                     /note="ATP-binding protein"
                     /product="probable ABC transporter"
                     /protein_id="BAB79843.1"
                     /transl_table=11
                     /translation="MSILIVKNMNHGFGDRAIFEDVSFRLLKGEHVGLIGANGEGKST
                     FMNIITGKLMPDEGDVQWSNKVRVGYMDQHAQLEKGKTIREVLREAFQYLFDMEVEMN
                     GLYERMGEMSEDEMTKALERTATIQDMLDHNGFYMIDAKVEEVAAGLGLRDVGLDKDV
                     TDLSGGQRTKVLLAKLLLETPDILLLDEPTNYLDEEHIAWLKNYLIGYENAFILISHD
                     IPFLNSVVNVIYHVENRALTRYTGDYDNFMRVYEANKKQLEAAYERQQAEIAKLEDFV
                     ARNKARVATTGMARARQKKLDKMDRIELAAEKPKPEFNFKQGRTSGKLIFEARDLVIG
                     YDEPLSKPLNIRMERGQKIALVGANGLGKSTLLKSLMGLIKPISGEVETGDYQSIGYF
                     EQEIKEANYNSCIEEVWQEFPGYTQYEVRSALAKCGLTTKHIESSVAVLSGGEQAKVR
                     LCKLINKETNILILDEPTNHLDVEAKDELKRALKEYKGSILLVCHEPEFYRDVVTDVW
                     NCEEWTTKIC"
     CDS             178710..179510
                     /codon_start=1
                     /gene="CPE0138"
                     /note="266 aa, similar to C-terminal of prf:2220313B ORF
                     3 - Lactococcal bacteriophage TP901-1 from Bacteriophage
                     TP901-1 (181 aa); 39.5% identity in 167 aa overlap"
                     /product="phage-related hypothetical protein"
                     /protein_id="BAB79844.1"
                     /transl_table=11
                     /translation="MNLTFKASFQKEWTILDDRIIYGEREILFTHIQSAKLFCKSSFV
                     TNGVIQIIVDGKSINLVYPHKLKVYGEKALTYLLDNYGIKEEKENRKSISEVQEEINS
                     LPCKDDWGTRKEIAELPSVLSIDEHIKAMTSGLTDGNTWLIVCTNKRVLMLDKGMIYG
                     LKLIDIPLDRINSISHSKGLLLGKISITDGATTRTIENVSNETLNFFTDTVSKEVEIY
                     KQAKNTSVTQVVNAMSTADEILKFKQLLDMGVLTQEEFECKKKELLGF"
     CDS             179861..180331
                     /codon_start=1
                     /gene="CPE0139"
                     /note="156 aa, similar to gp:AF125554_2 putative
                     transposase from Enterococcus faecium (156 aa); 72.4%
                     identity in 156 aa overlap"
                     /product="probable transposase"
                     /protein_id="BAB79845.1"
                     /transl_table=11
                     /translation="MDNSSLAHSKWNCKYHIVFAPKYRRQIIYGKIKSDIGAILRKLC
                     DQKGVEIIEANACKDHINMLVSIPPKLSVSQFMGYLKGKISLMIFDRHANLKYKYGNR
                     QFWCKGYYVDTVGRNKKAIEEYIKNQIQEDIAYEQISLKEYIDPFTGEPIKKNR"
     CDS             180609..182378
                     /codon_start=1
                     /gene="CPE0140"
                     /note="589 aa, similar to prf:2303403A ORF 1 from
                     Salmonella enterica (618 aa); 28% identity in 558 aa
                     overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79846.1"
                     /transl_table=11
                     /translation="MGINISLNKSEKLTKGEQRVLDALKNAYANMDYDVFLYVQPSLA
                     RKRPDFVVIDSKRGILILEVKDWSENYIKSVNKRKVVLLDDECENPTMQVKGYRSMLN
                     SALFNRGFDNIEEDDINIGVIFTNMDEVEKINPRLELLFNKDISYTFKNHINKLNLDK
                     LFNYNKVNFSEDDLKQVRIALFPEIEIIKDKKSGENKGVKALDFEQEDFAKRIPLGNY
                     MVTGVPGSGKTVMLLARAIYLVKENPDWKVLILTYNKSLNYKLNNNLERLAEIFKEDI
                     NNKYINIDNIEIRTFHNELLNLTGRVKRPQGMSEKEWFDEGWVNKAKEKVRQKYDAIL
                     IDEYQDFRMNWIELCVNLCKDYYIDDKVVKNIFLAGDRLQSIYNNKDISWKSIGIDMR
                     GRSKLLKTSYRSAKQHMSLALDFLRNDKVLKDEVEKFYKDNSDDKELNALNNGSLEFI
                     TGDFSEITNKILELKNQGYENKDILILAATERICKNIKECSNDKNIKYQMKFVKDLDN
                     SSIGNNIILTTYHSSKGLEAKVVILTTIDSIYTGDDCDDHLKRKVAYVGITRASEKLF
                     IFSKYGEEGPLLNELKELSMVNV"
     CDS             complement(182398..182559)
                     /codon_start=1
                     /gene="CPE0141"
                     /note="53 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79847.1"
                     /transl_table=11
                     /translation="MARKDLKNRTPVGSAMDNKIYYEMKAYSEKTGIPISKILDKAMS
                     MYLESTKKF"
     CDS             182670..182885
                     /codon_start=1
                     /gene="CPE0142"
                     /note="71 aa, similar to N-terminal of prf:2416406A   ORF
                     A from Lactobacillus casei phage A2 (160 aa); 32.1%
                     identity in 53 aa overlap"
                     /product="phage-related hypothetical protein"
                     /protein_id="BAB79848.1"
                     /transl_table=11
                     /translation="MNDLFIKKFNDEEIITLILDNRICWIAKDVAKILNYDDPSKAIN
                     QCIKAEKFEYGIEYEVLAGDKLKDLLV"
     CDS             182876..183235
                     /codon_start=1
                     /gene="CPE0143"
                     /note="119 aa, similar to N-terminal of gp:AF162221_131
                     ORF131 from Xestia c-nigrum granulovirus (442 aa); 40%
                     identity in 75 aa overlap. ATT start"
                     /product="phage-related hypothetical protein"
                     /protein_id="BAB79849.1"
                     /transl_table=11
                     /translation="MGVTHISYLKQTPKLVIFYEEGLYGFINYSKLPIGISFRKWLRR
                     EVLPELRAKGTYSINKESYKDNLKDENENLSLYIQDKLNKERNLSLLLEVLNLIDRIT
                     SKENEDKLRYLKDILNG"
     CDS             183767..184318
                     /codon_start=1
                     /gene="CPE0144"
                     /note="183 aa, similar to sp:YJII_ECOLI HYPOTHETICAL 24.6
                     KDA PROTEIN IN IADA-MCRD INTERGENIC REGION (O218) from
                     Escherichia coli (218 aa); 43.5% identity in 170 aa
                     overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79850.1"
                     /transl_table=11
                     /translation="MKNNDSKISKYISLILRHKPEEIGLKLDEHGYLGVLDLIEGLNK
                     SYKGFSMDDLERIVREDSKGRYSFNEDKSKIRANQGHSIKVDLGLEAIKPPKVLYHGT
                     GRKYIESILKNGLIKKERQYVHLSKDIETASIVGKRHGDLVILEVDSESMFKDGIKFY
                     LSKNNVWLCDYVKVEYIKEISLL"
     CDS             184608..185453
                     /codon_start=1
                     /gene="CPE0145"
                     /note="281 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79851.1"
                     /transl_table=11
                     /translation="MSNILDNFNKQKDFLICIDSDGCAIDTMDIKHIKCFGPCMVTEW
                     NLEEWKEPILERWNEVNLYTLTRGINRFKGLAVALIEINEKYITIEGLDEFVRWTEET
                     KELSNESLEVEIEKTNNICLKKALEWSKSVNKSIDLLSDDEKCPFEGVKEAIILAKKV
                     ADIAIVSSANEKAVLDEWNKHGLLENVDIVLTQNIGSKSYCINKLIAKGYSRNNVLMV
                     GDALGDLKAAEENEALYYPIMVRKEKESWIRFSKEALERFTSNSYYGEYQEKVIAEFK
                     ENLSK"
     CDS             185482..186507
                     /codon_start=1
                     /gene="CPE0146"
                     /note="341 aa, similar to pir:G72422
                     2-keto-3-deoxygluconate kinase from Thermotoga maritima
                     (strain MSB8) (339 aa); 38.2% identity in 322 aa overlap"
                     /product="2-keto-3-deoxygluconate kinase"
                     /protein_id="BAB79852.1"
                     /transl_table=11
                     /translation="MNELGFRSKKVLGFGEIMLRLTPPNNQKIIQANSFEAVYSGGEA
                     NVIASLAILGHDTKFVTKLPDNYLGKKVISKFRGYNVDVNDIVIGEGRLGVYYSEIGH
                     GLRSTEVIYDRKYSAISMASKDEFNIDNMLKGVGLVHLSGITPALSKDLKMLIIEIAK
                     ECKKKGILVSYDSNYRSKLWSIDEAKEVLEEILNYVDFAFLGSLDMINILKFEDNSLD
                     FDEKLQYHYEMLFKKYPNLRYAACTKRIVNSINNNTLKGYLFNGKELLKSNSYTFDIL
                     DRVGGGDAFTAGILHGILNEMPNERVVEFGTCASSLKHSIIGDINIIDEDTINSVIDN
                     GLCNVKR"
     CDS             186571..188370
                     /codon_start=1
                     /gene="bglR"
                     /note="599 aa, similar to sp:BGLR_ECOLI
                     BETA-GLUCURONIDASE (EC 3.2.1.31) (GUS)
                     (BETA-D-GLUCURONOSIDE GLUCURONOSOHYDROLASE) from
                     Escherichia coli (603 aa); 48.3% identity in 598 aa
                     overlap"
                     /note="CPE0147"
                     /product="beta-glucuronidase"
                     /protein_id="BAB79853.1"
                     /transl_table=11
                     /translation="MLYPIITESRQLIDLSGIWKFKLNEGNGLTEELSKAPLEDTIEM
                     AVPSSYNDLVESQEVRDHVGWVWYERNFTIPKTLLNERIVLRFGSATHEAKVYLNGEL
                     LVEHKGGFTPFEAEINDLLVSGDNRLTVAVNNIIDETTLPVGLVKEVEVDGKKVIKNS
                     VNFDFFNYAGIHRPVKIYTTPKSYIEDITIVTDFKENNGYVNYEVQAVGKCNIKVTII
                     DEENNIVAEGEGKEGKLTINNVHLWEPMNAYLYKLKVELLDDEEIIDTYFEEFGVRTV
                     EVKDGKFLINNKPFYFKGFGKHEDSYVNGRGINEAINIKDFNLMKWIGANSFRTSHYP
                     YSEEIMRLADREGIVVIDETPAVGLHLNFMATGFGGDAPKRDTWKEIGTKEAHERILR
                     ELVSRDKNHPCVVMWSVANEPDSDSEGAKEYFEPLIKLTKELDPQKRPVTVVTYLMST
                     PDRCKVGDIVDVLCLNRYYGWYVAGGDLEEAKRMLEDELKGWEERCPKTPIMFTEYGA
                     DTVAGLHDTVPVMFTEEYQVEYYKANHEVMDKCKNFVGEQVWNFADFATSQGIIRVQG
                     NKKGIFTRERKPKMIAHSLRERWTNIPEFGYKK"
     CDS             188513..189202
                     /codon_start=1
                     /gene="CPE0148"
                     /note="229 aa, similar to prf:2514353L regulatory protein
                     from Bacillus stearothermophilus (249 aa); 36.5% identity
                     in 208 aa overlap"
                     /note="GntR family"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB79854.1"
                     /transl_table=11
                     /translation="MILYEKLEKETCKEYVYRVLKDNIMSLELSPGEILSESDLSKKL
                     NVSRTPIREVLIKLKAEKLIEVKPQAGTYVSQIDWNLIEEAIFIRYNLEKEALKEACE
                     NFSEDTLIEMEKCLFAQKLVAQKGNNLLEFHNLDKEFHKLIFIGINKSNVWESICNIS
                     THYNRMRLLAEIRLNKEFLVDQHITYLNILKNKDSNIIDEVVSKHIKAPVEQWKKLIK
                     EDPEIANFIIL"
     CDS             189392..190243
                     /codon_start=1
                     /gene="CPE0149"
                     /note="283 aa, similar to gp:AP001509_145 D-mannonate
                     oxidoreductase  from Bacillus halodurans (284 aa); 58%
                     identity in 285 aa overlap"
                     /product="probable oxidoreductase"
                     /protein_id="BAB79855.1"
                     /transl_table=11
                     /translation="MKLPFNIDLKDKVCVVTGGTGVICGAMADALAECGAKVAILALG
                     QEACDNKAREINEKGGTAIGIETNVLDKENLKKAHEIILKEFGTVDILINGAGGNHPK
                     GTTTKEYLEVEDLENEDITTFFDLDAKGVEFVFNLNFLGTLLPSQEFSKDMINKDGAT
                     IINISSMNAFTPLTKIPAYSGAKAAVSNFTQWLAVHMSKVGIRVNAIAPGFFVTAQNE
                     KLLFNEDGTPTPRTEKILNSTPMRRFGEASELIGTLLYLVSEEASGFVNGVVIPVDGA
                     FSAYSGV"
     CDS             190258..190866
                     /codon_start=1
                     /gene="CPE0150"
                     /note="202 aa, similar to pir:F72422 KHG-KDPG
                     bifunctional aldolase TM0066 from Thermotoga maritima
                     (strain MSB8) (205 aa); 46.7% identity in 197 aa overlap.
                     Putative N-terminal signal sequence was found by PSORT"
                     /product="2-dehydro-3-deoxyphosphogluconate/4-hydroxy-2-
                     oxoglutarate aldolase"
                     /protein_id="BAB79856.1"
                     /transl_table=11
                     /translation="MILDELKASGVVAVVRGKSHEEARGYMEACLKGGIKSLELTYTI
                     PNVCELIKEYSSHAEALIGVGSVLNGKMASDAIEAGAKYVVSPGYSEEVNKVCKEMNV
                     LYLPGCMTVSEIMKAMDAGNKMIKLFPGDVFGAKYVKAIKAPIPNVEIMPTGGVSVDN
                     IEEWFANGVSCVGVGSSLIKGSLEDIENTAKAFMKKMEKIRC"
     CDS             190957..192009
                     /codon_start=1
                     /gene="uxuA"
                     /note="350 aa, similar to gpu:AP001509_144 D-mannonate
                     dehydrolase from Bacillus halodurans (345 aa); 66%
                     identity in 344 aa overlap"
                     /note="CPE0151"
                     /product="D-mannonate dehydrolase"
                     /protein_id="BAB79857.1"
                     /transl_table=11
                     /translation="MEMTFRWYGKDDPVKLEYIKQIPGMKGIVTAIYDIPVGEVWPLE
                     RILELKKEIESHGLKLSVIESVPVHEDIKLGLPTRDRYIDNYIQTIRNLAEAGVDTIC
                     YNFMPVFDWTRSDLNYKLEDGSTCLIYDEEQVKKMDPALGELELPGWDTSYGEGGLKG
                     LLEQYKDIDEEILWSNLNYFIQRIMKVADKVRMKMAIHPDDPPWGIFGLPRIITNFDN
                     LKRFIDLYDSPYHGITLCTGSLGCTKVNDMVQMINYFGKERNRIHFAHLRNVKITGDS
                     SFNEVAHLSEAGSLDFYEIVKAYCDYDFAGPYRPDHGRMIWGETGRPGYGLYDRALGA
                     VYINGLIEAIKKNKKN"
     CDS             192029..193429
                     /codon_start=1
                     /gene="uxaC"
                     /note="466 aa, similar to sp:UXAC_ECOLI URONATE ISOMERASE
                     (EC 5.3.1.12) (GLUCURONATE ISOMERASE) (URONIC ISOMERASE)
                     from Escherichia coli (470 aa); 54.3% identity in 464 aa
                     overlap"
                     /note="CPE0152"
                     /product="glucuronate isomerase"
                     /protein_id="BAB79858.1"
                     /transl_table=11
                     /translation="MKKFMDKDFLLENEVAKVLYHNYASKVPVFDYHCHLVPMEIATD
                     HKFKNLTEMWLYHDHYKWRAMRSFGIDEEYITGNASDYDKFYQFAKMMPYLIGNPIYH
                     WSHLELKRFFGVEETLSEKTASTIWEKCNKVIENNNLTAKKLIEMANVVYIGTTDDPI
                     DDLRYHKQLKEDINFKCSVNPSFRPEKAMKIQNEGFKEYIGKLAEVSNVEIKSFDDLK
                     KALEIRLDYFYENGCMITDHSLERVVFYKFSCEEINEIFIKALNGENINNEEASKYSV
                     ALLISLGKMYAERNMVMQLHIGALRNNNTRMFNRIGADAGFDSIDDGEIAYSLSRILD
                     ELDKEDKLPKTILYCLNPKDNEVLGTMIGNFQGGNIAGKIQFGSGWWFNDQKDGMERQ
                     MMALSQLGLISQFVGMVTDSRSFLSYTRHEYFRRILCNYLGNLVESGQYPYEEEILGE
                     IVQNICYKNSAKYFKR"
     CDS             193550..194941
                     /codon_start=1
                     /gene="uidB"
                     /note="463 aa, similar to sp:UIDB_ECOLI GLUCURONIDE
                     CARRIER PROTEIN (GLUCURONIDE PERMEASE) from Escherichia
                     coli (457 aa); 30.5% identity in 442 aa overlap. 9
                     putative transmembrane regions were found by PSORT."
                     /note="CPE0153"
                     /product="glucuronide permease"
                     /protein_id="BAB79859.1"
                     /transl_table=11
                     /translation="MVLDLISKKEERVKSFNMGDKIGYAFGDFGCATFFAFVSSYLMV
                     FYTDVLGISAAAVGTLFIVARFWDAINDPIMGVLLDKAEATRHGKFRPYVVRFGVPMV
                     IVGILAFTAIPGLPDNMKLPYAYVTYILYGMLYTAVNIPYGSLASVMTNDSDERTALS
                     TFRNLGSMLANVLVMILVPKIIFNAQGEVTAEGFITCAVILAIISTISFFFNFRLTRE
                     RIVHKVNNNKKSIGQTIALLFKNRAFIGVAIASFLMLGGSLALSSLNVYIFKDYFKEP
                     GLTAFGGMIGMLASIIVIPFAGAIVRKLGKKESAVLGSAFAACMYTVMLFIPNLSVMV
                     FLVLSFLAGLGSGLVNTIIWALVSDVIDYQEYTTGERNEGTVYSSYSLARKLGQVISG
                     GMGGFALSLLGYQSGATVQAESIGVGIKNIGIGMAAGGFVLTTLILVFVYNLSKKKVN
                     EMNKVLEERREAQ"
     CDS             195005..196774
                     /codon_start=1
                     /gene="CPE0154"
                     /note="589 aa, similar to gp:AP001509_113
                     beta-hexosamidase A precursor from Bacillus halodurans
                     (686 aa); 29% identity in 412 aa overlap"
                     /product="probable beta-hexosamidase A"
                     /protein_id="BAB79860.1"
                     /transl_table=11
                     /translation="MVNLKVKPYNLDEESIKWVEDTIKNMSIEEKIGQLFVNMGASRD
                     EEYLKSVLNNYHIGAVRYNPGKAEEVYEQNRILQENSKIPLLIAANTEAGGNGACTDG
                     TYVGNEVKIAATQDPHYAYELGRISGIEASAIGCNWSFAPIVDINRNWRNPIISTRTW
                     SADADQTLELSLEYMRGIMESGILPAAKHFPGDGIDERDQHLSFAPNTLSVEEWNATF
                     GKVYSGLIEAGLPSIMAGHIALPEYVKYFNPDATIKEMNMPATLSKYILTDLLKGQMG
                     FNGLVVTDASHMVAMTSAMKRKDMLPTAIAAGSDLFLFFNDPDEDFQWMMEGYKNGVI
                     TEERLHDALTRILGLKASLGLHKKAKTEILQPKEEAMAKIGLEENKKAALEIADKAIT
                     LVKNNEEIFPISPDKTKRVLLVKVKGFDGGFGKFLALMQGAQKGPVDIMKELLEQEGF
                     QVEIYESPVDKIMKLPKEEMGAAIGNIYAGKRPIAELTSKYDLIINLADVGASVDQRL
                     QWPPSKGTPDIPFYVNEIPTIFISLQCPFHLADVPQVKTYINAYDSKEFNIKALVDKM
                     MGRSEFKGVSSVDAFCGLKDTRY"
     CDS             197405..199576
                     /codon_start=1
                     /gene="CPE0155"
                     /note="723 aa, partially similar to gpu:AP001508_84
                     BH0361 gene product from Bacillus halodurans (1661 aa);
                     26.4% identity in 273 aa overlap.Also some similarity to
                     sp:CNA_STAAU COLLAGEN ADHESIN PRECURSOR from
                     Staphylococcus aureus. Putative N-terminal signal
                     sequence and 1 putative transmembrane region were found
                     by PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79861.1"
                     /transl_table=11
                     /translation="MKNSKNFNIFTLWSVVISMILIMISPGSIVLGEETKSVQNDGAV
                     EITSTTFESNTVAKGISNNLRIDYKILNKDKLKDGDKIVISLPDIFKDIEPKCHDQHF
                     KDFDVKDGVVTLTFNENVEKAVTGYMIIRFVGNSNIRKGVSYPVSIDLNGKPSTVYIT
                     GEEYSNSSSGAQYPLMYKTADLPTAATDKEQGREYYGEIVDRNKPIKYFVEINLGDGV
                     NPNTRSYLSNADFFDNIPKGMALDVNSICIKRMGYYDERSSDVTKDFWESNRIKADTK
                     HLEINFGDIRYERYTVIYETRITSTESGYLNDAKLYYDDKELPSKHYSKLSKDAGALN
                     VYKYVDKTKVKNNLNDQKIKYDIKFDSYGYFFKDTLNIIDKLDPRLSDIKITATDQFI
                     TDFDENTKELVIKNSNGDIDAKKPAYITIEASMKNVGPGEVVKNIAYVNGNPTNEVST
                     RKNPIVEIIKVSKDDVESNLLEGAIFKLTTKDGKTVKDVYNKGVKTFTTSSEGSIRFE
                     LPNGDYKLEEIKAPNGYKLDQTPIEFTVNDESKIVKVVAKDDPLPTTCNLVINKINEK
                     EIPILGAKFKLFEESNPKKVLKFSSQKNNYELNQNGVGKLTPSGKNASFKINNLHYGN
                     YILKEVQAPKGYKLSDDIYITLGFEESFYRVGKQGEKIILNKNTETNTYNISVENVPR
                     IILPETGGSGTSKFSFIGIILLAGVLSIVSTTKFVLKEREN"
     CDS             199580..201148
                     /codon_start=1
                     /gene="CPE0156"
                     /note="522 aa, similar to sp:TEE6_STRPY TRYPSIN-RESISTANT
                     SURFACE T6 PROTEIN PRECURSOR from Streptococcus pyogenes
                     (537 aa); 26.4% identity in 455 aa overlap. Putative
                     N-terminal signal sequence and 1 putative transmembrane
                     region were found by PSORT"
                     /product="probable surface protein"
                     /protein_id="BAB79862.1"
                     /transl_table=11
                     /translation="MKNNILKKFSFMMVFIFVFITTSIPVFAATPSISKDAPIKGSIT
                     ISKKGATFTAYKLLDAIKSGDAYEYSVNSDLKDFFNNSNYGSYSQESIQKLNGEQVKE
                     FAINLHKYILENKKSGQELKDGQKNTVDLGYYLVTETSSDSEGAAVASTPIIVSVPQV
                     SGDSWNYDVTINPKDNTPILEKNIVKENQRVKTSSENIGDVVKYEVKASIPVYQKNAQ
                     NIMYKFTDTMSKGLTYDEKTGFKVTSGDKVFAKDTDYTVDVKKQEDGSTVITINFVYE
                     NIKAYAETGITLNYQATLNKDAVISNKENLGNTNNIQLDYTNNPHVKDSYKKLTDKVT
                     TYTFGFGITKVDSELNSKLLQGAEFSVKDAGGKIVAKYTYDEKGQVVYLSGNGVTNSK
                     GITTFLGLKEGKYFITEEVAPSGYSLLKNPVEVTITANKDESGNYTGAATIEISNGNK
                     AGQIINDISEKDGNILFNVQIENHAGFSLPSTGGLGNTGFIKIAIILLSIVCVLAILG
                     LGYTKFENSRKTKN"
     CDS             201393..202148
                     /codon_start=1
                     /gene="CPE0157"
                     /note="251 aa, similar to gp:AF019629_2 putative
                     fimbria-associated protein from Actinomyces naeslundii
                     (365 aa); 39.5% identity in 205 aa overlap. 1 putative
                     transmembrane region was found by PSORT"
                     /product="probable fimbria-associated protein"
                     /protein_id="BAB79863.1"
                     /transl_table=11
                     /translation="MLYPSFSNYINNKFAVSTISDYTEKINNVKDEEVDDLIKNINKY
                     NYDLFNGTAENQLPDYLNIHQGDVLGYIEIPSINIKLPIYYGTSVDILKKGVGVLEGT
                     SLPVGGENTHSVLSAHTGLANQKLFTDIDKLKDGDVFYLHILKKDLAYKVNQIKVVHP
                     DEIDELKISDEKDYVTLLTCYPYGINTERLLVRGERTDLSPSNVEQVQKEISTFNHSN
                     ENLILIVIILISVLIIIFLLFLIMKFKGKNKSR"
     CDS             202217..203128
                     /codon_start=1
                     /gene="CPE0158"
                     /note="303 aa, partially similar to gpu:AP001512_149
                     BH1562 gene product from Bacillus halodurans (268 aa);
                     26.2% identity in 103 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79864.1"
                     /transl_table=11
                     /translation="MISREKYVTSSLELHLFFMRVMKEHAIFLEAGLGPKNSKLAKEL
                     DKCKGNLEKLLFDVVKLSKGRVRQSIVDSGEVFTDYTLETEKKTEHYTGININSKITT
                     MEKDLMCAPKKGIDSKVASCVKDINNKAIKLIDELIDLKMKILDDVLCCKIFTSNYPS
                     LVEHTIEEAKLYRSYIDDIECNRDIDEVNISKTEAFWNEIMMEHSLFIRGLLDPSEYE
                     LINTAHEFAFEFNELIQQLNNVTNVTIDNVTHEILKETTRLRDFKEEGTKGIMNCNIK
                     SLILPLLSDHVLREANHYIRILRCYEK"
     CDS             203688..204281
                     /codon_start=1
                     /gene="CPE0159"
                     /note="197 aa, similar to sp:YDJZ_ECOLI HYPOTHETICAL 26.2
                     KDA PROTEIN IN XTHA-GDHA INTERGENIC REGION from
                     Escherichia coli (235 aa); 23% identity in 152 aa
                     overlap. 5 putative transmembrane regions were found by
                     PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79865.1"
                     /transl_table=11
                     /translation="MVFYKLITNGEVVKSYLERFGPWAAVIFFVFQILQVVIFFIPGE
                     VIQAAGGYIFGALGGTLLSFFGIAVGSAILFYICQKFGKKLVQRFVPKDMYDKLEKIL
                     NSPKFKLILVILFFLPGAPKDSLIMVCALSNITIGHFIIFSMIGRIPALVASSFMGAN
                     LAEGNIVGVIIIGVIALIACALGVIFRKDVFKYMEKL"
     CDS             204516..205067
                     /codon_start=1
                     /gene="CPE0160"
                     /note="183 aa, similar to pir:T35433 hypothetical protein
                     SC6A9.02 SC6A9.02 from Streptomyces coelicolor (213 aa);
                     45.2% identity in 177 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79866.1"
                     /transl_table=11
                     /translation="MRYSVEGVCEKFKSGEKLEFLFFLGHTKNKNGKATKACFSQWYL
                     SDFTVNGVLYNCAEKYMMAEKARLFKDYETLEEILSAENQKEIKDLGRKVKNFNEELW
                     NREKYEIVKRGNLAKFSQNEDIKEFLLSTGDKIIVEASPYDSIWGIGMGAKDENIEDP
                     TAWKGENLLGFALMEVRDLLNAM"
     CDS             complement(205272..206738)
                     /codon_start=1
                     /gene="CPE0161"
                     /note="488 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79867.1"
                     /transl_table=11
                     /translation="MFKEDLLETSEKIQYNIFKKVYVNNGKINKNDLCSDLNISLPTL
                     KTHLKKIEYLLNKYYKSKVKISSSKDFIFLKYETGVSLHSLTTYYIESSLKYKLLKFF
                     FIKHTKKFTGIQICNYFNISLATLNRKILECNSLLKEFDISIKNYELTGSQLQISYFY
                     YLLFWNNRIDISSVVSANHNITEVIEKTFNITLKISEKYPLYTWLKILMIRKKFFVED
                     FFKDEFTKKNLSILENTEIFIELKNFFEKDSLSKSSSTYLAYSTLCFILSFNIIPYEV
                     IKEFSTVNESTPFKIFSLMTEEMSNLYTTHPNNFNNEVKLHLLSLCFKSYFFKGIFYS
                     NNKIVTNYYLNEFTSDSREKFVNDLLLKINSLYKVKYSFDPYYFKLCIILTLNYLNGV
                     SKHSLTIGILSRIDSLILNTTIDYLRKFLRRKFDVIVEVYDEYKKENYDLVITNFDPK
                     YIPKNYNNIYIFSNLAVQYDLGNIVKILNEIEKIKFEG"
     CDS             207408..208439
                     /codon_start=1
                     /gene="pfoR"
                     /note="343 aa, similar to pir:A43577 regulatory protein
                     pfoR from Clostridium perfringens (343 aa); 88.7%
                     identity in 327 aa overlap. Putative N-terminal signal
                     sequence and 7 putative transmembrane regions were found
                     by PSORT."
                     /note="CPE0162"
                     /product="regulatory protein"
                     /protein_id="BAB79868.1"
                     /transl_table=11
                     /translation="MQVLIGAGLLLIVLGLFTLFSYKAPHGMKAMGALAGAACASFLV
                     EAFHSSFFGNVLNIEFLKKVGDANGSLGGVAAAILVPLALGVSPVYSVLIGLSCSGLG
                     ILPGFIAGYLMSFVVKFLEEKLPSGLDLIVIIVVATPLTRIIGDFTAPVVDSTLLKIG
                     QVLIASANSNPITMGIILGGIITVVATAPLSSMALTAMLGLTGAPMAIGALSVFGSSF
                     LNFVLFQKMKFGSKKDTISVAIEPLTQADIITANPIPIYVTNFIGGALCGIIIVLMGL
                     TNMSPGTATPIAGFAVMFAYNPAFKVLIASLACVVVSAGSGYLGYLLFKNYKIHTVDE
                     IRGNDLEVE"
     CDS             209028..210530
                     /codon_start=1
                     /gene="pfoA"
                     /note="500 aa, similar to sp:TACY_CLOPE PERFRINGOLYSIN O
                     PRECURSOR (THETA-TOXIN) (THIOL-ACTIVATED CYTOLYSIN) from
                     Clostridium perfringens (500 aa); 99.8% identity in 500
                     aa overlap. Putative N-terminal signal sequence was found
                     by PSORT"
                     /note="CPE0163"
                     /note="theta-toxin"
                     /product="perfringolysin O"
                     /protein_id="BAB79869.1"
                     /transl_table=11
                     /translation="MIRFKKTKLIASIAMALCLFSQPVISFSKDITDKNQSIDSGISS
                     LSYNRNEVLASNGDKIESFVPKEGKKTGNKFIVVERQKRSLTTSPVDISIIDSVNDRT
                     YPGALQLADKAFVENRPTILMVKRKPININIDLPGLKGENSIKVDDPTYGKVSGAIDE
                     LVSKWNEKYSSTHTLPARTQYSESMVYSKSQISSALNVNAKVLENSLGVDFNAVANNE
                     KKVMILAYKQIFYTVSADLPKNPSDLFDDSVTFNDLKQKGVSNEAPPLMVSNVAYGRT
                     IYVKLETTSSSKDVQAAFKALIKNTDIKNSQQYKDIYENSSFTAVVLGGDAQEHNKVV
                     TKDFDEIRKVIKDNATFSTKNPAYPISYTSVFLKDNSVAAVHNKTDYIETTSTEYSKG
                     KINLDHSGAYVAQFEVAWDEVSYDKEGNEVLTHKTWDGNYQDKTAHYSTVIPLEANAR
                     NIRIKARECTGLAWEWWRDVISEYDVPLTNNINVSIWGTTLYPGSSITYN"
     CDS             210726..211184
                     /codon_start=1
                     /gene="CPE0164"
                     /note="152 aa, similar to gp:CLOPBG_2 unknown from
                     Clostridium perfringens (152 aa); 100% identity in 152 aa
                     overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79870.1"
                     /transl_table=11
                     /translation="MKLAEALILRADLQKELMSLKNRINQNLLVQEGEKPSENPYTLY
                     DEILLKVSELEGLILKINKTNSNYITSNNESISDLIVKRDMLGKKISILKEIAEEATV
                     KVNRYSQTEIKIFSAMKVDQLQREINKYSKEYRELDTKLQGLNWTIDLME"
     CDS             211256..211423
                     /codon_start=1
                     /gene="CPE0165"
                     /note="55 aa, similar to gp:CLOPBG_3 unknown from
                     Clostridium perfringens (72 aa); 100% identity in 55 aa
                     overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79871.1"
                     /transl_table=11
                     /translation="MLVAFIKEVINPNLGKKVIIHVSRSRYLFYNLCSNKLHGYYLRI
                     TIYNHMTINNK"
     CDS             212226..213713
                     /codon_start=1
                     /gene="CPE0166"
                     /note="495 aa, similar to gp:CLOPBG_4 membrane-spanning
                     transporter protein from Clostridium perfringens (495
                     aa); 94.9% identity in 495 aa overlap. Putative
                     N-terminal signal sequence and 10 putative transmembrane
                     regions were found by PSORT."
                     /product="membrane-spanning transporter protein"
                     /protein_id="BAB79872.1"
                     /transl_table=11
                     /translation="MSERKRSLSSGALMLMTFTAVFSFGNIIDSSVNIGLATIPSYIF
                     GTVFYFLPFALMIGEFASASSDSESGINSWIKKSLGARWAFLGSWSYFFVNLFFFTSL
                     LPKILIYASYTFVGRNVFDGKTVLISVISIVLFWAVTIISTKGVSWISKITSISGVAR
                     IILGLGFIVLSFGVILFLGKAPAQEFTAETIMPKFNWSYFMVLAWILQAVGGAESIGV
                     YIKDVKGGNKTFIRTMVISTAIVGGLYALGAVSVGLVVPSEVLQGNFSNGLFDAFAIL
                     GANYGVGNIITNIVGFIMMLASLGSLVLWTAAPVKVLFSEIPEGIFGKWIAKTDKKGT
                     PVNALYVQAVIVTVLLLVPALGIGSVDSLLEMLINMTASTSLIPVLFFLVGYIVLRAK
                     KDDMERSFKVGSKNFGIAIGVLLLALFVFVFVISSIPAPQDFAAYFNGTLAEGATNPV
                     FVLLYNVLGLIFFLGFAEICWRKYEKKVGKAVANEWDQEEVSEIA"
     CDS             213872..215941
                     /codon_start=1
                     /gene="pbg"
                     /note="689 aa, similar to gp:CLOPBG_5 beta-galactosidase
                     from Clostridium perfringens (676 aa); 99.4% identity in
                     676 aa overlap"
                     /note="CPE0167"
                     /product="beta-galactosidase"
                     /protein_id="BAB79873.1"
                     /transl_table=11
                     /translation="MKNYGPISSKVTKMLHGADYNPEQWIDMPNIWGEDVRLMKLSHT
                     NVVAVGIFSWTMLEPEEGKFNFEWLDEIMDLMHKNGNYVILATPSGAKPIWMAHKYPE
                     TLRVAPNRVRNLYGERHNHCYTSPIYREKIAIIDRLLAERYKDHPALILWHISNEFEG
                     QCYCPLCEQAFRDFLREKYDNDINKLNKAWWTKFWSHTYASFDEIEAPAPHGEPALHG
                     LNLDWMRFVTHQTLDYYKHERSILKEITPDIPVTTNFHDYISLFRGIDYWKFAPYLDV
                     VSWDNYPYWHGERTDDHEGSRIGFVHDLNRAILNGKPFMMMESSPSSTNWQPVAKLRR
                     PGMHVLSSLQAVAHGSDTVQYFQWRKSRGSSEKFHGAVVDHCGHENTRVFRDVTKVGE
                     ILSKLDDVIGTSVEPQVAVIYDWENYWAINDAQGPRIEQKDYFETCQKHYKAFWDMSI
                     PTDVINMDCDFSKYKVVVAPMLYMVRPGVGERLEEFVKNGGTLVTTYWSGIVDENDLC
                     FLGGFPGPLKKVTGIWAEELDALYDEDVNYVSIEEGNSLGMKGEYEARIFCDLIHSEG
                     AEVLATYKTDFYKGMPALTCNNFGEGQAYYIAFRNNDEFLSDFYSSLAKKLTLKRAIE
                     IDLPKGINAQVRMDEKNEFVFFMNFSSEEKTIDIKDLDLTDMVTGEKVTKEMEIEPYG
                     VRIVRRK"
     CDS             216493..217734
                     /codon_start=1
                     /gene="arcA"
                     /note="413 aa, similar to gp:CPPBGARCG_2 arginine
                     deiminase from Clostridium perfringens (413 aa); 99.5%
                     identity in 413 aa overlap"
                     /note="CPE0168"
                     /product="arginine deiminase"
                     /protein_id="BAB79874.1"
                     /transl_table=11
                     /translation="MRDDRALNVTSEIGRLKTVLLHRPGEEIENLTPDLLDRLLFDDI
                     PYLKVAREEHDAFAQTLREAGVEVLYLEVLAAEAIETSDEVKQQFISEFIDEAGVESE
                     RLKEALIEYFNSFSDNKAMVDKMMAGVRKEELKDYHRESLYDQVNNVYPFVCDPMPNL
                     YFTRDPFATIGHGITLNHMRTDTRNRETIFAKYIFRHHPRFEGKDIPFWFNRNDKTSL
                     EGGDELILSKEILAVGISQRTDSASVEKLAKKLLYYPDTSFKTVLAFKIPVSRAFMHL
                     DTVFTQVDYDKFTVHPGIVGPLEVYALTKDPENDGQLLVTEEVDTLENILKKYLDRDI
                     KLIKCGGGDEIIAAREQWNDGSNTLAIAPGEVIVYSRNYVTNEILEKEGIKLHVIPSS
                     ELSRGRGGPRCMSMPLIREDL"
     CDS             217842..218837
                     /codon_start=1
                     /gene="arcB"
                     /note="331 aa, similar to sp:OTCC_CLOPE ORNITHINE
                     CARBAMOYLTRANSFERASE, CATABOLIC (EC 2.1.3.3) (OTCASE)
                     from Clostridium perfringens (331 aa); 94.6% identity in
                     331 aa overlap"
                     /note="CPE0169"
                     /product="ornithine carbamoyl transferase"
                     /protein_id="BAB79875.1"
                     /transl_table=11
                     /translation="MAVNLKGRSFLTLKDFTPAEIRYLLDLSHDLKAKKRAGILGDSL
                     KGKNVVLLFEKTSTRTRCAFECGAAEEGAHVTFLTNSQMGKKESIEDTAKVLGRMYDG
                     IEFRGFKQSTVEELAKHAGVPVWNGLTDADHPTQILADFLTIEEHAHKPLSEIKLVFT
                     GDTRNNMSYALMYGAAKMGMHFVALGPDSLKPDEDILKEMQEYSKETGATIEFSSNVD
                     EAVKGADVIYTDIWVSMGEDESLYPERVKLLTPYKVTREMMNKTGNKNTLFMHCLPSF
                     HDEDTEVCKDMMDRLGLDIREVEDEVFRSKNSVVFDEAENRMHTIKAVMVATAGR"
     CDS             218982..220418
                     /codon_start=1
                     /gene="arcD"
                     /note="478 aa, similar to sp:ARCD_CLOPE
                     ARGININE/ORNITHINE ANTIPORTER from Clostridium
                     perfringens (476 aa); 88.5% identity in 478 aa overlap.
                     Putative N-terminal signal sequence and 11 putative
                     transmembrane regions were found by PSORT."
                     /note="CPE0170"
                     /product="arginine ornithine antiporter"
                     /protein_id="BAB79876.1"
                     /transl_table=11
                     /translation="MAEQHNEPKKLGFAQLAALIVGSMIGGGAFNLPSDMARGAGTGA
                     VIIGWIITGIGMIALAFVYQSLANRKPELTGGVYSYAKAGFGEYIGFNSAWGYWLSAW
                     IGNVSYSVLLFGAVGYFLPMFGAGNNVASIIGASVLLWAFTLLILNGVSGAALINLIT
                     TIAKLVPIFLFIVISLFMFNFDKFTFQFWGTSDLGGIVTQVKSTMLVTLWCFIGIEGA
                     VVVSGRAKKQSDVGKATVLGLIGTLIIYMLITLMALGVMDRVKLSGLENPSMAYVLEF
                     AVGKWGAVLINLGLIISLFGSLLGWALLAAEIPYVAAKDGVLPKVFAKLNKKGTPSGS
                     LIITNLLVQAFLILTLVASSTYQALYSVASTAILVPYLLSAMYGFKLALTGETYDKNP
                     TGRTRDKIFGGIATVYAIWLCYAAGLKYLLLCFILYAVGIIFFYIGKKQNNKDAEVFV
                     GKEKILAIIVLVIAIIAIVMLFNGTITI"
     CDS             220479..221423
                     /codon_start=1
                     /gene="arcC"
                     /note="314 aa, similar to sp:ARCC_CLOPE CARBAMATE KINASE
                     (EC 2.7.2.2) from Clostridium perfringens (314 aa); 93.9%
                     identity in 314 aa overlap"
                     /note="CPE0171"
                     /product="carbamate kinase"
                     /protein_id="BAB79877.1"
                     /transl_table=11
                     /translation="MKIVLALGGNALQKDSKDKSAEGQLETCRQTAISVADLIEDGHE
                     VSIVHGNGPQVGQILASIELAHQVDNGNPLFPFDVVGAFSEGYIGYHLQNTIREELLK
                     RGIEKSVDTITTQVIVDKNDPGFKNPTKPIGSFYTKEEAEKLEKDKGYTMKEDAGRGY
                     RRVVASPKPVDIVEKEAIKTMVDSGFIVIACGGGGIPVVEDGDRLEGVPAVIDKDFAA
                     EKLAEILDADALLILTAVDRVCVNFNKPDQKALKEINLEEVDKYIEEGQFAPGSMLPK
                     VEACKKFVLSGDKKVAIIASLTNAKAALRGESGTKIVK"
     CDS             221496..221951
                     /codon_start=1
                     /gene="argR"
                     /note="151 aa, similar to sp:ARGR_CLOPE ARGININE
                     REPRESSOR from Clostridium perfringens (145 aa); 91%
                     identity in 144 aa overlap"
                     /note="CPE0172"
                     /product="arginine repressor"
                     /protein_id="BAB79878.1"
                     /transl_table=11
                     /translation="MSNLEKSLRHEVILDIIESKCICKQEELIIELKECGINVTQATL
                     SRDLHEMNIIRKSFENHEHRYIVTKEDKFIKKFKNIFKSSVRSISMQEYFISVNTLDG
                     MASLIGEFIDRLGDGRIAGTVAKKNHILVLCRSVNATQQIFKELDSLRV"
     CDS             222495..225809
                     /codon_start=1
                     /gene="colA"
                     /note="1104 aa, similar to sp:COLA_CLOPE MICROBIAL
                     COLLAGENASE PRECURSOR (EC 3.4.24.3) (120 KDA COLLAGENASE)
                     from Clostridium perfringens (1104 aa); 98.1% identity in
                     1104 aa overlap. Putative N-terminal signal sequence was
                     found by PSORT"
                     /note="CPE0173"
                     /note="kappa-toxin"
                     /product="collagenase"
                     /protein_id="BAB79879.1"
                     /transl_table=11
                     /translation="MKKNLKRGELTKLKLVERWSATFTLAAFILFNSSFKVLAADKKV
                     ENSNNGQITREINADQISKTELNNEVATDNNRPLGPSIAPSRARNNKIYTFDELNRMN
                     YSDLVELIKTISYENVPDLFNFNDGSYTFFSNRDRVQAIIYGLEDSGRTYTADDDKGI
                     PTLVEFLRAGYYLGFYNKQLSYLNTPQLKNECLPAMKAIQYNSNFRLGTKAQDGVVEA
                     LGRLIGNASADPEVINNCIYVLSDFKDNIDKYGSNYSKGNAVFNLMKGIDYYTNSVIY
                     NTKGYDAKNTEFYNRIDPYMERLESLCTIGDKLNNDNAWLVNNALYYTGRMGKFREDP
                     SISQRALERAMKEYPYLSYQYIEAANDLDLNFGGKNSSGNDIDFNKIKADAREKYLPK
                     TYTFDDGKFVVKAGDKVTEEKIKRLYWASKEVKAQFMRVVQNDKALEEGNPDDILTVV
                     IYNSPEEYKLNRIINGFSTDNGGIYIENIGTFFTYERTPEESIYTLEELFRHEFTHYL
                     QGRYVVPGMWGQGEFYQEGVLTWYEEGTAEFFAGSTRTDGIKPRKSVTQGLAYDRNNR
                     MSLYGVLHAKYGSWDFYNYGFALSNYMYNNNMGMFNKMTNYIKNNDVSGYKDYIASMS
                     SDYGLNDKYQDYMDSLLNNIDNLDVPLVSDEYVNGHEAKDINEITNDIKEVSNIKDLS
                     SNVEKSQFFTTYDMRGTYVGGRSQGEENDWKDMNSKLNDILKELSKKSWNGYKTVTAY
                     FVNHKVDGNGNYVYDVVFHGMNTDTNTDVHVNKEPKAVIKSDSSVIVEEEINFDGTES
                     KDEDGEIKAYEWDFGDGEKSNEAKATHKYNKTGEYEVKLTVTDNNGGINTESKKIKVV
                     EDKPVEVINESEPNNDFEKANQIAKSNMLVKGTLSEEDYSDKYYFDVAKKGNVKITLN
                     NLNSVGITWTLYKEGDLNNYVLYATGNDGTVLKGEKTLEPGRYYLSVYTYDNQSGTYT
                     VNVKGNLKNEVKETAKDAIKEVENNNDFDKAMKVDSNSKIVGTLSNDDLKDIYSIDIQ
                     NPSDLNIVVENLDNIKMNWLLYSADDLSNYVDYANADGNKLSNTCKLNPGKYYLCVYQ
                     FENSGTGNYIVNLQNK"
     CDS             complement(225957..226415)
                     /codon_start=1
                     /gene="mscL"
                     /note="152 aa, similar to sp:MSCL_CLOPE LARGE-CONDUCTANCE
                     MECHANOSENSITIVE CHANNEL from Clostridium perfringens
                     (152 aa); 80.9% identity in 152 aa overlap. Putative
                     N-terminal signal sequence and 1 putative transmembrane
                     region were found by PSORT"
                     /note="CPE0174"
                     /product="large-conductive mechanosensitive channel
                     homologue"
                     /protein_id="BAB79880.1"
                     /transl_table=11
                     /translation="MWKEFKEFAMKGNVIDLAIGVIIGGAFGKIVTSLVNDIIMPVIG
                     RLVGKVDFSNLYINLSGQQFNSLQEAQAAGAATINYGLFLNNLINFLIIAFSIFIAIK
                     QINKLKNFTKKKEEVQVEATEKDCPYCCTKIDIKATRCPHCTSVLEEATN"
     CDS             227207..227782
                     /codon_start=1
                     /gene="ycgJ"
                     /note="191 aa, similar to pir:A83577 probable
                     transcription regulator PA0547 from Pseudomonas
                     aeruginosa (344 aa); 33.6% identity in 134 aa
                     overlap.Also similar to pir:E69758 hypothetical protein
                     ycgJ from Bacillus subtilis. 1 putative transmembrane
                     region was found by PSORT"
                     /note="CPE0175"
                     /product="hypothetical protein"
                     /protein_id="BAB79881.1"
                     /transl_table=11
                     /translation="MRVDYFKDELREMAIKSVDISNKVIADLGAGTGFISLGIAKKAN
                     IVFSLDSSKNMLKELYSSAKENEINNIYPIKGELENLPLFDDSIDLIFMNMALHHVAN
                     PDKAIKEMNRVLKPNGKVVITDVLEHKGEWAREEMFDTWLGFNYDQLINWFEKAGFKN
                     ISIKNTGLVARGESSFGEVIEPGIFMAIAKK"
     CDS             227846..229000
                     /codon_start=1
                     /gene="metB"
                     /note="384 aa, similar to gp:AB028629_1 cystathionine
                     beta-synthase from Clostridium perfringens (351 aa);
                     96.6% identity in 351 aa overlap. 1 putative
                     transmembrane region was found by PSORT"
                     /note="CPE0176"
                     /product="cystathionine gamma-synthase"
                     /protein_id="BAB79882.1"
                     /transl_table=11
                     /translation="MKKNSLLIHGGISIDEKTGAVNIPIYQTSTYKQRSFGENSGYEY
                     SRTGNPTRESLEKLIADIEYGKRGFAFASGLAAITAVLSLFKSGDKLLITNNLYGGTF
                     RVIDKIFSNFGIGYEIIDDFTNIEEKIDKSVKAIYIETPTNPLLDVIDIKIASDKAKK
                     YNLLTIVDNTFMTPYFQNPLNLGADIVIHSATKYLGGHSDLVAGLVVVKDEELGEKIH
                     FIQNSTGGILQPFDSFLLIRGIKTLSVRMDRHELNANFIAEKLGDLEGIDNVYYPGLK
                     THIGHDIQKKQASGFGGIISFTLNKKYNYEKFFNSLELITFGESLGGVESLACHPASM
                     THAAMPLELRERIGITDRLIRISVGIEDKEDILEDIQKALVKAGDKNEIL"
     CDS             228987..229895
                     /codon_start=1
                     /gene="cysK"
                     /note="302 aa, similar to pir:T43792 cysteine synthase
                     (EC 4.2.99.8) cysK from Clostridium perfringens (302 aa);
                     96.7% identity in 302 aa overlap. 1 putative
                     transmembrane region was found by PSORT"
                     /note="CPE0177"
                     /product="cysteine synthase"
                     /protein_id="BAB79883.1"
                     /transl_table=11
                     /translation="MKYYNDIRDLIGNTPILKLNNISTKEGVNIYAKIEGTSPGGSCK
                     DRVGIYMVEKAEKEGKLKPGSTIIEATAGNTGIGIALAAINKGYKIIFIVPDKFSIEK
                     QKIMKALGAEIINTPKEEGMEGAINLANSLLSEIPNSLSLNQFKNEANPLAHYETTGR
                     ELYDGLDGEIDYFVAGAGSGGTISGVLKFLKENISEVKGILADPVGSIIGGGQCGTYK
                     IEGIGNNFIPETMDMSLVDDVIKVNDEEAFDAVKLLAKKEGLIVGSSSGAAFAAVLKL
                     AEKIEKGNIVTIFPDRGDRYFSTDLF"
     CDS             229993..230448
                     /codon_start=1
                     /gene="luxS"
                     /note="151 aa, similar to sp:LUXS_CLOPE AUTOINDUCER-2
                     PRODUCTION PROTEIN LUXS (AI-2 SYNTHESIS PROTEIN) from
                     Clostridium perfringens (151 aa); 99.3% identity in 151
                     aa overlap"
                     /note="CPE0178"
                     /product="autoinducer-2 production protein"
                     /protein_id="BAB79884.1"
                     /transl_table=11
                     /translation="MVKVESFELDHTKVKAPYVRKAGIKIGPKGDIVSKFDLRFVQPN
                     KELLSDKGMHTLEHFLAGFMREKLDDVIDISPMGCKTGFYLTSFGDIDVKDIIEALEY
                     SLSKVLEQEEIPAANELQCGSAKLHSLELAKSHAKQVLENGISDKFYVE"
     CDS             231156..232166
                     /codon_start=1
                     /gene="lipA"
                     /note="336 aa, similar to pir:T43794 probable lipase lipA
                     from Clostridium perfringens (311 aa); 99.4% identity in
                     310 aa overlap. ATA start"
                     /note="CPE0179"
                     /product="probable lipase"
                     /protein_id="BAB79885.1"
                     /transl_table=11
                     /translation="MVIYRFLATVINMWFKKLYVGTIDLLSAIVEKIAKCNLACKIYK
                     AVFQLGVFPKPKNFNEIVSNLVIEKDIIYESSILEGNKLDVYYPKNLNKKAPILMWIH
                     GGGYIANSKETVKNYMMTLANKGFVVFNIDYALAPKYKYPSQIVQCNEALKYVFENAE
                     KFNGDRENIFIGGDSAGAQMASQLAAIISNEELSNKMNLKPSITNKFLRGVILFCGLY
                     NMDSLRATKFPGIKTYMEALTGESNFENYERIDELATIKYITPNYPSTFITVGDIDPF
                     VDQGKELASSLRVLGVKVVSRFFENKGLWHEYQFKFSVKEARETFKSVTEFLNDNSKS
                     MN"
     CDS             complement(232388..233179)
                     /codon_start=1
                     /gene="CPE0180"
                     /note="263 aa, similar to pir:H75377 conserved
                     hypothetical protein from Deinococcus radiodurans (strain
                     R1) (262 aa); 28.5% identity in 263 aa overlap. 5
                     putative transmembrane regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79886.1"
                     /transl_table=11
                     /translation="MKRYARIYVQFLKQYLKTLLEYKEDFIYGILGFFLVQATSIIFI
                     SLIFNNVPTLSGWSFYEIIFIYGFSQIPRGIDHIFTDYLWIFSGRSIVRGEFDRYLLR
                     PLNPLFQVIAERFQPDGFGELVVGFILVVYSAIKLSVNITPLWIIGFIIAVIGGTLIY
                     TGVKLATASIAFWTKTSFRHVQMAYGLSDFSKYPISIYPGAIKFLLTFIIPFAFTGYY
                     PGTYLLGKASFFMGVILTLIVGILSIIVSYRIWLKGVSSYESSGN"
     CDS             complement(233184..234002)
                     /codon_start=1
                     /gene="CPE0181"
                     /note="272 aa, similar to pir:G75377 conserved
                     hypothetical protein from Deinococcus radiodurans (strain
                     R1) (267 aa); 21.2% identity in 226 aa overlap. 6
                     putative transmembrane regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79887.1"
                     /transl_table=11
                     /translation="MDFFKTIRVYSSFAKGTFKALSSYKANLLMGLIGQLIMISVTYF
                     LWIAIYSSSQEGIMNGFTLKEMLTYVMITLLIGIVTSNDISQEISFEVRDGSISTNLI
                     KPINYRLRIIFIGIGNFIFFFLTLFLPGAILISTYAILNGININLASILIFLISIILG
                     CLINIYYSYIFGLLSFKFYNIWGISQIARAIIMLVSGAMIPLTFFPEIVQKLFNFLPF
                     SSIIYTPAMIYLNKLSCAQIAKSLGLQLIWVVILMVLSKIMWNKVIDKLTIQGG"
     CDS             complement(234005..235030)
                     /codon_start=1
                     /gene="CPE0182"
                     /note="341 aa, similar to gp:SCE6_29 putative
                     ABC-transport protein, ATP-binding component from
                     Streptomyces coelicolor A3(2) (354 aa); 50% identity in
                     258 aa overlap"
                     /note="ATP-binding protein"
                     /product="probable ABC-transport protein"
                     /protein_id="BAB79888.1"
                     /transl_table=11
                     /translation="MIKVKNLTKEFKIRKKESGLKGAFKSLFSSEFDSKTAVSNISFE
                     IKSGEIVGYIGSNGAGKSTTIKMMTGILTPSSGQVLVNGRVPYKEREKNAKDIGVVFG
                     QRTQLWWDLALSETFTILKDIYSIPDEVYEKNMKFLNKVLDLEEFMTRPVRTLSLGQR
                     MRGDLAASLIHNPKILYLDEPTIGLDVVVKEKVRTAIKEINKEFGTTVILTTHDLSDI
                     EELCKRIIIIDKGTKIYDGSLDDIKKKYGYMTTLEIQSKKDFKTLLNIKEILKSESNI
                     PIETFSSDDLSEYIESGKLIITFNKNKITSSKIISKVIERVDVLDFLLKESSIEDIIK
                     KIYRNEV"
     CDS             235341..236009
                     /codon_start=1
                     /gene="CPE0183"
                     /note="222 aa, similar to sp:YFKO_BACSU PUTATIVE NAD(P)H
                     NITROREDUCTASE YFKO (EC 1.-.-.-) from Bacillus subtilis
                     (221 aa); 42.9% identity in 217 aa overlap"
                     /product="probable NAD(P)H-flavin oxidoreductase"
                     /protein_id="BAB79889.1"
                     /transl_table=11
                     /translation="MKLDRKDIIDIFNFRFATKEFTGEIIPKEDMEMIAETARLSPSS
                     FGLEPWKFLIVENKELIKEISEVSWGFQRQASTTSHIVIALTKAGSEVKYDSDYIRNL
                     WINTKGVSEEFFEGIKDVLKNFQVGKLEADETNEKLLEWSKRQTYIALGNMMTAAAMR
                     EIDSCAIEGFDKEKVEEILAKKGLLDKEKYELTYLIAFGYRKEEPNRKKSRLPKSEVI
                     QWVE"
     CDS             236295..236960
                     /codon_start=1
                     /gene="nanP"
                     /note="221 aa, similar to prf:2516292A ManNAc-6-phosphate
                     epimerase from Clostridium perfringens (221 aa); 98.8%
                     identity in 160 aa overlap"
                     /note="CPE0184"
                     /product="ManNAc-6-phosphate epimerase"
                     /protein_id="BAB79890.1"
                     /transl_table=11
                     /translation="MLDVVKGNLIVSCQALSDEPLHSSFIMGRMAIAAKQGGAAAIRA
                     QGVNDINEIKEVTKLPIIGIIKRNYDDSEIYITPTMKEVDELLKTDCEMIALDATKRK
                     RPNGENVKDLVDAIHAKGRLAMADISTLEEGIEAEKLGFDCVSTTLSGYTPYSKQSNS
                     VDFELLEELVKTVKIPVICEGRINTPEELKKALDLGAYSAVVGGAITRPQQITKRFTD
                     ILK"
     CDS             236997..237863
                     /codon_start=1
                     /gene="nanA"
                     /note="288 aa, similar to prf:2406345A   acylneuraminate
                     lyase from Clostridium perfringens (288 aa); 100%
                     identity in 288 aa overlap"
                     /note="CPE0185"
                     /note="sialic acid lyase"
                     /product="acylneuraminate lyase"
                     /protein_id="BAB79891.1"
                     /transl_table=11
                     /translation="MKGIYSALLVSFDKDGNINEKGLREIIRHNIDVCKIDGLYVGGS
                     TGENFMLSTDEKKRIFEIAMDEAKGQVKLIAQVGSVNLKEAVELAKFTTDLGYDAISA
                     VTPFYYKFDFNEIKHYYETIINSVDNKLIIYSIPFLTGVNMSIEQFAELFENDKIIGV
                     KFTAADFYLLERMRKAFPDKLIFAGFDEMMLPATVLGVDGAIGSTFNVNGVRARQIFE
                     AAQKGDIETALEVQHVTNDLITDILNNGLYQTIKLILQEQGVDAGYCRQPMKEATEEM
                     IAKAKEINKKYF"
     CDS             237966..239483
                     /codon_start=1
                     /gene="CPE0186"
                     /note="505 aa, similar to pir:S75887 hypothetical protein
                     from Synechocystis sp. (strain PCC 6803 (512 aa); 31.5%
                     identity in 428 aa overlap. Putative N-terminal signal
                     sequence and 12 putative transmembrane regions were found
                     by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79892.1"
                     /transl_table=11
                     /translation="MQGFTKFDLVVLVVYLGAVLYAGLKFSKKEMKGKEFFRGDGTIP
                     WWVTSVSIFATLLSPISFLSLAGNSYKGTWIMWFAQLGMFVAVPLTIRYFLPVYSRLD
                     IDTAYEYLEIRYKDKGLRILGAIMFIIYQIGRMAIIMYLPSMVLANLTGINVYLLIVA
                     MGVIAIIYSYTGGLKSVLWTDFIQGCVLIAGIVFSLIFLISTINGGFGAIMSELTEGG
                     KFLSSQEPIFNANIFKTSVFLLIVGGGLNTFSSYISSQDIVQRFTTTTDIKQLKKMTY
                     GNLVLSLFVATVFYLIGTALYVFYNQNPQLLQTAQQDQIFASYIAFQLPVGITGIVLA
                     AIYAAAQSTLSTGLNSVATSWTLDIQNFITKDMSMEKQTKVAQYISLGVGIASIIMAV
                     ILANGGVNSAYEWFNGFMGLVLGVLAGIFVLGIFFKKATKAGAYAGFIASAIAVVVCK
                     YGGFDVSIWSYSIISIGVSVIVGMIVSLMTQSQLVDKKTLNEATVYYNESEIANS"
     CDS             239593..240045
                     /codon_start=1
                     /gene="CPE0187"
                     /note="150 aa, similar to pir:S56477 hypothetical 17.3K
                     protein (pyrL-argI intergenic region) from Escherichia
                     coli (153 aa); 32% identity in 153 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79893.1"
                     /transl_table=11
                     /translation="MIFGNLINLESYDYLPKLVKEALLHAKNNNVIEFEPGTHEIKGE
                     ELFFNRVNYTTKNKEDRFWEGHKKYIDVHVVFSGRERIDLNFKENLEFKEFVEKDDFL
                     SFDGKENSTVILEEGDFLICYPEDIHMTCLKADNEPSDVKKAIYKVIL"
     CDS             240201..241088
                     /codon_start=1
                     /gene="CPE0188"
                     /note="295 aa, similar to pir:S43901 hypothetical protein
                     A from Clostridium perfringens (182 aa); 90.4% identity
                     in 177 aa overlap. Also similar to gp:AP001509_235
                     glucose kinase from Bacillus halodurans. 2 putative
                     transmembrane regions were found by PSORT."
                     /product="probable glucose kinase"
                     /protein_id="BAB79894.1"
                     /transl_table=11
                     /translation="MGLFAVIDIGGTSIKYGVINEDGTLLETNDRDTEAYKGGLSIIE
                     KVKDIIHELKINNDISGICVSTAGMVCPKEGKIVYAGPTIPNYTGVEVKKILEEEFNL
                     PCFVENDVNCAALGEFFGGAGKGTHSMACLTIGTGIGGALIIDGKVLHGFSNSAGEIG
                     YMMVNGEHIQDIASASALVKNVALRKGVEPSSIDGRYVLDNYENGDLICKEEVEKLAD
                     NLALGISNIVYLINPEVVVLGGGIMAREEVFRPLIENSLRKYLIESVYNNTKIAFAKL
                     KNTAGMKGAYYNFKENFNK"
     CDS             241279..242118
                     /codon_start=1
                     /gene="CPE0189"
                     /note="279 aa, similar to sp:YNGB_CLOPE HYPOTHETICAL 31.2
                     KDA PROTEIN IN NAGH 5'REGION (ORFB) from Clostridium
                     perfringens (279 aa); 100% identity in 279 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79895.1"
                     /transl_table=11
                     /translation="MGILEQLENPKFKATKSEKTLIEYIKSDLDNIIYKSISIIAKES
                     GVGEATITRFTKKLGFNGFQDFKVTLAKEISNKKNTSIINLHVHRDESVTETANKMLK
                     SSINILEQTVKQIDLDLMCKCRDLIMNAKRVYFIGIGYSGIAATDINYKFMRIGFTTV
                     PVTDSHTMVIMSSITNDDDVIVAISNSGTTKEVIKTVKQAKENGTKIITLTEDSDNPL
                     RKLSDYELTYTSAETIFETGSISSKIPQIFLLDLLYTEVIKEMFSEAVEKKIKTTSAI
                     LND"
     CDS             complement(242319..242708)
                     /codon_start=1
                     /gene="CPE0190"
                     /note="129 aa, similar to sp:YNGC_CLOPE HYPOTHETICAL 10.8
                     KDA PROTEIN IN NAGH 5'REGION (ORFC) from Clostridium
                     perfringens (94 aa); 100% identity in 86 aa overlap.
                     Putative N-terminal signal sequence and 2 putative
                     transmembrane regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79896.1"
                     /transl_table=11
                     /translation="MKKGNVRTLDGIIYSLFIFMTIVTLFIIYRDIPSNAVLNFVTAY
                     AIFAILIPLYILVRVLFTVKHFTFEEVKKEGVKFLMFFIGIMMLNLVGDFLLPLPDLK
                     LSKMLPSSLGFAFGITCFDIVLSKRTK"
     CDS             242971..247857
                     /codon_start=1
                     /gene="nagH"
                     /note="1628 aa, similar to sp:NAGH_CLOPE
                     HYALURONOGLUCOSAMINIDASE PRECURSOR (EC 3.2.1.35)
                     (HYALURONIDASE) (MU TOXIN) from Clostridium perfringens
                     (1042 aa); 97.5% identity in 1041 aa overlap. Putative
                     N-terminal signal sequence was found by PSORT"
                     /note="CPE0191"
                     /note="mu-toxin"
                     /product="hyaluronidase"
                     /protein_id="BAB79897.1"
                     /transl_table=11
                     /translation="MNKNIRKIITSTVLAAMTISVLPSNLVVFATDGITENFYEIYPK
                     PQEISYSGGEFQISDEINIVYDDGIDTYTKKRVDEVLEASNLEATVSNEIVPGKTNFL
                     VGINESGGVVDNYFNKNIPHDESFFDEKMDANIVSVKDGVIGVIGEDTDSAFYGVTTL
                     KHVFNQLEEGNKIQSFRADDYAEVAHRGFIEGYYGNPWSNEDRAELMKFGGDYKLNQY
                     VFAPKDDPYHNSKWRDLYPEEKLSEIKKLAQVGNETKNRYVYALHPFMNNPVRFDTEE
                     NYQNDLGVIKAKFTQLLENDVRQFAILADDASAPAQGASMYVKLLTDLTRWLEEQQST
                     YPDLKTDLMFCPSDYYGNGSSAQLKELNKAEDNVSIVMTGGRIWGEVDENFANNFMNN
                     ISTEGHPGRAPFFWINWPCSDNSKQHLIMGGNDTFLHPGVDPSKIDGIVLNPMQQAEA
                     NKSALFAIADYAWNIWDNKEEADENWNDSFKYMDHGTAEETNSSLALREISKHMINQN
                     MDGRVRPLQESVELAPKLEAFKQKYDSGASIKEDALELIAEFTNLQKAADYYKNNPGN
                     ERTRDQIIYWLNCWEDTMDAAIGYLKSAIAIEEGDDEAAWANYSEAQGAFEKSKTYGF
                     HYVDHTEYAEVGVQHIVPFIKSMGQNLSVVIGSIVDPNRIIATYISNRQDAPTGNPDN
                     IFDNNASTELVYKNPNRIDVGTYVGVKYSNPITLNNVEFLMGANSNPNDTMQKAKIQY
                     TVDGREWIDLEEGVEYTMPGAIKVENLDLKVRGVRLIATEARENTWLGVRDINVNKKE
                     DSNSGVEFNPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGDTSLAGEFIGLDLG
                     KEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEES
                     FETPISAKYIRLTNMENINKWLTFSEFAIISDELENAGNKENVYTNTELDLLSLAKED
                     VTKLIPTDDISLNHGEYIGVKLNRIKDLSNINLEISNDTGLKLQSSMNGVEWTEITDK
                     NTLEDGRYVRLINTSNEAVNFNLTKFEVNSNEVYEPSLVDAYVGDDGAKKAVDGDLKT
                     RVKFLGAPSTGDTIVYDLGQEILVDNLKYVVLDTEVDHVRDGKIQLSLDGETWTDAIT
                     IGDGVENGVDDMFSTPLKNGYKHGNQSGGIVPIDSAYVEGDNLNQKARYVRILFTAPY
                     RHRWTVINELMINNGEYISTVNDPTYISNPIEERGFAPSNLRDGNLTTSYKPNTNNGE
                     ISEGSITYRLSEKTDVRKVTIVQSGSSISNAKVMARVGDGSENVTDQWVQLGTLSNSL
                     NEFINRDYNNIYEIKIEWTDVAPNIYEIITLNQEFEFPVNDSLKAKYDELINLSGDEY
                     TLSSFETLKEALNEAKSILDDSNSSQKKIDKALEKLNKAEERLDLRATDFEDFNKVLT
                     LGNSLVEEEYTAESWALFSEVLEAANEANKNKADYTQDQINQIVIDLDASIKALVKET
                     PEVDKTNLGELINQGKSLLDESVEGFNVGEYHKGAKDGLTVEINKAEEVFNKEDATEE
                     EINLAKESLEGAIARFNSLLIEESTGDFNGNGKIDIGDLAMVSKNIGSTTNTSLDLNK
                     DGSIDEYEISFINHRILN"
     CDS             248736..249479
                     /codon_start=1
                     /gene="cbiM"
                     /note="247 aa, similar to sp:CBIM_SALTY CBIM PROTEIN from
                     Salmonella typhimurium (245 aa); 46.3% identity in 216 aa
                     overlap. Putative N-terminal signal sequence and 5
                     putative transmembrane regions were found by PSORT."
                     /note="CPE0192"
                     /product="probable cobalt transport protein"
                     /protein_id="BAB79898.1"
                     /transl_table=11
                     /translation="MSKKNQVFIGFLLMFLLIPRSVSAMHIMEGFLQPKWCIAWGVIT
                     IPFIVLGLFSIKNKVGNNPRLKILLAMAGAYAFVLSALKLPSVTGSCSHPTGVGLAAI
                     LFGPTAASVLGLIVLLFQALLLAHGGLTTLGANTFSMAVVGPLVSYGLYKLVKKLNGP
                     TWLGVFLASALGDLATYMVTSVQLGLAFPAEVGGVMASVMKFMGIFAVTQVPLAISEG
                     ILTVIIFNTIENYAKEDLMELNIFSKGVK"
     CDS             249479..249790
                     /codon_start=1
                     /gene="cbiN"
                     /note="103 aa, similar to pir:T35725 probable cobalt
                     transport protein cbiN from Streptomyces coelicolor (118
                     aa); 66.7% identity in 54 aa overlap. Putative N-terminal
                     signal sequence and 1 putative transmembrane region were
                     found by PSORT"
                     /note="CPE0193"
                     /product="probable cobalt transport protein"
                     /protein_id="BAB79899.1"
                     /transl_table=11
                     /translation="MKNKRVLTNVILLLLVVFITIIPFFVAKNGEFGGSDDQAEEAIT
                     QIDENYEPWFSPLFEPASGEIESLLFALQAAIGAGVIGFGLGYLKGKKKVNDEVNDKH
                     R"
     CDS             249837..250544
                     /codon_start=1
                     /gene="cbiQ"
                     /note="235 aa, similar to pir:H64435 cobalt transport
                     protein Q homolog from Methanococcus jannaschii (268 aa);
                     34.2% identity in 225 aa overlap. Putative N-terminal
                     signal sequence and 3 putative transmembrane regions were
                     found by PSORT."
                     /note="CPE0194"
                     /product="probable cobalt transport protein Q"
                     /protein_id="BAB79900.1"
                     /transl_table=11
                     /translation="MFFALITLCVCLWANNFIVSMIIISIMTFLITKVGRTKIRVFIK
                     LMMVPIAFLIIGILTIVVSYSLKQDTFLVSFKLFNGWIGVSKSGIIQGLNMFLKVMGS
                     LSCLYFISLTTPMIDVISVLAKLKVPSFLIELISLVYRFIFIILETSEMMFISQNSRL
                     GYRDIKTSYKSLGALASTLFIRSFKRANDLYTALEARGYNGELKVLEEQVQKRNYIYI
                     ITIIINLIFIGIAIFIK"
     CDS             250559..251416
                     /codon_start=1
                     /gene="cbiO"
                     /note="285 aa, similar to pir:G64435 cobalt transport
                     ATP-binding protein O homolog from Methanococcus
                     jannaschii (279 aa); 50.7% identity in 272 aa overlap. 2
                     putative transmembrane regions were found by PSORT."
                     /note="CPE0195"
                     /product="probable cobalt transport ATP-binding protein O"
                     /protein_id="BAB79901.1"
                     /transl_table=11
                     /translation="MEDYILKVEELNYNYSDGTHALKGINMNIKRGEVTAILGGNGVG
                     KSTLFQNFNGILKPSSGRILFDNKPIDYSRKGIMKLRESIGIVFQDPDNQLFSASVYQ
                     DVSFGAVNMKLSEDEIRKRVDNALKRTSIEHLKNKPTHCLSFGQKKRVAIAGVLVMEP
                     KVLILDEPTAGLDPMGVSEIMKLLVEMQKELGITIIIATHDIDIVPLYCDNVFVMKEG
                     RVILQGNPKEVFAEKEVIRKVNLRLPRIGHLMEILKEKDGFVFDELDLTIGQARKTIN
                     SWKNKIFND"
     CDS             251886..253466
                     /codon_start=1
                     /gene="ptiB"
                     /note="526 aa, similar to sp:PTIB_BACSU PTS SYSTEM,
                     ARBUTIN-LIKE IIBC COMPONENT (PHOSPHOTRANSFERASE ENZYME
                     II, BC COMPONENT) (EC 2.7.1.69) from Bacillus subtilis
                     (527 aa); 60.7% identity in 527 aa overlap. Putative
                     N-terminal signal sequence and 6 putative transmembrane
                     regions were found by PSORT."
                     /note="CPE0196"
                     /product="PTS arbutin-like enzyme IIBC component"
                     /protein_id="BAB79902.1"
                     /transl_table=11
                     /translation="MQKIQRFGAAMFTPVLLFAFAGITVGLCILFKNPDIVGPIANEG
                     TLWYQIWTLIEEGGWTVFRQLPLLFVVGLPIALAKKAQARACMEALVTYLTFNYFVNS
                     MLTQWGSFFGVDFAQEVGGVSGLTTIAGIKTFDTGMIGAILIAGIAVWIHNRFFDTEL
                     PEYLGIFRGSSFVVMIGFFVMIPTAFVVCLVWPAVQNGINSLQGFLASSGIVGVWIYT
                     FLERILIPTGLHHFIYGPFIFGPAVVEGGIATYWPQHLAQYAMSQQSLTELFPAGGFA
                     LHGHSKIFGSVGIALALYMTAKPNKKKIVAGLLIPATLTAILAGITEPLEFTFLFVAP
                     ILFVVHAILAATLAAAEFAFGVSGNFGGGIIEWAAQNWIPLAKNHWQAYLIQIAIGLC
                     FTAIYFIVFRFVILKMNLKTPGREDDDEETKLYTKADYKAKKGEESIKEDKSGKSKTA
                     KKAEGILEALGGKENIVDVTNCATRLRLTVKDESKLASDSVFKSAGALGVVRNGKAIQ
                     VIIGLSVSQVREEFEQLL"
     CDS             253730..254500
                     /codon_start=1
                     /gene="CPE0197"
                     /note="256 aa, similar to sp:YFIA_BACSU HYPOTHETICAL 29.3
                     KDA PROTEIN IN GLVG-GLVBC INTERGENIC REGION from Bacillus
                     subtilis (254 aa); 40.2% identity in 254 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79903.1"
                     /transl_table=11
                     /translation="MRLEELVNKHYDKLNHSDLYIWKYIFNHKKDCCNLTIDELANRC
                     NVSRTTILRFAQKLSLKGYSELKIYLKWESEDKEFNEKDYLKVVCNDITKFINDMQEK
                     DFSSVCNLMYNAKRIFVYGTGAVQSSVAAELKRIFLSGQECIYNIQGEAEADMILNTI
                     SDEDLIFLISLTGESEHVKRLAKQFKLRNVPIISITKLKNNTLARLSDENLYINTSMH
                     ELGGGKTYESTTLFFTLAEIIFLKYSMYKNELEKEDKN"
     CDS             254724..255224
                     /codon_start=1
                     /gene="CPE0198"
                     /note="166 aa, partially similar to sp:YFIA_BACSU
                     HYPOTHETICAL 29.3 KDA PROTEIN IN GLVG-GLVBC INTERGENIC
                     REGION from Bacillus subtilis (254 aa); 26.7% identity in
                     90 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79904.1"
                     /transl_table=11
                     /translation="MESLILLENLIEDTQSKNEIMLKLIEEEALGDFVEKISKSNRIF
                     VYGKGVSSSIVGQELKRAFTELGKYVFDFYKADEFDSVLSLIREDDCIILIDIENSKD
                     YLNLINEKLRGKNVSRFFIGLDKGKKVPICTYDFNRIDKNYDEIYKGLELYSMLIRFL
                     YELCKL"
     CDS             255480..256805
                     /codon_start=1
                     /gene="malH"
                     /note="441 aa, similar to sp:MALH_FUSMR
                     MALTOSE-6'-PHOSPHATE GLUCOSIDASE (EC 3.2.1.122)
                     (6-PHOSPHO-ALPHA-D- GLUCOSIDASE) from Fusobacterium
                     mortiferum (441 aa); 81.4% identity in 441 aa overlap"
                     /note="CPE0199"
                     /product="maltose-6'-phosphate glucosidase"
                     /protein_id="BAB79905.1"
                     /transl_table=11
                     /translation="MKKFSIVIAGGGSTFTPGIVLMLLDNLDKFPIRKIKFYDNDADR
                     QEVVAKACEILLKERAPEIEFLATVDPEEAFTDIDFVMAHIRVGKYAMRELDEKIPLR
                     HGVVGQETCGPGGIAYGMRSIGGILEIIDYMEKYSPNAWMLNYSNPAAIVAEATRKLK
                     PNSKVLNICDMPIGIETHMAQILGLKSRKDMIVKYYGLNHFGWWSSIRDKEGNDLMPK
                     LKEHVAKHGYIVDIEENQHSEASWNDTFAKAKDILAVDPTHLPNTYLKYYLFQDYVVN
                     HSDKNYTRANEVMDGREKFVFGECRKVIEEGTAEGSGLHIDEHASYIVDLARAIAFNT
                     QERMLLIVENNGAIENFDKTAMVEIPCIVGSNGPEPLVVGDIPRFQKGLMEQQVAVEK
                     LVVEAWVEHSYQKLWQALTLSKTVPSATVAKEILDDLIEANKNFWPELK"
     CDS             257386..257547
                     /codon_start=1
                     /gene="CPE0200"
                     /note="53 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79906.1"
                     /transl_table=11
                     /translation="MFTNELKDLLAGLYQKYGCTQEVLQLSNIIDKIIVKEQSERLKE
                     YYKSRKNNI"
     CDS             complement(257764..258627)
                     /codon_start=1
                     /gene="CPE0201"
                     /note="287 aa, similar to gp:FMY12759_1 acid phosphatase
                     from Chryseobacterium meningosepticum (267 aa); 42.3%
                     identity in 234 aa overlap. Putative N-terminal signal
                     sequence was found by PSORT"
                     /product="probable acid phosphatase"
                     /protein_id="BAB79907.1"
                     /transl_table=11
                     /translation="MRNSKITAIVLSAIIGIGVGTGGTLVYENNQEAKQISQLEQTTK
                     TNAIEEIVKGNVLATLWQQNSGEVKALRYEAYNSGKRYVDQLVKEPTAKPYAVTLDID
                     ETIIDNSPHAGYEIKHNELYSKENFGEWVQMADAAAIDGAKDFTDYAKSKGFEVFYVS
                     NRSEEKELDATIKNMQKLGFVNSDKDHILLKTDTSSKDARWNKIKDNYNLAIYCGDNL
                     GDFPDGYDNKSNEQRREIVDKEAQFFGTKYIVLPNPTYGDFENAVYGYDFKKSPEQKQ
                     EDRLNSIKSFK"
     CDS             complement(258849..260048)
                     /codon_start=1
                     /gene="spoIIQ"
                     /note="399 aa, similar to gpu:AP001519_115 cell
                     wall-binding protein from Bacillus halodurans (461 aa);
                     32.4% identity in 336 aa overlap. Putative N-terminal
                     signal sequence was found by PSORT"
                     /note="CPE0202"
                     /product="probable cell wall-binding protein"
                     /protein_id="BAB79908.1"
                     /transl_table=11
                     /translation="MNKLKIVSLFMSSFLMISAFSAPLITKANPEVNKLQEEKKQITE
                     EKEIKKGKLDEIKDSIDAKQAELNSAQAKVNEYEEKIKTLNNEITSTDSEINKVKKSI
                     EENTSEIEKAKKEQELKQEILGERLRNVYKSNLSDKFLYMILESKNFGELFSNIANIR
                     TLVKTDNKLIEEIEALKNELEVRQAELETSKSTLDSKKAELIDKEKTLKEVKSEHEST
                     LNTYKAQLNELEELEAEKNAELKSLADREDEIEKEIQSYFNQTPNTASTSSNSSSGFI
                     RPVSSSTITSSYGPRVHPVTGQYKVHTGVDFAASTGTPFVAAKDGVVTAAEYHPAYGN
                     MVIIDHGGGFSTLYAHASQLKVSAGQKVKQGQVVSLVGSTGYSTGPHAHFEIRINGQH
                     VNPMDYI"
     CDS             260735..261391
                     /codon_start=1
                     /gene="CPE0203"
                     /note="218 aa, partially similar to N-terminal of
                     pir:G64667 NA+/H+ antiporter from Helicobacter pylori
                     (strain 26695) (383 aa); 28% identity in 150 aa overlap.
                     Putative N-terminal signal sequence and 4 putative
                     transmembrane regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79909.1"
                     /transl_table=11
                     /translation="MARKSSKKYLKEANAQIILFVLIMIIMRMVVLNFMSEISGIGFD
                     ELSKARIYNGDITATLFLESLVNFFGNFILETYKGIILLAIINVFIASYILTKKDFTG
                     NSYFNMVIAYLFSAIITVFLLLAGIILFFCIMQCMVVINSLKIDVSSEILWLAISVLV
                     GVVFIKYFRKSVVFSLFAFLIISVYASYYTDIGKKAINTDYTQYSLEEFANNLNLVGE
                     "
     rRNA            261964..263470
                     /gene="rrnE-16S"
     rRNA            263659..266562
                     /gene="rrnE-23S"
     rRNA            266680..266793
                     /gene="rrnE-5S"
     tRNA            266809..266881
                     /gene="trnA-Phe"
     CDS             267399..268028
                     /codon_start=1
                     /gene="CPE0204"
                     /note="209 aa, similar to gp:AF125164_20 putative
                     acetyltransferase from Bacteroides fragilis (194 aa);
                     30.7% identity in 101 aa overlap"
                     /product="probable acetyltransferase"
                     /protein_id="BAB79910.1"
                     /transl_table=11
                     /translation="MKDIVIIGTENIGKEVVKIIEAINSKRNTWNVLGFISLKKDEEG
                     SNIEGYSVLESIDSMFNYFEGRKKDKFYFFKKLESQNELFTIIAIDNCKLKKEIENKL
                     KNKIKFATIIHPDVSFFNKQEVGEGTIIYPGLIVVGRFKLGKHVILKQKCSLGNNIEI
                     GDYSFISFNSNIDSNVMVKEGSYIEANTTILANSNIDKNTYIKEGSILY"
     CDS             268495..268770
                     /codon_start=1
                     /gene="CPE0205"
                     /note="91 aa, similar to pir:E70718 hypothetical protein
                     Rv0967 from Mycobacterium tuberculosis (strain H37RV)
                     (119 aa); 34.9% identity in 83 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79911.1"
                     /transl_table=11
                     /translation="MNMNAEKKKALQCLKTAKGQIEGIIRMIEDERYCIDISNQVMAS
                     QALLKKANKLILQQHMHNCVKSAFENNESKDEKIEEILSVLNKLIDK"
     CDS             270353..270934
                     /codon_start=1
                     /gene="CPE0206"
                     /note="193 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79912.1"
                     /transl_table=11
                     /translation="MENLLKDYSNEEVLKALKIVTELKLEREQGDLPEFIRGRVSEVS
                     EDEFDLIQAYNYYMRELRRGSVLLSEEETEKCGFNSRLAIDVELKDLIIFLNTQPNIK
                     TLYSCSGHQFVRGQITFEGLLKFPQVDDFKIEYADERDETKVSFDIPERSYDYLNKLR
                     KLYNYFYLINYNNLKTLTRDEVSAIKIKENCTA"
     CDS             complement(271073..273448)
                     /codon_start=1
                     /gene="CPE0207"
                     /note="791 aa, similar to pir:C72228 sensor histidine
                     kinase HpkA from Thermotoga maritima (strain MSB8) (412
                     aa); 28.4% identity in 349 aa overlap. 8 putative
                     transmembrane regions were found by PSORT."
                     /product="two-component sensor histidine kinase"
                     /protein_id="BAB79913.1"
                     /transl_table=11
                     /translation="MDNPIFFHIFNDDKNKLETQRIIKLSIFIVFSIFFILLIDLSYK
                     VLIRKNIEFIPGNSMPSFSLSLSLILGTMAYISSLIYYSSTKKDDFFIISLIYMNLSV
                     ELLITKGHNLIIFDKFIFIHAIFRIILLFYVAFNKKGIPPLITKHKIITSIVVFLFSV
                     ITPMINYRIFSNNLFAKDIYFYATLMTMIIILYIIACIFLSKKSLDDCELIYSFIIAS
                     ILLIALRGLYWICEVLLPNITLLKTNNVVLLLTILSFLLAISGVFNEITAKNKRSSLL
                     QNELQVFYHLVEFNTSSSIILYDNKKKVIYTNKTIRERYCKSTKLKDQLKEVEKLFVD
                     SIFIDDSEKNATKALFNKGNWEGKLILKNGKIVSAYIQILNVENKNYFAVNLKDITEE
                     YTLTKNIKRNEQLLSCINNNVQDLIISVDNNGLITYVNDSVLKTLNYTYEEIIGMPII
                     NLLGKNDEILNQLKLEDEEDSIKCKLVGKHSFVYVESIIRTLNDNNEIPYGKVIVAKN
                     LTSKKRLENLAIKFKEAKAYEQIRNEFFANISHELRTPLNIIYSTIQLLNSKHETDPM
                     DFNNFYDKYKQGLKINCYRMLRLINNLIDVSKIEVGFLKADFTNRDIVFLVENIVSLV
                     IPHSENKDINIIFDTNVEENIIKCDPVKIERLILNLLSNAIKFTQNHGEIFVDLNISK
                     DWVKISIKDNGIGIPKEMQASIFDRFVQADKSLKRRNEGSGIGLSIVKSIAELHDGKI
                     ELISDGIKGSEFIVWLPNVKLNYTEESNNLVDYITDDKNIELELSDIYEVH"
     CDS             273815..274873
                     /codon_start=1
                     /gene="CPE0208"
                     /note="352 aa, similar to pir:S23349 hypothetical protein
                     17.4 from Salmonella choleraesuis (367 aa); 24.8%
                     identity in 319 aa overlap. Putative N-terminal signal
                     sequence and 6 putative transmembrane regions were found
                     by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79914.1"
                     /transl_table=11
                     /translation="MNTVLKQRKRLDYLDIAKGLLIISVVLCHSPFENAYYLYWFHMP
                     AFFIISGMLYKRGMNIKEQAIKFFVPYAIFSLIDISFNYIMYYHGNFSLGDLIHEIIK
                     YAYGGKATWGVFWFIPVMFVTKVVFDQLNKRLTSKKLAFVCILSYILAHIYSMSFIPS
                     SVTEITENQFVFWNLDTVLITLPYYSLGYYITKLNIQRVFKETSTLILSSIGVVAMFI
                     LNSSIGIYYYLNIKYSYYKDPIFDILMPVTITIFILSLSYQISKFKYKKLFTIIGANS
                     LVIMYLHKQVATLFMDVFNYGYIMFTIIGVCLPLLMMVLINKSIVSKFLFNGDLTFYR
                     KIKDIKDIEPKDIIIENK"
     CDS             274974..275201
                     /codon_start=1
                     /gene="CPE0209"
                     /note="75 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79915.1"
                     /transl_table=11
                     /translation="MLRREKACIKEFYLNNRRGLVDTNGCVYLDGRYAGILKPSGAIY
                     IEGRRGFIKKNGDIYLDGILIGTLNNYSIVY"
     CDS             275341..276222
                     /codon_start=1
                     /gene="CPE0210"
                     /note="293 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79916.1"
                     /transl_table=11
                     /translation="MAMERKNFNNYKEVSLLIMLIPMLFILIDTLGRMNSKINNKNLF
                     EIIFNEIFLYREVIVKFIMAIVVIFVITKIKIIKEKFILGDFKIIIGYTTLGVISYKF
                     FGSEYGLSKSLDVYVMCIIAMIFILSGIREIMSSIDNININIEEKSNFERLVYTRVKY
                     LGIIYFIIFAILIAIENLNSIMSSDFIVNLISNYNQHYNNMARVISVLGVVLIVALIL
                     IIKKSFSNLNLCYEEYIYIIKHKTVTEEIKKDIDFVNLKVEANKKYINNKFKKLEDKK
                     AQVLLKGIFDLFKDNKH"
     CDS             276250..278448
                     /codon_start=1
                     /gene="CPE0211"
                     /note="732 aa, partially similar to pir:F75103 probable
                     purine NTPase PAB0812 from Pyrococcus abyssi (strain
                     Orsay) (880 aa); 33.3% identity in 201 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79917.1"
                     /transl_table=11
                     /translation="MESKKSTNFDFILKTSIESYYDLLKNAEKAWETHAALTYIALRM
                     VVEDLLIKLEEKYEIKREKEAGFKSTLNKLKEYVPSWILEYGEYIRIKGEKSANKEID
                     SNLEENSTLLALKKVHEILIWYLKNVTKEMSLDADYSFITPESIKESECDLAIDKKVL
                     ENKEKFIISLEKQIKTNSDDEKKQEELEELLRNVKEEKKELTEKLEKKELELQEVLNS
                     FKELQVKLTTYIEKDQSAEENNNKYPDFYKGFLSLQGYELRVVYAFLKSLSLGSIFLN
                     KSKSIFLKSQRKEFLKFIEKEVEDLKKYSDGILKLKLYYILLKLTNTPVASVADKETF
                     DKSLDSIVEKAYFIIESRNGFNGKVDKLEAIINYYLIVIMNSLSAEINHEEDNKDKVS
                     DIIYEVLRTIPLDERKIILNKMNFTDISEGAIKENIRLNQVEFLKAALDCGISESSEF
                     VIRSVFSIYVAFQKDFDFYEFRTRHDMLRAYIGPLLLVILLKEFKISRENLVPIFVME
                     ISISNKILRKERREKIYYNQLVQAWLEEKEKYDKILSEKNNLEKNLKEVQEARELLLT
                     NERKFVAEKDNTENAIKSQWDMFKEKALQSEEIKSFNSYEEYIRAINQKNLIEVSEEH
                     SLKDRGIIKNFFSLDTWKYKLNKLEISKNIKVLEEKLIEEAKESGVFENELLTIRELE
                     KILADKESGLEDIRVDLKENSVENEKLNRLISNSNKLMEKFKEDNFDFAK"
     CDS             278930..279700
                     /codon_start=1
                     /gene="CPE0212"
                     /note="256 aa, no significant homology. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79918.1"
                     /transl_table=11
                     /translation="MKRFLAVGIIGVLVAGISVFGIEEFKHKRVKGLEAKVFQAKTYI
                     NHGDLVNAEIMLNIIKEENLDLKDKNVQEDILEIENSIDSNKDSFRDKPIKNLEDLSV
                     DQKKVELLNIYLENNEFSPDVRSIESAGKEYYIQFRKSKKLPLDKNKDFSNKKGYILK
                     PIRTSKRFFEDTCLIFDVEKPYYINKNIYYKFVEMPVSSYFGEDDKEIWYFADLNFNI
                     ISKENLEFYMNNKDVLDSNNNILSNYNLTNYIKDEYLY"
     CDS             complement(279879..280694)
                     /codon_start=1
                     /gene="CPE0213"
                     /note="271 aa, similar to gpu:AE004134_7 conserved
                     hypothetical protein from Vibrio cholerae (287 aa); 34.2%
                     identity in 263 aa overlap. Putative N-terminal signal
                     sequence and 4 putative transmembrane regions were found
                     by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79919.1"
                     /transl_table=11
                     /translation="MKFDLSKMYEKLLSWITTNGFKLVIGLILLYIGWKIINKVIKIL
                     ANIMKSRNVDPTLTSFAEAFSEVSLKVLLVITLMSYVGFDIAGLAALIASAGLAVGLA
                     LQGSLSNFAGGVIILLLRPFRVNDFIEASGYSGTVERITVFYTHLVTPDNKEILIPNG
                     TLANGSLINYSSKDTRRVDLVFSVGYDDDIIKVKNVLWDIINKNELILKTPEAFVGIS
                     QHAASSIDFTVRVWTKQEDYWKVHFSLLEEVKLRFDEENITIPYPQMDVTLTK"
     CDS             complement(281268..281912)
                     /codon_start=1
                     /gene="CPE0214"
                     /note="214 aa, similar to sp:HO1_SYNY3 HEME OXYGENASE 1
                     (EC 1.14.99.3) from Synechocystis sp. (strain PCC 6803)
                     (240 aa); 32.5% identity in 200 aa overlap"
                     /product="probable heme oxygenase"
                     /protein_id="BAB79920.1"
                     /transl_table=11
                     /translation="MNSFMMDIKNNSNDLHAVAEKTGFLKRLLEGKASTESYAEYLYN
                     LYEVYNAIEVNLEKCKDNKVVKDFVLPEIYRAEAILKDLKFLLEENLNTMKPLASTRA
                     YVARINEIGETAPELLVAHAYTRYLADLFGGRTIYGMVKDLYKIDEEGLNYYKYETLS
                     DGSEMKGFVMNYHNKLNNIELNEEMKERFINEVANSYVYNIAISNELAFIRFNR"
     CDS             282313..283536
                     /codon_start=1
                     /gene="sbcD"
                     /note="407 aa, similar to sp:SBCD_BACSU EXONUCLEASE SBCD
                     HOMOLOG (FRAGMENT) from Bacillus subtilis (325 aa); 38.1%
                     identity in 339 aa overlap"
                     /note="CPE0215"
                     /product="probable exonuclease"
                     /protein_id="BAB79921.1"
                     /transl_table=11
                     /translation="MRILHTADWHLGKNLEGLSRMDEQERFLEDFVHIVKDNNIDLVI
                     IAGDVYDSSNPPARAEKMFYDTLKKISANGERMTLVISGNHDNPERLVAAGPLAREHG
                     IIMVGTPKSIVEVGEYGRNKVLNSGEGFIELDINGEKSVILTVPYPSEKRLNEVLYGA
                     MDETCERIKSYSDRIKLLFDSLKGNFKEDTINLVVSHLFATGAENTGSERNIELGGSF
                     IVDKECFPKEAQYIALGHIHKPMILPGTNKKIRYAGSPLQYNKKEISFEKKCFIVDVK
                     ANEEANIDEIKFDVYKPIEVWKCDSIDEAIYKCEENKDRECWVYLEIKTDRYIREDEI
                     KAMKKLKRDIIEIIPKITLDEEENDERSFSEKSFEELFTDFYEKERGVKPEEDLLELL
                     LNIVKEEGDEENETN"
     CDS             283514..287041
                     /codon_start=1
                     /gene="sbcC"
                     /note="1175 aa, similar to >gp:CPSBCC_1 sbcC gene product
                     from Clostridium perfringens (140 aa); 91.4% identity in
                     140 aa overlap"
                     /note="CPE0216"
                     /product="probable exonuclease"
                     /protein_id="BAB79922.1"
                     /transl_table=11
                     /translation="MKKMKPIKLEVKGLNSFIDKQVVEFDKLTERGLFGIFGPTGSGK
                     STILDGITLALYGDIARKSSNYINTNCDGVYVSYEFQITGNEVKRYRVDREFKRDNKS
                     GGIRNKSSKIIDITGGVENVLEEKAKAVTSKCEEIIGLKLDDFMRTVVLPQGKFSEFL
                     KLEGKERRNMLERLFNLRKYGDDLSSKLSFEIRKEKDKMNVLEGQLKGYEGISEEALK
                     AKEEEIKEINLSIKSKEELLNKIKKEFEEAEKVWNTQKELYDKRIEEESLVSRSEEIK
                     SFKERVEISNKADKVIVFINNLEEILKEINKEDLKFSELNKKLEELINLREENKLKFE
                     EFTKKKEEKLPDLRLKKEKLLESQKERDILFQIKADGVKLKEACKKIFEDRSKCDTKL
                     NSIEENEKRLNEELKEKEERKEELFVHEEFKNKINSGLFILNSYESLDKQFNEIKSEE
                     VELKKYIKNLTEDKEKSEKDLKVKVESLSKIRDKLESLLKETPGDSNSILEKQIKLGE
                     YREKLNKYKEIKNSLEESLKTKNNFEEKLKTFENQKLLLEKEVRELKDYINKVKVEEL
                     AHKLRENLVEGECCPVCGSTHHELNKVEKINLEESNEKTILLESKEEKLKELILEFSK
                     IEATLEYENKKIEELNISIEEVGEVNEERLKFLEEEFNTLKDKIEEFNLKKENLEKDL
                     EKLKEEKNNLENIFNKAEVILCEKIVREKEIASKIKELDKELKLKNSELNSIKNELKI
                     EDIKLENELILKKEKEKNLLEKEIRILRTQLEESNKIKDELREKRDALKENYLSQKSL
                     LDGKVEVYREKERMIKGSLKGLIDEALPIEKIDIKGLLEDLQLEIDYIEKAYLNLSEA
                     KEKLEKAFNNMNQEVSVTKERVNSLKLRKENEEKKVNLALEEEGFKTILEVKEGILSK
                     DEKEKLKTLIEEYDNNLIKIKANIELLIKKLNGKSLTEEEWTRVLQEKNNTEKELKEV
                     EELKIRLVTESESIKKKLEEQRDILHIKAKQEHKLALLSDLEKLFKGKKFVEFIAANQ
                     LKYISIEASKKLKDITNGVYGLEVDENGKFIIRDYKNGGAERDASTLSGGETFLASLA
                     LALSLSSQIQLKGTAPLELFFLDEGFGTLDDNLLDVVMSSLERLHHERLSVGIISHVE
                     SIKNRVPVKLILTPAEAGIGGSKVKIERS"
     CDS             287446..288642
                     /codon_start=1
                     /gene="ackA"
                     /note="398 aa, similar to sp:ACKA_CLOTM ACETATE KINASE
                     (EC 2.7.2.1) (ACETOKINASE) from Clostridium thermocellum
                     (400 aa); 62.1% identity in 396 aa overlap. 2 putative
                     transmembrane regions were found by PSORT."
                     /note="CPE0217"
                     /product="acetate kinase"
                     /protein_id="BAB79923.1"
                     /transl_table=11
                     /translation="MKILIINCGSSSLKYKLIDMANEKDIIEGIVERIGLDQSRLVQK
                     NELREKYILEKEIKDHKEAIDIVLNTLVDPKVGVIESIDEITAVGHRVVHGGERYSSS
                     IIINEEVIKYLEECSKLAPLHNPANIIGIRACQSLMPNKEMVAVFDTAFHGTLPEKAY
                     IYAIDYALYKDHKIRKYGFHGTSHKYVSHKVAETMGKDIKDLKIITCHLGNGASISAI
                     KGGECIDTTMGFTPLAGIPMGTRSGNIDPSIIPFLVEECGYTIEEVSESLNKKSGVLG
                     ISGVSSDFRDIEDAASKVDKRAQLALDIFHYRIRAEIGSFIVNMGGVDVIVFTAGVGE
                     NSPETREECLKDLEFLGLTLDKEKNKVRGKLAEISQADSKIKAYVVPTNEELMIAKET
                     VELIGK"
     CDS             289079..289900
                     /codon_start=1
                     /gene="CPE0218"
                     /note="273 aa, similar to gpu:AE004132_1 DnaJ-related
                     protein from Vibrio cholerae (284 aa); 27.9% identity in
                     208 aa overlap. Putative N-terminal signal sequence and 1
                     putative transmembrane region were found by PSORT"
                     /product="DnaJ-related protein"
                     /protein_id="BAB79924.1"
                     /transl_table=11
                     /translation="MGFIVFCLIAYFVISHLSNKKDVSGNKANSNCPYCNAAFYLTEN
                     GDFNCSNCGRLFKYRDGIVYRQDERLPIVVELACTLFTILCKADGVVTKDEVSITKEL
                     LEKNFGLEDKDMKMAIDILNKSKSKPYTKTIINDLNNIFNNYDFSKTDAEDYKELILR
                     CAMIIAFCDDGEPSNNQNKILDDIVSIFNISATKYTNLLNYFRDNCIEKNKNDYYEIL
                     GVSEGASKEEIRAAFRKLSKLYHPDRYSSKDLPPEIIKEFEEKLAKIIEAYEALK"
     CDS             complement(290151..290909)
                     /codon_start=1
                     /gene="CPE0219"
                     /note="252 aa, similar to C-terminal of gpu:AP001511_12
                     BH1123 gene product from Bacillus halodurans (526 aa);
                     34.7% identity in 101 aa overlap.Also similar to
                     C-terminal of many regulatory proteins"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB79925.1"
                     /transl_table=11
                     /translation="MIFLKSVLIDFYNCCEIPIRAVDNNMNILSEVGYSSFYDYIFND
                     LNLNSKFERSYLKHDHNDSLIITFENNISFYSLFNYKSIDKDLIFIIGPLYLKEDLKN
                     SNDDLELYKIPLKTKSCLKYYNSLLKIILDEKLKDNFSISYSPYVGRAIDFIEKNYAE
                     EITIDSLCTEFKINKSYFCNIFKSETGQTFINFLNNYRIEKSKDLLKDFNLSLLDIAH
                     KVGFSNQSYYCTVFKKFTGLTPLKYREDNYKKGL"
     CDS             291056..293287
                     /codon_start=1
                     /gene="CPE0220"
                     /note="743 aa, similar to gpu:AP001518_129 BH3298 gene
                     product from Bacillus halodurans (1071 aa); 24.4%
                     identity in 439 aa overlap. Also some similarity to
                     gp:AB012764_1 Chitinase A from Clostridium paraputrificum
                     (832 aa). Putative N-terminal signal sequence and 1
                     putative transmembrane region were found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79926.1"
                     /transl_table=11
                     /translation="MGRKKINKILGYALVTSMLVGVGADTVYAATNINSGTAIVRSEG
                     LRDGIYEANNVTSYVEEGNSTGENMARNAVGEKTKFRIEDGKTLMTVYFNSSLYGFMN
                     NIEVSAGGEALKIEENKDDKSITFEVPSPDTKVKIGLFITMMGRKVELFLVNDMNTVN
                     LLDEAPTINNAKDISVTQGDAIDLLSGVIGTDKEDSNLKVEISGDTSFVKDGKAEIPG
                     VYPITYKVTDSSGQFDEKTVNVTVNKKTTLGDGSYTLKNTVQYVGQGNMETGNSMARK
                     VLSDDSRIDISNGKNTVTLTFNSELYAFLKNFNVTVDGEKVEAEVNKDNRTIKFNIPD
                     LNSDIVVSTLVSMMGKEVSFKTTLNYDTAKKLEDNLEDNNKPGNEDNENIPGENENSG
                     NQDNSGNTNSGSNGSANEDKENESEGSSGEIVDANQLKNGIYNIKNDVSYIGDGNQNV
                     GNDMARKALSKNSKLEVKDDKKILTLKFNEEQFSFFKDFRITVNGKDVVATPNEADRT
                     ISFEIPSLDADIVVTAFVSVMGRDVSFKTILNKGTLELVSGEDKPAIEEENKSEESNG
                     TSSSNNGSSANEGNSTVTENKVTKGKLYTIENKVVHKSQTGVDMARKYLNKISDLEEI
                     DGKTYLTLTFTGQEFMKDHKITVNGKDANYKVVSKNGDSIKLRFEIPNLDADIKVSLY
                     VIPMGRNVEFNVELLKDTKKFVKDFTVSSLPQTGSPIGGNSVALLGMAMMGASMFIRK
                     REE"
     CDS             293350..293997
                     /codon_start=1
                     /gene="CPE0221"
                     /note="215 aa, similar to gpu:AP001518_130 BH3299 gene
                     product from Bacillus halodurans (221 aa); 20.3% identity
                     in 153 aa overlap. Putative N-terminal signal sequence
                     and 1 putative transmembrane region were found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79927.1"
                     /transl_table=11
                     /translation="MRFLKPVLLVMLTLFISLTGVFGSVDVLANENLENGIYDVKNDV
                     YHDSDIGMSMSRSYLNDTMQLKILGDETEYTIGFSGTEYMENFRILVDGNDGNAEIVE
                     EDKENGTIKLKVKVPNKDSELEAKIYVGPMERDVQFKVIPKFDTLTLVEKLEAPKVEN
                     KESSNENLSDETGKSEDAISEATGLANNKNMFIYIGGGIIIVALIVSLVIFKRKK"
     CDS             293999..294562
                     /codon_start=1
                     /gene="CPE0222"
                     /note="187 aa, similar to gpu:AP001519_111 BH3596 gene
                     product from Bacillus halodurans (187 aa); 30.2% identity
                     in 126 aa overlap. Putative N-terminal signal sequence
                     was found by PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79928.1"
                     /transl_table=11
                     /translation="MRNKLAKGLFILGLVIVSTVLIGKLYKSSVEKKTLEEFKEKFNY
                     SEEEKKKTLEEIKNGDGIALIDIEKIGVHTVIAEGSTLDVLENNIGHFENTAMPGENG
                     NFSIAGHRNTINNEVFRNIDKLQVGDEIKITTLTDIFQYEINEIFVTSPSDTDVLNQN
                     LDEKTMTIVTCTNRGKDRYIVKAKLIG"
     CDS             294576..295463
                     /codon_start=1
                     /gene="CPE0223"
                     /note="295 aa, similar to gpu:AP001518_128 ferrichrome
                     ABC transporter (ferrichrome-binding protein) from
                     Bacillus halodurans (302 aa); 36.2% identity in 287 aa
                     overlap"
                     /note="ferrichrome-binding protein"
                     /product="ferrichrome ABC transporter"
                     /protein_id="BAB79929.1"
                     /transl_table=11
                     /translation="MFLKKGIALSLICLLGFGVMGCSNNSGESKESLKKENGEEIVVA
                     TSVAVTEILDELGVKVSGVPTSSYDLPESTKDAVKVGNPMNPDLEIIKSLNPDVVVSV
                     DTLGEDYKKLFTDNNIPSEFIDLTTLEGLKTSISTLGERFNKTEKANEILNELKVKED
                     EFVNLSKEEKKNVLLVFAAPGSMMIATPSSYIGNLVDKVGANNIVKDDKKPFVSYSNE
                     EIVKLNPDMVLVMTHGMPEQAKKMAEEKFASDPAWSRIEAVKEGKVYYLENGYFGMSA
                     NLKVIESLDKLGEIIYGEK"
     CDS             295450..296436
                     /codon_start=1
                     /gene="CPE0224"
                     /note="328 aa, similar to gpu:AP001518_127 ferrichrome
                     ABC transporter (permease) from Bacillus halodurans (328
                     aa); 35.6% identity in 298 aa overlap. Putative
                     N-terminal signal sequence and 9 putative transmembrane
                     regions were found by PSORT."
                     /note="permease"
                     /product="ferrichrome ABC transporter"
                     /protein_id="BAB79930.1"
                     /transl_table=11
                     /translation="MVKNNKLKSLYIGLSILIVLILMIVSLKLGSIDISFGELIKGLL
                     SGSNEGNIGIIKDLRMPRVIIAALVGGNLALAGVLLQAVIRNPLADPQVTGISSGACL
                     VSLIFIIFMPASGSIRPIVGFFGGLVSCIVVYLMAYKKELDTMRIVLAGAAINALLGG
                     LSQILTIGSGVGAGNIQSWISGSLAATSWDEVKILFLYSIIGMGFALILAKSCNVIVL
                     GNKNAKSLGFNSDLQMILITVVAVFLGSVSTAIVGIISFVGLVVPHICRILIGSDHRY
                     LIPFSIFVGGALVLLADTIGRMLVKPYEIPAGIIMAVIGALFFLYLLRRSDM"
     CDS             296437..297216
                     /codon_start=1
                     /gene="fhuC"
                     /note="259 aa, similar to gpu:AP001518_126 ferrichrome
                     ABC transporter (ATP-binding protein) from Bacillus
                     halodurans (256 aa); 48.4% identity in 250 aa overlap"
                     /note="ATP-binding protein"
                     /note="CPE0225"
                     /product="ferrichrome ABC transporter"
                     /protein_id="BAB79931.1"
                     /transl_table=11
                     /translation="MIRGEKLSFNYKGEKNIINDLNIDIKEGEITTIIGPNGSGKSTL
                     LSLLCALNKSKTGHVYLGDINMNNLKYKDIAKILATVHQQNSVPKDIKVEELVAYGRY
                     PHKGYFKSNNKEDKNIIKWALECTGLDDLKHKGVMNLSGGERQRAFISMALAQKPKIL
                     FLDEPTTYLDIFHQIEILEIVKKLNKYNGLTVVMVLHDINQAIKYSHNIVVMKDGKIV
                     KEGKSENVIDENLLKEVYKVNGVINKCKETGETYFIPKTIC"
     CDS             297255..298985
                     /codon_start=1
                     /gene="CPE0226"
                     /note="576 aa, similar to sp:Y663_HAEIN HYPOTHETICAL ABC
                     TRANSPORTER ATP-BINDING PROTEIN HI0663 from Haemophilus
                     influenzae Rd (560 aa); 44.2% identity in 550 aa overlap.
                     6 putative transmembrane regions were found by PSORT."
                     /note="ATP-binding protein"
                     /product="probable ABC transporter"
                     /protein_id="BAB79932.1"
                     /transl_table=11
                     /translation="MMIDKRLLNLCKESKKYIGLTVLMNWISVICNLMTIIVIGFSIQ
                     ELFSLGNIENLNKKVLILVGLLGVRFCVNLLSGHFSYKSSEMVKITLRDKIYEKLLKL
                     GMRYDKVDSTSSIVQMAVEGVEALEVYFSKYLPQLIYSILAPLTLFCALAFISFKAAL
                     VFILCLPLIPISIILIMKIAKKILKEYWGQYSDLGNTFLENLQGLTTLKVFDMDNERH
                     ELMNEEAESFRKITMKVLSMQLNSINVMDLIAFGGAALGSIVALLQFRAGTVSLGGMI
                     VILLISAEFFIPLRLLGSYFHIAMNGIVAADRIFKVLEADESKVSSDSNLNEISNISL
                     ENVSFSYDGKREVLKDISLSINKGDYVAIVGESGSGKSTIASLILNNYKASKGKITLN
                     GTDINNIDFSKLYNRVSIISTNSYIFNGTVRDNLLIAKKDATLEEINYALKKANLLDF
                     VNSKKEKLDLEVGEGGSKLSGGQKQRLALARTILANREVIIFDEATSNIDVESENMIW
                     KSINEISKEKTVIVISHRLANVKNADRIYMLDKGVLVEEGSHKDLMERKNKYYGMVNY
                     QNELEVGGVI"
     CDS             298986..300674
                     /codon_start=1
                     /gene="CPE0227"
                     /note="562 aa, similar to sp:Y664_HAEIN HYPOTHETICAL ABC
                     TRANSPORTER ATP-BINDING PROTEIN HI0664 from Haemophilus
                     influenzae Rd (552 aa); 43.2% identity in 551 aa overlap.
                     Putative N-terminal signal sequence and 5 putative
                     transmembrane regions were found by PSORT."
                     /note="ATP-binding protein"
                     /product="probable ABC transporter"
                     /protein_id="BAB79933.1"
                     /transl_table=11
                     /translation="MRKSGFSIMKRLIVELKPLAPVMFITVFMGVLGFLAAIGITVLG
                     SVAISSLIDSTISFSFKTALILMIVLGILRGPLRYGEQLSGHYIAFKILVILRDKVFS
                     ALRKLAPAKLEGMEKGNLISMITSDIELLEVFYAHTIAPISIAIITNTIMGLILLSIN
                     VKVGIVGIIGYILIGFGVPYISSSFGKEAGVQYREAFGKTNSYILDSLRGIKEVLIFN
                     NGNERRGNIKKFSEELNEKQKVIKKHEGIIRAFSDLIIMLTILIALYVAYLEVLKGTM
                     TIGGLIIVVTLIASSFGPVVALSNLSNNLLLTFASAQRIFNILDEKPSVEEVLGEGMK
                     VGNNIEYKDVSFAYKGKENVLKDVNIDIKLGDKIAVIGESGTGKSTFVKLLMRFWDVT
                     KGEISLGNKNVKEIQTKELRKKMALMGQETSLFNMSIEDNIKIGKLDATLDEVKEAAK
                     KAGIHEFIMGLEDGYKTKVGELGGNLSSGEKQRIGLARVFLRESEIVILDEPTSNLDT
                     LNEGIILKSIRTYLKDKTLILITHRKSTTRVCEKVFRINKGNLIQCEEVKHELA"
     CDS             300661..301056
                     /codon_start=1
                     /gene="CPE0228"
                     /note="131 aa, no significant homology. Putative
                     N-terminal signal sequence and 3 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79934.1"
                     /transl_table=11
                     /translation="MSLLKIFYVILGFISLGLGLIGIILPILPTTPFLLLTAFCFVKG
                     SDKFDKWFKGTKIYKNHLESFEKNRAMTLKTKLTILLTADIMLLFPLILSKSIHLKIF
                     IVILMMFKFYYFIFRIKTVKAGDVVEQNR"
     CDS             301037..301336
                     /codon_start=1
                     /gene="CPE0229"
                     /note="99 aa, similar to prf:2511340D ygbA gene from
                     Proteus mirabilis (75 aa); 54.4% identity in 57 aa
                     overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79935.1"
                     /transl_table=11
                     /translation="MLNRIDKEKEIITLMIKLYCKKKHGGSNGELCNECRELEEYAHK
                     RLTYCKFGNEKSSCKKCPIHCYKKDMREKVKEVMKFSGPRILIYNPKEYIRHIFK"
     CDS             301463..301648
                     /codon_start=1
                     /gene="CPE0230"
                     /note="61 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79936.1"
                     /transl_table=11
                     /translation="MGNIDKDRIVCRCKKVSEGTIIEAIKNGADTYEKVKKETGANTY
                     GCFACRLEIKKLLEENK"
     CDS             301943..303388
                     /codon_start=1
                     /gene="CPE0231"
                     /note="481 aa, similar to pir:T44602 phosphonate
                     monoester hydrolase (EC 3.1.3.-) PEH from Burkholderia
                     caryophylli (514 aa); 30.2% identity in 450 aa overlap"
                     /product="probable phosphonate monoester hydrolase"
                     /protein_id="BAB79937.1"
                     /transl_table=11
                     /translation="MKPNIVLIMVDQMRGDCLGVNGNEFIETPNLDMMATEGYNFENA
                     YTAVPSCIASRASILTGMSQKSHGRVGYEDGVSWNYENTIASEFSKAGYHTQCIGKMH
                     VYPERNLCGFHNIMLHDGYLHFARNKEGKASTQIEQCDDYLKWFREKKGHNVDLIDIG
                     LDCNSWVSRPWGYEENLHPTNWVVNESIDFLRRRDPSKPFFLKMSFVRPHSPLDPPKF
                     YFDMYKDEDLPEPLMGDWANKEDEENRGKDINCVKGIINKKALKRAKAAYYGSITHID
                     HQIGRFLIALSEYGKLNNTIFLFVSDHGDMMGDHNWFRKGIPYEGSARVPFFIYDPGN
                     LLKGKKGKVFDEVLELRDIMPTLLDFAHISIPDSVEGLSLKDLIEERNSTWRDYIHGE
                     HSFGEDSNHYIVTKKDKFLWFSQRGEEQYFDLEKDPKELTNLINSEEYKERIDYLRKI
                     LIKELEGREEGYTDGNKLLKGYPVSTLKHIR"
     CDS             complement(303546..304883)
                     /codon_start=1
                     /gene="glpT"
                     /note="445 aa, similar to sp:GLPT_BACSU
                     GLYCEROL-3-PHOSPHATE TRANSPORTER (G-3-P TRANSPORTER)
                     (G-3-P PERMEASE) from Bacillus subtilis (444 aa); 48.5%
                     identity in 412 aa overlap. 8 putative transmembrane
                     regions were found by PSORT."
                     /note="CPE0232"
                     /product="glycerol-3-phosphate transporter"
                     /protein_id="BAB79938.1"
                     /transl_table=11
                     /translation="MFGFFSPAPAIPRLPKDKVSSAYKAYRIRMFLMIFIGYTGYYLV
                     RKNFAVASPYLIDNYGFSKTQIGLISMGLAVSYGLSKFILGNLSDKSNVKKFICFGLI
                     ASSVLSVLMGFARTVPIFLILMVFNGFFQGMGAPPCSIVLGKWFSQKERGLKMGIWNT
                     SHNIGGGLIAPIATLCLLVFGQNHFQSIFFVPAIICTIVALFCYVIGADTPASVGLPP
                     VEEYRNDYPEVKAEVNPTTLSSKEIMVKYVLKNKYVWYLALANIFVYLIRQGVVNWIP
                     IYLKESKGFSAANANWAMFLFEYAAIPASILLGWLSDVVFKGKRAPLSILCMIGVIFA
                     TVAYWQTSSTLVTMISVAFIGCFIYGPQLLIGMNLIDVVPNFAVGSATGFSGLCGYLL
                     GEFMADFVLGMIADSFGWNGAFIFIIVGAFIALLLLALTLKIKKNPQVEDKIA"
     CDS             complement(305084..306103)
                     /codon_start=1
                     /gene="CPE0233"
                     /note="339 aa, similar to prf:2223232C   Fe-binding
                     protein from Actinobacillus pleuropneumoniae (346 aa);
                     28.5% identity in 291 aa overlap. Putative N-terminal
                     signal sequence was found by PSORT"
                     /note="periplasmic iron-compound-binding protein"
                     /product="probable iron(III) ABC transporter"
                     /protein_id="BAB79939.1"
                     /transl_table=11
                     /translation="MKKFLNKKITIILTIIILLLIAKLHIIKKEKALSTSNMNHIVVY
                     GSLREEEGKYLLEKFKNEYDCTYEYIKLPTEEAVQRILDTKDNPQGDIFIGGSCDGYE
                     ILKKYDALEEYNSPWANNIPAKYKDLRGYWTGFQITPLSIGINKSLWQTHFGDSVPYP
                     KKIEDLLNPEFKDKIILPNPQTSGTGYTLMASLYQELGKEKFETFIAKLNDNVSSSTI
                     SGFNSIQRVASGEYLITVNFLSDQLIANRSSDNIISIVPENAGWNVDSIALIKNSKHE
                     KIAKSFIDFVLSKETSSDLSKFSKAISTKNFDTNQFKIYDKYNFYLAAEDREKIMQIL
                     YKNND"
     CDS             complement(306084..306872)
                     /codon_start=1
                     /gene="CPE0234"
                     /note="262 aa, no significant homology. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79940.1"
                     /transl_table=11
                     /translation="MSKNFKNTLAIYLFFIVIILATYIYYSSNIYDSLTVVKSSQENK
                     GDLNIKIPDKIILSNPYLGTTVISNKSELNELLQYFNKICLTNSTKENALPLENTLFI
                     SGEIHYLNGDKTPFEISNILKLDGESYSNNSSLINMLRNNLKDAFYTVNNLESILSSP
                     DNLITYKEDGTMKNLSKDSKSLLLEDFKSLRLMNDNKDFLKTDLSEIPKHHLTLYRYA
                     KEGDISNNTFYIDVYKDYVIIQYLGDENGKNIYLKGNLNEEIFK"
     CDS             complement(306865..308295)
                     /codon_start=1
                     /gene="CPE0235"
                     /note="476 aa, similar to gp:AB028738_5 Sensor histidine
                     kinase protein VirJ from Clostridium perfringens (471
                     aa); 30.3% identity in 413 aa overlap. Putative
                     N-terminal signal sequence and 1 putative transmembrane
                     region were found by PSORT"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BAB79941.1"
                     /transl_table=11
                     /translation="MKNNKKQMNLNLKQKIILTNLLILAPIIIFIFIITYNALSKNLI
                     NNSIEYLLDKSRTTESYILNLLSSNDSEDKEDIIRDNAPFIASTLSEKYNVRIQIISN
                     SAQIIYDSSSDEVSLFGSDINEALDGQTAYIVEKIDNIPTLFLSSPIFYKGKEYGAIR
                     LILMNTEAYEILRNTLTIFIISGLMAIILAIFLINTFAKELVSPLMILKQKSKNISEG
                     KFKEKLHITSGDEVEDLANTFNIMSENLDKYINEIKSAKLHQKKFFDNVSHEFKTPLT
                     AIIGFSEIIPKLNDKEKIVQSSALIEKEGKRLLNLVEEILLLAKSNKNTFEIEYTYID
                     VKSLIDDCLKILKIKLDNYDIKVYRNYESFFIYGDHDKTKQVFINIIDNAIKYSGCET
                     LNISTKRSPNKMEVIIEDDGTGFIIKDEYVNPKGNGLGIKICKDIMQSQNYGFNIESE
                     LDVGTKVTLSFSIGKNNEIKEEDFNE"
     CDS             complement(308285..308956)
                     /codon_start=1
                     /gene="CPE0236"
                     /note="223 aa, similar to gp:CAU58131_2 PhoP from
                     Clostridium acetobutylicum (217 aa); 38.3% identity in
                     222 aa overlap. 1 putative transmembrane region was found
                     by PSORT"
                     /product="two-component response regulator"
                     /protein_id="BAB79942.1"
                     /transl_table=11
                     /translation="MKILVVDDEVSILQLIKMNLEIEGHIPITAENALDALELVIKEK
                     PDIIILDAMLPDISGFNLIPKIKNIDDIPIIMLTAKSDINDKLLGLQLGADDYITKPF
                     NSTELILRINIVGKHISSDSKKKVKDLTIGDLTLLLDERKALIKSEYINLTFKEFEVL
                     RCLCQNKNKVFSREELLNKVWGYDFEGTTRAVDILIQRLRKKLGPCQNYIKTLYKAGY
                     KLDEK"
     CDS             309248..310447
                     /codon_start=1
                     /gene="napA"
                     /note="399 aa, similar to prf:2210362A   grmA gene from
                     Bacillus megaterium (386 aa); 36.4% identity in 357 aa
                     overlap.Also similar to many bacterial Na+/H+
                     antiporters. Putative N-terminal signal sequence and 12
                     putative transmembrane regions were found by PSORT."
                     /note="CPE0237"
                     /product="probable Na+/H+ antiporter"
                     /protein_id="BAB79943.1"
                     /transl_table=11
                     /translation="MLSYEFLFDLALILISTKLFGLITKKIRMPQVVGALVAGVVLGP
                     AFLNVLSETEFIQNLAELGVIVLMFTAGLETDINQLKKTGKASFIIAVLGVIIPLVGG
                     FFIASIFNKGNDVNTILQNVFIGIILTATSVSITVETLKEMGKLNTRAGNAILGAAII
                     DDILGIIALTITTSLADPSINVIIVLIKIVMFFIFAGFAGYLFHWAFIKLDERYQRDL
                     RRFVIIAFVFCLLLSFCAEEFFEVADITGAFIAGLVISDSNRSKYLNSRFETLSYMLL
                     SPIFFASIGIKVQLTAMTKTIFIFSILLLLVAILSKVFGCALGAKLCRYSNREAIQIG
                     TGMISRGEVALIVANKGIAMGLMLPEFLAPVVIVVVVTTIVTPILLKVVFNNKSKSVD
                     LNVKANV"
     CDS             310700..311227
                     /codon_start=1
                     /gene="CPE0238"
                     /note="175 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79944.1"
                     /transl_table=11
                     /translation="MSKEIIDIEVEEFIPFNDAADMKEFRKFLKQYGIEDALEDTTLD
                     YTKKKLEMLLALAEDGEDEELAEHKNILKKLLNNLKGEKVKREAMKALYEVYREYEDL
                     TGKECEDLIDSKELDKKIKEALKEYKKYEHFKTHEEQIAEKWIRELKKEAIEYKKQYK
                     ELKKDIRRDLKRLEK"
     tRNA            complement(311356..311428)
                     /gene="trnA-Met"
     CDS             311601..312377
                     /codon_start=1
                     /gene="CPE0239"
                     /note="258 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79945.1"
                     /transl_table=11
                     /translation="MFTKGFDEAYNRALELQKLFYGEKEKYNEELKNENRDIKHLVNK
                     INEEKIYILETLVPKYAKNMSILERQSIKATLGEEVSSEYIINDYNIRPIKELLLIDY
                     DEKSIIKNIKNPFIKVFKINKINKNLDEETMEIQSARDEMKKISQCAQDDKLKLIRIY
                     KLICSATNLGEAIEERFRDFIPMIQSSRLIYGDCNIEKRSYRIGNVMKCYDGIMQFLV
                     KICETKYRSAEGKRVKYIKDSLIDEHLEELDLWKQSFNEI"
     CDS             312795..314225
                     /codon_start=1
                     /gene="CPE0240"
                     /note="476 aa, partially similar to pir:T28317 ORF MSV156
                     hypothetical protein from Melanoplus sanguinipes
                     entomopoxvirus (1127 aa); 24.2% identity in 293 aa
                     overlap. Putative N-terminal signal sequence and 2
                     putative transmembrane regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79946.1"
                     /transl_table=11
                     /translation="MSTISNILKSFLTQNILGYIGVTLILIVICLGFIYNMRVKKKYE
                     NLLNAFNESEWINVSNNEDQKELKFLNSELKAMADDFRKSAIKGTYNINTEVIIQKNI
                     EKRILKEENIANILPSISIALGLIGTFLGLTVAIMTTTGILSSGTQSMADFSRSMNMP
                     LGSMSSAFWTSIVGVIGSIILNCLNINLKRAKEDFYDVFEDYLDNILFSIYIKSDKDV
                     LTDFMNKALGSFSVKLDELFNNGINNLVEGINKNTVDMTSTFNGMNKHISDLENIVSY
                     FRVSVMGIKTPIKSFGEDLEKFSRVSAEFCNSVNSTNNKFLNKSARLEESVNELSKAI
                     NDNKREINKLCMRLEVQSNEVRRGYNTFNDVFNIIKDEQSRNNKIISNQISKLNDGYR
                     EFERGINKFSSNVSNMKNEVANGIYYALQRETQELSSNIVDKLNVPLRDISLATEELS
                     RSTNRNREIGKVDSGWKKDSKEIGRC"
     CDS             314228..314920
                     /codon_start=1
                     /gene="CPE0241"
                     /note="230 aa, similar to C-terminal half of pir:F81407
                     probable periplasmic protein Cj0599 from Campylobacter
                     jejuni (strain NCTC 11168) (317 aa); 26% identity in 181
                     aa overlap. 1 putative transmembrane region was found by
                     PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79947.1"
                     /transl_table=11
                     /translation="MKVRRRKYKTEQEVPSYWPSFVDIMTTVTLVFFFILLTSIGISS
                     IFVDNIAVERETVYDKIQGELNQYAVNEEVMNFNREEGKIDIKTETFFDSDSSVLKED
                     GKKLASELGDIFFKLLSNEDIKEKIDYIEIVGHTDFAGSTIHGRELSTERAISFLNEM
                     MPEDSELENLHGEKFKASGMSEFENYASKEERDRGYDEYNIEETKKDRRIEVRMVFSN
                     EDLEKAIKERKN"
     CDS             complement(315018..315338)
                     /codon_start=1
                     /gene="CPE0242"
                     /note="106 aa, similar to prf:2503398E divercin immunity
                     protein from Carnobacterium divergens (97 aa); 64.3%
                     identity in 98 aa overlap"
                     /product="probable immunity protein"
                     /protein_id="BAB79948.1"
                     /transl_table=11
                     /translation="MENGELMNKSKDLVHSLYNSLSKSKENNFDDIKEVLLKVYTKLD
                     LCDEKNIPLINRLVNYIYFTAYTKKLTFSSNEENIIRELSEIGKYAGLNGVYRSNYGD
                     KSQF"
     CDS             315473..315721
                     /codon_start=1
                     /gene="CPE0243"
                     /note="82 aa, no significant homology. Putative
                     N-terminal signal sequence and 1 putative transmembrane
                     region were found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79949.1"
                     /transl_table=11
                     /translation="MEGKIKKSKAPIILGVISCIAWLIPLIGIIISIVGIVMSSKKIK
                     EFSCKAYKIALALNIIGLVLTIINSVAGMIMFYNQLMI"
     CDS             315728..316504
                     /codon_start=1
                     /gene="CPE0244"
                     /note="258 aa, similar to C-terminal of pir:S76167
                     hypothetical protein from Synechocystis sp. (strain PCC
                     6803) (529 aa); 34.3% identity in 67 aa overlap. Putative
                     N-terminal signal sequence and 7 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79950.1"
                     /transl_table=11
                     /translation="MYMKKFFKTVGVCLGFPILNFLIVSFIQVFFLGYTKNNISLFQK
                     NIFSLTILGDILTLVLITIILLPSNERLLRRIKIKKINLKEYFYIIALSIGVSILLLF
                     LSGILSKIIPSYGDVVNQLNVASKSSLQLVIAIILIPIYEEIVFRGIIFGYLRKNFNI
                     IVAVLVQALIFGIMHLNLVQGIYTFILGIVLALIYMYSDSILGNITVHIIFNLLGALI
                     VPMLLSKFPIMVIVLLILGIVLFIFSVIKIIGKYEKSLYK"
     CDS             complement(316595..318922)
                     /codon_start=1
                     /gene="CPE0245"
                     /note="775 aa, similar to C-terminal half of
                     gp:BCE243712_8 YkoW protein from Bacillus cereus (892
                     aa); 32.5% identity in 425 aa overlap. Putative
                     N-terminal signal sequence and 7 putative transmembrane
                     regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79951.1"
                     /transl_table=11
                     /translation="MTHRPMLNKIKLFFIVQIILSFLVLVGTLVTILVIPSHLPDYFI
                     WAIAFSFWVFQCGFSTIFAFRYRISKSSLSTIKLSFILIGSIQILITLATNLFGIFNL
                     PIFNVLLIKNFQFLILSLIFIVMIYKLIKDMLKYSVLKDYIIRDSFFTFIPFAFIIYK
                     NSKYFISSIYFLDDSVYSLALLNINSLRIFLEGFLIILIFVKTIYLRGNKKSSFLLLI
                     YFYVSNLNCYIVSYFNSKLLFSHYLYQGIGIYFICPILLMLSIYYSITEQDKAPDQVL
                     FDDSYMNINNSWISITIGIFPVSFSAIDIIASSIASGDFNGIESLVIILLVMILLVCR
                     DVILRKDNLRLIESVKRANEIDFLTNMYSRNYFLKKLETINTDYALFFIDIKSFKDIN
                     NIFGHVVGDKVLVEVANKFKELKLLLGKTVFYCRYSGNEFALISKLDQVDLILKFFRD
                     LENIKIQHNSDLIHINFNIGYSLNDSNINLDLLIQETDYALMRAKKLKGPNNSILMYD
                     DNLKTDLEHMNILKKDFKNDLLTGKFHLVFQPKVCVKTLKIVGFETLLRWKHDKLGEI
                     SPCKFVPIAENLGEISSLDLYVFKKSCEFQRCLIDKRIKLKCSVNLSLNTLKSYEKIN
                     EILNIYKEYRIPKHLITAEILENVSLNNNAKTISYINLLRENGICISIDDFGTGYSSL
                     SQISNLYFDELKIPREFVINARTPSKLAVIEAISILAKKLNVTSVIEGVETYEDFKLF
                     SNLGFDIVQGYYFSKPLTKSEIIDYIKVNINNKIS"
     CDS             319177..320445
                     /codon_start=1
                     /gene="CPE0246"
                     /note="422 aa, partially similar to sp:Y798_METJA
                     HYPOTHETICAL PROTEIN MJ0798 from Methanococcus jannaschii
                     (334 aa); 29.1% identity in 134 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79952.1"
                     /transl_table=11
                     /translation="MIDYFKELNIQIDASDNEVKKAYFNMTKKYPPEKFPKEYRVIRD
                     AYETLIDKSKRDSYILETFDIEIKNILNEGIDLAKSEKYDLAVLNFEKVLKKYPDNSK
                     VKKDLAVCLMRGRNYKKSSKILKELVIREPNNIEYYKLLINIYGDNYDLKNLEGVLKK
                     SLNLKNVEVDFYLKLFEIYNESELRDYTKAIKVLKDGLENKNINSKKYKLYLKFLDLS
                     DRLDCKDDFNKGCEALSGIILKDNYEEVKSSILNLLDRILKEFHFKNGVRLTSTALVL
                     IDEKEDMETLEKIINLRRSFLELSRLYEDKSINEDFKKIVFYNAVSKFLKDDIEFNKD
                     FERINQNFFNNLNFESDELVKSIGKLKNDYRNVYLETRKLSDKVLGRYSKVQKIKEEK
                     NVPKEFYSNRREGNPVKILFRKVINSFRDK"
     CDS             320463..321065
                     /codon_start=1
                     /gene="grpE"
                     /note="200 aa, similar to sp:GRPE_FRATU GRPE PROTEIN
                     (HSP-70 COFACTOR) from Francisella tularensis (195 aa);
                     35.2% identity in 105 aa overlap"
                     /note="CPE0247"
                     /product="GrpE protein"
                     /protein_id="BAB79953.1"
                     /transl_table=11
                     /translation="MNYEEALKDICEEKKYIDLFEEDRGLKEIKNSIKKIVIQNENMN
                     QGYIEEVYKIASSLEGITTYISKKSEEEELRSKRINKELEVREKRLVKSIISILDNIK
                     YIYDFSQKSSNEVLNEAMNNLLNTVKRAMVNVDILLIDGKETFFDESLHECVSTIWND
                     ERKDYEINEVLKFGYIYKGKVERTAQVVVVKNKEDMKWEE"
     CDS             321053..322780
                     /codon_start=1
                     /gene="dnaK"
                     /note="575 aa, similar to pir:C72385 dnaK-type molecular
                     chaperone dnaK from Thermotoga maritima (strain MSB8)
                     (596 aa); 43.3% identity in 563 aa overlap"
                     /note="CPE0248"
                     /product="DnaK protein"
                     /protein_id="BAB79954.1"
                     /transl_table=11
                     /translation="MGRIIGIDLGTTTSEIAYVKDGKPCIIRNIEEGDEHAIPSVVSI
                     EGDEIKVGKKAKNQILLKPELTVAEVKRVMGTENIIQIQGKEYRPEEISALILKKLKE
                     VAEYFLGEEVEEAVITVPANFNDIQRKATKNAGEIAGFKVERIINEPTAAAMAYGVDN
                     LDKNGNIIVYDFGGGTFDVTILEMFNGVLDVKVSRGNNYLGGKDIDNKLIDHVVNEFN
                     KSTGVKLDTSDSRILARLKEGVEEAKKTLSTSKMAEIVLPYISADKDNNPINLEMVLT
                     REEFEFNVKEIIDSTEDIVNEALEDANITDNEIDTVLLVGGSSRIPYVRNMLEKRFKG
                     KIARGVNPDEAVALGASVQAAIKNDIPVGDSGTIIVTDTCNYTLGVALKGGIFDPIID
                     RDSKLPANVTKRYCTVMDNQTEVLVSVYEGESRYVSDNTLIDEFILSGIPKADTGKEK
                     IDITFTYDLNGILNVSAEILSTGDEISKIMSTKGLSKEEIHDLKEVVSSNENNNELVP
                     WKSANLFKLVEPNFRLAERKIPMLPSADREKLQEIMSDMKDAIVDNDKMALMKLDEEL
                     TDFLFDFVN"
     CDS             322798..323532
                     /codon_start=1
                     /gene="CPE0249"
                     /note="244 aa, partially similar to prf:2123314A   SPR3
                     gene from Saccharomyces cerevisiae (512 aa); 26.7%
                     identity in 161 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79955.1"
                     /transl_table=11
                     /translation="MKNSKEALEGAYNNALDLILNKKLKEGEKLLEKIYGSGNINIDI
                     LNLLGIIKYMYCDFYGAKKYWNESLKVSCEDNQASEFIEDIESDDFKIISEKYRDSLN
                     LIEDKNYLQAIETLEEIDKGRGELIEVKIILALLYMIIDKKNNAFKNIESALSYDISN
                     YKIKEIYNEIKCDLAKDEEKEESEELTFSESILNLIMILNYRINSFYEEELKYRNEEI
                     KSLYEEIKTMNLEIESLNTEKEKLSL"
     CDS             323804..324577
                     /codon_start=1
                     /gene="CPE0250"
                     /note="257 aa, similar to prf:2315479F   epsC gene from
                     Lactococcus lactis (254 aa); 37.4% identity in 235 aa
                     overlap"
                     /note="EpsC"
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="BAB79956.1"
                     /transl_table=11
                     /translation="MIDIHSHIIPNIDDGSKSLEMSLEMLKRAEESGTKKIIATPHFF
                     KGYWTENYNSVKDKVKELNKLAKENNLNIEIYPGQEVFFNNYILEDFKLGDIGTLGES
                     RYMLIEFPMDKIYFQKAIDEIYELKIKGITPVIAHPERYVDFINNPEEINQFIDEGYL
                     FQLNGGSLTGLFGKEVKKTAELFLENNLYSFIGSDAHSNGNRNTSLKEACEVANSISR
                     GASRRFEANGLALLNNEKIVFQGQKIKKKKKGLFSFFKR"
     CDS             324892..326214
                     /codon_start=1
                     /gene="CPE0251"
                     /note="440 aa, similar to pir:H82985 hypothetical protein
                     from Pseudomonas aeruginosa (423 aa); 26.6% identity in
                     331 aa overlap. Putative N-terminal signal sequence was
                     found by PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79957.1"
                     /transl_table=11
                     /translation="MKNNKKISLSIVLASLITVSLVSCGSSSVKQDSTASKTKVEEKA
                     DGKVQYGLEELNWDSDNYKALVNIIKEYGKDSKNYDENQKPYAVFDWDNTTIMNDVEE
                     ALLAYQLMNLEFKMTPEELDTVMKTNIPKDNFVEKCNNKEGKPVNIDLITEDIVSDYT
                     YLYENYKGFKGNKSLDEIKKEKEYEDFKAKLRYLYSAIGESFSSDVSYPWVTYLFKGM
                     TSEEVAKLTEKSNDYWLNEKLGVETWTSSEEIPGKAGIVSVTFDTGLRTIKEQQNLYK
                     TLMKNGIDVYICSASYIDVVREFATNPKYGYELPSKNIYAMELLKTDDGKIKAELNPE
                     YYQTQGKGKTETIKKFLVPTHNKGPVITGGDSNGDYYMLSDFEDTKVSLIINRCKGGK
                     IGELCDKAIETMGKSDERYFLQGRNNNTGEFIPSEKTILLGEDTEKLK"
     CDS             complement(326287..326733)
                     /codon_start=1
                     /gene="CPE0252"
                     /note="148 aa, similar to N-terminal of sp:DIVB_BACSU
                     DIVISION INITIATION PROTEIN (CELL DIVISION AND
                     SPORULATION PROTEIN) from Bacillus subtilis (263 aa);
                     25.2% identity in 115 aa overlap. Putative N-terminal
                     signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79958.1"
                     /transl_table=11
                     /translation="MIFLCIFLILLGVCAVAFVLYQCNIKITEYKRQILTLNNQLSKY
                     KDTTYKKSNNDSKKTLIINFNKPEFRYGITLPYTSIFIAPSEESIAISKIKEKSQVKI
                     IDEAEINNEIWYYSLLNTESKINCNGWIKKSQFSMLMEDTNNIIGE"
     CDS             326853..327056
                     /codon_start=1
                     /gene="CPE0253"
                     /note="67 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79959.1"
                     /transl_table=11
                     /translation="MLGGIIMANLNELELQNLRHLIGAHCTIEKKLECYSEQCTDPTL
                     KNMLKKDAQDAKNSKEKLMSFLG"
     CDS             327069..327317
                     /codon_start=1
                     /gene="CPE0254"
                     /note="82 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79960.1"
                     /transl_table=11
                     /translation="MQEKEMISDYLAGINASLAGYGGIISQCENQELRETIQNMRNQD
                     EVRQYALFKIAKEKGYYIPAQQATPEEVATVKQQVSQG"
     CDS             complement(327402..327716)
                     /codon_start=1
                     /gene="CPE0255"
                     /note="104 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79961.1"
                     /transl_table=11
                     /translation="MFIQKILSYKKIFKINMLFLILCLAINIILFKNLPNKIALQIVE
                     SGELGNYIPKLFFIFFTPIVISLITFYNYMKTELRVSRSIVPVIVLFILNIIILITNL
                     FA"
     CDS             complement(327853..328587)
                     /codon_start=1
                     /gene="CPE0256"
                     /note="244 aa, similar to gp:STALACR_1 Staphylococcus
                     aureus lac repressor (lacR) gene from Staphylococcus
                     aureus (243 aa); 46.9% identity in 239 aa overlap. 1
                     putative transmembrane region was found by PSORT"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB79962.1"
                     /transl_table=11
                     /translation="MDDKINKLKEIIKNSNNIVFFGGAGVSTESGIPDFRSANGLFNE
                     KLNITFTPEQLVSHSFFERYPEEFFNFYKAKLIYPNSKPNDAHIALAKLEEMGKLKAI
                     VTQNIDGLHQMAGSKNVFELHGSVLRNYCVDCHTFYDEKFILESKGVPKCTKCGGIVK
                     PDVVLYEEPLDDNVIRGAIDAISKADTLIIGGTSLVVYPAAGLINYYFRGKNLVLINK
                     SSTQADSKADLVINDSIGKVLGKVID"
     CDS             328757..329080
                     /codon_start=1
                     /gene="CPE0257"
                     /note="107 aa, no significant homology. 2 putative
                     transmembrane regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79963.1"
                     /transl_table=11
                     /translation="MDKNTILEKSRNSRSDEGIEYAESKGRKIGFVIFSLIFLFIILF
                     NLFFSGGNNSVFYAASSMFWIFISTDAFEKFKFTRKKSHLVITIAGGVATIIWLANFI
                     IITLE"
     CDS             329114..329323
                     /codon_start=1
                     /gene="CPE0258"
                     /note="69 aa, similar to pir:H75270 transcription
                     regulator, PbsX family from Deinococcus radiodurans
                     (strain R1) (64 aa); 40% identity in 60 aa overlap"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB79964.1"
                     /transl_table=11
                     /translation="MKDELILKNKLKISRVEKGLSQQALADLVGVSRNTISSIETGQF
                     NPTAKLALILCIALDKKFEELFYFD"
     CDS             329698..330204
                     /codon_start=1
                     /gene="CPE0259"
                     /note="168 aa, similar to gp:AP001511_272 transcriptional
                     factor from Bacillus halodurans (201 aa); 22.5% identity
                     in 173 aa overlap"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB79965.1"
                     /transl_table=11
                     /translation="MFKINDYIMYGTVGVCQVIDITKETLMNNIEKEYYVLSPVYSKY
                     PKKTVIKIPVDNKKISMRTLLSKEDVNSIINSIPETETLWIDNDRQRNDEFKTILRSG
                     NCDDLIVLIRSIYLDKKKRKLDGKKACKGDDEIMQTAEKLINEEFAVILDIRPEEVKS
                     YIKSHIPQ"
     CDS             330592..331728
                     /codon_start=1
                     /gene="CPE0260"
                     /note="378 aa, similar to gpu:AP001516_112 BH2683 gene
                     product from Bacillus halodurans (379 aa); 39% identity
                     in 272 aa overlap. Putative N-terminal signal sequence
                     and 4 putative transmembrane regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79966.1"
                     /transl_table=11
                     /translation="MKELERLLGRLTIINIKEIIIILVIMIIVLIINKILINNLFKLL
                     MRGARRTKNYLDNNIVRALENPLKLIVSFVGIYSIFKVINLDSLGIDFLSTYKILRVG
                     IIVSIIYFAYNLTLENSLLYSKLHKNDGGNTIVFPFVSIIIRLIILLVGIIIIANEFG
                     LTGFIAGLGVSGVAFALAAQDTCSNLFGGMVIVLDRPFSIGDWIQAGDVEGVVEEITF
                     RSTRIRTFSMAIATVPNSKLANSNIINWTQRKLRRIHFKFTMDCKTPIESIKNSVNKI
                     ENMLKKHDKIDKNLIIVSFNELSTYGFGVFIYFYTDEFEYLKYEKLKEEINIKILEIL
                     REENVSLMFLNFDFKGFERRSGNCNLENTELESIKNITEEERGV"
     CDS             331725..332348
                     /codon_start=1
                     /gene="CPE0261"
                     /note="207 aa, similar to gpu:AE004159_7 copper
                     homeostasis protein from Vibrio cholerae (254 aa); 38.2%
                     identity in 199 aa overlap"
                     /product="probable copper homeostasis protein"
                     /protein_id="BAB79967.1"
                     /transl_table=11
                     /translation="MTIKLEACVENYKEGKRAEELGANRIELCDNLAQGGTTPSYGTI
                     LQCKKDINIDINVIIRPRGGNFVYSKEELNIMKNDIKLCKDIGVTGVVFGFLKEDNTL
                     DYETTKEFVELAKPLSVTFHMAFDEIENKVDALGKLIDLGVDRVLTKGGLDNAFKNKD
                     TLKELVEHAKDKIIILPGGGVTKDNFLELKDYTNAREFHGTKIVGNL"
     CDS             332724..332924
                     /codon_start=1
                     /gene="CPE0262"
                     /note="66 aa, no significant homology. 2 putative
                     transmembrane regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79968.1"
                     /transl_table=11
                     /translation="MILSDKECEYLAKSIAGGVLIGLALGAIFNNPQFGFALGGVTGI
                     VASLIYTLVKRAKIKSDKKLIN"
     CDS             complement(333045..334364)
                     /codon_start=1
                     /gene="CPE0263"
                     /note="439 aa, no significant homology. Putative
                     N-terminal signal sequence and 9 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79969.1"
                     /transl_table=11
                     /translation="MLLLKRLPQEYLIHLILYISFIIFAFFLESPKEILNGLYNIISN
                     SDILITDYISIGGFGATVINSALLGLIFILLFYITDTKSTGKSIMSLWFLTGFGMFGK
                     NIINIWPIVLGTFIYSKVKKKPFKDYLVIASLGTALAPTVSQFSFFPGVHPISGAIMG
                     ALVGIIVGFILPPIAKNASKIHSGFSLYNVGFAGGIIAIAVMSLMRAVGHDFETNSIW
                     HKGNNILYMLFLFTISAYFIICSLILDKSKKSVLKDQIGINKEHGIFPSDFFSIYGSS
                     CYFNMGVLCIFSTLFVLLINGDLNGPTIGAIFSMAGFGCYGKNLANSVPLIIGASLAS
                     LISISDINSPVTVVCILFSTGLAPISSYYGWPYGIIAGFLHIFMVFNIGELHGGLNLY
                     NNGLASGFVAAIIVPVIESLQVTNTKNNLKDSSKRHPISLGIKKEAD"
     CDS             complement(334577..334873)
                     /codon_start=1
                     /gene="CPE0264"
                     /note="98 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79970.1"
                     /transl_table=11
                     /translation="MKNYKDNDENFKLVPMNMKCNQEYSFMPMNKFNSNSMNLNPMIN
                     KNSNHSCCCMHNYVMKPSPYNNNYYENQMFPQNHTDNMMVKTLITVKKKSDLFD"
     CDS             complement(335081..335758)
                     /codon_start=1
                     /gene="CPE0265"
                     /note="225 aa, similar to gpu:AP001520_74 uracil-DNA
                     glycosylase from Bacillus halodurans (224 aa); 66.8%
                     identity in 220 aa overlap"
                     /product="uracil-DNA glycosylase"
                     /protein_id="BAB79971.1"
                     /transl_table=11
                     /translation="MAAEFNNDWDDLLKDEFKKEYYLNLRKFLINEYKTQKIHPSMYD
                     IFNALKFTPYKDVKVVILGQDPYHGPNQAHGFSFSVKPGVQTPPSLRNMFKELNSDLG
                     CYIPNNGFLESWAKQGILLLNTVLTVREGQANSHKGKGWEIFTDRVIELLNKREEPIV
                     FILWGRNAISKEALITNPIHKIIKSVHPSPLSATRGFFGSKPFSKTNDFLVSINKEPI
                     DWQIPNI"
     CDS             336095..338632
                     /codon_start=1
                     /gene="CPE0266"
                     /note="845 aa, similar to sp:YBBD_BACSU HYPOTHETICAL 70.6
                     KDA LIPOPROTEIN IN FEUA-SIGW INTERGENIC REGION PRECURSOR
                     (ORF1) from Bacillus subtilis (642 aa); 46.4% identity in
                     619 aa overlap. Also similar to gp:AP001509_113
                     beta-hexosamidase A precursor from Bacillus halodurans.
                     Putative N-terminal signal sequence and 1 putative
                     transmembrane region were found by PSORT"
                     /product="probable beta-hexosamidase A"
                     /protein_id="BAB79972.1"
                     /transl_table=11
                     /translation="MLLKKLAAILTVASIGATIFTSNKEVMATDSYSKAKEIVSNMTL
                     EEKLGQMIMPDFRMWQEEGAKEPSDLTEINSEVAEVIDKYDLGGVILFAENVKEISQT
                     TTLIHDLQEIAINDEDGNLPLLITLDQEGGIVTRLGEGTNLPGNMALGATRSEKSSYD
                     AGYVIGKELNALGVNVDFAPVLDTNNNPENPVIGVRSISSNPELVGKLGKNIANGIQD
                     QGVAATAKHFPGHGDTSTDSHYGLPMVDKSIEELRETELKPFKIAIENGIDMIMTAHI
                     QFPQIEKDTFISKKDGSQISIPATLSDDIIKGILREEMEYDGVVITDAMNMKAISDHF
                     GELESTKMAINAGIDIILMPTILRNNEDVKKLDYVVNGILDSIKSGEIKEEEITDSAE
                     RIVKLKIDRGIIDLKNNTASLEEKIKKAKKTVGSVENRNIERRISEEAITITKNEDNI
                     LPLNPKEGEKVLLIAPNESQIHSMKFGINRLIHENSLNNIKLNTYEYNNIGIIDDVLK
                     EKIESSDYIIVASLSSNANHLKPGAWNRDLPRSVIDYGNKLNKDTVLISLRNPYDLAA
                     YDNAKAQVVAYGFKGMDPTEGDTLFPTKSSGPNIPASMGVVFGAVEPKGKLPVDIPSL
                     NNDGTMNTEVNYYDYGHGITNINSLGNVNISMNKKINLGDNFQVKFNLSDFNEIVAGK
                     YRAKIKFQGEKLEFINGKVEFSGDLQTNIIDNNTLEVLINLEEGSLKANEVNFILEFK
                     AIDKAELTSIEITSSELIDEKGRCFKQKYVISEFSIEDNKEDKPLSPDEDKEDEENNE
                     DLENSDDNNKDELPQTGSGVGKEFIFGLGSLSLLVGIGLKSKRFKRK"
     rRNA            339055..340561
                     /gene="rrnF-16S"
     tRNA            340725..340797
                     /gene="trnA-Ala"
     tRNA            340806..340879
                     /gene="trnA-Ile"
     rRNA            340982..343885
                     /gene="rrnF-23S"
     rRNA            344003..344116
                     /gene="rrnF-5S"
     tRNA            344132..344204
                     /gene="trnA-Phe"
     CDS             complement(344672..345139)
                     /codon_start=1
                     /gene="CPE0267"
                     /note="155 aa, similar to gpu:AP001510_123
                     bacterioferritin comigratory protein from Bacillus
                     halodurans (154 aa); 61.2% identity in 147 aa overlap"
                     /product="probable bacterioferritin comigratory protein"
                     /protein_id="BAB79973.1"
                     /transl_table=11
                     /translation="MSIEINKLAPDFKLMGSDGKEHSLSDYKGKNIVLYFYPKDNTAG
                     CTTEACDFRDNIQNFHDLNAIILGVSRDSLASHDKFITKLSLPFVLLSDPDETVCKLY
                     DVIKEKNMCGKKYMGVERSTFLINKEGILIEEFRKVRVKGHIEKVLDKLKEIN"
     CDS             345779..346525
                     /codon_start=1
                     /gene="CPE0268"
                     /note="248 aa, similar to gpu:AP001511_66 protein
                     secretion (post-translocation chaperonin) from Bacillus
                     halodurans (333 aa); 31.5% identity in 235 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79974.1"
                     /transl_table=11
                     /translation="MEKKVLATVGNTEITSDYIDEIIARYPAQQQAMLASDEGKRQVL
                     EQAIAFELMSEFAKETGLDKTEEFKDQLNKFAKELLAQMVMKKTLSSVTVTDDEAKAF
                     YEEHKENFVELETVTAKHILVASEEEAKKVEEEIASGSITFEDAANKYSSCPSKEQGG
                     NLGSFSKGMMVPEFEEAAFNLELGVVSAPVKTQFGYHLIKVEDKTEAKTKAFEDVKEQ
                     VVNMLIQERQQKKYLELIKELREKYGVKLA"
     CDS             346988..347800
                     /codon_start=1
                     /gene="CPE0269"
                     /note="270 aa, similar to gp:AF071085_12 putative ABC
                     transporter permease from Enterococcus faecalis (264 aa);
                     32.7% identity in 269 aa overlap. 6 putative
                     transmembrane regions were found by PSORT."
                     /note="permease"
                     /product="probable ABC transporter"
                     /protein_id="BAB79975.1"
                     /transl_table=11
                     /translation="MKDWLEIEKSIFSHWRMIFSISKKEFKKEFAGSKLGMAWAIIRP
                     LAMITVFWMIFSTGMRTTSSNVQVNYLVWLVSAYIPWIFISDVIMSGAGSIRVNSFLV
                     KKVKFPVEILPTIRIVISFYTFLILLVISFIIFAVNGNLNLINIPKLIYAIIITIIFL
                     AALSRLLSAWVVMSIDILHGISVFMQFLFWMCPVMWQAGELPVGSSMPWIEKILKLNP
                     LYYLAVLFRDAYLGTHTVSLAYGVYFWVVTIILFIFGSKVFKKFRPEFDDVL"
     CDS             347818..348990
                     /codon_start=1
                     /gene="CPE0270"
                     /note="390 aa, similar to gp:AB030032_11 putative ABC
                     transporter from Actinobacillus actinomycetemcomitans
                     (398 aa); 43.7% identity in 387 aa overlap"
                     /note="ATP-binding protein"
                     /product="probable ABC transporter"
                     /protein_id="BAB79976.1"
                     /transl_table=11
                     /translation="MSVAIRVKDLTKKYKLYQKRSERLANAFGKEKNIKEFYALKGVS
                     FEISKGECVGIIGHNGAGKSTLLKLLTGVAFPTSGEIEINGRLASMLELGSGFNPELT
                     GMENIYFNGSLNGLTKEEIDGKLKDILEFADIGNFIEQPVKNYSSGMFARLAFAVAIN
                     VDPDILIVDEILSVGDVGFQVKCMEKFNEFKKKGKTILYVSHGLGTVKKFCDRAIWLQ
                     KGEVVDDGNSVIVVERYYNLNFNPANIEQLKDHKSDIINSIAVKSNTKNVEYLEKLDL
                     EVEYDLISNDLKDPNIVLEFRKTDYEPGTTRGNDQFVCGINSKDNIKNIPFNLGVNKL
                     KVSLNKVNLVAGVYYIDFVLRDGEEEVYRKINGYSFTLNDKYRGEGFLILGHSWGN"
     CDS             349004..350287
                     /codon_start=1
                     /gene="CPE0271"
                     /note="427 aa, similar to pir:C75592 conserved
                     hypothetical protein from Deinococcus radiodurans (strain
                     R1) (415 aa); 27.1% identity in 251 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79977.1"
                     /transl_table=11
                     /translation="MSVGRIARRTTEVLKEDGLIEVIKRVLRYIKRRIKDKLDNNALT
                     YRKNYEEANAIFHKILKKEKFKAVVVFDSRVGWNIPLFQRSQHMANELTDDGYLYFYR
                     TSEQFDPHVKTVEKLKDRLYLVNMANFALQNAMFDLLKEYKGHKFLSLYSTDVYLDEQ
                     YIKEKYIDNGFKIIYEYIDELSDEISGHLPDFVYDRHKNIIEDKSNIAVGSADKLIEE
                     IEEIRGKENVAMITNGVQYDHWQYRSDEVPEKLKDIVSKGNPIIGYFGALAKWFDYEL
                     LKKVAKERPNYEIVLIGFLYDNSFKDSKIDELENVHYLGIVDYKELNQYSQYFTISTI
                     PFLLNDITESTSPVKLFEYMAMGHPIVTTDMRECRKYKSVLIGKSHEDFIEKLDFALT
                     LDKKDEYYNYLKEEALANTWREKAAILDRLIEKNI"
     CDS             350306..351541
                     /codon_start=1
                     /gene="CPE0272"
                     /note="411 aa, similar to prf:2318308D   cps19bP gene
                     from Streptococcus pneumoniae (360 aa); 30.5% identity in
                     256 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79978.1"
                     /transl_table=11
                     /translation="MSLKRSLKNLLRPILKPMLLKYREKGHEDQKQVFFDEITGAIKN
                     GNYDAIVIFDVYFGFEVKMFQRPQHIALNLAKENVLYFYKASPYVDKDIKTYKKMEEN
                     LYLVNTDLYWLQECLIDIVSQSGVPAFGQIYSTSFVEYDSWLKKFTDRNFKIIYEYVD
                     DLSDDIAGFKISDEIKASHKRMLEDTEKVYVVTTADKLYQEAKELRGENKLALVTNGV
                     QYEHFANIDCKKIPDKMKNIVNSKKKIIGYFGALASWFDYDLIKELAEEFKDDYEIVL
                     IGIDYDQSLGKSGILKLDNVHYLGTVNYNELPTYSKFFNVSIIPFVVNEITEATSPVK
                     LFEYMALGKPIVTTALPECRKYESPLVSDSHEDFINNIKKAAELENSKEYIELLRKEG
                     NQNTWRQKAKDIKELILNS"
     CDS             351555..352736
                     /codon_start=1
                     /gene="CPE0273"
                     /note="393 aa, similar to gp:AB030032_11 putative ABC
                     transporter from Actinobacillus actinomycetemcomitans
                     (398 aa); 40.1% identity in 389 aa overlap"
                     /note="ATP-binding protein"
                     /product="probable ABC transporter"
                     /protein_id="BAB79979.1"
                     /transl_table=11
                     /translation="MEKAIEVKNLCKNYRVYDSKSSRIRNIINPFAKKEVKEFKALTD
                     VSFHVNKGEIVGIIGNNGAGKSTLLKILTGVSFPSSGEVNVNGRVSSLLELGTGFNPE
                     LTGEENIYFNGSLMGLTQDEIDKVKDNIIEFADIGEFINQPVKSYSSGMYARLAFAVA
                     ININPDILIVDEILSVGDVGFQKKCMDKFNEFKEAGKTVLYVSHGLETVQTFCERAIW
                     LEKGRVVDIGPSFDIVEKYYDKLMKSDDKEELETGKFVELINVEILDDKKVYKKGESI
                     EFLVEYEVFNPSVKNAGITIEMRKAYREPCEYRNADQFIFSVNSNVDEFTIPWKKGRN
                     KITFKIDSLDVKEGIYYLDAIFSESQNLVALETQEDVVSFEVKNEGESEGFVFLDSTW
                     T"
     CDS             352851..354284
                     /codon_start=1
                     /gene="CPE0274"
                     /note="477 aa, similar to prf:2318308D   cps19bP gene
                     from Streptococcus pneumoniae (360 aa); 26.6% identity in
                     361 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79980.1"
                     /transl_table=11
                     /translation="MSNIFEVMLKKNIGDFTYEEKRELNNWLIENLKLKELIYSGLEL
                     TKVINEDGEETAYYENKITEEDILSGNFNELCSKTSKYIDDAISSILFEGQFNCFYEK
                     IKSILELEDFDEIIVFHASFGWNIEMKQRPQHLAEALSKKKVLYIYRSDVKNDNIYSI
                     KKIKDNLYVLNLDMYSLNVAFFEAIKSINKPKFAHVYATCLNSVDYEKIKTYMDKGFK
                     VIYDFVDELSSEISGYNITSKMIEDHEKLLRDKENVLVVSTAKKLKDIANKFRGENEN
                     NILSPNAVNLEDFKNHGNEIGEKIQPIVNKRKPIIGYYGALAKWFDYKLIEQLAKERE
                     DYEIVLIGMDYDGSYDQSNLKNYSNISYLGMIDYKYLINYSRYFDVCIVPFIKNDITD
                     STSPLKIFEYMALEKPIVTTDINECKNYESCLVSKDYDEFIKNIDKALKLEVDNKEYF
                     NILRREAEENTWDNRAELIKEAIKNLE"
     CDS             complement(354420..355073)
                     /codon_start=1
                     /gene="CPE0275"
                     /note="217 aa, similar to gp:AE003576_10 Gs1l gene
                     product from Drosophila melanogaster (231 aa); 29.2%
                     identity in 209 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB79981.1"
                     /transl_table=11
                     /translation="MLSNIKGVIFDLDGTLVDSMGVWAKIDSDYLTDLGLEVPKNLKE
                     EITHLGFKEVAKYFKKRFNIASSEEEIMKTWHDMAYVEYKNNIKLKSGAREFLEQLKE
                     SNIKIGLATSNSYPLLEVCLKSNDIFHLFDSITITGEVPRGKDFPDVYLLAAERLGLE
                     PKECAVFEDILPAVKGALSAGMKVFAVEEHTVSEEEKSQIKEIVHEYIDSFNDLLVN"
     CDS             complement(355156..356505)
                     /codon_start=1
                     /gene="CPE0276"
                     /note="449 aa, partially similar to pir:G72256
                     hydrogenase (EC 1.18.99.1) (Fe) large chain from
                     Thermotoga maritima (strain MSB8) (645 aa); 31.3%
                     identity in 240 aa overlap"
                     /product="probable hydrogenase"
                     /protein_id="BAB79982.1"
                     /transl_table=11
                     /translation="MNKKYNSLFKELISSYYSEDNFDEKLNDIVKNNFNSKEDAIEVL
                     SSLCGVDIDKNSDNIAYDIRKAITTHKIKKNIVDKVSVCTKNCSKESKGKCQSLCPFD
                     AILTDPIDNSKYIDPNLCQNCGICVQVCESGHFLDRIELLPIIDLIKNNETVIAAVAP
                     AIAGQFGENVSLDMLREAFIKIGFSDMIEVAFAADMLSIKEAVEFNHHVEKTGDILIT
                     SCCCPMWVAMLRKCYKDLVKDVSPSVSPMIAAGRVIKKLNKDAKVVFIGPCIAKKAEA
                     REKDLVGAIDYVLTFEELNGIFEALKIDPSSMKGVPSIEYTSRGGRLYARTGGVSEAI
                     NDVVKELYPDKAKIFKAVQANGVKECKELLNKVQSGELKANFIEGMGCVGGCVGGPKR
                     IVDPSIGKKHVDEVAYNSPIKVATHSHTMDEVLLRLGINSLKSFEDKEKISIFEREF"
     tRNA            complement(356964..357036)
                     /gene="trnA-Pro"
     CDS             357202..357492
                     /codon_start=1
                     /gene="CPE0277"
                     /note="96 aa, no significant homology. Putative
                     N-terminal signal sequence and 2 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB79983.1"
                     /transl_table=11
                     /translation="MKISSIVMLAASFLLIVVGIVLFANKKRFEGENQAGKYSAKYIQ
                     SNAIGNIFIGFLGTILGVLDNFVNGNSIKIAFVVIIIGGSIVQKLIGNKISK"
     CDS             357677..358975
                     /codon_start=1
                     /gene="CPE0278"
                     /note="432 aa, similar to gp:LMO250194_1 P45 from
                     Listeria monocytogenes (401 aa); 26% identity in 388 aa
                     overlap. Putative N-terminal signal sequence was found by
                     PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79984.1"
                     /transl_table=11
                     /translation="MKKKIISTVLAATMTFGVGHSVFATPLTDDQKQQMEQSQDKYAD
                     INSKIRELEDKIDGLSAKIEPLFFQVEKNKEEISKTEESISTVKVQIEESKKKIEKQQ
                     EVLGQRIRATYKSGGQANYLTALLDSNGIGDFLSRVQAISKVMGMDKQVIDELTSEKE
                     KLDSQVKELEDKTAELNKLNSETQSKIDELNKMKAEQEGAIKDMKAEQEKVVGELAPL
                     ERQLIEPWTSKINSNSSVNDLNQAVTALRGLRNQIKTPEVDAEAVQAIEKAKDLIETK
                     KAEEAVSSAPNRGGDVNSGGSSSSTSNGSSSSNSGSTVAPPSEGAASAVVSYAYQFIG
                     RPYVFGATGPDSFDCSGFTSYVYRNAVGREITRTTYTQINQGRPVSRDQLQPGDLVFT
                     NGVGHVGIYVGGGNMIHAARPGVGVIVGPIYNFSSARRIL"
     CDS             359149..359919
                     /codon_start=1
                     /gene="CPE0279"
                     /note="256 aa, similar to sp:YABB_BACSU HYPOTHETICAL 28.3
                     KDA PROTEIN IN XPAC-ABRB INTERGENIC REGION from Bacillus
                     subtilis (247 aa); 43.3% identity in 240 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79985.1"
                     /transl_table=11
                     /translation="MNKTLKELDLTLVNENETLDDLQLDGLHLIQKKEGFRFGVDAVL
                     LANFANVNRKHSVLDLCTGTGIIPFIIYGKKNPKEVVGIEIQEEFAEMANRSAKINNI
                     EDKVSFVCGDLKDKELSKSMPKFDVVTVNPPYKLNNAGIVNPEDKLAIARHEIMCNLE
                     DVIAASRRFLKDNGRLYMVHRPERLADIFCLMRKYKIEPKRVRMIHPNTKKAANIVLV
                     EGQRDGGAFLKWEAPLYVYKDEGGYSEEIDKIYGRESK"
     CDS             359922..360764
                     /codon_start=1
                     /gene="CPE0280"
                     /note="280 aa, similar to gpu:AP001507_49 BH0049 gene
                     product from Bacillus halodurans (289 aa); 52.4% identity
                     in 271 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79986.1"
                     /transl_table=11
                     /translation="MSKVYLVPTPIGNLGDITLRALEVLKSVDLIAAEDTRQTLKLLN
                     HFEIKKPLISYHKHNEQGKGEEILRRVKEGTSVAIVSDAGTPGISDPGSVVVEKCIEE
                     GIEFEVLPGATAFTTALIYSGLDTTKFMFKGFFPRENKDKRSFIEDIKDRTETIIIYE
                     SPYRILDTIDTLKEGLGNRKVAICRELTKLHEEIFRGTLEEAKIHFEENAPKGEFVCV
                     ISGKTDKEIEEENTSKWISMSIEEHIIHYIDNEGMKKKDAIKQVAKDRGVAKSEIYKF
                     SLDI"
     CDS             complement(361080..361319)
                     /codon_start=1
                     /gene="CPE0281"
                     /note="79 aa, similar to gpu:AP001507_50 transcriptional
                     pleiotropic regulator of transition state genes from
                     Bacillus halodurans (96 aa); 76.7% identity in 60 aa
                     overlap"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB79987.1"
                     /transl_table=11
                     /translation="MKSTGVVRRVDELGRIVIPIELRRTLDIAEKDALEIYVDGEQII
                     LKKYEPACIFCGDARDVVNYKGKNICQKCLDELKK"
     CDS             362011..362610
                     /codon_start=1
                     /gene="CPE0282"
                     /note="199 aa, no significant homology. 1 putative
                     transmembrane region was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79988.1"
                     /transl_table=11
                     /translation="MDINNFNSEQIKVLAEEMSKNSMVSYDDLPKYDLFLSQVIDYLN
                     DKFTEDKFTNNIVQNYIKSEVISKPEDGKKRGYTKVHLAQLVLLSYMRPLLKTDEIKK
                     VFALAFNDINDRSDDIISWETAYKMFGEVQEESIKRFLEVPLVDNDKIEEIIQVSDIK
                     EEDRDCIVTFLTVMTLIAQASVVKKVVQKIVNGYHKEEK"
     CDS             complement(362646..363521)
                     /codon_start=1
                     /gene="CPE0283"
                     /note="291 aa, similar to sp:LAXC_LACLA LACX PROTEIN,
                     CHROMOSOMAL from Lactococcus lactis (299 aa); 33%
                     identity in 288 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79989.1"
                     /transl_table=11
                     /translation="MIYTLENQHLKISLSNHGGELHSIKGKKDNTEFLWSGDEAYWKY
                     HAPILFPIVGKVFNGKYTVDGITYELPQHGLARVRDFEMIEQTKNSISFELKYSEDTL
                     KVYPFKFSLIIKYTLNDINLSIDYIVKNLDNKEMYFSIGAHPAFMCPIENDKFDDYYF
                     EFNKKENASIMQLVGPGYFSKEEKPYLKDEHIINLSTDLFKNDALVFKNLKSNKISLK
                     SKNHKKYLEFDFGEFPYLGLWTKDTGAPFVCIEPWFGHADFDGFNGEFKDKAAIQSLM
                     PNKEFHCNYNISFFE"
     CDS             complement(363632..364654)
                     /codon_start=1
                     /gene="CPE0284"
                     /note="340 aa, similar to gp:EFA276231_1 PSR protein from
                     Enterococcus faecalis (390 aa); 29.3% identity in 324 aa
                     overlap. 1 putative transmembrane region was found by
                     PSORT"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB79990.1"
                     /transl_table=11
                     /translation="MSQGKHAKKNDSNSQGNTPKKKSKVKIIVLTLFFLLLIGIGLGA
                     TYVYSTLNKMDIKKIAQDDKSLGIDESNKDLFQDGILNIALFGVDSREHDNVGRSDSI
                     IIATIDTKHDKIKLTSLMRDSYVEVDGHGKTKLTHAYAYGGPTLALKTINENFGLDIK
                     DYVTVNFDNLAEIIDDLGGVPINIKPYEVKEVNNYAKNVAEIAGREYEPVSEGEQVLN
                     GAQAVGYSRIRYVGDGDYERTERQRNVLDAIIKKLSALKPSEYPETIKKLLPYVETNL
                     TPSKILSIATSVASTGIPPVENMRFPLDGYCKGEMIDGVWYLTFDEAKTKEQIQDYIY
                     KDVNPK"
     CDS             364830..365681
                     /codon_start=1
                     /gene="CPE0285"
                     /note="283 aa, similar to prf:2516401CC   yfkH gene from
                     Bacillus cereus (289 aa); 39.4% identity in 249 aa
                     overlap. Putative N-terminal signal sequence and 4
                     putative transmembrane regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79991.1"
                     /transl_table=11
                     /translation="MKKKSKGFLRKTVIFLVMFIKKIGDDDIFALGAQLAYYMVLSFI
                     PFLMFLMTLVGFSHLNSDAVLNLLSNVMPTEAFNLIQSTVIEIVDREQTGLLWISIAL
                     AIWVSSSGFKAVIKGLNKAYGVKETRSYIKLKLISMIYTILLALIVIATLFLFVFGDV
                     IGDFFMKVLEHPEFIYYIWNMLRYVVVILIMILFFMFLYNATPCVRLGWLEVIPGAVI
                     TTLGWISISYIFAYYVNNFSNYSRLYGSLGAVFMFMTWMFITSMILILGGEINAVLAE
                     KNRLKDL"
     CDS             complement(365742..366728)
                     /codon_start=1
                     /gene="galE"
                     /note="328 aa, similar to gpu:AP001510_283 UDP-glucose
                     4-epimerase from Bacillus halodurans (334 aa); 63.5%
                     identity in 326 aa overlap"
                     /note="CPE0286"
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="BAB79992.1"
                     /transl_table=11
                     /translation="MAILVCGGAGYIGSHMVAELIENNKEVVILDNFEKGHEDAILGG
                     KLYKGDLRDRKILDKIFTENNIEAVIDFAAYSLVGESMTEPLKYFNNNVSGTISLLEA
                     MRDHNVKYIVFSSTAATYGEPENIPILETDKNLPTNAYGESKLLVEKILKWCDTAYGI
                     KYTALRYFNAAGAHVNGKIGEDHSPETHLIPLILQVALGKRDKIMMFGDDYDTKDGTC
                     VRDYIHVSDLASAHSLALERLMNGGESRIYNLGNGTGFTVKEVVEVARKVTGHPIPAE
                     VAPRRAGDPAILIASSDKAIEELNWKPKFNSLETIIETAWNWHKNHPNGYEK"
     CDS             366883..367227
                     /codon_start=1
                     /gene="CPE0287"
                     /note="114 aa, similar to gp:BA1242593_64 putative SSB
                     protein from Bacteriophage A118 (160 aa); 45% identity in
                     111 aa overlap"
                     /note="SSB"
                     /product="probable phage-related single-strand DNA
                     binding protein"
                     /protein_id="BAB79993.1"
                     /transl_table=11
                     /translation="MNKIVLLGRLVKDPELRYVEGGEKVYTKFTIAVARNFKSSTGER
                     KKDFIPIIMWEKKAEIACKYLKKGDLLSVSGRLITRSFEDTEGKRRYIVEVSVEDFKC
                     VNFNHDRVDNNF"
     CDS             complement(367303..368424)
                     /codon_start=1
                     /gene="CPE0288"
                     /note="373 aa, similar to gp:RCAFDXC_3 ORFU1 product,
                     potential FMN-protein from Rhodobacter capsulatus (435
                     aa); 42.6% identity in 387 aa overlap"
                     /product="probable flavoprotein"
                     /protein_id="BAB79994.1"
                     /transl_table=11
                     /translation="MYTPYGTTYNSYVVKGSEKTAIFETVKAEFFDQYIARLKDLGVE
                     PSEIDYIVVSHTEPDHAGSIGKILELAPNAKIVASPIAINYIKEIVNGDFESIPVKDG
                     DSISLGNKTLKFMSVPFLHWPDTIYTYVEEDKTLITCDSFGSHYSCEEMFDDLIPNEE
                     EYMEALKYYFDCIMGPFKPYVLKALDKIKGLDIEIICPGHGPILRSNPYKVVNLYKEW
                     STPAPAKEVKKASIFYVSAYGYTKQLAEKIAEGIKSTGNLDINLFNIIEHDMTELVGE
                     VGSSDAILFGSPTIVNELVEPVRDLMAKLNPVVHGGKIAGAFGSYGWSGEAVPRIESR
                     LKELRMKMPVEGLRIKFKPSEEEAQKAFDFGVEIGNALK"
     CDS             complement(369002..372418)
                     /codon_start=1
                     /gene="CPE0289"
                     /note="1138 aa, similar to gpu:AP001509_223
                     endo-beta-N-acetylglucosaminidase from Bacillus
                     halodurans (878 aa); 45% identity in 845 aa overlap.
                     Putative N-terminal signal sequence was found by PSORT"
                     /product="endo-beta-N-acetylglucosaminidase"
                     /protein_id="BAB79995.1"
                     /transl_table=11
                     /translation="MTNKQKMRKRRRALLCVFAAFAFSFNPLGKIAYATPKQDTSVVN
                     YVKTQEETSNSIQNQPISSYWYPEDLLKWSANNDKDAKFNKSTVPLAKRVEKDKLDTI
                     NDTQNKDVKVVAISIMNANTSGNPSQGSNKFSANTFSYWQYIDKLVYWGGSAGEGLIV
                     PPSPDVTDSAHRNGVPVLGTVFFPMTAHGGKMEWLNKFLEKDANGNFPIVDKLIEVAE
                     NYGFDGWFINQETEGTEQEPLTPEHAKLMQELIKQFKAKSNGKFEIMWYDSMTKDGDM
                     DWQNALTDKNEYFLLDGDKNKVADSIFLNFWWTYNSLKDKDLLRVSNEKAKEIGINPY
                     DLYAGIDVQANGYKTPLRWTHYQRDDQAPFTSLGLYCPSWTYFDAKTPEQFQENENRL
                     WVNEHGDPSKTTNAQGVDWRGISTYSVEKSAVTSLPFTTNFNIGNGYDFYVDGNKVST
                     QDWNNRSLNDIMPTYRWVISNEENNNVKADIDYTTAYYGGNSIKLSGYLAEGKASTIK
                     LYSSDLTLPEGVQFTTTAKANGNTVDMDLVLTFHDGTETTISADKKLGTDWTKLNYDV
                     SPYVGKSIKTISYKLSSPVCVDNFSANLGNITIEIPNSSSKVNISNAKLNDVDFKDGI
                     YAGARLSWSPEGNSSDVHHYEIYRVMNDGTKVLLGATPNTSYYVSDLRRNDKETNTNF
                     EVVAVNKNFNRGNSQSINMEWPAYPAPTASFKVSNTLIAPGQSVTFTNTSSEVTEEIQ
                     WKFPGAKVESSTEQNPTVTYEKEGVYPVILTAKNSSGENVETKTELITVTNAAKDGLV
                     NLSLNKSAKASSFVNENEAPQYALDGNVKTKWCAVGSAPHTLTIDLGDIKTIGELEIS
                     HAEAGGESSGMNTKAYSFEVSNDGENFTPVLNVDDNTKAISNDAFPVTKARYVRLNII
                     QPTQGADSAARIYEVAVKGLDGNVDLPPVMNPDDSNKPVDPDQPENPDKPNNPEKPEN
                     PDNPGNTDKPVNPDQPGDSEKPETPNKPGDTENPEGKPANPSDLVSKEITENSALLSW
                     KAPEKVESIQEYVVYQDGKEIGRVPTDKTPLEFLVKDLKPNTKYNFEVSSIDKDGKES
                     DKISLEVTTKKKDNGNLPNTGSPIGAGALATTGIALSSAGVYLTLKKKRK"
     CDS             372789..373094
                     /codon_start=1
                     /gene="CPE0290"
                     /note="101 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB79996.1"
                     /transl_table=11
                     /translation="MKIVKNLYKEINLEDKCYKFCYRLIESCFKGTTVYGIEVERKDF
                     KDSDLINIERDSVDKISPNKDKVEVLVEKLHKYEVSPIHLIDVIGEDVDNCVADFAF"
     CDS             373143..373544
                     /codon_start=1
                     /gene="acpS"
                     /note="133 aa, similar to gpu:AE004316_1
                     holo-(acyl-carrier-protein) synthase (EC 2.7.8.7) from
                     Vibrio cholerae (126 aa); 40.2% identity in 107 aa
                     overlap"
                     /note="CPE0291"
                     /product="holo-(acyl-carrier-protein) synthase"
                     /protein_id="BAB79997.1"
                     /transl_table=11
                     /translation="MIIGIGVDIIEIERVRQAIQNNKNFLSKLFTERELDYFISRNMN
                     SEVIAGNFAAKEAVSKALGTGIRGFSFKDIEILRNELGKPEVILHNGANLIGNKLVGN
                     NNSLRVHLSISHNNSSAIAYSVLEGEYYGNM"
     CDS             373531..375030
                     /codon_start=1
                     /gene="CPE0292"
                     /note="499 aa, similar to pir:C72317 conserved
                     hypothetical protein from Thermotoga maritima (strain
                     MSB8) (490 aa); 37.6% identity in 474 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB79998.1"
                     /transl_table=11
                     /translation="MEICSSNSIRNMDKDYIEKFNMPSIVLMENAIIKFLENIDLTKE
                     SFTIISGRGNNGGDALGIARHLLNKGKKVYVHILEKEKEGSVDYKTNLTILEKLGCYI
                     KGISNSKDLEILKNNIINSEILIDGILGTGLNKEISGIYFNTIKCINENSKFTVSIDV
                     PSGINSNDGSICGIAVKANETISFQVYKLGFLNYKSFEYLGNLKIVDIGIPKSIVYKN
                     SDNMRFTDREYIRNKFPYRNKYGHKGTYGRSLIFAGHKGFIGAAYMVGQAAIKTGAGL
                     VTVFTHKDVQSELSIKLNEGMTGTYNSKEEYEEFISGANVIAFGPGMGNNDLTFEVLN
                     NIFNLYSGTLVIDADGINVLERKKSILKEFKGDIVLTPHPGEMARLLGIEIKDVERDR
                     IGIAKDFAKQNGITVLLKGYNTIITDGDKVFVNPTGNSAMASGGMGDTLTGIITSLIS
                     QGVNSFDAAILGAYIHGYIGDELSKENFTVSAMEIIKNIPNKIKELISF"
     CDS             375091..375684
                     /codon_start=1
                     /gene="CPE0293"
                     /note="197 aa, no significant homology. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB79999.1"
                     /transl_table=11
                     /translation="MKSKRNAILIILLIIILGVIGGLAIYQRTYNLTPEDILEDMFSI
                     ESYETEIIYDVKNSRGQFQEKGRIYYDEEVGTKIVLDDREQLFEKDKIIINYVKDEKT
                     YEVGRDYDQFYRFMFINELKDLCNEEHEFTYKWNDENEKSEIILEFKNLNGNENFSRE
                     VMIIDAKKKVPKEATIYDRDDSESVSIKFNNFSKVKN"
     CDS             375931..376173
                     /codon_start=1
                     /gene="CPE0294"
                     /note="80 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80000.1"
                     /transl_table=11
                     /translation="MSVSKINKQDSKKEKKIENFSQLKGRNIITYSEDKKEDDFYEAM
                     KEGYKAMALINSQYAEEGTSVEYFDQIEYETWLCGV"
     CDS             376179..376532
                     /codon_start=1
                     /gene="CPE0295"
                     /note="117 aa, similar to gpu:AP001508_245 BH0522 gene
                     product from Bacillus halodurans (116 aa); 73.9% identity
                     in 111 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80001.1"
                     /transl_table=11
                     /translation="MASLNVKRGDIFYADLSPVVGSEQGGIRPVIIIQNDIGNRYSPT
                     VIVAAITSQINKAKLPTHVEISSEEYGLNRDSVVLLEQIRTLDKKRLKEKIGHMTEDD
                     MKKVNKSLLISLNLQ"
     CDS             376970..377794
                     /codon_start=1
                     /gene="tktN"
                     /note="274 aa, similar to sp:TKTN_METJA PUTATIVE
                     TRANSKETOLASE N-TERMINAL SECTION (EC 2.2.1.1) (TK) from
                     Methanococcus jannaschii (274 aa); 57.7% identity in 267
                     aa overlap"
                     /note="CPE0296"
                     /product="transketolase N-terminal section"
                     /protein_id="BAB80002.1"
                     /transl_table=11
                     /translation="MSNKIQELKSMSKVIRKDIVTMLTESASGHPGGSLSIADIVTIL
                     YFDEMNIDPKNPKDPNRDRFVLSKGHAAPVLYSALARRGYFDPAELTTLRKFGSNLQG
                     HPNMNDLPGIDMSTGSLGQGISAAVGMALAGKLDNKDYRVFTILGDGELEEGQVWEAA
                     MSAAHYRLDNLTAFVDFNGLQIDGDIKEVMSPCPIDKKFEAFGWNVIVINGHDYEEII
                     NAIQKAKSTKGAPTCIVCNTVKGKGVSFMENEAAWHGTAPTKEQCEQAIKEIGGDN"
     CDS             377794..378738
                     /codon_start=1
                     /gene="tktC"
                     /note="314 aa, similar to sp:TKTC_METJA PUTATIVE
                     TRANSKETOLASE C-TERMINAL SECTION (EC 2.2.1.1) (TK) from
                     Methanococcus jannaschii (316 aa); 51.2% identity in 303
                     aa overlap. 1 putative transmembrane region was found by
                     PSORT"
                     /note="CPE0297"
                     /product="transketolase C-terminal section"
                     /protein_id="BAB80003.1"
                     /transl_table=11
                     /translation="MAKKIATREAYGKALAALANENKNIVVLDADLSKSTKTADFKKA
                     CPERFINMGIAEGNMMSVAAGLSTCGKIPFASTFAMFAAGRAFEQIRNSICYPRLNVK
                     ICATHAGLTVGEDGASHQAIEDLSLMRSIPNMTVICPSDAVETEAAIRAIAEYNGPCY
                     VRLGRAGVNVINDRPEYKFEIGKGIELKEGNDVTLFATGIMVDVAIEAVEALAKEGIN
                     ARLINIHTIKPIDSELILKAAKETGAIVTLEEHNIIGGLGSAVAEVVGGEYPVPVVRV
                     GVKDTFGESGKPDQLLKAYGLTSEEAVKAAKKAMSLKR"
     CDS             378965..379822
                     /codon_start=1
                     /gene="CPE0298"
                     /note="285 aa, similar to pir:G72409 conserved
                     hypothetical protein from Thermotoga maritima (strain
                     MSB8) (283 aa); 37% identity in 281 aa overlap. Putative
                     N-terminal signal sequence and 5 putative transmembrane
                     regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80004.1"
                     /transl_table=11
                     /translation="MKISMKTLKEYGIITLGVILLAVSLEYFYYPNDIAAGGVSGLAL
                     VINKITGISQGMFMNVANVILFALAFWLIGGSFGGRSIYAAFGLSITISLIESFLPTF
                     AVTENMLLATIFGSVVGAFGIALVFSQNSSTGGTAIVAKILNKYLHIEIGKSLLCADC
                     VVVVCALLVFGVDKALFGLIGVFIMGILIDKIIEGFNSCKQLLIISEKSEEISQVIMK
                     EIERGCTKIEGTGGYSKEPVTILYVVVNRRQFISLKKKIKEIDPRAFITVNDSKEVFG
                     EGFLDLVEM"
     CDS             380028..380714
                     /codon_start=1
                     /gene="ftsE"
                     /note="228 aa, similar to pir:D69627 cell-division
                     ATP-binding protein ftsE from Bacillus subtilis (228 aa);
                     60.7% identity in 224 aa overlap"
                     /note="CPE0299"
                     /product="cell-division ATP-binding protein"
                     /protein_id="BAB80005.1"
                     /transl_table=11
                     /translation="MIEFRNVSKVYNKNVKALTNVNINIDKGEFVFLVGPSGAGKSTF
                     IKMLLKEVEPSTGNIVMGNEDLSKIKRRQIPYHRRKIGMVFQDFRLIPTLNVYENVAF
                     AMRVVGASPKEIRKRVPMVLSLVGLSNKYKMFPTELSGGEQQRVSIARAIVNNPKVLI
                     ADEPTGNLDPETAKEIMELIDDINKAGTTVVMATHAKEIVNSMKKRVIAIDKGEVVSD
                     VQKGGYEYEV"
     CDS             380680..381612
                     /codon_start=1
                     /gene="ftsX"
                     /note="310 aa, similar to sp:FTSX_BACSU CELL DIVISION
                     PROTEIN FTSX HOMOLOG from Bacillus subtilis (296 aa);
                     28.3% identity in 251 aa overlap. 4 putative
                     transmembrane regions were found by PSORT."
                     /note="CPE0300"
                     /product="cell-division protein"
                     /protein_id="BAB80006.1"
                     /transl_table=11
                     /translation="MFRKEDMNMKFSTIGYFISDAFKSLKRNRTISIASIATVLTTLF
                     IFGAFLLTALNVKNGVTDVQDKVEVKVFLKDDVTQEQRDAVEAKLKTVQGVKEVEFES
                     KDQAFAKMEGSSDYNKEILAGYSKENNPLPASYIVRLESPEVASSVESAMKTNDKFMA
                     GVEDVGNDEELIGTINSFVKVINTVGLVLGVVFVGVSLFLIVNTIKITVYSRRREVGI
                     MKFVGATDWFIRWPFVIEGVIIGLVGGILSTLLLFAGYNFLYGKIVSSSSLYMPQFVQ
                     PMYVLTTMSWQFILAGIVIGAIGSIIALRKFLDV"
     CDS             381701..382987
                     /codon_start=1
                     /gene="CPE0301"
                     /note="428 aa, similar to pir:B69610 carboxy-terminal
                     processing proteinase ctpA (EC 3.4.99.-) from Bacillus
                     subtilis (466 aa); 41% identity in 376 aa overlap.
                     Putative N-terminal signal sequence was found by PSORT."
                     /product="probable carboxyl-terminal proteinase"
                     /protein_id="BAB80007.1"
                     /transl_table=11
                     /translation="MSRNKDEKNKYNNIIKNLKKKKGFRALAMGVALTLIIGVSVYAG
                     NRLTAFGILPITSVSAVQSSLEKVNDTENFKKVLEVREMLYRWYDGEIDDSKLAEGAI
                     KGMVSSLGDQYTYYMNEKEFSDFKEKSQGNYMGIGIQVAVKDGKIVVISPIQGGPAEK
                     AGIKTGDIILKVNGEPVSGNELDKAVSMMKGTTKENIKLTLYREGKGEFDVDVMRDVI
                     KTFNVKSEMIDGDIGYIEVLAFDEGTAKDFETQLKALEEKGMKGLILDLRGNPGGFMK
                     ECVDLVSNFVPKDKVIVSTIDKYGNKEESVSKGGIAQGMPLVVLIDGGTASASEIVAG
                     AIRDYDLGTLVGTTSFGKGIVQVVLDKIGQEKDGTALKVTISKYYTPNGENIHKKGIG
                     PDVTIEYPKELKEKTYSRSTDPQFEKALEIIQEKIK"
     CDS             383010..384290
                     /codon_start=1
                     /gene="CPE0302"
                     /note="426 aa, no significant homology. Putative
                     N-terminal signal sequence and 7 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80008.1"
                     /transl_table=11
                     /translation="MNLLIENIRGISYALVSPTLSLMLIVIAIIFYFKNRKIAFMQKL
                     MLGRSIQSPLEMTLLQILIGILGGLIASLLLSILGVTFENSSLIDVILTVSVFSVLYK
                     NRFLKFPYIAALLGVIGVLVSKNTEYFGRGFSFSINLTSIIVLIGVFSIVEGILAMID
                     GDKGYLPIFTQKDGKLVGGFGFKRFWALPLCLLVVLGANSGNSIINEVKDLPQWLPFF
                     NGDKARALMSVAALGTLAAYGATSYEGTTFTQSKRSKTISSGLINIAYGIVVIILAYL
                     LKESFIFTIALIILIPLLYELRIRMELKLESLREPLYFSNDDEICILDVLPNSIAYKK
                     GLRSGDKIVKINEEIPKNEKEVFMAIKRNFYGLDLEIRKNNGNIEKHTITGEDRGKQF
                     GIVLVPKGISFDKEIDEFLEKLKKASKDEEVKNK"
     CDS             384378..386357
                     /codon_start=1
                     /gene="uvrB"
                     /note="659 aa, similar to sp:UVRB_BACSU EXCINUCLEASE ABC
                     SUBUNIT B (DINA PROTEIN) from Bacillus subtilis (661 aa);
                     66.3% identity in 652 aa overlap"
                     /note="CPE0303"
                     /product="excinuclease ABC subunit B"
                     /protein_id="BAB80009.1"
                     /transl_table=11
                     /translation="MGEFKIQSKFKPTGDQPKAIDTLVQSIENGNRGQTLLGVTGSGK
                     TFTMANIIERTQKPTLILAHNKTLAAQLCAEFKEFFPDNIVEYFVSYYDYYQPEAYVP
                     QTDTFIEKDASINDEIDKLRHSATSALLERRDVIIVASVSCIYGLGNPEEYKKLTISL
                     RPGMIKDRDEVIKKLIEIQYERNDIDFARGTFRVRGDNLDIIPSSSSSKGIRIEFFGD
                     EIDRIREFDVLTGNIIGERQHVSITPASHFAASEETLEKSIRVIEDELEDRLKVLTAE
                     DKILEAQRLKQRTNYDIEMIREMGYCQGIENYSRILDGRMPGTPPQTLLDYFPEDFLM
                     FIDESHVTLPQVRAMYAGDRSRKTSLVEFGFRLPCAFDNRPLKFSEFESKINQVVFVS
                     ATPGEYELDHSEIVAEQIIRPTGLLDPVIEIRPIQGQIDDLYGEIQRTVQRGFRVLIT
                     TLTKRMAEDLTKYLKDLNVKATYMHSDIDTLERMKIIRELRLGEVDVLIGINLLREGL
                     DIPEVALVAILDADKEGFLRSETSLIQTIGRAARNSESKVIMYADNITKSMDKSIKET
                     ERRRVIQMEYNEEHNITPTTVIKGVRDIIEATKVSEEKENYESEVKKAAKKDIPVEKL
                     IEQYEEEMKEAAKNLQFERAAELRDIIKDLKENSK"
     CDS             386623..387474
                     /codon_start=1
                     /gene="CPE0304"
                     /note="283 aa, similar to sp:DEGV_BACSU DEGV PROTEIN from
                     Bacillus subtilis (281 aa); 32.3% identity in 279 aa
                     overlap. 1 putative transmembrane region was found by
                     PSORT"
                     /product="DegV-like protein"
                     /protein_id="BAB80010.1"
                     /transl_table=11
                     /translation="MAVKVITDSTSCIPKDLAEKYGVEIVSLSVIMNGESYKEVDIDS
                     EAFYDELAKCDKLPTSSQPPMDEFYNAFEKFAKDGHDIVAAFISSKLSGTYTTSHIIK
                     DMILEKYPDVKIDLIDSQTSVMALGIGVLEGAKAAQEGKDFNEVSKIVRNTIEESEII
                     FVPGTLENLKKGGRIGGAAALFGKMLKINPILTVKEGAVVVMDKVRTKKRAIDKIVEV
                     VKQDLKEKGIKQAVVCHILAEDEAKDLAKRLKEELDLDSMIGEISAVIGVHVGVKSVG
                     IAYARES"
     CDS             387705..388430
                     /codon_start=1
                     /gene="CPE0305"
                     /note="241 aa, similar to pir:B72334 ABC transporter,
                     ATP-binding protein from Thermotoga maritima (strain
                     MSB8) (260 aa); 42.9% identity in 238 aa overlap"
                     /note="ATP-binding protein"
                     /product="probable ABC transporter"
                     /protein_id="BAB80011.1"
                     /transl_table=11
                     /translation="MIILKGVDKEYTQGVKAVDNLNLEIKDGEIFGILGPNGAGKTTT
                     ISMITGITEPTMGEIKINNIDISKNPVEAKMQFGYVPDSPDMFLRYKGIEYLNFMGDV
                     YNVSESDREERIKDLAKRFEMTNALGDKIQSYSHGMRQKIIIMGVLIHKPSIWILDEP
                     LTGLDPKSSYILKEMMREHASEGNTVLFSTHVLEVAEKLCDRVGIIKKGKLIFVGTLE
                     ELKEEFKGDESLEKMFLEITENE"
     CDS             388423..390021
                     /codon_start=1
                     /gene="CPE0306"
                     /note="532 aa, partially similar to gp:BSP250862_5 MrsE
                     protein from Bacillus sp. HIL-Y85/54728 (244 aa); 27.9%
                     identity in 183 aa overlap. 13 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80012.1"
                     /transl_table=11
                     /translation="MNRIKLLLKYFIGNSFNNASSNIKSRNLAIVMYILIIIGISTPI
                     ANMIDSMYPNFASIGQEGYLLSIIFLIGSLTLLVLGVYDILDSFFFSQDIEPLMPLPF
                     KSGEIMIGKFITCLVDMYIYLSITIIPLISFGLNAKIGFSYFLMIIPVYLFAPIIIVI
                     FCILITMILMSFINVSKYQNTFKIIFGTLGIVLILGVYSLNSTGLNSENVSVALRNKT
                     ALVDLTNKIFITTTFSVKALLYSNSLKGLLNLGLLIGISIVALIIAYFLGKSMYNKIL
                     SRNLNVYSERKNILENNKNKVVVRSSVRKAMVLRELRTILRDPSNFINCVVMIVYMPI
                     FIFIFFIKGNILVNDTQLAKDTIIMAATFIVTALTISGNSVASTALSREGKEILISKY
                     IPVDYKVQIQSKLIVSFIVNGLALILGIAILIYLKASPLVIVMSLLVQMGTIATISLV
                     GMILDYLSPKLEWTDTKNLYSKNFKPLLVMLICLVIGGFNIGLIVTKSPLIVFLIDMS
                     ILLIVSLVLYKILMKKGLEVYKRL"
     CDS             390238..391242
                     /codon_start=1
                     /gene="CPE0307"
                     /note="334 aa, similar to pir:T43794 probable lipase lipA
                     from Clostridium perfringens (311 aa); 23.1% identity in
                     260 aa overlap. Putative N-terminal signal sequence was
                     found by PSORT"
                     /product="probable lipase"
                     /protein_id="BAB80013.1"
                     /transl_table=11
                     /translation="MKKILKVVEVILLSLIIIMGALAYYFRGQIGFYINIGKEYLEFK
                     ENPPSIEDLKNIKMSEDMDFKDVVYKDTNGKAQTLDIYGPEKKLRHGSPVILYVHGGS
                     WVYGNKEIPDLIAPLLDSFRKEGYTIISVGYELATDKVDFKKQASDVKDAIRWVYKNK
                     ETYGFNTDEIGVIGASAGAHLSLLATYSGEDEFVDDKELSNYPSKVKYVVDFFGPTEL
                     SALDMTMASWDLNNSIEKTEKQLRGEESITEYMDKYSPINYVKPNLPKTLIVHGRQDK
                     LVPYSNSMNLYNKSKDMGNDIQILTLENSGHDFSQVDVNEVFELGFKVLNFILFNTKF
                     "
     CDS             391401..392966
                     /codon_start=1
                     /gene="CPE0308"
                     /note="521 aa, similar to N-terminal of sp:MUTS_THEMA DNA
                     MISMATCH REPAIR PROTEIN MUTS from Thermotoga maritima
                     (793 aa); 32.2% identity in 267 aa overlap. 2 putative
                     transmembrane regions were found by PSORT."
                     /product="MutS-like protein"
                     /protein_id="BAB80014.1"
                     /transl_table=11
                     /translation="MDKRLLKVLKHDYAVEMDKKRNLKAIRTLYDMNEKEEYHIDEQT
                     WNDLDLDKVYSKLDRNYSSLGEASLYSMLRNPLNDEKKLNKRREEIEYFKENEEVRFK
                     IMWIFFELGRDKKNSLLDMINEKLIESNKFKYYFYTITGKILPLILILTAIFVSVSAM
                     LGLMAVTFLNIYINSKERDRIKANGLMYLRRVIKASKQIVKINDKNLDDFNIKIRENL
                     KDLKSIDRNTIMISFINMWGGVFEFISVLFLLEETAYYKIADSIEKNKDSILSLYKTL
                     GEMEAIISIGSYEEEKKDKITRPKFIREITLEIKNGIHPIIENPVANSINMSKRGIVL
                     TGTNMSGKSTFLRMLGVNMLFAQAFNFVLAEKYEGPIFNIVTSISPNDDLSVGKSFYM
                     AEAESILRIIRALDKELPVFCAIDEIFRGTNPIERISASAEILTYINNKNSISIVATH
                     DRELVDILKESYEFYYFSENVDSKNGLSFDYKLKRGVSKTRNAIKLLEYIGYPKDIIN
                     KSYRRSEKLEGFI"
     CDS             392981..393667
                     /codon_start=1
                     /gene="CPE0309"
                     /note="228 aa, similar to sp:YCBG_BACSU HYPOTHETICAL
                     TRANSCRIPTIONAL REGULATOR IN GLTP-CWLJ INTERGENIC REGION
                     (ORF6). from Bacillus subtilis (233 aa); 30.8% identity
                     in 224 aa overlap"
                     /note="GntR family"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB80015.1"
                     /transl_table=11
                     /translation="MFKPVKNMKVYEQVVDQIKEMVRVGQIKKGDKLPTERVMAEELQ
                     VSRTSIREAMRALEVVGLIESRQGAGNYIREEFDDVLLEPLSIVFMLQNGTNKDIFEL
                     REVLELSTIFLSVMRISDEELKKLGELVERFKTSRDEEENVKIDSEFHSIIVKGANNV
                     LITNLLEGVSELVDKFISEGRRAILSDERNRGKLLDFHEKIYLAIKNRDAYSAYKHMQ
                     EHFQLIKENI"
     CDS             393902..395425
                     /codon_start=1
                     /gene="CPE0310"
                     /note="507 aa, similar to gp:SILCT_2 lactate premease
                     from Streptococcus iniae (474 aa); 49.5% identity in 416
                     aa overlap. Putative N-terminal signal sequence and 13
                     putative transmembrane regions were found by PSORT."
                     /product="probable lactate permease"
                     /protein_id="BAB80016.1"
                     /transl_table=11
                     /translation="MNTYLMFFLALIPIIILIIGLGVLKIPAHKICPIALIITILLSI
                     FIWKMPTIDSLTAALEGIALGIWPIMIVIIAAVFTYNLVVHTKAMEVIKSMLISVSDD
                     KRILVLILAWGFGGFLEAVAGFGTAVAIPVGIMAALGFNPFFASVICLVANTTPTAFG
                     AIGLPVITLANVSGIPIESLSYYVVLQLFLFVVLIPFALVALTEKSLKGIKGVFGITL
                     ASGLSFGIVQVLVAKFLGPELPAVLGSIVSLLVTIFIAKKFYKHNEETKREEKFELKS
                     VLVAFSPFILILVIIIGISPLFPGLYNKLSEVRTSVNIYTGVGAKPYTFVWLTTPGIL
                     ILIASFIGGFIQKASFREMVEILLKTIKQMSKSTITILAIIALAKVMGYSGMVASIAT
                     VLVMITGSFYAFIAPFIGALGTFVTGSDTSANVLFGSLQAEAANSLGISPAWLGAANT
                     CGATAGKMISPQSIAVATAATGLAGKEGKILNSTLKVCIVYVILLGLISYLGSLIFV"
     CDS             395519..396307
                     /codon_start=1
                     /gene="etfB"
                     /note="262 aa, similar to sp:ETFB_CLOTS ELECTRON TRANSFER
                     FLAVOPROTEIN BETA-SUBUNIT (BETA-ETF) (ELECTRON TRANSFER
                     FLAVOPROTEIN SMALL SUBUNIT) (ETFSS) from Clostridium
                     thermosaccharolyticum (260 aa); 44.9% identity in 256 aa
                     overlap"
                     /note="CPE0311"
                     /product="electron transfer flavoprotein beta-subunit"
                     /protein_id="BAB80017.1"
                     /transl_table=11
                     /translation="MKIMVCIKQVPGTSKVEVDEKTGVLKRDGVDSKMNPYDLYALET
                     ALRIKEKKGGNIKVISMGPPQAKAVIKEAYSMGADEGTLVSDRKFAGADVLATSYTLS
                     QGVKKCGDFDIILCGKQTTDGDTAQVGPEMAEYLGIPHVANVRRILDVNDDFIKVEMD
                     MPNTIEVLEVKYPCLLTVDKDIFQPRLPSYKKKLETDEREINVISLNDFEDKDEKKYG
                     LNGSPTQVERIFPPSNNDDHEIWTGDSSELSERMEDKLRELKFI"
     CDS             396320..397513
                     /codon_start=1
                     /gene="eftA"
                     /note="397 aa, similar to sp:ETFA_CLOTS ELECTRON TRANSFER
                     FLAVOPROTEIN ALPHA-SUBUNIT (ALPHA-ETF) (ELECTRON TRANSFER
                     FLAVOPROTEIN LARGE SUBUNIT) (ETFLS) from Clostridium
                     thermosaccharolyticum (330 aa); 49.1% identity in 212 aa
                     overlap. 1 putative transmembrane region was found by
                     PSORT"
                     /note="CPE0312"
                     /product="electron-transfer flavoprotein alpha-subunit"
                     /protein_id="BAB80018.1"
                     /transl_table=11
                     /translation="MGRLVVHQDKIEDANSVIKICPFGAMEIVNGKVEINASCRMCKV
                     CVRKGPKGAFEFVEDENKVLVNKDEWKGIAVYVDHVNGEIHPVTLELIGKARELADKV
                     NQKVYCLFMGNGIKDKAGELLHYGVDEVIVYDYKELENFRIEPYTAVFYDFINKIKPC
                     SILVGATTLGRSLAPRVAARCRTGLTADCTILDIKENTDLVQIRPAFGGNIMAQIVTP
                     NSRPQMATVRYKVMSAPERNEECTGEIKYFEIEKDKLKSDIEVKEIKQKPKEHSISDA
                     EVIVVAGRGVKSEKDLEIIKELADLLGGELAVTRPLIENGWADANRQVGLSGRTVRPK
                     LIITCGVSGAIQFVAGMNNADYIFAINKDEKAPIFKVAHYGIVGDIYEIVPKLIEKIK
                     GEGVL"
     CDS             397515..398915
                     /codon_start=1
                     /gene="CPE0313"
                     /note="466 aa, similar to pir:D69984 glycolate oxidase
                     subunit homolog ysfC from Bacillus subtilis (470 aa);
                     39.9% identity in 431 aa overlap. 2 putative
                     transmembrane regions were found by PSORT."
                     /product="probable glycolate oxidase subunit"
                     /protein_id="BAB80019.1"
                     /transl_table=11
                     /translation="MSYNKINESGIEFIKGIINDNERVFIGEEISEDYSHDELGSEKH
                     MPDIVVKAMSRDEIVEIMKYANNNNIPVTVRGAGTGLVGAAVPILGGILLDLSGMNKI
                     LELDEDNLTLTVEPGVLIMEIAKFVEEHDLFYPPDPGEKTATIGGNVSTNAGGMRAVK
                     YGVTRDYVRGIEVVLPSGEVLELGGKVVKNSSGYSLKDLIIGSEGTLGIITKIVLKLL
                     PLPKKVISLLVPFNDLESAIETVPKIIKSKNIPTAIEFMQRDLIISAEEFLGKKFPDN
                     SSNAYLILSFDGNSKEEVEGYYEKVADICLKEGALDVFISDTEERQESIWSARGAFLE
                     AIKASTSDLDEVDVVVPRNKVAEFVKFTNEVEKKLNVRIRSFGHAGDGNLHIYILKDE
                     LSEDEWHKKLNEAMEILYRKQRELNGQVSGEHGIGLAKRLYLNESLNKATMDIMRGIK
                     LAFDPNNILNPGKVCE"
     CDS             complement(398998..399396)
                     /codon_start=1
                     /gene="CPE0314"
                     /note="132 aa, no significant homology. Putative
                     N-terminal signal sequence and 2 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80020.1"
                     /transl_table=11
                     /translation="MPKLLIPAIIFITLALIFYTIGVWSEHRAGILKKKHVIIFWCGL
                     VCDTLGTYTMSRIVAAGTDKGITPTDLLIHQSTGMLAIILMLIHAVWATIVLNRGSEK
                     AKAIFHKFSLVVWFIWLIPYFVGMYIGMTS"
     CDS             399764..400273
                     /codon_start=1
                     /gene="sipS"
                     /note="169 aa, similar to sp:LEP_STAAU SIGNAL PEPTIDASE
                     IB (EC 3.4.21.89) (SPASE IB) (LEADER PEPTIDASE IB) from
                     Staphylococcus aureus (191 aa); 40% identity in 165 aa
                     overlap. Putative N-terminal signal sequence was found by
                     PSORT"
                     /note="CPE0315"
                     /product="type I signal peptidase"
                     /protein_id="BAB80021.1"
                     /transl_table=11
                     /translation="MSKNLKEYVVIICAAIVLTLLINKFLLFKIVVPTPSMAPTIEPG
                     DQLFATRIHNLSKMERGDMIVFYSKEFDERMIKRLIGLPGDKVEIKDDGTVNVNNEKL
                     DEPYIKYPGGKVNMNFEVPEDKYLLLGDNRDNSKDARYWSDKYIDGDDILGKAQITVW
                     PLNRFNFAS"
     CDS             complement(400516..401295)
                     /codon_start=1
                     /gene="CPE0316"
                     /note="259 aa, similar to gpu:AP001510_1 transcriptional
                     repressor from Bacillus halodurans (251 aa); 32.3%
                     identity in 220 aa overlap"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB80022.1"
                     /transl_table=11
                     /translation="MLKQDRLMEITNIIQNKKRIQIKDLAKSTFSSISTIRRDVIFLE
                     KQGLIKRLHGEIILNNFNTVEPSKFLRESENVIKKRAIASLAKDFIAPGMCIYLDSST
                     TVYELCPFLCDIEHLIIFTNGLNTALRLAEYGNPTMKIFITGGEVKHFSSSVVNLDIE
                     NSLLNHFNVDIAFCSARGIDESNVYEVSLSQAVSKKRIIDKAKETILLIDSSKFEVTG
                     FFKINDLKKYKAIISDKLPSPKILAAAEALDIEWISDTDIS"
     CDS             401487..402890
                     /codon_start=1
                     /gene="fucK"
                     /note="467 aa, similar to gpu:AP001512_138 rhamnulokinase
                     (EC 2.7.1.5) from Bacillus halodurans (467 aa); 43.6%
                     identity in 463 aa overlap"
                     /note="CPE0317"
                     /product="rhamnulokinase"
                     /protein_id="BAB80023.1"
                     /transl_table=11
                     /translation="MGSVLAVDLGASSGRAILGELKDGKIALKEVNRFPNKPIYKRGI
                     LSWNTDYLFSEIKKSIMEAKKVAEVESIGVDTWGVDFGLLDEYGNLITFPANYRDSRT
                     KGILKRVASLFSLKELYKITGNQIMEINTLFQLLALREKNPELFYQAKTVLLIPDLFN
                     YLLTGKIAAECSIASTTQLTDPHTKKWSKEVLDSFELSSQMFPEIVNEGNFLGTTKSE
                     LGLGNIKVINVCQHDTASAVVSVPSEKNFLFISCGTWSLIGTELNEPILNEQAIKFNL
                     TNESGHSGTTRLLKNCTGLWVIQELKRNYEEEGINYSYEEIANMASLVSCNECIIDTD
                     DESFLEPGDMRERIISYGKKTNQKVPKEPKEFFRCAYESLAYKYKETIKEIEMITNKK
                     FEEIYIVGGGAKATFFCQLVANITGKEVIAGPGEATAIGNIIIQLIALKEIKDVSEAR
                     KIISNSFNLTKYIPGVK"
     CDS             402971..404758
                     /codon_start=1
                     /gene="fucI"
                     /note="595 aa, similar to gp:AF137263_3 L-fucose
                     isomerase (EC 5.3.1.25) from Bacteroides thetaiotaomicron
                     (591 aa); 58.8% identity in 594 aa overlap"
                     /note="CPE0318"
                     /product="L-fucose isomerase"
                     /protein_id="BAB80024.1"
                     /transl_table=11
                     /translation="MKTYPKIGIRPTIDGRQGGVRESLEEKAMKMAQAAKKLIENSLY
                     YADGTPVQCVLASRTIGGSGDAGIVQQEFTGKNIVATLSVTPSWCYGTETMDLDPNTI
                     KAIWGFNGTERPGAVYLAAAMSGYAQKGIPAFKIYGHDVQELDDDTIPVDVQEKILSF
                     ARGAIAVGQMKGKSYVNIGASSMGIAGSQVDISFFEDYLGMLVEFVDMTEILRRIHLE
                     IFDPIEYDKALNWIKENCREGIDINEGKDLPDIVKKSKVIPADKDWEFIAKQAIIIRD
                     ILYRNEKLGDLGWEEEARGRNAIAGGFQGQRQWTDWLPNGDFTEAIMASTFDWNGPRQ
                     VTAFATENDTLNGVSMLLGTLLTNKAPIFSDVRTYWSPESVKRVTGKELTGKAKNGII
                     HLINSGASALDGTAAAKDKDGNKTMKEFWNMTNEDVQSCLKATDWCRANYEYFRGGGF
                     SSHFKTEAELPVTLIRVNLIKGIGPTLQIAEGYTCVIDEDIHQILDERTDKTWPTTWF
                     APNLGECGFETVYDVMNHWGANHGAFVHGHIGSDLITLASMLRIPVTLHNVPRERIFR
                     PNIFEGAGTKALETADFEICRLLGPLYKK"
     CDS             404788..405444
                     /codon_start=1
                     /gene="fucA"
                     /note="218 aa, similar to sp:FUCA_ECOLI L-FUCULOSE
                     PHOSPHATE ALDOLASE (EC 4.1.2.17) from Escherichia coli
                     (215 aa); 39.4% identity in 213 aa overlap"
                     /note="CPE0319"
                     /product="L-fuculose-phosphate aldolase"
                     /protein_id="BAB80025.1"
                     /transl_table=11
                     /translation="MLMEKERKKLIEYGKKLVVEKLTKGTGGNLSVFDRNLGYIAITP
                     SGIDFFEMKDRDIVILDLNGNVVEGENLPSSEWQMHLKLYKTREDIDAVIHAHTLYST
                     VLACLHEELPATHYMIAVAGKNVRVANYATYGTEELAENAAKAMEERKAVLLANHGIL
                     AGSNDLLNAFNIIEEVEYCSKIYCISKSIGEPFILPDDEMELMEKKFTSYGQRKSKEA
                     "
     CDS             405449..405886
                     /codon_start=1
                     /gene="CPE0320"
                     /note="145 aa, similar to N-terminal of gp:AF130465_1
                     mannose-specific phosphotransferase system component IIAB
                     from Streptococcus salivarius (330 aa); 34.7% identity in
                     98 aa overlap. 1 putative transmembrane region was found
                     by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80026.1"
                     /transl_table=11
                     /translation="MSKYKNGILVVSHGPLASAIVSSAEMIFGKISDERLETLTLDVG
                     ANVDLFYETMNDLVENLLVNNEKVIILTDLLGGTPNNTALKIAIGNERVSVITGYNLM
                     VLIEIFSNIDNEIDNDNLIKSGREFLLNLNTIIVEEEEEEEWL"
     CDS             405877..406350
                     /codon_start=1
                     /gene="CPE0321"
                     /note="157 aa, similar to gp:AF129168_5 EIIB sorbose-PTS
                     homolog from Lactobacillus casei (164 aa); 38.9% identity
                     in 157 aa overlap"
                     /note="mannose-specific component IIAB"
                     /product="probable PTS system"
                     /protein_id="BAB80027.1"
                     /transl_table=11
                     /translation="MAIEFLRIDDRLLHGQVVTTWIKKYEIEQAIIVSEDVYKDKLRQ
                     TILKTAAPAGIKVVFFNPEKFISAYHKVPIKRRTMLLFTNPKEVFECLEGKVKFDYLN
                     VGNMSKTSLNEKITAGVAVTDEDRKYFKEIINSGVKVEIQMVPNDKSEDMKNYID"
     CDS             406367..407143
                     /codon_start=1
                     /gene="CPE0322"
                     /note="258 aa, similar to sp:PTNC_ECOLI PTS SYSTEM,
                     MANNOSE-SPECIFIC IIC COMPONENT (EIIC-MAN) (MANNOSE-
                     PERMEASE IIC COMPONENT) (PHOSPHOTRANSFERASE ENZYME II, C
                     COMPONENT) (EII-P-MAN) from Escherichia coli (266 aa);
                     33.5% identity in 239 aa overlap. Putative N-terminal
                     signal sequence and 6 putative transmembrane regions were
                     found by PSORT."
                     /note="mannose-specific component IIC"
                     /product="probable PTS system"
                     /protein_id="BAB80028.1"
                     /transl_table=11
                     /translation="MIIQMLLVTAVAVIATIDYNGPVLMLYRPLIAGSLVGLVLGDFQ
                     QGMIIGATLELMWLGVTAVGGYTPPDTISGAIVGTALGILSGHGVTAGVAIAVPVAVV
                     TQQLDVLAKTVDIYFVKKADEAAKKGDPSKIGLYHHSSLVLIVLFKVVPIFAALVLGG
                     NYIKDLFDKIPPVIMTGLNVAGGMLPAIGFAMLLNMMLKKNMWPYLLVGFVFSAFLNL
                     STIGIALLGVAIVFLLSMKSNSVQISNNTCEVEEEEVLDL"
     CDS             407140..407943
                     /codon_start=1
                     /gene="CPE0323"
                     /note="267 aa, similar to gp:AF130465_3 mannose-specific
                     phosphotransferase system component IID from
                     Streptococcus salivarius (303 aa); 37% identity in 254 aa
                     overlap. 5 putative transmembrane regions were found by
                     PSORT."
                     /note="mannose-specific component IID"
                     /product="probable PTS system"
                     /protein_id="BAB80029.1"
                     /transl_table=11
                     /translation="MNKNGLEKKTINKVFWRSFMYGASWNYERMQNLGFLYTILPTLK
                     KIYKDKKEDMSVAMSRHLEFFNTHPTAAPFILGITSALEEQEKNEGDQSIRGIKVGLM
                     GPLAGLGDSIIGLTLLPIIFSVGASYAKAGNPLGIFLALFLINAINIPLKYFGLKFGY
                     EKGANFIQSQKTKSNLENITNMSMALGLILIGGLIPQWVGVNFAFEYIQGDLVVSLQE
                     TLNKIIPGVVPLLLTLGLYKLVKKGKNPVVIIFGVMIVSVLLVWLNILK"
     CDS             408080..409396
                     /codon_start=1
                     /gene="CPE0324"
                     /note="438 aa, similar to pir:T36467 probable glycosyl
                     hydrolase from Streptomyces coelicolor (423 aa); 34%
                     identity in 332 aa overlap"
                     /product="probable glycosyl hydrolase"
                     /protein_id="BAB80030.1"
                     /transl_table=11
                     /translation="MKNELDSIMKRTEWFRESRFGMFIHWGLYSILGRGEWVRSAERI
                     SSEDYDFYLEQFNPERFDPHKWAKAAKEAGMKYMILTAKHHDGFCLFDSKYTDFKSTN
                     TKIKKDLVREFIEAAREEGLKVGLYYSLIDWRHKDYPKYNDLYHPMRGNENFINEEVN
                     FDNYLSYMHSQVEELVTNYGKLDILWFDFSYDKMFGEVWKAKELIDMVRKHQPDVIID
                     NRLETSGGGFGSIVTENPSPYCGDFVSPEQIVPHEGIRNYKGDIVPWELCLTMNNNWG
                     YNPTDNLYKPGSVLIRKLVECVSKNGNMLLNVGPTAKGVINQPSLDILDEFAKWMSAN
                     GESIYGCGSASELPKPDWGYYTKKDNVIYAHVFEQPIGPLALIGINEKDVKAMTLLHD
                     GSEVRISKSWTTRAYDSILFVQFGEVAHFTYPLADPIDTVIKIELK"
     CDS             409414..411303
                     /codon_start=1
                     /gene="CPE0325"
                     /note="629 aa, partially similar to pir:T36462
                     hypothetical protein SCF85.02 from Streptomyces
                     coelicolor (499 aa); 33.3% identity in 78 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB80031.1"
                     /transl_table=11
                     /translation="MKVLGNYIQRNFHYDGKSFYTTSFLNPILNEEILVHTQNEFIIY
                     FVDGEILPSSEMNVEIKKQSEQLLVVNFSKDNLSVEVNYFVENKVINKKLTVFNCCKR
                     INYIDCDTFEFEDTNNIYYPKKQNNIKEMGNFNGYYVELGQPIYAKSLFMGMEFPMGE
                     NRIQERKYFSRYYYGKSVEKRLDIHSAIIGAAPEKSKEKIQASFFEYIKAISLPATFR
                     KQYNSWYDHMLNITNDSIIKSFLEINRGFKNYGITLDAFVVDDGWANYESVWEFNDKF
                     PNELKDISECVKNLGSTLGLWIGPRGGYNGTQVTMSDWLEKNKDLNIGSKNKISNDVN
                     VGDFNYLRKMKEKMLEYQSKYDISYWKIDGMLLKPDTEDESGPYGMHTMTAVYEFMIS
                     LFNELREERGEKSFWINLTSYVNPSPWFLKWVNSLWIQTSQDVGFTPNGGNDIQKMIT
                     YRDSQYYEFLIERDIQLPLCSLYNHEPIYAESASMWYLDHQIYCSIEEFKEYLMFIAT
                     RGNAFWEFYYSYSMFDDERWEVNAQAIKWIEENYPILKNSTFFGTKPSLMGVYGYYCQ
                     SDSGSKSIISFRNPSDEIKSYKLENIEPKKYDVVLGNKNYKVFEDGSVEVKLNPKEII
                     ILKSK"
     CDS             411556..411984
                     /codon_start=1
                     /gene="lacA"
                     /note="142 aa, similar to sp:LACA_STRMU
                     GALACTOSE-6-PHOSPHATE ISOMERASE LACA SUBUNIT (EC
                     5.3.1.26) from Streptococcus mutans (142 aa); 66%
                     identity in 141 aa overlap"
                     /note="CPE0326"
                     /product="galactose-6-phosphate isomerase"
                     /protein_id="BAB80032.1"
                     /transl_table=11
                     /translation="MRVVIGADKEGMELKNMIKCYLLENNFEVIDKSEEASEDFVEST
                     VAITKDVLENKGSLGIAFDGYGAGSFMVATKIKGIIAAEVSDERSAYMTREHNNSSII
                     TIGSKIVGSELALNIVKEFLEASYDGGRHQIRVDMLNKMA"
     CDS             412020..412535
                     /codon_start=1
                     /gene="lacB"
                     /note="171 aa, similar to sp:LACB_STAAU
                     GALACTOSE-6-PHOSPHATE ISOMERASE LACB SUBUNIT (EC
                     5.3.1.26) from Staphylococcus aureus (171 aa); 71.9%
                     identity in 171 aa overlap"
                     /note="CPE0327"
                     /product="galactose-6-phosphate isomerase"
                     /protein_id="BAB80033.1"
                     /transl_table=11
                     /translation="MKIAIGCDHIVTDTKIAVSDFLKAKGYDVLDVGTYDFTRTHYPI
                     FGKKVGEAVASGEADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTAIYAKEQLNAN
                     VIGFGGKITGEFLMCDIIEAFIKADYIENEENKKIINKINSLEENKPEQNDIHFFDEF
                     LERWNRGEYKD"
     CDS             412552..413484
                     /codon_start=1
                     /gene="lacC"
                     /note="310 aa, similar to sp:LACC_STAAU
                     TAGATOSE-6-PHOSPHATE KINASE (EC 2.7.1.144)
                     (PHOSPHOTAGATOKINASE) from Staphylococcus aureus (310
                     aa); 56.8% identity in 310 aa overlap"
                     /note="CPE0328"
                     /product="tagatose-6-phosphate kinase"
                     /protein_id="BAB80034.1"
                     /transl_table=11
                     /translation="MILTITMNPSIDISYPLDVLNLDSVNRVTKVTKTAGGKGLNVTR
                     VLKQLDADVLASGLLGGFFGDFIKNDLNINGIKHSFSDISGETRNCIAILHEGNQTEI
                     LESGPNISEKEANNFLRHFELLVDKANIISISGSLPLGISKDFYVKMLSICNKKDKRV
                     VLDCSGEELRQVLKNDSKPFAIKPNIDELSDLLGVKVKDSIEDLKLILNTPMFNGIEW
                     IVISMGAKGSFAKHNDKFYRVIIPKIQVVNPVGSGDSTIAGLTKGLNDGETDENVLKI
                     ANTLGMLNAQEHITGYVNMDNYKNLFEKIKVVEV"
     CDS             413725..416112
                     /codon_start=1
                     /gene="CPE0329"
                     /note="795 aa, no significant homology. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80035.1"
                     /transl_table=11
                     /translation="MKNNLKKYIKYILSVILVFFVGVNGMEVYALEESRDVYLSDLDW
                     LNATHGDDTKSKIVQKNHPFTPGNNNQSTKISLKMEDGSISEFEKGLGTIAGSPSTIT
                     YDISGAGVTKFFSYLGIDRSANPINEQYAKVDKIEVVVDGKVIYSTINQFPNGLTYET
                     PAIKVDLNIPENAKRLQLKSYAGEKTWGDEVVYADAKFTAKGDFVNPNDWTPAEKRRE
                     ISNEKPLLMIPLYANGSKYEKGDYAFWGDDTLVGKWKEVPDDLKPYTVIQLHPDDLPK
                     RDGVAADFYEHMLNEAQSYVNPKTNKNEPIPIVLTVYTAGNVPGYTAAHWLTTEWIED
                     MYSKYSALQGVFSTENYWVWTDNVESNAAEYLKLSAKYGGYFIWSEQNNGGSIEKAFG
                     SNGKTVFKEAVEKYWENFIFMYKNTPQAEGNDAPTSSYMTGLWLTDYAYQWGGLMDTW
                     KWYETGKWKLFESGNIGKTQGNRQWLTEPEALLGIEAMNIYLNGGCVYNFEHPAYTYG
                     VRNEESPLFSNVIKEFFRYVINNPSPSKNEMRAKTKSLLYGNFTQNGNGNYFVGLNTE
                     MSQSPAYTTGRYGNIPAVPSSIERNKIESRLSGSQIKLIDMNSSELSNITNRKEYFNK
                     LYKEEYNGNIFAQKLDNRWFIYNYKYNENINQKGSFDIANIKSEVTLEPHTYLIMEDN
                     NQSINIKLNNYRTNKDSLWEGAKNADEAKKLPEMSKVDALNWVYDSYIKNTNNGEKRT
                     SVIKLMNIDKAPTITNVNGIEGSYDIPTVKYNSETRSAEITIKNNGNIDFDIVIK"
     CDS             complement(416323..416703)
                     /codon_start=1
                     /gene="CPE0330"
                     /note="126 aa, similar to pir:C69850 hypothetical protein
                     yjgA from Bacillus subtilis (132 aa); 54.2% identity in
                     107 aa overlap. Putative N-terminal signal sequence and 2
                     putative transmembrane regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80036.1"
                     /transl_table=11
                     /translation="MRKKYFILTILTMILGLLSRKFMSYVPSLISPYLGDVLWATMVY
                     FGFRFLLPKLNTNTSFLIAILFSFGIEFSQIYQAKWINNIRATTLGGLVLGHGFLWSD
                     LLCYTIGILIGSFIDRLALIKKKL"
     CDS             417022..417696
                     /codon_start=1
                     /gene="CPE0331"
                     /note="224 aa, partially similar to pir:S32215
                     hypothetical protein 1 from Bacillus megaterium (226 aa);
                     54.4% identity in 57 aa overlap. 5 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80037.1"
                     /transl_table=11
                     /translation="MTDRVECKLKAKELLRGRWENAVGACLLFFVSTFLLSFLLSPIP
                     VFGWIIIALISTFLTGSFIKYCIKLNETEGKVKYLECLISFKTTLKILVCDILIGLVV
                     GIGWIIFTMIFSVAFIASQSIVVIIVVLIILVALGFFIEAILFPVPMILTEDEGVGVM
                     EAIEMSFNITKGYRWKYIVMNLSFIGWMILSFLTFGIGMLWLQPYMMLTYYLFYKGIR
                     SANTTI"
     CDS             complement(417887..418510)
                     /codon_start=1
                     /gene="CPE0332"
                     /note="207 aa, similar to sp:APL_LACLC ALKALINE
                     PHOSPHATASE LIKE PROTEIN from Lactococcus lactis (242
                     aa); 32.5% identity in 169 aa overlap. Putative
                     N-terminal signal sequence and 4 putative transmembrane
                     regions were found by PSORT."
                     /product="alkaline phosphatase-like protein"
                     /protein_id="BAB80038.1"
                     /transl_table=11
                     /translation="MEFLGSLLTFLIDIVGSFGYFGILLIVGLEYACFPLPSEVVLTF
                     FGLSASQGEFSLIGVIIFSIIGGLLGSLICYAIGYYGGVPLQEWLGRKFPSSQKSMLA
                     LNKWFKKYGKPAVLLARIVPLTRTYVSLLAGAEKFSLKYFILYSSLGISIWNIFLVSL
                     GYFIGDNLPLINSIMEKYTFVTLAILIIAVIIFIYLKFFKKEKNTSK"
     CDS             complement(418607..421264)
                     /codon_start=1
                     /gene="CPE0333"
                     /note="885 aa, similar to pir:H69877 calcium-transporting
                     ATPase homolog yloB from Bacillus subtilis (890 aa);
                     42.1% identity in 837 aa overlap. 9 putative
                     transmembrane regions were found by PSORT."
                     /product="probable cation-transporting ATPase"
                     /protein_id="BAB80039.1"
                     /transl_table=11
                     /translation="MKKVYSKSKEELFKELGVNKDGLNDTEVKSMEEKYGKNELVEGK
                     KKSTFQVFLDQFKDMLIIILICAAAISMFLGDIESAAVIIFVLIVNATLGTIQHLKAE
                     QSLSSLKALSSPSTKVLRNGERIEIDSKDVVVGDIIFLEAGDYVPADGRILENYSLQV
                     NESSLTGESESIVKMSEIIKGEEIPIGDRKNMVFSGSLVTYGRATILATAVGMDTEIG
                     KIAQLLNDTKEKKTPLQANLDNFGKKLAIGILVICAIVFALSLYRGEAIIDAFMFAVA
                     LAVAAIPEALSSIVTIVLSLGTQKMAKENAIIRKLQAVEGLGSVSIICSDKTGTLTQN
                     KMTVKKIFVDGKVIDSNELNLEKKIDNDLLTMSLLCNDAITDCEKEIGDPTEVALVNL
                     GDLYGVDELVQRDKFKRLGEIPFDSDRKLMSVVYNIHGENIIATKGAVDVLLKRSTKI
                     ETSEGVRPITKEDIAKIEEINQEFSKTGLRVLSFAYRNIESRTDIKLDDENDLTFIGL
                     ISMMDPPREESAEAVRACIEAGIKPVMITGDHKITASAIAKQIGILKDESEAIEGSAL
                     DKISDEELKNMVEHISVYARVSPEHKIRIVRAWQEKGNVVAMTGDGVNDAPALKQADI
                     GVAMGITGSEVAKDAASMVLTDDNFATIVKAIENGRNIYSNIKNAIKFLLSGNTAGIL
                     SVLYASILALPVPFAAVHLLFINLLTDSLPAIALGLEPHKKEVMKEKPRKANASILTK
                     DFVTDVLFEGVVITIVTMIAFHIGLNQGGPLLASTMAFATLCLSRLVHGFNSKSKKHV
                     VSKELFSNKYLWAAFGVGFVLLNIVLLVPAFEGLFQVAPLTLNNLLTIYGLSLCTFIV
                     VQFVKFIREKFTENKTNTVQESNKENRAA"
     CDS             422038..422601
                     /codon_start=1
                     /gene="CPE0334"
                     /note="187 aa, some similarity to gpu:AB018117_28
                     Arabidopsis thaliana genomic DNA, chromosome 5, P1
                     clone:MQL5 from Arabidopsis thaliana (268 aa); 37.6%
                     identity in 125 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80040.1"
                     /transl_table=11
                     /translation="MTAFTNMGVEREKVAFASPYPGKIIPVDLRNYGGKLICQKDAFI
                     CAAKGVSIGIDFRRKLGTGFFGGEGFILQKLEGDGMAFIHAGGTIVRKRLLPGQKLKV
                     DTGCLVAMTKDVNYDIEYVKGIKNAVFGGEGIFFASLVGPGEVWIQSLPFSRLASKVV
                     SSAPQVPGSRDVGEGSVLGEFGRLFQD"
     CDS             423159..423731
                     /codon_start=1
                     /gene="xpt"
                     /note="190 aa, similar to gpu:AP001512_101 xanthine
                     phosphoribosyltransferase (EC 2.4.2.-) from Bacillus
                     halodurans (198 aa); 47.6% identity in 189 aa overlap"
                     /note="CPE0335"
                     /product="xanthine phosphoribosyltransferase"
                     /protein_id="BAB80041.1"
                     /transl_table=11
                     /translation="MEALKEKILKEGKVREGNILKVDCFLNHQMDIKFLNEVGKEFRK
                     RFEGEKVDKILTIEASGIAIAGIASQYFDYVPVVFAKKTESLNLDKDVYESNVHSFTK
                     KKDYKVRVGKQFLNKGERVLIIDDFLAQGCATKGMIDLVEQAGAELVGIGIVIEKGFQ
                     DGRKVLEDLGVRVESLAIIDKLEDNKVYFK"
     CDS             424217..425149
                     /codon_start=1
                     /gene="CPE0336"
                     /note="310 aa, similar to pir:D71226 hypothetical protein
                     PH0070 from Pyrococcus horikoshii (275 aa); 30.4%
                     identity in 273 aa overlap. Putative N-terminal signal
                     sequence and 8 putative transmembrane regions were found
                     by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80042.1"
                     /transl_table=11
                     /translation="MNNKQKGISLVLIATVFWGIMGISSRILYEAGLSTMFIAFSRSF
                     LSSICFFIWIMITDRKILKIDPRGLAISALYGIGTFALCFIGYNLSVEYIPISVATVL
                     MFTNSIWVTIFGVLFFGEKFNMKKGSVILLTLVGCIMVSNMSLGHFNMSAIGIAAGLG
                     TGFLFAFQIIFPKFFSGYRKDTLLIYGYIFASIFIGLFTDFKESFDIIANTPNIGMVI
                     LNILSIGILSTFISNTFYIKSTEYIEASVTSILASMEPVLSSIFAFFIFGEVLNGKQI
                     VGAILIIIAAIILELKLDKERINNVFKLKFINQN"
     CDS             425340..426722
                     /codon_start=1
                     /gene="CPE0337"
                     /note="460 aa, similar to gp:BCE237785_5 putative amino
                     acid transporter from Bacillus cereus (471 aa); 44.1%
                     identity in 454 aa overlap. 11 putative transmembrane
                     regions were found by PSORT."
                     /product="probable amino acid transporter"
                     /protein_id="BAB80043.1"
                     /transl_table=11
                     /translation="MEIFKKQSLKRILSEANENKERTLSALDLTLMSVGSVIGTGVMV
                     LTGIVAAKQSGPATSIAFIGGGIAAAIIVLCYAEFSSSIPSAGGSYSFTYVSLGEIIA
                     YISGLCIVIGYTLSTATVASGWGAYLLSLLDILGIKLPKTFTAIPSEGGIVNLPAMIS
                     ILFIVFVISLGTKESKKVNDIMVFIKIVVIALFIGVGAFHVNTSNWHPFAPFGVKGIV
                     TGTASLFFAYCGFDATASAAEEVKNPQKSLPLGLISSLVICTIIYIAVSLVLTGVTSY
                     TNLNVGDALSYALKLVGQRGVAFVVSLGTVIGILAVIFAGNFTTSHILLAMSRDGLLP
                     KFFSKVDKKDVPYTALWTVGIIGALLAGFFNLGQLANFANIAFLLTYTLVCISLIAFR
                     KKYPHVKRGFKTPLVPFIPLLGAFSCLFLMSNLSEETWKIFIVVLVLLITSYLVYGRK
                     HSLINKNNDN"
     CDS             complement(426876..428180)
                     /codon_start=1
                     /gene="CPE0338"
                     /note="434 aa, partially similar to pir:S74882
                     hypothetical protein sll1151 from Synechocystis sp.
                     (strain PCC 6803) (605 aa); 30.4% identity in 227 aa
                     overlap. 7 putative transmembrane regions were found by
                     PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80044.1"
                     /transl_table=11
                     /translation="MSITRERFFNEFKKDQATYDEIHENILDGVNIGGANFIILMCAI
                     IIASVGLNMNATAVIIGAMLISPLMGPIIAIGYSVGIYNLKLLKKSAIILIIEIFISI
                     TTATIYFSLSPISSAGSEILSRTSPNIWDVIIAFTGGIAGIIGITRKKSGNILPGVAI
                     ATALMPPLCTSGYGLATKNIHIFLGAGYLFFINSFFIALSTLLVVKFMKIPTRNTLSE
                     VKQKKLKKMIIVSTILVTIPSLISAATMVNSFLNNANLSNFIENEMPSEYILNKEINT
                     KNKTIDLVIIGNTIDNSEEEKLQEALKYYNFSGYKLIIQQSTDNFPELKMYLDKIKEQ
                     DSGFIGDLEINKGKINSSSNNNVTSALNSVTSSLPGKFDDITKVYSGVLDNELPVFII
                     NHSKDYIDKDAINAYILSNPELKNAKIYFEKEDSNKENTKPQ"
     CDS             428452..429837
                     /codon_start=1
                     /gene="tldD"
                     /note="461 aa, similar to pir:D72342 tldD protein from
                     Thermotoga maritima (strain MSB8) (499 aa); 51.6%
                     identity in 467 aa overlap"
                     /note="CPE0339"
                     /product="TldD protein"
                     /protein_id="BAB80045.1"
                     /transl_table=11
                     /translation="MLSKDTIKKVLSVALSTGGDFAEVFVEEKLNNNIVLTSGAVKDI
                     ISGKDYGIGIRIFKGLKCIYAYTNDDSLMSLVNTAKKAALALGDVIDGHTVNLNLVER
                     INTNIHPILYVPSSISSAKKIEKMKEAYKGAKGYNHEISQVTVTMKDEDQRVLIANSE
                     GLFTEDRRIRSRIAISSIASNGVDNQAGTRSPGASMGFEFFDTIDLSNLGREASKSAV
                     TMLHADYCPAGKMTVAIENSFGGVIFHEACGHSLEATAVAKGNSIFCDKLGMQIASKK
                     VTAIDDGTIANAWGSLNIDDEGEPTRRKVLIENGILKSYMIDKFNGRRMGMPSTGSGR
                     RESYKYAPTSRMTNTFIANGEDDNEKIIKSIENGLYAKQMGGGSVNPITGDFNFNVLE
                     GYLVKNGVIDRAVRGASLIGNGSDILMNIDMVGKNLDHGQGVCGSLSGAVPTNVGQPL
                     LRVKEITVGGR"
     CDS             429853..431202
                     /codon_start=1
                     /gene="pmbA"
                     /note="449 aa, similar to pir:E70461 pmbA protein from
                     Synechocystis sp. (strain PCC 6803) (441 aa); 34.3%
                     identity in 428 aa overlap"
                     /note="CPE0340"
                     /product="PmbA protein"
                     /protein_id="BAB80046.1"
                     /transl_table=11
                     /translation="MEFKDFKERLFNRAKELNFEKYELYYGKSESLNITSSNGEVERY
                     GLSTSIGASFRGIYNGKMGYSYTEKLDEESIEILLLKAMECAELVESEDEEFIFGDKA
                     KYVEVNSYDENIISLTPKEQIEKALKLSTEPSKINSEIIKSEYTKFNTAKLERVIVNS
                     EGIDLKEEKTIVQATISPIAKDGENMIVDGASRVSTKLNDVNIEELMKKAINNTLRKK
                     GSTSIKSGKYKVIIDGEVMASLIRTMEDNFLGHIAQENKTLLKDKIGEKVASSKVTLV
                     DDPFLEGGISTCSFDDEGVPTRVKNIIENGVFKGFLHSLKTAKKSKVNPTGNGFKAGF
                     KSTVKASPTNLYIKEGDKSFEELLSSVENGIYIIDLAGLHSGANAVTGDFSLAAEGIK
                     IENGVLTRAIKHITIAGNFFDLLNNIEEVGNDLEESGVTSGYGSPSILIKELSVAGE"
     CDS             431519..433105
                     /codon_start=1
                     /gene="CPE0341"
                     /note="528 aa, partially similar to pir:G75037 probable
                     aromatic-amino-acid transaminase (EC 2.6.1.57) PAB1523
                     from Pyrococcus abyssi (strain Orsay) (390 aa); 33.1%
                     identity in 172 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB80047.1"
                     /transl_table=11
                     /translation="MITKDLEKKLEGLGAFEISSKMLKLAKNNEKHNKFLNAGRGNPN
                     WINTEGRLALGRIVEFGVFESRRTIHEGNLAGYTNLDGIYERLMDFLNGGHEVDKFLR
                     DAIDYSIKTLSVNKDELVKEFVDGAIGNDYPVPNRCLVNTEKILKLYLEKELFGGVKL
                     AKETNVFPTEGGTAAICYIFNSLKENGLIKAGDKIAINTPIFTPYLQIPELKDYEMVE
                     VDLISKEENNWVIEDSELDKLRDKEIKALFFVNPSNPASKALSEEALNHIADIVKERK
                     DLMIITDDVYGTFVENFKTIYSVAPHNTLLVYSFSKLYGVTGWRLGLIAANENNVFDE
                     LISKLPEEKLQDLDKRYGLVTFEPRKFKFIERIVADSRSVGLYHTSGLSTPQQIQMAL
                     FALTSLITKGRDPYIESSKNLVRERYHDLCNTLGIKEDDSRENAKYYSLIDIYELAGD
                     LYDHKFKEYLKENFEPIDFLLRLAEINGVVLMEGVGFGAAPGILRVSEANLPDEAYKK
                     IAKQVLELLSEYYNQYKSQN"
     CDS             433417..433899
                     /codon_start=1
                     /gene="CPE0342"
                     /note="160 aa, similar to gp:MAV011838_4
                     methylated-DNA-protein-cystein methyltransferase from
                     Mycobacterium avium subsp. paratuberculosis (165 aa);
                     46.6% identity in 133 aa overlap"
                     /product="probable methylated-DNA-protein-cystein
                     methyltransferase"
                     /protein_id="BAB80048.1"
                     /transl_table=11
                     /translation="MFMKESLIKKGYYNSPIGILEIIESDGYIVEINFVEDDNCLEEF
                     ISEEIEKCKIELEEYFSGRRSEFSVKVDLAKGTEFQRKVWNALRDIPYGETVSYKEIA
                     EKIGNPKAVRAVGGANNKNPIPIIIPCHRVIGKDGSLTGYGGGLSKKECLLNLENENK
                     "
     CDS             433948..436122
                     /codon_start=1
                     /gene="recQ"
                     /note="724 aa, similar to pir:F69901 DNA helicase recQ
                     from Bacillus subtilis (591 aa); 48.1% identity in 590 aa
                     overlap. 1 putative transmembrane region was found by
                     PSORT"
                     /note="CPE0343"
                     /product="ATP-dependent DNA helicase"
                     /protein_id="BAB80049.1"
                     /transl_table=11
                     /translation="MNRAKEILKSFYGYSEFRKGQEEIINEIINGNDVVAIMPTGGGK
                     SICYQIPALILDGVTVVISPLISLMKDQVDAINSMGIESAYINSTLSNEEINNIFQSV
                     KDGHIKILYVAPERLESMEFLNLVSNIDISQVAVDEAHCVSQWGHDFRSSYKFIGRFI
                     NLLRKRPVVSAFTATATEEVRKDIVKLLELNDPKVFVSGFDRDNLKIIIEKGVNKAHY
                     ILDYLKENKDVSGIIYCATRKEVDYLCELINSRGIGCTKYHAGLSDEERKKNQEDFVF
                     DKVSVMVATNAFGMGIDKPNIRYVIHNNMPKNIEGYYQEIGRAGRDGEKSECILIFSP
                     GDVQTQKYIIETGTLNPERKINELSKLQTMMDLVYSNGCYRRFILNYFGEDLEEDCHN
                     CSNCEMEGELVDKTIDAQKVISCVYRMKRPFGIGVIIDVLRASKNKKIIDLGLDQLST
                     YGIMKDYSKEGLKDFINTLISHRYIDYIGEYPVVRLNQSSIDILKGNEKVMFKEKIKA
                     KRVSKNNELFDLLRSLRREIALEEGVPPYIVFGDNTLKEMSVRIPVNESQLSEISGVG
                     EKKILKYGEMFLNVIKEYVKVNNIEVKWESGLKINKDELEEKFKKSNGKDGKKKSFEI
                     TIDMLREGDKFHTIAKERELSITTVLSHIQQYLEEGNKIDFEIDFDSLFSKREEELVL
                     DAIDKVGYSKLKPIKENLEEDVSYEKIRFIVTKLTINNLRKE"
     CDS             436353..437150
                     /codon_start=1
                     /gene="CPE0344"
                     /note="265 aa, similar to gpu:AP001513_52 BH1779 gene
                     product from Bacillus halodurans (287 aa); 36.9% identity
                     in 252 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80050.1"
                     /transl_table=11
                     /translation="MEIRNNKGYGKLKTVIVCYPCNFKVKGKVQINYPLMYEQYNNFI
                     NLISGEGVKVQLLEPIYGENQVFTRDVGFVIGDTLFISSMSNKERIEETKALEKYIKN
                     HNLKVYRMENKIEGGDVIVYENYIFVGLSKRTSLEAIKELKEYINEYNMGYEIIEINF
                     NKEKMLHLDCVFNILGKDQCIISDYLYDKDKIKKRIKTCYNIDKKTSEELGANIVALG
                     DGRILTSNKTVFHILKKADFEVFYLDYSEILKAGGGFTCSTLYFYIE"
     CDS             437275..438732
                     /codon_start=1
                     /gene="CPE0345"
                     /note="485 aa, similar to gpu:AE004241_1 conserved
                     hypothetical protein from Vibrio cholerae (458 aa); 29.3%
                     identity in 444 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80051.1"
                     /transl_table=11
                     /translation="MFGLSPMYFGVYFFVTALIILGVTLFLKKKLVGKDREFYKVLLV
                     LCIPIIVQNFISTSVNVIDTVMISSLGEESIAAVGVANQVFFLFNMGLIGLTGATGLF
                     ISQFYGSNDRKSIKKVMGLSTILCVGFSFIFFVLAFFFPELIIGIFSTDPKVVELCKN
                     YLVVIAISYPLTALSMVISAGARAVRNPKLGMFCSGASLIINIIFNYCLIFGIGIFPE
                     LGVKGAAISTVFARIIECLLLVGYVILKDKDYIIKFNINDIKGINKDFFKVYMSKGMP
                     IFINDFAWAIGSVSYSVAYAMVGTSAIAASQIATSTANLFIMLAMCIATGAAIMLGNE
                     LGADNTDRAIDYSNKFSKIVFVVGSILGGMLILSIPILLKVYSTSSTMAGDLSKIFVI
                     MGVLMGLKSFNILVIVGILRSGGDTKYAFALEFGCMWLVSIPLTFFGAINGFPIYMLV
                     LFTYSEEIVKAIFGLPRVLSKVWVVNLTKDIEISG"
     CDS             438898..439647
                     /codon_start=1
                     /gene="CPE0346"
                     /note="249 aa, similar to pir:C69661 transcription
                     activator of multidrug-efflux transporter genes mta from
                     Bacillus subtilis (257 aa); 44.3% identity in 246 aa
                     overlap"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB80052.1"
                     /transl_table=11
                     /translation="MYRVKEVSELTGISVRMLHHYDKIGLLRPTAISESGYRLYNDND
                     LKLIQQILIYRELDFSLKEIKEILSDENLDLKETLRIQKQFIIDKRDRLNKIVETIEN
                     TIKDMEEEFNMNKKGLFEGFDIEKHNKLYEEEVENKYGKSDAYKESKVKTSKYSKEDW
                     NNIMGEIDDLYKNLAELMDRDVSDEEVQSLVHQWRMLISKNFYQCSIEMFKGLADMYI
                     YDERFTKNIDKYGEGFTNFLSEAMNYYCNKN"
     CDS             complement(439781..440452)
                     /codon_start=1
                     /gene="CPE0347"
                     /note="223 aa, similar to sp:YEIL_ECOLI HYPOTHETICAL 25.3
                     KDA PROTEIN IN NFO-FRUA INTERGENIC REGION from
                     Escherichia coli (219 aa); 26.9% identity in 201 aa
                     overlap. Also similar to prf:2508375B FNR-like protein
                     from Lactococcus lactis and many transcriptional
                     regulators"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB80053.1"
                     /transl_table=11
                     /translation="MLLVKNEEKLLEVINKYELNSIFSQEIMPFLELHMFKKNEHICF
                     MNEELNYLYFFVHGKAKVYKTLPNGKSLLLEFYEPVQLIGDLELISKIKANCNVKALK
                     SSLCIAIHIQAVNSIALKDLNFLMYITKNLSNKLAQCSVTSSITITYPLENKLASYLL
                     AMNSNNIIMIDNYSNLADLLGTSYRHLNRVLNKLVEKGIILKDKNEIKILNKEELENI
                     CVDLN"
     CDS             441396..444215
                     /codon_start=1
                     /gene="uvrA"
                     /note="939 aa, similar to sp:UVRA_BACSU EXCINUCLEASE ABC
                     SUBUNIT A. from Bacillus subtilis (957 aa); 66.4%
                     identity in 934 aa overlap"
                     /note="CPE0348"
                     /product="excinuclease ABC subunit A"
                     /protein_id="BAB80054.1"
                     /transl_table=11
                     /translation="MKDKIIVKGAKVHNLKNVSLEIPRDKLIVFTGLSGSGKSSLAFD
                     TIYAEGQRRYVESLSSYARQFLGQMDKPDVESIEGLSPAISIDQKTTSRNPRSTVGTV
                     TEIYDYLRLLYARVGVPHCPKCGKEITQQSVDQIVDQIMELPERSKIMILAPIIRGRK
                     GTHEKVLENIKKQGFVRARIDGEIYDLTEDEIKLEKNIKHNIEAVVDRIIVKDGIEGR
                     LTDSIETSLKMAEGLVLVNIIGEEDRLYSEHFACADCGISIDELAPRMFSFNSPFGKC
                     ERCDGLGTLMEIDEDLVVPNKDLSIRGGAISTWGDSRMKEESWTYCVLKALMEKYNFD
                     LDTPYKDLPKKVQEVLMYGEPEKLKVTYTKENVTAVYNHSFEGEINNLRRRYMETNSD
                     TMKAEIEKYMSDNPCPKCKGARLKPEALAVTVGGKNIFEFTSMAIREELDFINSINFS
                     EKDKIISSQIIKEIQSRLSFLINVGLDYLDLARKAGTLSGGEAQRIRLATQIGSQLMG
                     VLYILDEPSIGLHQRDNDRLISTLKQLRDVGNTLIVVEHDEDTMREADYIVDIGPGAG
                     EHGGKIVASGTLDEIMSNENSLTGKYLTGAKKVELPEERRKGNGNFITVKGAKENNLK
                     NVTAKFPLGTLTMVTGVSGSGKSTLVNEILYKGLNKIVNKAKDLPGKFKEITGYENID
                     KIIDIDQSPIGRTPRSNPATYTGTFDIIRELFSQTQEAKMRGYKPGRFSFNVKGGRCE
                     ACSGDGIIKIEMQFLSDVYVPCEVCKGKRYNRETLEVKYKGKNIADVLNMTVEEALEF
                     FENIPRIKNKLQTLMDVGLGYIRLGQPSTQLSGGEAQRIKLAYELSKRSTGKTLYILD
                     EPTTGLHIHDVNRLVKILQRLVDGGNTVIVIEHNLDMIKCADYIVDLGPEGGDKGGTI
                     IATGTPEKIAGAKESYTGKYLKKYL"
     CDS             444550..444984
                     /codon_start=1
                     /gene="CPE0349"
                     /note="144 aa, similar to pir:A70700 hypothetical protein
                     Rv0019c from Mycobacterium tuberculosis (strain H37RV)
                     (155 aa); 31.8% identity in 88 aa overlap. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80055.1"
                     /transl_table=11
                     /translation="MFSKLMTWVFGIIFIVILYSIIYYALKIMYKDVKGGKKKKAPGK
                     KAHGLEVLKTISNGTLGIGSVIPVTSTISIGRREDNSIVLNDQFVSSYHAKIYVKNND
                     FYLEDLASTNGTFINDSKVEGRVRLKVNDQIRMGSTVFKVIG"
     CDS             444998..446227
                     /codon_start=1
                     /gene="ftsW"
                     /note="409 aa, similar to sp:FTSW_MYCTU PROBABLE CELL
                     DIVISION PROTEIN FTSW from Mycobacterium tuberculosis
                     (469 aa); 35.6% identity in 354 aa overlap. Putative
                     N-terminal signal sequence and 8 putative transmembrane
                     regions were found by PSORT."
                     /note="CPE0350"
                     /product="probable cell division protein"
                     /protein_id="BAB80056.1"
                     /transl_table=11
                     /translation="MNTTLKYEKRMLLLVYLLCLALFTNIAVKQTPIDKMAFIIAGIL
                     IIIIGFSHFIIRKFYPDGDKYMLIFASVLAVVGIAVLYRLDPKLAIKQLVWFSLGIAL
                     YMGIVIVMPDLKSFAKYKYIYMGGTLIFMAMAMIIGKTVNGSKNWVYIGSFGFQPSEI
                     GKIFLILYLASALMKYEKKDNIKYEFKQLLEPALVVMYSLGFMVLQKDLGSALMFFFV
                     SITMLYIATCNWKYVGTGLVLFSLGGTVSYFLFSHVKKRVMIWKDVWKYASNESYQIV
                     QGFYAMSLGGMFGTGLYNGYPKLVPFASTDFIFTLIAQELGLVFGIGLLLLYFLLFYR
                     GIRAALNTDDPFSQLNAVGFSTLIVAQVLVIIGGVFAVIPLTGITLPLVSYGGTSMLT
                     VFIALGILQKISEEGLR"
     CDS             446228..447691
                     /codon_start=1
                     /gene="CPE0351"
                     /note="487 aa, similar to pir:T36716 probable
                     penicillin-binding protein from Streptomyces coelicolor
                     (490 aa); 32.8% identity in 473 aa overlap. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="probable penicillin-binding protein"
                     /protein_id="BAB80057.1"
                     /transl_table=11
                     /translation="MAKKKDLSGSIKKVMFVYLVLLVGLISYIAYFQLIQVPKIAEMD
                     SNSAVMAAQNEVIRGEIKDRDGNVLAKSTKSGDLTQKREYPYGEIYSHPIGYASGIYG
                     NAGLEGAYSKELTTYENVSLKAFLKSFNLKKDFKERNESDKKVGNSIVTTLDTDLQKA
                     AYAALGANRGAVVALDPKTGAVLASVSKPGFNPNNMKETYEIANNPNGNPKDAILVDR
                     ALNGQYPPGSTFKVVTLTSALENLPGVTERTFNDTGSINVGTKDLPNENGNAYGNISL
                     RKALSVSSNVIFGGILGEELGNKKLRETAEKYGFNKDLYLGNLKAYSGSFPDRKTVDK
                     GLIAYDAIGQGEVLSSPIEMAMVAATVANNGVRMEPYIVSKVVDKDGDTVKEFSSTKK
                     DTVMSKEQAQIINEYMQGVAKDRINDNWGYFKGMNVAAKTGTAQVPDGNSHAWLIAFA
                     PADDPKIAVATIVENGGSGSKVAAPVTARVMQAYFNK"
     CDS             447848..449710
                     /codon_start=1
                     /gene="uvrC"
                     /note="620 aa, similar to sp:UVRC_BACSU EXCINUCLEASE ABC
                     SUBUNIT C from Bacillus subtilis (598 aa); 42.5% identity
                     in 609 aa overlap"
                     /note="CPE0352"
                     /product="excinuclease ABC subunit C"
                     /protein_id="BAB80058.1"
                     /transl_table=11
                     /translation="MFDFQHQLKILPDKPGVYIMKNSLGEVIYVGKAKVLKNRVRQYF
                     QNSKNHSEKVRAMVKNIAEFEYIVTDSEMEALILECNLIKKYSPRYNIALKDDKFYPF
                     IKITTNEDFPRVYVTRNFAKDGNRYFGPYTNGTAVYEVMGLIKKLFPLRTCKKAIVEG
                     GEPTRACLNYHINLCKAPCAGYISKAEYWEMIDEIINILNGTDTSIIKKLKLEMEKAA
                     EELEFEKAAKIRDRILAIELISEKQKMFTVKEGDEDFIDLYTDEKDGCAQVFFVREGK
                     VTGREHFMIENIGDDPVKEVISSFIASFYGGTAQIPKTIYVPEEIEDQELIEKFLTEK
                     RGSKVWIKVPKKGDKKNLLDMVRNNAKIMLDQFKEKMVEEKELNKSALTELADVLGLD
                     SLPVRIEAYDISNIQGVDSVGTMVVFENGKAKNSDYRRFKIKSVKGPNDYESMREILS
                     RRFSHGLEEVNKIKERNLEYSNGKFCIFPDLIMMDGGKGQVNIALEVLKGFGIEIPVC
                     GLVKDHKHRTRGIILNNEEILIRRGSGLMNLITRVQDEVHRYAITYHRSLRDKRTLHS
                     ILEDIPRIGEKRRRNLLMKFGSIDNIKKASMEELLDTPGIDKRAAESIKQYFSS"
     CDS             449859..450773
                     /codon_start=1
                     /gene="murB"
                     /note="304 aa, similar to sp:MURB_BACSU
                     UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE (EC
                     1.1.1.158) (UDP-N- ACETYLMURAMATE DEHYDROGENASE). from
                     Bacillus subtilis (303 aa); 41.7% identity in 283 aa
                     overlap"
                     /note="CPE0353"
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="BAB80059.1"
                     /transl_table=11
                     /translation="MNQYMEFYKLLGEFYNEEDITVDSPMSEHIYFRVGGPADILVTP
                     VNEEQVVNTLKLCREYNVPYFILGNGSNILVKDGGISGVVIKFNKLNKITTEGNCVTA
                     QSGALLKDVSKAALENNLRGFEFACGIPGSIGGAVFMNAGAYDGEMAHVIKSARVIDE
                     NCNIKNLTKEELELGYRSSIVMKKGYVVIEATVELESGEYASIKDKIDDLTNRRESKQ
                     PLEYPSAGSTFKRPEGYFAGKLIQDSGLKGFSIGGAAVSEKHSGFVINKGGATAKDVL
                     DVIAHVQKTVKENFDVELHTEVRIIGRD"
     CDS             451013..451897
                     /codon_start=1
                     /gene="CPE0354"
                     /note="294 aa, similar to gpu:AP001519_84 BH3569 gene
                     product from Bacillus halodurans (295 aa); 50.9% identity
                     in 291 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80060.1"
                     /transl_table=11
                     /translation="MRFVIVTGLSGAGKTEATRSLEDLGYFCVDNLPPKLIPKFAEAC
                     VQSEGKIDKIALVIDIRGGIFFDDLFESIEYLKANDFNYEILFLEASDEVLVKRFKET
                     RRSHPLSPDGRIITGISEERMRLRELKDRADNIIDTSNYPIRNLREKINLLYGDGKPV
                     EQNLSITVLSFGFKYGIPSDSDLVFDVRFIPNPFYIPELKPFSGEDEPVKNYVLAQEE
                     TKGFLSRLSDMAEFLIPNYIKEGKRQLIISIGCTGGRHRSVAIANALYKDLLCKNFHV
                     TLEHRDINEDINRGDRKL"
     CDS             451894..453240
                     /codon_start=1
                     /gene="CPE0355"
                     /note="448 aa, similar to sp:YAMB_THETU HYPOTHETICAL 35.6
                     KDA PROTEIN IN AMYB 5'REGION (ORF1) from
                     Thermoanaerobacterium thermosulfurigenes (323 aa); 55.7%
                     identity in 300 aa overlap. Putative N-terminal signal
                     sequence and 1 putative transmembrane region were found
                     by PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80061.1"
                     /transl_table=11
                     /translation="MMMKKMLKPGIRVKRYIFLALASIITMAVAIAKLIDERHLTTIH
                     DKAVFIILIIFSGLVGYKSIVWCVKSVVSLVNKGYINLSIEEDDLEDLIEDDRLLIKG
                     PKIVVIGGGTGLSTMLRGLKHYTSNVTAIVTVGDDGGGSGILREDLGILPPGDIRNCI
                     LALANTEPLMNELLQYRFNDGRLKGQSFGNLFLAAMDGISENFEDAVQKMSSVLAVKG
                     EVLPVTLENMVLEAELMNGHRVRGESLIGEEVIDQSSPIKKLKIIPEDAKALDRALEA
                     IEDADAIVLGPGSLYTSVLPNLLVKDISKAIKKSKAFKIYNCNIMTQPGETDGFKVSD
                     HVQVILDHCGKDMVDCIIANSKDISEELKEKYLDKNSELVELDINKLKKMGLCVVDGD
                     LTKVKGDYIRHNSDYLAQLLIETVMEKHLLYDRKKILEYIYLSQRIKKREGSNRKE"
     CDS             453243..454193
                     /codon_start=1
                     /gene="CPE0356"
                     /note="316 aa, similar to gp:SAY14324_4 Staphylococcus
                     aureus partial ORF292 and ORF271, ORF331 and ORF314 from
                     Staphylococcus aureus (314 aa); 46.8% identity in 314 aa
                     overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80062.1"
                     /transl_table=11
                     /translation="MSFSAKVKGEICRYIDISKEEALAQISAIMKVCGTLAFSGRQIS
                     FKMTTENPASARLMFTILKDYFDIHAKLMVKKSNSLKKNNIYMVVVTEEMGVKKLLEV
                     TGILREIDGIMSLDYHIDENLVDTEEKKKAYIRGAFIGGGSISNPEKTYHLEFVTHSQ
                     EYAEDLGKLINTFGLKAKVIQRKNSYIVYIKEGEQIVDLLNIIGAHTALLELENIRIM
                     KEMRNNVNRLVNCETANLSKTVNAAVRQVESIKLIEREIGLARLPKNLREVAELRLTY
                     PEESLKELGEMLEPPVGKSGVNHRLRKIEKIAEELRTGNF"
     CDS             454367..454921
                     /codon_start=1
                     /gene="CPE0357"
                     /note="184 aa, similar to C-terminal of prf:1711414A  
                     USO1 gene from Saccharomyces cerevisiae (1790 aa); 29.7%
                     identity in 148 aa overlap. Putative N-terminal signal
                     sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80063.1"
                     /transl_table=11
                     /translation="MARNFKKTIWLLVGVMIFGIIGMVGCTKKTNEMTENSGLSATTP
                     AEYKTMLEEKIKTYIGDVNLGTEYDFSKVTEDTKQATYEEYEKYYKNLDTELINLKNE
                     LNSKVSPSDGKVNDANRKIVESIDNLKMSISTVKSDLDANRNKILAMPKDEFIGAMKD
                     IEKSAYDARVKVQESIDAAKNSFK"
     CDS             complement(455050..456294)
                     /codon_start=1
                     /gene="CPE0358"
                     /note="414 aa, no significant homology. 1 putative
                     transmembrane region was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80064.1"
                     /transl_table=11
                     /translation="MIDDFDRKLFEMARESKVKEPNALKYKVDYTFKKLKKNKFNFRH
                     LGSIAAILIFCILSVGIYFPTYAMNIPILGDVVEILSNKFNLSGYEINAQNLNYQVSN
                     EDYTLTIESAYYNGLETTFFFKIKGNAKLNKSGQYFFEANFKYNEDISYEGGLEKGEF
                     IDDYTFAGMMTFYINPYSESKLPEKFNIKFSIPNIIADSEILAVNSDTLNLSFDITDL
                     NVKETKINKEIQANENSILISSIKKYPTSIVIDYDEKFNNPENKLSFILWHETLGQIN
                     YLLPSTPGKLFIVPKTRSKLNVDNLIKESMPLSIGETKTFGKVGKVSIENIETKDGKT
                     YISIRKTGDINSYDFNIIKKENINSKLNMYEYETKVIGILDTLTTYVIPDFTSDIDYL
                     LEYEYISNDDIEILYDQIIEIN"
     CDS             complement(456308..456844)
                     /codon_start=1
                     /gene="CPE0359"
                     /note="178 aa, similar to gpu:AP001509_58 RNA polymerase
                     ECF-type sigma factor from Bacillus halodurans (177 aa);
                     30.3% identity in 142 aa overlap"
                     /product="probable RNA polymerase ECF-type sigma factor"
                     /protein_id="BAB80065.1"
                     /transl_table=11
                     /translation="MLELISFFNKNSFNKVSYKKLTKERLSQNFELLIKENLTSMYRV
                     AKGILKVEEDIEDAIQTTILIAFNKINTLKDERYFKTWLIRILINECNKIYKKNKNTP
                     KELSSELYITENYENIDLYDAIKCLKEDLRVITILFYFEDMSYKDIAVALNIAEGTVK
                     SRLFRAKEALYEILKDNI"
     CDS             457313..460891
                     /codon_start=1
                     /gene="dnaE"
                     /note="1192 aa, similar to sp:DP3A_BORBU DNA POLYMERASE
                     III, ALPHA CHAIN (EC 2.7.7.7) from Borrelia burgdorferi
                     (1161 aa); 41.7% identity in 1174 aa overlap"
                     /note="CPE0360"
                     /product="DNA polymerase III, subunit alpha"
                     /protein_id="BAB80066.1"
                     /transl_table=11
                     /translation="MGDKKFCHLHLHSGYSLLDGSGKIKPLIKRAKELGMESIALTDH
                     GVMYGCVDLYKEAKAEGIKPILGCEVYVVPKSRKIKSNDEDNKTYHLVLLVKNEKGYE
                     NLMKIVSVASIEGFYYKPRIDREYLKEHSEGIIALSACLGGEVQKAILNGNIDKAREA
                     AIFYRDTFKDGFYLELQNHGIEEQKKVNEVNIQLAKELNIPLVATNDVHYINQEDSKA
                     HDILMCIQTGKTVDDPNRRRYPSDQFYLKSPEEMWDMFDYIPEALENTLKIAEECNFD
                     YEFHVSKLPKFPLPEGVEPFEYLRKTCFDGLIDRLEELKPLKEKGIYDIDKVYEIGEN
                     NDKVKEDIERLEYELGVIKQMGYVDYFLIVWDFIKYANDNGIPTGPGRGSAAGALVAY
                     TLGITKIDPMKYSLLFERFLNPERVSMPDIDSDFCYEGRQRVIDYVVEKYGHDNVSQI
                     ITFGTMAARACIRDVGRAMNYTYAEVDRIAKQIPTVLGVTIDKALDLNPELKTIYDTE
                     ERVRELIDVSRRLEGLPRHSSTHAAGVVIASQPLVEYVPLQKNDESIVTQFDMTTLEE
                     LGLLKMDFLGLRTLTVMRDAVDMIKYNRGVDIDLDNLDFDDKEVYKMIGEGNTVGVFQ
                     LESAGMTSFMKELKPDCLEDIIAGISLYRPGPMAEIPRYISGKRDPKSVEYIVPELEN
                     ILNVTYGVMVYQEQVMEIVRKLAGYSMGRSDLVRRAMSKKKHKVMEEERKNFIYGIED
                     ENGNIEVPGCLRNGISAEAANKIFDSMMDFASYAFNKSHAAAYAVIGFQTAYLMRYYP
                     VEFLAAMLNSVMGNSDKVSEYIRSAEKLGIQVLPPDINESYTKFTVKGDTIRFGMGAI
                     KNVGVNVVENIAKSRDEKGKFTSLMDFCNKIDLSIVNKRSVESLIKAGTFDSLKVYRS
                     QLLSVFEKIMDGVYSQRKKNIDGQMSLFGALQEESESNLEIRYPNIKEFNKKYMLAME
                     KEMTGLYMSGHPLDDYEKPLKEQTSITIEKIIEAQKNLNEQKNVELEDLVLDSSLTDG
                     TRVIIGGILTNVSRKVTRNNTLMAFAKVEDLTGYLECVIFPKTLEKCNALVNEDSFVL
                     IRGRVSLKEDEEPKILCEDIQPLELINSSKVYIKVEDREKANMIVKPLRVLLSQYKGD
                     SPVYIFAAKEKASFRLNRDMWVDLDTDVIDFLISKFGEGNVKVVEG"
     CDS             461602..462561
                     /codon_start=1
                     /gene="pfk"
                     /note="319 aa, similar to sp:K6PF_CLOAB
                     6-PHOSPHOFRUCTOKINASE (EC 2.7.1.11) (PHOSPHOFRUCTOKINASE)
                     (PHOSPHOHEXOKINASE) from Clostridium acetobutylicum (319
                     aa); 70.2% identity in 319 aa overlap"
                     /note="CPE0361"
                     /product="phosphofructokinase"
                     /protein_id="BAB80067.1"
                     /transl_table=11
                     /translation="MKKIAVLTSGGDAPGMNAALRAVTRMALHHGLEVMGVQRGYAGL
                     INGELFKMDRKSVSEIINRGGTILRTARCLEFKQEEVREKAAQILKAYGVEALVVIGG
                     DGSFMGAKLLSKLGVKTVGLPGTIDNDLSYTDYTIGFDTALNTVVDAINKLRDTSTSH
                     ERVSIVEVMGRNCGDLALYAGIAGGAEAIIVPEMPFDKDELIKTILEGRTNGKTHSII
                     VVAEGVGGSAELAKEIESVTGIETRATILGHIQRGGSPTADDIVLASRMGAKAVEVLL
                     EGKTSKVIGIKENRIFDMDIDEALDIERSFDESLYEMANAINK"
     CDS             462655..464058
                     /codon_start=1
                     /gene="pykA"
                     /note="467 aa, similar to sp:KPYK_BACSU PYRUVATE KINASE
                     (EC 2.7.1.40) (PK) (VEGETATIVE PROTEIN 17) (VEG17) from
                     Bacillus subtilis (585 aa); 56% identity in 466 aa
                     overlap. 1 putative transmembrane region was found by
                     PSORT"
                     /note="CPE0362"
                     /product="pyruvate kinase"
                     /protein_id="BAB80068.1"
                     /transl_table=11
                     /translation="MRRTKLVCTIGPASENEEILTKIIEAGMNASRHNFSHGDHEEHK
                     GRMVKVREISKKLGKEVAILLDTKGPEIRTGKFEPSKVELTAGTEFTIYAGAEDVIGD
                     TTKCSVTYAGLAKDVKAGDTILIDDGLVGLEVVSVEGNAVKCVVRNTGLVGTHKGVNV
                     PGVSIKLPAMTDKDRADLIFGCEMGVNMVAASFIRKAEDVKAIREVLVANGGADIQIF
                     SKIENQEGVDNIDAIIEASDGIMVARGDLGVEIPMEDVPSVQKMIIEKCNNAGKPVIT
                     ATQMLDSMMRNPRPTRAEVSDVTNAILDGTDAIMLSGESANGSWPVEAVETMVKIATK
                     SEEMLSYELASSKAKKHIPAVPGVISRAACNAAHELKSAAIVSLTQSGATAKRISQCR
                     PDAPIVTVTPNERVAKKVALCFGVYPVVAENATMENAVEIAKNAGFVKANDTAVVVAG
                     VPANEGNTNIVKVEVVK"
     CDS             464641..464997
                     /codon_start=1
                     /gene="CPE0363"
                     /note="118 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80069.1"
                     /transl_table=11
                     /translation="MTRLACSAHNCVNYVNGMCSALTIEVDGESAENKQETCCNTFAP
                     RTFVNAIKSAFNTNYAGTIMQALDSQEDVDHKIKCYAMNCTYNVGMTCTSTDIQVFGP
                     EATTSTSTECETFYKK"
     CDS             465305..466102
                     /codon_start=1
                     /gene="CPE0364"
                     /note="265 aa, similar to pir:T35593 probable
                     dehydrogenase from Streptomyces coelicolor (257 aa);
                     32.4% identity in 210 aa overlap"
                     /product="probable dehydrogenase"
                     /protein_id="BAB80070.1"
                     /transl_table=11
                     /translation="MNELGKIAVITGATSGIGKEYAFQLAKKGYDLILVGRRVEKIKT
                     VAEEIENNFKVKTHVEILDLTDDNKLDDFIKRLEKKDNIEFLVNNAGYGADDSFTRDE
                     YSKQYDMAKVHMLVTMKLCHSLSKKMKENNKGYIINVSSMAGFNVFPSSAMYCSTKAF
                     LISFTQCLAMELLENNIKVQCLCPGFTRTDFHSKLNMEESKLQNKGFVRWMSTREVVE
                     ISLKNINKKLKVIVIPGFCNKFLYFVSKFTPRWLYYKVAIKGWELMD"
     CDS             466277..467812
                     /codon_start=1
                     /gene="clsB"
                     /note="511 aa, similar to sp:CLS_CLOPE CARDIOLIPIN
                     SYNTHETASE (EC 2.7.8.-) (CARDIOLIPIN SYNTHASE) (CL
                     SYNTHASE) from Clostridium perfringens (476 aa); 34.1%
                     identity in 451 aa overlap. Putative N-terminal signal
                     sequence and 2 putative transmembrane regions were found
                     by PSORT."
                     /note="CPE0365"
                     /product="cardiolipin synthase"
                     /protein_id="BAB80071.1"
                     /transl_table=11
                     /translation="MEKFLKKLLSRAFIVGFLIFIQFVILMGAIWKVSEDFIYVYFLF
                     IFISIVVFIYIVSRKDNPSYKLAWAVPVLLVPVFGGLFYLIFGGNKTSKKFRKQIKAS
                     YDETAHLLYDDRTVLEELENLDKSIANQSRYIADYSQFPVYKNTTTEYLSPGEVFFER
                     LKEELKKAKHYIFMEYFIVHEGVMWNSILEILEEKVKEGVEVRFVYDDMGCLGTLPYK
                     YNEVLEAKGIKCMVFNPFVPLLSLRMNNRDHRKITVIDGHTGFTGGINLADEYINEIV
                     RFGHWKDASIMIKGDAVWNLTVMFLQIWNFYSEGKEQYEKYYPYFHHEDEFESDGYVQ
                     PYGDSPLDDEIVGENVYLNIINKAKDYVYINTPYLIIDNELVTALTLAAKSGIDVRIV
                     TPHIEDKWYAHIVTRAYYPQLIESGVKIYEYTPGFIHSKTFVSDDEIGIVGTINMDYR
                     SLYLHFECGVWLYKTKSVGQIKDDFLKTLEKCQRITLEDCAKVKVPTRILRSIIRVFA
                     PLM"
     CDS             468439..470001
                     /codon_start=1
                     /gene="CPE0366"
                     /note="520 aa, similar to pir:B69780 transcription
                     regulator GntR family homolog ydfD from Bacillus subtilis
                     (482 aa); 26.7% identity in 475 aa overlap"
                     /note="GntR family"
                     /product="probable transcription regulator"
                     /protein_id="BAB80072.1"
                     /transl_table=11
                     /translation="MFKNLTFNENEKKYIQIARYIRELINRGVLIEGSKLPSSREISS
                     ILSIGRNTIMSAYEILESEGLVETIKGKGTFVKKEFSNEKSNKVSSMKKENSEIKEDN
                     KWNIDWKYKTNEYGVLAESLDIIKSEEKWEKGMISFKSIAPPGNLFNIEELKRSFSNR
                     IALEKHKIVNYGYAVGYKPFIDYLKDYMKEKGAYSEEKEVIVTNGFTEGLDMMLSAFT
                     KEGDYIFCENPTHNTALKIMKTHKLNIIGVEMTKDGMDIEDLNKKIKKFGEKIKFSYL
                     IPSYHNPTGVVASIKKREEVYNVLKDAGIPIIEDGFNEELLYESSPTIPLASLDRESN
                     GVIYIGSFSKILFPGLRIGWVYGDKKIIGILESVKRCRNIHTSFLDQGILYDFMISGA
                     FEKYIKKVRKVYKEKYKFTKSVIEKYIKEAEIWGEGGLYMFLKIKGVDTRELLKRCYD
                     RGVLFMPGDLFYIDKDLYLEKENRVFSLEGHNIKGREKRDTLRIGFTRLSEEEIEKGI
                     KIIGEEVKSILT"
     CDS             470131..471498
                     /codon_start=1
                     /gene="CPE0367"
                     /note="455 aa, similar to gpu:AP001509_125 RNA
                     methyltransferase from Bacillus halodurans (458 aa);
                     50.8% identity in 451 aa overlap"
                     /product="RNA methyltransferase"
                     /protein_id="BAB80073.1"
                     /transl_table=11
                     /translation="MVEKNKEYIFDIISQGYEGEGIAKIDNKYPIFIEGALKGEKVKV
                     RIVKVNKNFAYGKLMEVLEASEERVNPPCAIYKRCGGCKLQHASYKAQLDFKWDRVKD
                     CVSKIGKLDPSIVKYPLGMENPWRYRNKVQLPIGLINGEVKIGFFAPRSHDIIDMESC
                     LIQDEIGDKVVKLTREWIEKFNIRPYNVDGEYDEKGIVRHIMIRRGFTTNEVMVVLVT
                     NGEKLPHKEEFVDLMVKNIPGIKSVIQNINSKKTNVILGLESKTLWGEDTISDYIGDF
                     RFNISPLSFFQVNPIQTEVLYGKALEYANLTGNEEVFDAYCGTGTITLFLSQKAKKVY
                     GVEIIPQAIDNAWINAKENKVENVEFFVGESEVVIPDLINKGVKADVVVVDPPRKGCD
                     KKLLDAITNIDAKKIVYVSCDPSTLGRDLKVLEENGYKTLEVQPVDMFPNTAHIENVA
                     LLIKK"
     CDS             472441..473340
                     /codon_start=1
                     /gene="CPE0368"
                     /note="299 aa, no significant homology. 1 putative
                     transmembrane region was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80074.1"
                     /transl_table=11
                     /translation="MERINLKKCALCDRETDLQLSHIIPKFVGRHLKKTSIGNIRNLE
                     DHNNIIQDIEKHYMLCHDCEELFSASERWFANNVFYPWQKDKKDEIQYNKYLHYFITS
                     LSWRSLYLDILFHVKNNDIDILSLNKMIESEKIMKEYLLNNREDIGLIENHIFFFDRV
                     EEVVSKNDKTFYLSPHVTVHRSITSYSVTSGDTIFTVSNLMGIIVVTLYYKGIGEKWS
                     GTKIKCGAGLLSAKNQIMKSVVGGEISYWLQEAEKKSKSLNSEQKKKIIDKINAVKKS
                     IKDYQIYDDINCDIRLRKNNLLD"
     CDS             473520..477425
                     /codon_start=1
                     /gene="CPE0369"
                     /note="1301 aa, similar to pir:H69898 hypothetical
                     protein yobI from Bacillus subtilis (1201 aa); 28%
                     identity in 1236 aa overlap. ATC start. Putative
                     N-terminal signal sequence and 4 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80075.1"
                     /transl_table=11
                     /translation="MNIKFIINLLLINIILLALNLKKNSEIWTKIKRYVASKYKFVIE
                     KISLFINLCISLLAKINNNILKKLDYKKEYESLTPKDNLEKSNSYIKALKESIDDLKR
                     KNIAISGIYGSGKSSIIESFKQQYKEYKYLDISLATFISSEENKLEEELERNILNQIF
                     YKVSYDKMPYSRFRKIKNIRFLHIFKVTLIFISLILSLSLLIKPELIEKFTSNVSKLK
                     ELFSTIPILKYNVNLSLIIVICLCVITILYTTMILIKFILSKFTINKIQTKNGNVQLA
                     KREESETFNKYLDEIMYFFESLKYDIVFFEDLDRFDNLEIFTKLRELNTLINKAESIS
                     RKVTFVYAIKDEIFFIKEDLEDEDEYKYIDKKEMNKNRTKFFDFIIPVIPIVNGENSY
                     EILSKKIEQFNKKYGVQGSIISKELLSDLSMFIDDMRLLTNIYNEFLIYYKKLVIERK
                     NKTLSSDNLLAIIVYKNLYPVDFTKLQNREGMVYNVFSEKNDIADRAVHKLNKEIKEC
                     RTNIYHLEKEILENEEELYLIYNNEWISNKMNFIRTPNKTYSIDKISDFNVIEELKNS
                     NSIRWSVSNDYYTNDYKNISFENFMTINGKKLNLYNRLIAIKSKGKNIEEKIKYNQNR
                     IQAIEEKIKEFKNNSVATLMKDERFFDCLDEKIKKEALIIRLLKYGYIDEMYSYYLLY
                     FYEGRLTQKDFEFVQSVIYNKPLNCEFKLENINEILVKFRIEDFESKAILNYDLIKFL
                     SENVYIDINKMRLKKIVGILSELKIEDINFIMDFIYKNGEIDSFIELLCKNINNFWNN
                     IYENSYLPSEKKDYMLELLFKYCSIEDILIQNNEGYIKEYIELNSNFLKTIGIKIEKT
                     KLKDILIKLNIKLKDIDQDIVDDIKNQSNKKYMSVFEDIYYNNLYDLNIAIVSKIIFI
                     ENKNIENISDVELSYSFISKNELNYLIKYIDNNINLYIRNIFIEPIVIENTETIIDIL
                     NNEEVDKDLIDNIVNNKQFKVDDINKIENIDIWNLIFDNLKVNSSWENILSYYKTNNS
                     IETCLGGFINNPEVCKELLKDTLYKESINNDEKEIIDLFVEKFVMSKIISDEIVDLLS
                     CKLGITFTDFDFEDMLDSRILVLINKNLIALTESIYRALKNDYHGLHINLIEKNIDQF
                     ISGNIQDFDSNDMESILKSEKISKENKYDIIKLYGEDIEINDSLAEIIFDIIEKFLPD
                     EEIKYKLIEDIIRCQFDKEKRIKLIAYQIDFIDKMNISNLLSYIDKEYDGLLDLSHKK
                     MYIENTNANRLILGKLKSKKYISTFNPERSRIVVNRRRT"
     CDS             complement(477962..478819)
                     /codon_start=1
                     /gene="CPE0370"
                     /note="285 aa, similar to pir:A42400 probable
                     transcription regulator msmR from Streptococcus mutans
                     (278 aa); 32.8% identity in 271 aa overlap"
                     /note="AraC/XylS family"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB80076.1"
                     /transl_table=11
                     /translation="MSKFETYVFNNENYIDLKPIQFGSEKCDPLHSVGPTVKNNYLFH
                     YVISGKGKFFSVDPKTFEKKYYEVSPGEGFLICPNEICSYQSDENDPWHYMWIEFNGI
                     KAKLYMEEAGLTPANPIFKLKESINSLKIIEEMKSIISNNKKNPSFLIGHLYLFINSL
                     IEFSLNSTLNELDTLNELYIREALNFIEENYNRNISVEDVSNRCNLSKSYFTRIFKKH
                     MNTTPQEFLIQYKMLQACNLLKDKSLSISQVAELLGYSNQFNFSVAFKKKFNLSPSKW
                     RTTFINNIS"
     CDS             479008..480276
                     /codon_start=1
                     /gene="CPE0371"
                     /note="422 aa, similar to gpu:AP001513_137 BH1864 gene
                     product from Bacillus halodurans (461 aa); 30.2% identity
                     in 420 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80077.1"
                     /transl_table=11
                     /translation="MRKRFKLVALSLCTLFLAGCGSKGQEKVGKSNDGTVTLSYAIWD
                     SGQEKGLRKLADEFESKNPNTKINIQVIGWNDYWTMLEAAATGGSLPDTFWMHSNEIH
                     RYGSNGMLLSLNDYIKNSEVVDLKNFPEGLNEIYNINDNQYAIPKDFDTIGLWYNKKM
                     FDEAQIPYPDETWNWDKLYEVSKKLTKADGSQFGVLAPLHNQEGYYNFVYQNGGDIIT
                     DDKKSGYDNPKTIEAMNYYFNLSKEGLSPKIFNDKERAEALQNGQAAMGFFGSWNLGS
                     FADNEYMAKNFDVTVLPSSNDGKRATIFNGLGNAISAKTEHPEEAWKWVEYLSSKEGQ
                     EKQGELGIAIPAYNGAADIWAKNNTTFNTKAFVDMLDYAQIRPYSNSTAKWEDKATEI
                     LKKAYLQDMSAEEACKETAKMMNDYLNQEK"
     CDS             480350..481276
                     /codon_start=1
                     /gene="CPE0372"
                     /note="308 aa, similar to gpu:AP001513_138 sugar
                     transport system (permease) (binding protein dependent
                     transporter) from Bacillus halodurans (309 aa); 35.1%
                     identity in 291 aa overlap. 6 putative transmembrane
                     regions were found by PSORT."
                     /note="permease"
                     /product="probable ABC transporter"
                     /protein_id="BAB80078.1"
                     /transl_table=11
                     /translation="MELRKNNLFKRLFVPNRKRKEWIWGYFLVAPTIIGLIILNIIPI
                     FQVLKMSFYKSGDFGRNDIFIGFENYIRLLGDEQVWQATINTLKYTFFVVPLNVIIAL
                     ILATILNKKIKGRDIYRTIYFIPMVATPAAITMVWKWLYNTQFGLINHLLGKIGIPKI
                     DWINDPKIAIYSIIIIGVWSTIGYSMVLILAGLQEIPKDYYEAATIDGANSVNQFFNI
                     TLPLVSPTLFFVIVTNIIQSMQVFDVIYMMIDITSPAYDKTVSLVYLFYNNAFKYSDK
                     GYGSTIIILLLIIILIFTFIQMKLQKKWVNYM"
     CDS             481293..482120
                     /codon_start=1
                     /gene="CPE0373"
                     /note="275 aa, similar to pir:A56641 probable membrane
                     transport protein from Clostridium perfringens (275 aa);
                     68.5% identity in 251 aa overlap. Putative N-terminal
                     signal sequence and 5 putative transmembrane regions were
                     found by PSORT."
                     /note="permease"
                     /product="probable suger ABC transporter"
                     /protein_id="BAB80079.1"
                     /transl_table=11
                     /translation="MEGKKISRIFMHLFLIIIAIIMILPFVWMVLTSFKSVTESTQMN
                     PFVIFPSQWRIENYIEVIKGNDFLALYINTFLMMIFRVICSVLFSAMAAYAFARLEFP
                     GRNFLFGLVLFQMMIPAQVFIIPQYLMIDQINMRNTIFALVFPGLVSAFGTFLLRQFF
                     MGLPKELEEAAYLDGCNIGQTFFKVMLPLAKSGLVALSIFTALFAFKDLMWPLIVNSN
                     TDAATLSSALSKIQSAYSVNYPQLMAASVLAIWPMLVVYIIFQKQFIEGIATSGGKL"
     CDS             482148..484355
                     /codon_start=1
                     /gene="aga"
                     /note="735 aa, similar to gp:AF038547_4
                     alpha-galactosidase (EC 3.2.1.22) (melibiase) from
                     Bacillus stearothermophilus (743 aa); 52.4% identity in
                     735 aa overlap"
                     /note="CPE0374"
                     /product="alpha-galactosidase"
                     /protein_id="BAB80080.1"
                     /transl_table=11
                     /translation="MPIIFHKELKEFHLYNKEISYIIHILPNGHVGNLYFGKKIDPYK
                     TYNHLFEGIYRPLAAYVYEGDNKFSLQNTRQEYPTFGLSDFRKGAFLIKQENGSEISD
                     FKYESHKIIEGKLKLKGLPQTYVENKEDATTLEITLLDEVIKSKLKIYFTIFEDRAVI
                     TRSASFLNLSNKTINIEKAMSFNLDLPDSNYNMIQLNGAWGRERHVYDRSIKEGTQGF
                     YSLKGASSAEFNPFLALRRPNTDEFSGEVIGFSLVYSGNFMAEIDVDTYNQTRIMMGI
                     HPERFSWPLNLNEEFYTPEVVIVYSDKGLNYMSQVYHSLYRECLMRGKWKNSVRPILL
                     NSWEALSFSIDEEKIKELATNASKLGVELFVLDDGWFGKRNNDNAGLGDWTVNKEKFP
                     NGLNEIIEYINKLGMDFGIWIEPEMVNKDSELYRSHPDWIIYDPNRKPSHTRNQYTLD
                     FSRDEVVDHIYNQIEKLLSYYNISYVKWDMNRYITECYSKDKGANLQGTVYHKYILNV
                     YKLYDKLTTRFPNILFESCSSGGARFDPGMLYYAPQTWTSDNTDAMERIKIQYGSSLV
                     YPLISMGSHVSESPNQQVFRETALETRANVAYFGNLGYELDVNKLSDVEKEEIKKQIQ
                     FYKENREVFQFGEFYRIKNPYNNNISAWMVKSNDEKTIILGCYKLLNHANEGKERVKL
                     FGLDKDGDYKLSYPYEKEFKGDELMNVGISMNDDYFCNSGNDFSSVLYLLRKI"
     CDS             484394..486931
                     /codon_start=1
                     /gene="CPE0375"
                     /note="845 aa, similar to gpu:AB038772_1
                     endo-beta-galactosidase C from Clostridium perfringens
                     (845 aa); 97.2% identity in 832 aa overlap. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="endo-beta-galactosidase C"
                     /protein_id="BAB80081.1"
                     /transl_table=11
                     /translation="MKFFSKFKKVNVFLILFAFIGTIFLSSFSKLVLADENEYVLTNV
                     LNGLIPTTNSKYMIISGDSTVPQVSILHPDSATDGDNSSSNDDSLNTKVIVGEETGGL
                     DNGYSKWGSVFLQYDFKKIRPVKEIKIYRNTYDNAISTFKDVKVELSTSPNFEKDNTS
                     VVFEKQDIIESRESKGNPQIISLDKAIDAQYIRIWGKGHYIENTNSSWKGYSNGNLYN
                     EIEVMANVPKSEVPSQPDNIQPRNLASGKLPYVYGLEPSNIEAITDGKIDDNYAVHNS
                     MGNNWLQFEYKNTYKFNSIKFKLEPGNYKSVKVAISNSPNNGFKEVFSKINWTQNNDL
                     EVINLPSNTKGRYIRFTIDKDGKSKTKYSEIEIWGTGNNYDESKDEYVEPQSKYNELV
                     WSDEFNGEKIDENKWTIIDGMVNHGAIYNRGAVSIKKDGNNSYLAINTKNFNSTEELI
                     KAVGVDNYLGQSINKQKVTWSSGRIESKNKYSFQFGRMAVRAKVNDSQGIWPAIWMLS
                     QDETGHDEIDVLEYLGQDPWGAWTTNHFGILGKNKASNGIRNSNYEAWSQDFHVFEVE
                     WDPEFIKWYIDGKEVFQSTQGRDDGRDGMHTRPMFPILETQVGDGWVGDVDYNKQNTK
                     QNSDYLIDWIRVYQMPNQANVKFDDLRSLDKKENKGYEVTPYSHTNNLIKLSDGDLNE
                     ENKDNFYYGGQPRLENNRIAVGENGGRESIIYNVTNVKDIHLTTYYQTIEDKITWNRS
                     AGAYEGYSIRSSLISGNIDFKLFTSDDGEIWNEVRNVKIVDNFVEKHPGYARTTFDAY
                     NLPKNTQFIKIEFPQYKNVKYRLNSGAIKDVKNTDIQLAKVTFLQNK"
     CDS             487133..487684
                     /codon_start=1
                     /gene="CPE0376"
                     /note="183 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80082.1"
                     /transl_table=11
                     /translation="MSNLDCFLSLLIGNFDNSEQFKDFENNGVKDFPFAEHVNTVCNN
                     KIKNLPENFKGKFLLEESYYTSNGKTHASPHLFLFTEETKGIKLTSYEIPQGYDKKSF
                     NYENMNLIDYSDLKISEKFTPAFYVFKENFWGGGSVSNFSPIMKFTLFERFSEKQLEV
                     SETIEVNGKRTFGYDDPIIYKRK"
     CDS             487803..488381
                     /codon_start=1
                     /gene="CPE0377"
                     /note="192 aa, similar to gpu:AP001518_225 BH3394 gene
                     product from Bacillus halodurans (186 aa); 25% identity
                     in 180 aa overlap"
                     /note="TetR/AcrR family"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB80083.1"
                     /transl_table=11
                     /translation="MAQQYTKKMIRSVFIELLNERPLNKITVKDIALACGINRNTFYY
                     YYSDMYELLSELFQTELQNVIDEYNDTMSWEESFVLATRFALGNKKVIYHVYNSMQRE
                     ELVNYIYNVSGNMMERYVKKLSHGINASEYDMKLIATFYQCALTEMVIQWISSGMKED
                     PDAIIRRIGKLFDGNIKLSLQRSEEFNKIGEK"
     CDS             488731..490524
                     /codon_start=1
                     /gene="CPE0378"
                     /note="597 aa, similar to gp:SPU09352_2 67 kDa
                     Myosin-crossreactive streptococcal antigen from
                     Streptococcus pyogenes (590 aa); 44.8% identity in 585 aa
                     overlap. 1 putative transmembrane region was found by
                     PSORT"
                     /product="probable myosin-crossreactive antigen"
                     /protein_id="BAB80084.1"
                     /transl_table=11
                     /translation="MKLKTHDDRLTLTNGSYHALVHARKPKGIENKSAYLIGTGIGAL
                     AAGCFLIRDAHMDGSKITFFEQLDLPGGSLDGEVLQNLGYVARGGREMGHHFEVLWGL
                     FSSLPSTEDPNMTVLDHFFYTNYDDPNYSNCRITHKNGERYDNAKFNLGQDLAKELAE
                     FVLIPDEELQDKSIDEIFSEELLNTDFWTLWRTMFAFENWHSALEMKLYMNRFIHHVG
                     GLPTLSALQFSRHDQYTSFVKPMVKFLKENGARFEYGVHVENVEFDISDDKKVAKKIV
                     AKDKNGKDISVNLTENDLVFITNGSMTEGSGYGDDNTPAPFNKEPQGCWELWRNIAKQ
                     SDEFGHPDKFCTDTEKSNWESCTVTCHDERVPKYIEKITKRSPYGGKTVTGGIVTAVD
                     SSWLMSWTINRQEQYYGQPEKDVVVWVYGLFSDVEGDYIKKPMRDCTGKEITKEWLFH
                     IGVPVDEIEELAESCTAIPVMMPFITSQFMPREFGDRPYVVPKNAVNFAFLGQFAETL
                     DDPGRDTVFTIEYSGRTAMEAVYVLTGVEKGVPEVYASRYDIRYLLNAGVCLLDGEKP
                     KLDLPPLAKRKVMKQIAGTDIEKLLKEYGII"
     CDS             490919..492652
                     /codon_start=1
                     /gene="CPE0379"
                     /note="577 aa, similar to gp:SC7A8_2 putative ABC
                     transporter from Streptomyces coelicolor A3(2) (577 aa);
                     39.1% identity in 575 aa overlap. Putative N-terminal
                     signal sequence and 5 putative transmembrane regions were
                     found by PSORT."
                     /note="ATP-binding protein"
                     /product="probable ABC transporter"
                     /protein_id="BAB80085.1"
                     /transl_table=11
                     /translation="MKLILKYLKNYKSIFILNFISVFGFALVELGIPTIMAKVIDIGI
                     INNDISYIKKMGLVIVVISIVGVMGTILLGYCSSKISTGITKDIRNDIFKKAQEFSHT
                     EYDEFGVSSMITRTTNDPFVILQFTNTLLKMALITPVMFTISLVMILKTSLSLSLVLA
                     VVIPIIILGVILIAKTSEPLSEKLQKRLDKLNRISRENLTGIRVIRAFGNEKYEEKRF
                     DETNESYAEVAKKLNKLMAISQPLFFFLLNIAIIVIFWISSKMINVGTLQVGQLVAFI
                     EYLFHAMFSIMLFSMVFVMYPKAQVSANRIMEVLNTEPIIKSPKNGIKDTENKGTIEF
                     ENVSFTYPNGEEPVIKDVSFSGKKGEVIAFIGSTGSGKSTLINLIPRFYDVTKGSIKI
                     DGVDVRDYDLKYLRKKIGFIPQKTLLFTGSIANNIKFGKKDAEYKEVEDSAKIAQAYE
                     FISNKPNKFDEIITEGGSNVSGGQKQRLSIARAIVRKPDIYIFDDSFSALDFKTDAIL
                     RKELRSETKDAIVLIVAQRIGSIMDADKIIVLNEGEVVGIGTHKELIKNCPIYHEIAT
                     SQLTEEELANE"
     CDS             492645..494426
                     /codon_start=1
                     /gene="CPE0380"
                     /note="593 aa, similar to gp:SC7A8_3 putative ABC
                     transporter from Streptomyces coelicolor A3(2) (642 aa);
                     46.1% identity in 532 aa overlap. Putative N-terminal
                     signal sequence and 6 putative transmembrane regions were
                     found by PSORT."
                     /note="ATP-binding protein"
                     /product="probable ABC transporter"
                     /protein_id="BAB80086.1"
                     /transl_table=11
                     /translation="MNKFKSVVKKISPFVGKYKWAFLGAILFIISAAVFTAIAPRTEG
                     LIITQLTKDFEGIIRGVSGASVNFNYIFKVLILLFLVYAGGTGSTLIASFLLTNAIQN
                     TMKNIRNEVEKKINRLPIRYFDGNSYGDVLSRITNDVDTISNALQQSFVQVINAFLSV
                     GLALIMMYSINIKLALIATLIIPLSILITKIIVSKSQKLFNSQQKALGNLNGKVQEMY
                     TGFNELKLYGKEDDALNEFVKVNEELRETGFKAQFISGIMSPLISLVTYLGIAVVGVV
                     GSIIAIAGGITVGNLQAFIRYIWQINQPLSQVTQLSSAIQSAVAAANRVFEFLEEEEE
                     VKDPNNAIKIEKPKGDVTFDHVKFGYKEDKPLIKDLSVDVKSGQMVAIVGKTGAGKTT
                     LINLLMRFYDVQGGSIKIDGVDIRDMKREDLRAMFGMVLQDTWLFNGTIYDNIRYGRF
                     DATKEEIIEAAKVANVHHFIKTLPGGYNMLLNEEASNVSQGEKQLLTIARAILKDPAI
                     LILDEATSSVDTRLELLLQKAMRNIMKDRTSFVIAHRLSTIRSADLILVMNDGNIIEQ
                     GTHEELMKQGGYYESLYNSQFASKEAN"
     CDS             complement(494507..494905)
                     /codon_start=1
                     /gene="CPE0381"
                     /note="132 aa, similar to pir:H72370 conserved
                     hypothetical protein from Thermotoga maritima (strain
                     MSB8) (284 aa); 27.4% identity in 124 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80087.1"
                     /transl_table=11
                     /translation="MKQNGNEVLLKLQQGELDAVLVYRKLAELASSEEEKNVLLSIAA
                     DEGRHASIIREYSKEILKPCNKSSEEIEAAYKNLGKEKVFEMLINAEINGGPVYEKLG
                     EEFPRLKEIAKDEIKHGNLLKGLIGKSNLN"
     CDS             495171..496199
                     /codon_start=1
                     /gene="CPE0382"
                     /note="342 aa, similar to sp:YNGE_CLOPE HYPOTHETICAL
                     PROTEIN IN NAGH 3'REGION (ORFE) (FRAGMENT) from
                     Clostridium perfringens (88 aa); 100% identity in 87 aa
                     overlap. Also similar to gp:CLOLYC_1 autolytic lysozyme
                     from Clostridium acetobutylicum"
                     /product="probable autolytic lysozyme"
                     /protein_id="BAB80088.1"
                     /transl_table=11
                     /translation="MEGRNSNNLKGIDVSNWQGNINFKSVKNEGIEVVYIKATEGDYF
                     KDSYAKQNYKRAKAEGLKVGFYHFFKPNKNAKRQAKYFIDYLNEIGATDYDCKLALDV
                     ETTEGRSAYELTTMCIEFLEEVRKITNREVVVYTYTSFANNNLDNRLGVYPLWIAEYG
                     VKAPKDNRVWSSWIGFQYSDKGNVAGVSGNCDMNEFKEEILDVKNNFKLYNATTKNIS
                     TYLNIREKGEIDSKIIGKIPAGEEFMIKWVDSNYLGWYLIEYKNITGYVSSKYVEKFQ
                     MATTYNVSDFLNVRERGTTDSKVVAIIDDGEIFRIDWVDSDYIGWYRITTKYGKNGFV
                     KADFVKKI"
     CDS             496521..496928
                     /codon_start=1
                     /gene="CPE0383"
                     /note="135 aa, similar to sp:YNGD_CLOPE HYPOTHETICAL 14.9
                     KDA PROTEIN IN NAGH 3'REGION (ORFD) from Clostridium
                     perfringens (132 aa); 78.1% identity in 128 aa overlap.
                     Putative N-terminal signal sequence and 2 putative
                     transmembrane regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80089.1"
                     /transl_table=11
                     /translation="MEGIIICIKLGVVFLGTLFTWIFGAWDMPIVTLLVFIFLDYLTG
                     VIKGCKSKELCSNIGLRGITKKGLILVVLLVAVMLDRLLDNGAWMFRTLIAYFYIMNE
                     GISILENCAALGVPIPEFLRQALKQLNNKNNIK"
     CDS             complement(497081..498001)
                     /codon_start=1
                     /gene="CPE0384"
                     /note="306 aa, similar to pir:A70081 conserved
                     hypothetical protein yxkH from Bacillus subtilis (279
                     aa); 31.1% identity in 254 aa overlap. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80090.1"
                     /transl_table=11
                     /translation="MRKIKHKGFLIALVSALIISSSFIACDMKGNKSNVESEKANLEN
                     NTQKDEASSNKENSTDNTSEKSNSNAEATKNRFEGLKTTSEDMNIPVLCYHDVTPNNP
                     NNNELLVNPEKFKEQLQYLKDNNYTPITLDELYDYLRNNKPIPEKSVVITLDDGYKGN
                     YEYAYPLLKEFKFPATIFVISNYVGAQDYMTADQLKEMSNNGIEIESHTFKHDDLSTL
                     DEAKQLETLKDSKVALEKIIGKPVDFVAYPFGRYNSSTRVAAEKAGYKLGFNLNGNFT
                     DRKDNNFNMDRIYVSNNDSLQKFESRLTGK"
     CDS             498485..499225
                     /codon_start=1
                     /gene="CPE0385"
                     /note="246 aa, similar to sp:Y325_THEMA HYPOTHETICAL
                     OXIDOREDUCTASE TM0325 (EC 1.-.-.-) from Thermotoga
                     maritima (251 aa); 39.9% identity in 263 aa overlap"
                     /product="probable oxidoreductase"
                     /protein_id="BAB80091.1"
                     /transl_table=11
                     /translation="MALRAAKEGAKLVLADKKEEMSKETLKEIREITSNVEFLICDLR
                     EGENCKKVIDTAIKKFGGLDILINNAGITGTPAPVHEISEEMFRNVLDCNIMIAFHCS
                     HYGIQEMIKQNKGGAIVNVSSVAGLTGFPGHSAYVTSKHGLNGLTRNMALDYARYGIR
                     VNAVNPGTTDTPMYHEALEFLKNKRESAEKAGVKIEGGIVSGKVTSPQNRVARAEEVA
                     DVILFLSSPEASNVTGIFMPVDGGFTAF"
     CDS             complement(499248..499979)
                     /codon_start=1
                     /gene="CPE0386"
                     /note="243 aa, similar to gpu:AP001515_128
                     transcriptional regulator (GntR family) from Bacillus
                     halodurans (242 aa); 27.2% identity in 217 aa overlap"
                     /note="GntR family"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB80092.1"
                     /transl_table=11
                     /translation="MEILTVNKHKELLYVTVYDKLFKMINEGTFPENSRLPSEPELAK
                     RLGVSRSTLRQALALLQDDGLIKNIRGKGNYIIKENKTDTTGLEKIGHPVYKCLDVET
                     NNIELDFKIDPPSDYYKKILGDSSVATVCIDRWYLDDNLALAYSYTILSIEAISKFNI
                     DLSDKNNLLKFIEEESYKECSKIKSTIKFTTSGNFVTKRHPIPDESQFYLIEEAIYSN
                     SELPVIFNKHYLPMKHSTIKINPMK"
     CDS             500213..500998
                     /codon_start=1
                     /gene="udp"
                     /note="261 aa, similar to sp:UDP_TREPA URIDINE
                     PHOSPHORYLASE (EC 2.4.2.3) (UDRPASE) from Treponema
                     pallidum (258 aa); 54.2% identity in 249 aa overlap. 1
                     putative transmembrane region was found by PSORT"
                     /note="CPE0387"
                     /product="probable uridine phosphorylase"
                     /protein_id="BAB80093.1"
                     /transl_table=11
                     /translation="MIYTQGSDKQFHIDVAPGEVGKYVIMPGDPKRCAKIAKYLDNAK
                     LVADKREYVTYTGYLDGEKVSVTSTGIGGPSAAIALEELVKCGADTFIRVGTCGGIDL
                     NVKGGDLIIATGSIRAEGTSREYAPIEFPAVANLDVINALVKGAKELKVPYHTGVVQS
                     KDSFYGQHSPETKPVSYDLLNKWEAWKRCGCLGSEMEGAALFIVGSYLRVRVGAVFLT
                     IANQEREKEGLDNPQVHDTELAIKAGIEGIRNLIKEDKMKNNA"
     CDS             501176..502366
                     /codon_start=1
                     /gene="deoB"
                     /note="396 aa, similar to pir:JE0180 phosphopentomutase
                     (EC 5.4.2.7) from Bacillus stearothermophilus TH6-2 (393
                     aa); 59.8% identity in 391 aa overlap"
                     /note="CPE0388"
                     /product="phosphopentomutase"
                     /protein_id="BAB80094.1"
                     /transl_table=11
                     /translation="MSKYKRIFTIVIDSLGIGAMNDSEKYGDVNVDTLGHIAESVDTF
                     NIPNLQKMGIANLHPIKHVAPVENPIGYQAKMAEASVGKDTMTGHWEMMGLHITKPFK
                     TFTDTGFPQELLDELTERTGHKIVGNKSASGTEILDELGEHQIATGDMIVYTSADSVL
                     QICGQEETFGLEELYRCCEIARELTLKDEWKVGRIIARPYLGTKKGEFKRTSNRHDYA
                     LKPYGRTVLNELKDNNFDVISVGKIKDIFDGEGITEGNKSKSSVHGMEQTLEIMDRDF
                     TGFCFVNLVDFDALWGHRRNPQGYAEELEKFDVNLGKVLEKLHEDDLLIITADHGNDP
                     TYTGTDHTREYVPFLAYSPSMKGHGQLETPKTFATIGATIADNFGLKMPEGTIGESVL
                     NKLV"
     CDS             complement(502793..504238)
                     /codon_start=1
                     /gene="arcD"
                     /note="481 aa, similar to gpu:AP002548_234
                     arginine/ornithine antiporter from Chlamydophila
                     pneumoniae (481 aa); 48.7% identity in 456 aa overlap.
                     Putative N-terminal signal sequence and 11 putative
                     transmembrane regions were found by PSORT."
                     /note="CPE0389"
                     /product="probable amino acid permease"
                     /protein_id="BAB80095.1"
                     /transl_table=11
                     /translation="MNDNKKLGVIALAGVVISAMLGGGVYNLPQNMAQSASAGAILIS
                     WIITGIGIWFIANTFRILAAARPDATTGIYTYGELGFGKFTGFLMAWGYWICNSFANV
                     GYAVLLMDSLNYFFPPYFKGGNNWLSIACGSLVLWIIFFIVLAGVKQASALNVIGTIG
                     KLLPLAIFLLVLLFSFRFSTFFTDFWGLKTVAKVHDTNLGGILPQVKSTMLVTLWVFT
                     GIEGAVVVSGRAKSQKDVSKATFLGFITCLLIYTLLSLLPLGVYSQGEISKMAPPSTA
                     AVLMDLIGNWGSVIMNLGVIIAILSSWLIWTVMLSELPFAAAQSGTFPKIFAKENKNE
                     SPSFSLLASTIIMQIILILVHFAGNAWNMMLSITSVMALPCYLVSTLYLFKITYKNEN
                     YPTDIFAKRKYAMITAILGSIYGVWLIYAAGINYMLIAIVIYALGIPVFIKARRETSP
                     NEKEFTKVERYFAIVLIILALIGLVYLFKFM"
     CDS             complement(504284..505246)
                     /codon_start=1
                     /gene="dchS"
                     /note="320 aa, similar to pir:DCCLHP histidine
                     decarboxylase (EC 4.1.1.22) precursor from Clostridium
                     perfringens (320 aa); 99.7% identity in 320 aa overlap"
                     /note="CPE0390"
                     /product="histidine decarboxylase"
                     /protein_id="BAB80096.1"
                     /transl_table=11
                     /translation="MNKNLEANRNRTLSEGIHKNIKVRAPKIDKTAISPYDRYCDGYG
                     MPGAYGNGYVSVLKVSVGTVKKTDDILLDGIVSYDRAEINDAYVGQINMLTASSFCGV
                     AGQVWGHDLATHDSIAKDEIKPLYELKQFDGTPLKVYDAKPLLEAGIELFGTEKNRRF
                     TTAPGAHVICANKSATAYRPKENRPLKEGEAYGVWSFIALSLSNDRDHCADLFIEDAG
                     LWTKNDNPEDLKKFLEDHRKAVTWSVVECGRDSHVVFERTYIGFAYVIMKPGEIGNAL
                     TCAPYVTLARDAVPSEGFPSLNRISLSQWLDDMNFDSLVNPSKK"
     CDS             505714..506547
                     /codon_start=1
                     /gene="CPE0391"
                     /note="277 aa, similar to pir:D69860 probable
                     phosphoesterase (EC 3.1.-.-) ykoQ from Bacillus subtilis
                     (270 aa); 28.8% identity in 271 aa overlap. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="probable phosphoesterase"
                     /protein_id="BAB80097.1"
                     /transl_table=11
                     /translation="MEILLGALGITLVTGFFYYENNGISTTNYEVDCGIGKDINVVHL
                     SDLHGKEFGKNNEKLKRLILKEKPDLVVATGDMIDSSLKNMEGVIDFLSDLSKCVKVV
                     YISGNNEQRCKKAEYIFESLKSKGVIVLRNEIITLSLSRVKVNILGMFEKPKGDLHSS
                     LKKINGSYAYEDSHKLFKRLESLEGLKIVLSHYPELFEAEYSKYDFHIMFSGHAHGGQ
                     FRIPIIKRGLIAPGQGIFPKYTEGMHGNKNKLIISRGLGNSTKITRLFNRPEIVNVKI
                     K"
     CDS             506672..506824
                     /codon_start=1
                     /gene="CPE0392"
                     /note="50 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80098.1"
                     /transl_table=11
                     /translation="MNKNMEMMKKLIEEKKNKGKNTKANVRAQKTIGFAQGGRKSNNG
                     GGLFDK"
     CDS             506921..507784
                     /codon_start=1
                     /gene="CPE0393"
                     /note="287 aa, similar to sp:YKWC_BACSU HYPOTHETICAL 30.7
                     KDA PROTEIN IN MCPC-KINA INTERGENIC REGION from Bacillus
                     subtilis (288 aa); 51.7% identity in 286 aa overlap. Also
                     similar to many dehydrogenases"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80099.1"
                     /transl_table=11
                     /translation="MKKIGFIGVGIMGKSMVRNLMKNDFEVSIFARNKDKVLDVISEG
                     ANFYPTIKECVSGCDAVITIVGFPKDVEEVYFGENGILENVKEGTYVIDMTTSSPKLA
                     VEIFEKAKEKGVKALDAPVTGGDIGAKNGTLTILVGGEEEDYKACLPILKAMGTNIHY
                     EGKAGFGQHTKLANQIMIAGAISGVCEAMAYAKDKGLDVKKMLDSVSTGAAGSKQLEL
                     VSPKILEEDFAPGFFIKHFIKDMKLAKEEALAYNVNLDILSKVLENYEELEREGFGDL
                     GTQALIKHYNK"
     CDS             508092..508997
                     /codon_start=1
                     /gene="nadA"
                     /note="301 aa, similar to pir:H70462 quinolinate
                     synthetase A from Aquifex aeolicus (322 aa); 40.3%
                     identity in 298 aa overlap"
                     /note="CPE0394"
                     /product="quinolinate synthetase A"
                     /protein_id="BAB80100.1"
                     /transl_table=11
                     /translation="MDIRDEILKLKKEKGAIILAHYYQIPEIQEIADYVGDSYYLSKI
                     AKDCEENIIVFCGVKFMAESAKILSPEKTVILPVMEAGCVMADMATEEGLAKLKEEHP
                     NAKVVCYINSSTEVKALSDVCCTSSNAENIINNLEEKEIIFLPDRNLGSYIQEKTPDK
                     KFILWNGFCIVHEAIQKEEILRLKSEHEGILTVAHPECSKEIRDISDFIGSTSEIINF
                     VNNSSNKKFIIITEEGVLHQLRKNGEEKEFYIPYGKMVCRNMKMTTLKDLYESLLKME
                     NKIEIDEDLRLKAYNSLKNMHKLGG"
     CDS             509002..510321
                     /codon_start=1
                     /gene="nadB"
                     /note="439 aa, similar to sp:NADB_SYNY3 L-ASPARTATE
                     OXIDASE (EC 1.4.3.16) (QUINOLINATE SYNTHETASE B) from
                     Synechocystis sp. (strain PCC 6803) (553 aa); 43.4%
                     identity in 371 aa overlap. Putative N-terminal signal
                     sequence and 1 putative transmembrane region were found
                     by PSORT"
                     /note="CPE0395"
                     /note="quinolinate synthetase B"
                     /product="L-aspartate oxidase"
                     /protein_id="BAB80101.1"
                     /transl_table=11
                     /translation="MKRVADVLIVGSGVAGLYASLNLREDLEIIMVSKKSVNLCNSSL
                     AQGGIAVARGKEDFQSFIEDTLKAGKYENNIDSVRVLVEESMDNINKLIDLGANFEKD
                     ENGVLFTKEGAHEINRIVYHKDITGKHVEDILLENVKRRKNIKIIEDCEMVDIYHRGN
                     RCIGALFNKDGQDLSIYAKVVILATGGIGGLFKKSTNERIITGDSIGVAIRNNIEIKD
                     LSYIQIHPTAFFSKKSEEKRFLISESVRGEGGKLLNCNGERFVDELLPRDIVSKKIYE
                     EMKKTNSNNVFLDVSFMEKSFLQNRFPNIYNKCLEEGIDISKEPIPVAPAQHYFMGGI
                     KVDLNGKTSMENLYAFGETSCTGVHGANRLASNSLLEALVFSRRGALEINSYIDNLEL
                     IIEERECEDLDKYRLLNRKILIDEICRLRGDIKDELVTCGGECKKSS"
     CDS             510278..511117
                     /codon_start=1
                     /gene="nadC"
                     /note="279 aa, similar to pir:B70375 quinolinate
                     phosphoribosyl transferase (EC 2.4.2.19) from Aquifex
                     aeolicus (274 aa); 55.7% identity in 273 aa overlap"
                     /note="CPE0396"
                     /note="quinolinate phosphoribosyl transferase"
                     /product="nicotinate-nucleotide pyrophosphorylase"
                     /protein_id="BAB80102.1"
                     /transl_table=11
                     /translation="MNWLLVEENVKRALNEDLQYGDITTESVVLDHKIAKVDIIAKEK
                     GVIAGTEVFKMVFKILGDVEVDFSVNDGEEVEKGQHFGQVSGDAKKILMGERVALNYM
                     QRMCGIATLTREFVERLEGTKVKLLDTRKTTPNMRIFEKYAVKVGGGTNHRFGLNDGV
                     MIKDNHIEAAGGIKNAVSLARKNSPFVRKIEVEVESIEQLKEALETKADIIMLDNMDI
                     KTLKEAVKLIDNRAEVEASGNVTLDNIREIAETGVDFISTGAVTHSFKVLDISMKNFR
                     YID"
     CDS             complement(511369..512727)
                     /codon_start=1
                     /gene="uapC"
                     /note="452 aa, similar to sp:YCPX_CLOPE HYPOTHETICAL
                     PROTEIN IN CPE 5'REGION (FRAGMENT) from Clostridium
                     perfringens (311 aa); 88.2% identity in 306 aa overlap.
                     Also similar to many permeases. 11 putative transmembrane
                     regions were found by PSORT."
                     /note="CPE0397"
                     /product="probable transporter"
                     /protein_id="BAB80103.1"
                     /transl_table=11
                     /translation="MEKQNLKNTEVNLIYGVDDDLDLPKKVLFGLQHIFAAFGGIIVV
                     PLVIATSLGFDSKVTTALISASILGSGLATIIQAKGVGKVGARVACIMGTDFTFVSPA
                     ISVGSVLGLPGIIGATILGSLFEVILSFFIKPLMKFFPPLVTGTVVALIGLTLLPVSI
                     DWAAGGAGSANYASLENLAVAMFVLVITLLLNNYGKGMISSASILIGIVVGYIVCIPL
                     GLVDFTPVKEASWLSFPKILEFGVTFDAKAVMAFIPAYFVATIGTVGCLKAIGETSNI
                     DIGDKRVAAGVLSDGVGSALGGLVGSCPNTSFSQNIGIISLTKVASRHVAVMAGILLV
                     ILGFLPKVAAIITGIPNPVLGGVGIMMFGTVAAAGIRTLSNIKLTERNLLIIAISMGL
                     GLGVTFRPDVIHNLPEAIRMIFSSGISTGTIAALILNAVLKESPTSMEFENMYDEEKK
                     AS"
     CDS             513402..514220
                     /codon_start=1
                     /gene="deoD"
                     /note="272 aa, similar to gpu:AP001512_119 purine
                     nucleoside phosphorylase (EC 2.4.2.1) from Bacillus
                     halodurans (275 aa); 53.1% identity in 245 aa overlap"
                     /note="CPE0398"
                     /product="purine nucleoside phosphorylase"
                     /protein_id="BAB80104.1"
                     /transl_table=11
                     /translation="MNLSKEIKEAYEYIKSKSKYSPKIGLVLGTGLGDLANEIEEAEY
                     YRYMDIPNFPVPTIAGHEGTLIIGKLHGREVIAMKGRCHYYEGHSMQRITLPIRVMKL
                     LGVETLVVTNCSGQAKESIEAGDLVLIRNHINFTGDNPLIGENLLEFGERFPDLAYPY
                     DKDLREEVKNIAKDLDINLKEGVYAMFSGPSYETAVETLMAASLGADVVGMSTVPEVI
                     VANHCGIKVLGFSGVPCLAAAYSEAEITHEEAMANFQSITEKCTSIVKEFLKRY"
     CDS             514310..514987
                     /codon_start=1
                     /gene="CPE0399"
                     /note="225 aa, similar to pir:E83401 probable transporter
                     PA1958 from Pseudomonas aeruginosa (191 aa); 23.6%
                     identity in 178 aa overlap. 6 putative transmembrane
                     regions were found by PSORT."
                     /product="probable transporter"
                     /protein_id="BAB80105.1"
                     /transl_table=11
                     /translation="MELMKKFTSYTCSPIFVVVACAICLLVGFSINSSIIEIFASVMG
                     IINVWLLSREKVSNFIFGIITVVAYLYIYYNTGLYALAVLACFQVGFNIFGWYYWVKN
                     SDQEDNVVTSGLTKKGQILWTIIILAAWAVWGYVEINILHAQNAILDSLTAVLGLVAQ
                     YWLSKKLYENWILWILSNILFIIIYILNGYYVMLILVAIQLILSISGLLEWYASFKEQ
                     GENKLTL"
     CDS             515021..515662
                     /codon_start=1
                     /gene="CPE0400"
                     /note="213 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80106.1"
                     /transl_table=11
                     /translation="MKSYELIEFINNCPKEIEKELKNRSFKYGEKLLVQNENCDFVYI
                     LLKGKIKTYHCDFTGAIYLEDIDSEATIFGELEALINKEVVTTVEALSQCETLEISKE
                     SFIKWIELDNKFSLFISKLIAERNYECCKRERVNAFYNLRYRVMYIILNTLHKNNLGI
                     TKDLLVEGVGSNIRSINRIINQLIEEGILDYNSGKIKVKSIEKLKEEVNYYKP"
     CDS             515887..516204
                     /codon_start=1
                     /gene="CPE0401"
                     /note="105 aa, no significant homology. 1 putative
                     transmembrane region was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80107.1"
                     /transl_table=11
                     /translation="MKITDEKVKKNFVIRALKQIGTFFIFTMVFAIVFSFLQPRVYKT
                     HSEYLSIKEKYDNLQKEYDSLNEKISNDTNALNSKKEDLTKSNEDLQNKLNSLNKEIQ
                     SLN"
     CDS             516217..516828
                     /codon_start=1
                     /gene="CPE0402"
                     /note="203 aa, no significant homology. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80108.1"
                     /transl_table=11
                     /translation="MIKEIIKFIKTHKIALILALILGISPNLMVKDYSKEFNEVAPKV
                     NELEYKIPALKNNTELKSIHEEVDKLQNENNDLSKEVEDKQKELDNLRAKKEEQAKIA
                     QEESKKSEENSKNKAIENSNSTSDNNSKNTNKSSGDPSNLANSSGDSTPKTAGSGEIV
                     YWTSGGKSYHKRSNCTTLKRSKKIYSGTQAESGKSDPCNVCCR"
     CDS             517036..517572
                     /codon_start=1
                     /gene="CPE0403"
                     /note="178 aa, no significant homology. 2 putative
                     transmembrane regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80109.1"
                     /transl_table=11
                     /translation="MSDKKLFTIKTSINKKDYSRFLYIATFLRKKFTIPAIIVITALM
                     AGFVSYNNRIFELKSFLIYWLILLIITLFAIVVKIEFQSREREKADKAGVLKSIETLE
                     FFDDILVIKSTAFKGKSKIKYYKFYEVIETKNYFIIYFNRRQASIIRKIDLEDSLVDE
                     LRNLLTGKIGHKYKKLFK"
     CDS             518306..519643
                     /codon_start=1
                     /gene="brnQ"
                     /note="445 aa, similar to pir:C69596 branched-chain amino
                     acid transporter braB from Bacillus subtilis (445 aa);
                     44.5% identity in 418 aa overlap. Putative N-terminal
                     signal sequence and 10 putative transmembrane regions
                     were found by PSORT."
                     /note="CPE0404"
                     /product="branched-chain amino acid transporter"
                     /protein_id="BAB80110.1"
                     /transl_table=11
                     /translation="MKDLSRKDLLLVSLMLFSLFFGAGNLIFPPFLGQAAGSATWVTI
                     LGFFVTAVGFPVLGVIAVAKSGGLHALASRVNPVFATFFTVLIYISIGPGLGIPRAGS
                     LPFEMAVAPFLPEGLISNNLALFIYTFVFFAVAYWLSLSPAKLVDRMGKVLTPSLLVL
                     IGLIFVASIFKPLGAYGEVTGVYKESPFISGFLDGYMTMDTIAALNFGIVIALVIKSK
                     GVKEEKFVVKTSVKAGIIAGGLLIVIYSMLAHLGATSGGRFGLTENGAQTLSNIITYI
                     FGKPGAILLAVIFTLACLTTCVGLITSCSQYFQTLTKKINYLSWVRILTLTSMVLANM
                     GLNKILAVSVPVLNAIYPMAIMLIVLAMLDKYIKGNSVVYTTTIAFTTIVSVIHALSG
                     TGINIEFLNRIFENLPFYSEGLGWVLPALFGLGLGLVLKSFFEKNKEEVLEVS"
     CDS             519899..520771
                     /codon_start=1
                     /gene="CPE0405"
                     /note="290 aa, similar to gp:LSEXOGC_5 L.sake gene
                     cluster from Lactobacillus sakei (283 aa); 43.4% identity
                     in 274 aa overlap. Putative N-terminal signal sequence
                     and 2 putative transmembrane regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80111.1"
                     /transl_table=11
                     /translation="MNKKNGRIYQVAYRITAIILFGALAGIGVNFFLTPAHIYSSGVT
                     GVSQLLSSIGGDFFNINIDISTWVLILNLPLAYLSYRKLGKKFTLYSFLSIISLSFFI
                     GVIPTRAVTNNQLLNSIFGGVLMGAGVGMCFRAGFSTGGTDIIVLVVQKMTGKSVGQL
                     GFIVNGIILLVAGLVYGWELALYSLVSIYVTTKVIDLFYIQQYKLTVTIYTKKEKEVV
                     DSLIKSQMRGVTIGRNLYGGYTNEPLSSITTVISKHELLIVKKNVMDIDPEAFVNIQP
                     TVEVMGNFYDNSLI"
     CDS             520903..522249
                     /codon_start=1
                     /gene="CPE0406"
                     /note="448 aa, similar to pir:G70034 reticuline oxidase
                     homolog yvdP from Bacillus subtilis (447 aa); 30.6%
                     identity in 451 aa overlap"
                     /product="probable reticuline oxidase"
                     /protein_id="BAB80112.1"
                     /transl_table=11
                     /translation="MEKVDFSKLTGDLVTRENIEYEKSIESWNRAIKKYPLGIVFCNN
                     IDDVKNALEWAKENNIPFRIRVGRHNYEGYSIENDILVIDLSKMNNIIIDEENMKVTI
                     EGGVKNEEIYEALGVLGYPFPGGGCPTVGVVGFALGGGWGYSSRLLGLGCDNLLEVKF
                     INSKGKIVIANEYDNSDLFWAAKGCGGGNFGVVVSMTFKIPQKIEMATLIDIDYPNAE
                     KEELVYVIRTLQKKFKNLDRRMNLKTAIYNSKYKGIGVKITGLFYGHKEEANEILLPF
                     KLPTRVNFNLSYMRVLEANRKIEYSHPPYEKYKSTGRFVFRDYDNSEIEKLIDIVSNR
                     AEGAYYTAISFYGLGGAVKDVHKNSSAFYYRDARFIMGIQSVWEDDIFAEENIKWIKN
                     NFKYIESITTGSFINFPFKDLKDYEEEYYGENKDKLREIRKKYDENRFFAFEQGIK"
     CDS             522549..522902
                     /codon_start=1
                     /gene="CPE0407"
                     /note="117 aa, no significant homology. 2 putative
                     transmembrane regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80113.1"
                     /transl_table=11
                     /translation="MAYKSSIILNKEKYDSYFDNTFKNSIVHHLKCLLLGILTLGLAY
                     PWIICMKYEATCKHTVICGKRLKFIGNPKELIGHWIFWWILIVITFGLYGLVVKIRFQ
                     QWTSANTIFEDVEIK"
     CDS             523097..523921
                     /codon_start=1
                     /gene="CPE0408"
                     /note="274 aa, similar to gpu:AP001513_19 BH1746 gene
                     product from Bacillus halodurans (282 aa); 36.2% identity
                     in 271 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80114.1"
                     /transl_table=11
                     /translation="MSIKLICIDMDGTLLMDQQNIAEEDKNAIKEAVEKGVIVAITTG
                     RIYDCARMYSDTIGLKTPIIASNGAYIGGVNDEEIYNNPLKQSDLEDFNIITKKNNLF
                     TYVNTNWGIVSTVELPEDHVYKVLNKTLPKDKQVRLEVVKDLDEAFKKYKGEILKGVC
                     VEKEFKDKLKEAKEELIACTTDLEVVSSWDDNFEIMKKGSSKGEAVQMLAKYLGVSQE
                     EVMCIGDSENDLSMITWAGTGVAMGNAIDSVKDVANYVTADNKHGGVAEAIRKFVL"
     CDS             524071..525504
                     /codon_start=1
                     /gene="CPE0409"
                     /note="477 aa, similar to pir:E72254 conserved
                     hypothetical protein from Thermotoga maritima (strain
                     MSB8) (479 aa); 43.9% identity in 467 aa overlap.
                     Putative N-terminal signal sequence was found by PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80115.1"
                     /transl_table=11
                     /translation="MRDIIVIGAGVVGCSIARELSKYNLDVLVVEKNSDVSEGISKGN
                     SGIVHAGYNEKIGTLKAKLNIEGNKIFDDLSRDLQFPFKRNGAFILAFSDEEMKTLES
                     LKENGEKLGVEGLEILTREEALNIEPNLNKEIVGVLNVKTSGIVSPYEMTIALAENAA
                     ENGVEFKLNSKVTNIEKISEGYKVTLNNKELVSGKIIINASGLEGAFLNNLVSMSKRE
                     INPVKGEYCLFDKVAGAMINKTLFQVPSKLSKGVLVTPTAEGNLLVGPNAVEGKTLET
                     SREGIDEILDKSKKSLEELPVARILNTFSGIRPKTKGGDFIIEEVEDAKNFINVIGID
                     SPGLTAAPAIGVYVVNMIKERLDLVEKKNFKKTREKIVRFAELSLEEKNRLIKEKPAY
                     GHMVCKCEFVTEGEIVEAIHRPIKALTVDAIKRRTRASMGGCQGVGCTLPISKILSRE
                     LGIDISDINKNSEGSPVIGFKEMIFNY"
     CDS             525713..526912
                     /codon_start=1
                     /gene="CPE0410"
                     /note="399 aa, similar to gp:CPIS1136_1 C.perfringens
                     IS1136 DNA from Clostridium perfringens (122 aa); 65.6%
                     identity in 125 aa overlap"
                     /note="IS1136"
                     /product="probable transposase"
                     /protein_id="BAB80116.1"
                     /transl_table=11
                     /translation="MKKLKRAYKMEINPTQEQKSKINRTIGVSRFIYNFYIAYNKEIY
                     EREGKFVSGIDFSKWLNNEYIPNNQEMKWIKEVSSKATKQAIMNGDKAFRDFFKKAKG
                     FPRFKKKKNQDVKAYFPKNNKTDWTIERHRVKIPTLGWVRLKEFGYIPVNSVVKSGTV
                     SQKADRYYVSILVEERDIKISNGNIGIKIFNYNNEGLGIDLGIKEFAVCSDGIKFKNI
                     NKTSIVKKIEKKLKREQRKLSRKYESLKTRNKNIREGRATSQNIQKQIVKVQKLHQRL
                     TNIRTDYINKIVSSIIKQKPSYITIEDLNVKGMMKNKHLSKAIASQKFFEFKTKLTVK
                     CKENDIELRIVDRFYPSSKTCSQCGKVKKDLKLSDRIYKCDCGLAIDRDLNASINLKN
                     VKKYKIA"
     CDS             527033..527965
                     /codon_start=1
                     /gene="CPE0411"
                     /note="310 aa, partially similar to pir:C75218 probable
                     monooxygenase PAB0184 from Pyrococcus abyssi (strain
                     Orsay) (407 aa); 26.3% identity in 259 aa overlap. 1
                     putative transmembrane region was found by PSORT"
                     /product="probable monooxygenase"
                     /protein_id="BAB80117.1"
                     /transl_table=11
                     /translation="MDMFDHILSSRIKAMREYDLIIIGGGASGLLLAINGKKDGIKNI
                     LLVEKDPILGGALNSADYNISEKGNLTGIEYKESLLKEFNELNIDVKLNTMVLKIEDS
                     NEILCTSSECGVEKIKGKNIIIANGGKEKSRNAVQIPGDRTAGVLTVGMAKKIFGIKN
                     MVPGKNIFIVGDSTLYMIQEDLKKHNIKVSGIITDKNKNEVFDLSENLYSGYEIIAIH
                     GEGRVSSVTIKNGDEKKNIKCDTVIFSYPMISDGLVALRSGLKLNPNTTGPAVDENLE
                     TSSENIYACGNAIYIHKSIEEIEDECKKLIKTIS"
     CDS             528206..528583
                     /codon_start=1
                     /gene="CPE0412"
                     /note="125 aa, similar to pir:F32057 hypothetical protein
                     2 from Azotobacter vinelandii (183 aa); 33.3% identity in
                     123 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80118.1"
                     /transl_table=11
                     /translation="MVYFAYGSNLCLEQMKKRCPEAIPMISVHLDDYKLVYNKYADII
                     PCEGEKVYGAIYEISLNDLKNLDKYEEYSDLYEKIDLIVQDINGISYEAFAYVMNEKG
                     DKTPDKRYLDIINKGYEDWGIIY"
     CDS             528800..529372
                     /codon_start=1
                     /gene="CPE0413"
                     /note="190 aa, similar to pir:F69993 carbonic anhydrase
                     homolog ytiB from Bacillus subtilis (187 aa); 57.7%
                     identity in 182 aa overlap"
                     /product="probable carbonic anhydrase"
                     /protein_id="BAB80119.1"
                     /transl_table=11
                     /translation="MEKNVRRLEEILEFNKSFVENKEYEKYKATKKPEKKLVILSCMD
                     TRLTELLPKAMNIKNGDAKIIKNAGATIMHPFGSIVRSILVAIYEFNAEDVLVVGHHG
                     CGMSNLNSKDMISKMEDRGISEETILTIKHCGIDVEKWLHGFGCVEESVKESVTSLKN
                     HPLMPSDVNVHGLVIDPHTGELKVIVNGYE"
     CDS             529513..530151
                     /codon_start=1
                     /gene="CPE0414"
                     /note="212 aa, no significant homology. Putative
                     N-terminal signal sequence and 3 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80120.1"
                     /transl_table=11
                     /translation="MDISSTINVYKIIWIFTIGSILGYCVEMIWCYVRNGHFESRKGL
                     IYGPISPVYGIGGVALTLLLYRFIDYNGIIIFFISAIIGGAFEYLCSWVQEKVFGSVS
                     WEYNSKALSIHGRTSVEYSVFWGILGVFFLRDIYPLFDKFMGIFSSQTVKIITVIFLV
                     LLIPDIIISSLAVRREVARMKGIKAKNALDRFLDKKYTDEFLKKIYPNMIFK"
     CDS             530176..530565
                     /codon_start=1
                     /gene="CPE0415"
                     /note="129 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80121.1"
                     /transl_table=11
                     /translation="MFFIGIFGIENKQKEVKQLENIYCKTCSTRTMGTLIKSYEYFHI
                     FFIPIFRWNEKYYVMCKRCNSIYEISKEKGKAIENGEINEVNLEDMTLIQEGQVYGKR
                     AVKKVCPNCGKTVDGDYNYCPYCGSEI"
     CDS             530899..532770
                     /codon_start=1
                     /gene="htpG"
                     /note="623 aa, similar to sp:HTPG_BACSU HEAT SHOCK
                     PROTEIN HTPG (HIGH TEMPERATURE PROTEIN G) from Bacillus
                     subtilis (626 aa); 69.6% identity in 622 aa overlap"
                     /note="CPE0416"
                     /note="chaperonin"
                     /product="class III heat-shock protein"
                     /protein_id="BAB80122.1"
                     /transl_table=11
                     /translation="MEKREFKAESKRLLDIVINSIYTNREIFLRELISNASDAIDKVY
                     YKTLGDSSLTFNKDDYYIKIKPNKEERTLTISDKGIGMTEKELDENLGVIAKSGSLQF
                     KKENEIKDGFDIIGQFGVGFYSGFLVADKITVITKAFGADKAYKWESDGVDGYTISEA
                     EKDSFGTDIILHLKANDEDENYDEFLEEYKLKSLIKKYSDFIRYPIKLDVTKSRVKEG
                     TENEHEEYVEEETVNSMVPLWRRNKNELTDDDYNNFYVEKRFGFDKPLRHMHISVDGM
                     ISYNSILYIPENIPYDYYTKEYEKGLELYSNGVLIMEKCSELLPDYFGFVKGIVDSQD
                     LSLNISREMLQHDRQLSRIAKNIKTKIKNELESMMKNDRESYEKFYKSFGRQLKYGVY
                     DDFGMNKDELKDLLMFYSSKEKKMVSLAEYVERMAEDQKYIYYAVGESNERIEKMPQT
                     EMVLDKGYEILYFTEDVDEFAIKMLMNYKEKEFKSVSSGDLGIESEEENKKENEENKG
                     IFEAMKEALGEKISAVKASSRLKNYPVCLSSEGEVSIEMEKILSAMPNNQGVKAQKVL
                     EVNTNHEVFNSLKDALENDKDKFNLYTKLLYNQALLVEGLSIENPVDFTNDICKLMK"
     CDS             532934..533926
                     /codon_start=1
                     /gene="CPE0417"
                     /note="330 aa, similar to sp:MALR_STRPN MALTOSE OPERON
                     TRANSCRIPTIONAL REPRESSOR from Streptococcus pneumoniae
                     (327 aa); 39.4% identity in 310 aa overlap"
                     /note="LacI family"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB80123.1"
                     /transl_table=11
                     /translation="MKVTIKDVAREANVAPSTVSRVLSDSPKISEETKIKVNKAIKKL
                     NYKPNAIARSLVNNKTKILGVVLPNEADDSFKNLFFVEAMRGMSMSAEENGYYIMYAF
                     SKNDEDELKTIKEFSSNNLLEGLCLLSVREEDKTIKYLKDINFPFVVIGRPDEEDVLW
                     VDNDNFQAMFKLVDKFIKDGQSDIAFIGGKKSWNVSKDRLSGFKDAFKANNLNYDKTM
                     VIEGIDFSEECGYLAMREIISKRTPKIVVTTDDLLALGANKFLNEEGIEGVKIVGFNN
                     TPMTKYQNPPISSIDINARELGYEATKLLIDYLNGNLVCRKKYCIVDTELIDRG"
     CDS             534362..536026
                     /codon_start=1
                     /gene="CPE0418"
                     /note="554 aa, similar to gp:BACEA14G_1
                     exo-alpha-1,4-glucosidase from Bacillus
                     stearothermophilus (555 aa); 62.3% identity in 551 aa
                     overlap"
                     /product="exo-alpha-1,4-glucosidase"
                     /protein_id="BAB80124.1"
                     /transl_table=11
                     /translation="MNKKWWKELIAYQIYPKSFMDSNGDGIGDIQGIISKLDYLKDLG
                     IDLIWLCPMYKSPNHDNGYDISDYKDILDEFGTMDDFNELLNEVHNRGMKLIIDLVIN
                     HTSHEHPWFIESRSSRDNPKRDWYIWREGKGDEEPNNWESIFKGSAWEFCENSEEYYL
                     HLFAKEQPDLNWENKEVRNELYKMINWWLDKGIDGFRVDAISHIKKEEGLKDMDNPEG
                     LKYVSSFEKHMNVEGINSHLKELKEETFSKYNIVTVGEANGVSANEADHWVAEDEGTF
                     NMIFQFEHLNLWNYEEGQGFDVKAYKDVLTNWQNSLEGKGWNALFIENHDIPRVVSTW
                     GNDKEYLTECAKAFGAIYFLQKGTPFIYQGQELGMTNVKYHSISEYNDVKTINTYNER
                     IESGVSEEIALKEAWVTSRDNSRTPMQWNSSENAGFTCGKPWIGVNENYKTINVEVEE
                     RDENSVLNFYKKLIKLKKSNEALIYGVYDLILEEDENIFAYTRTLNNEKFLIMANLTG
                     ENAKYMYEKEKLNSKDLILNNYEVCEHKNLTEFTLKPYECRVYKLS"
     CDS             536285..537940
                     /codon_start=1
                     /gene="CPE0419"
                     /note="551 aa, similar to gp:SMU78600_1 putative ptsG
                     protein from Streptococcus mutans (409 aa); 51.1%
                     identity in 266 aa overlap. Putative N-terminal signal
                     sequence and 7 putative transmembrane regions were found
                     by PSORT."
                     /note="glucose-specific enzyme IIA component"
                     /product="probable PTS system"
                     /protein_id="BAB80125.1"
                     /transl_table=11
                     /translation="MKKFKLGSFDFWQKFGKALLVVVAVMPAAGLMISIGKVMGIYID
                     VDFIKTIARVMEDIGWAIIGNLNLLFAVAIGGSWAKERAGGAFAGTIAFVLINRITGV
                     IFSVSNAMLAGDSTATVQSFTGQTLLVKDYFVSVLGAPALNMGVFVGIISGFLGAALY
                     NKYYNYNKLPNALAFFNGKRFVPFMVIIGSTISAIILSFVWPFVQYGLNTFGQWIATS
                     KDTAPIIAPFLYGTLERLLLPFGLHHMLTVPVNYTELGGVYHILTGPTAGQVVAGQDP
                     LWLAWITDLNNFKQAGDITSYNQLIGSVVPARFKAGQVILSSASLIGVALAMYKNVDP
                     DKKKKYKSVFFSAAIAVFLTGVTEPIEFMFMFISPILYVVYAVIAGLGFAIADIINLR
                     VHAFGFIELITRSPLMINAGLTKDLINFIIVAVVFFFLNYFVFSFLIKKFKIATPGRM
                     GNYIDNEDENTNKASSNSKASMDELAVKAIELLGGKENIVDVDACMTRLRVTVKEIEK
                     VGDEKAWKDNKALGLIVKDKGVQAIYGPKADVLKSDIQDILGI"
     CDS             537951..538742
                     /codon_start=1
                     /gene="CPE0420"
                     /note="263 aa, some similarity to pir:T37061 probable
                     secreted protein from Streptomyces coelicolor (279 aa);
                     23.9% identity in 176 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB80126.1"
                     /transl_table=11
                     /translation="MKLLTLNCHSWLEEEQLYKIKYLAKTIVEEKYDVIALQEASQSI
                     KASIKEGNLKEDNYGLVLIEEINKLGGEKYHLVWDYSHIGYDIYEEGLCILTKHKIVN
                     SESFYISKSHCKTFWRSRKIVKATIDINNENIDFYSCHMGWWHDKEESFTFQVENLLA
                     HAKESKNRAFFMGDFNNNAFLKNEGYDFLKSNGLIDTYDLAENKDSGVTVNKNIAGWE
                     DNTGELRIDIIFTNRNTKVYDSRVIFNGKNKEVVSDHFGLEIETT"
     CDS             539283..540020
                     /codon_start=1
                     /gene="glpQ"
                     /note="245 aa, similar to pir:F69961
                     glycerophosphodiester phosphodiesterase homolog yqiK from
                     Bacillus subtilis (243 aa); 37% identity in 235 aa
                     overlap"
                     /note="CPE0421"
                     /product="probable glycerophosphodiester
                     phosphodiesterase"
                     /protein_id="BAB80127.1"
                     /transl_table=11
                     /translation="MKKILNVAHRGLSGLYPENTMIAFRKAIEADCDGIEMDVHLTRD
                     GVPVVIHDEEVDRTTNGSGYVKDFTYEQLCNLDAGIKFSDEFKGEKIPTLKEFFDFMK
                     DNNKLINIELKNSIIHYEGLEEKVYKEIENYGFEDRVIISSFDHYSIRKCIRLNKNIK
                     TGILYWDCIFEPHNYCKVVGSSALHPEFNSITEEIVRDAHEDFQQVNVYTVNEKKDME
                     KMIDLNVDMIITNYPNILKEVLESKNK"
     CDS             540117..541403
                     /codon_start=1
                     /gene="CPE0422"
                     /note="428 aa, similar to sp:YIHN_ECOLI HYPOTHETICAL 46.3
                     KDA PROTEIN IN GLNA-RBN INTERGENIC REGION (O421) from
                     Escherichia coli (421 aa); 37.5% identity in 408 aa
                     overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80128.1"
                     /transl_table=11
                     /translation="MKNNNAKKWITLLVLCAGGGIIYRLPYLREVFYIPMQQAFHLTN
                     FQMGFLTSMYGIVNFLLYIPGGVIADKFSYKILVPFSLIATGLLGFWYATIPSYTVCL
                     IINGAWAITTVFTFWPTMVKAVRMLGDSSEQGKLFGILEGGRGAASTVVSFIALGMLA
                     KLGEGLLGIRSIIIFYSVALIVIGIIAYFLLDDSKEEKEINKQTRGDIVHGIKKVVKM
                     PEVWLVAALVFTTYAAFSGLAFLTPYVTEIFGMSVALGAFIGIIRSYVIMMLAPPISG
                     VIADKMHSTIKFMIIGLTLSIIFTLVYVFMPGKSAFIIPVLINMLILSIILLGMKGVF
                     FAPLDEVRVPREYTGIAAGIVSFIGYVPDMFINSYYGGLLDSHPGIKGYNLIFLSMIA
                     LCVIGLICGIVLYKLVYSKKKESVGEKELEVAKLNS"
     CDS             541903..544515
                     /codon_start=1
                     /gene="pcrA"
                     /note="870 aa, similar to gpu:AP001509_86 ATP-dependent
                     DNA helicase from Bacillus halodurans (747 aa); 30.3%
                     identity in 478 aa overlap"
                     /note="CPE0423"
                     /product="probable ATP-dependent DNA helicase"
                     /protein_id="BAB80129.1"
                     /transl_table=11
                     /translation="MINLNEEQQKVVNEQKNNIILLASAGTGKTNTLAERVTSIIKNG
                     NSKPSEILCITFTNKACKEMSDRVMKIVGGEAKDITIRTFHSFCFDVVRTYAKRNTDI
                     FSDFTIFDEDDCREVISKLSYYYATSNLMATNMQIQKVIDFIKVERARIETLEDRVLD
                     EYKTVIDEIFKFREEKINQVCTNKGNLNLNLKNYIKFHGHELVTLYDSKLRDDHALDF
                     NDLIILTKELFKDEKVVRALKNKFNYINIDEVQDTSIIEYSIIEKLFEGNNVLICGDF
                     FQTIYSWRGSDPEMIFNKFKEKYNPVEIVFSKNYRATKNLNKASLEFLNNAFSSKVST
                     MYKDGILAESKEDGEKILLKETRGLREEARFIFDYVNKLCEKGEDLKRVCVLTRDNNY
                     NIGLSEELYQIGGYEGADFEFILVDQFKFFRRQEVKDILAFLKLIANRYDSLSLKRIV
                     NRLPTGIGMRTLEAIESYKYKEVGIRLADYIDPLVLEYGEKFSLLINEFEKENIIVFD
                     VESTGVDVTEDEIIQIAAIKLNKKGEVVDKFEKFLKNKKPVKDSYYVHGFSDEMLQRI
                     GEDKEKVLKEFVEYSKDSIIVGHNVQYDINILCSELERSNLGKPKFKTFYDTLDIYRR
                     FYPGNINYKLENLSKVYDTKHKPSHDAMDDIIATGELLVRAINEKIRETSMERMTLMS
                     KHLKAFTAISKKLNELFQIAESKRPYELVACVMNGFNIKSMYAGDENKEKLNRLRDLY
                     ALFRDLDDKSKGNRDALLDIIRITGLSNGELESLIINRTKKPRIPIITVHQAKGLEFD
                     TVFLAGIQNNTFPSYMSIKEGNLAEEKRVFYVAITRAKKRLVITYNSQGKYGHRNEIS
                     QFINYIPKEFFKII"
     CDS             544692..545351
                     /codon_start=1
                     /gene="CPE0424"
                     /note="219 aa, similar to pir:B69997 conserved
                     hypothetical protein ytmQ from Bacillus subtilis (213
                     aa); 43.8% identity in 208 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80130.1"
                     /transl_table=11
                     /translation="MRMRRKPWARPELEACDFFVANPKENKGNWKNTFKNTENPIYLE
                     LGCGKGTFMAVHGSDNPNINYIAIDIKDEVLVLAKRSIEKAYEEKNKALDNVKLMPQE
                     IALIDTILDSNDKIERIYINFCNPWPKDRHKKRRLTHTRQLTKYRDFLVDGGEIHFKT
                     DDDELFEESLEYFKECNFEITYITRDLHNSGYEYNVVTEHEEMFSKQGIKIKFLIAKK
                     L"
     CDS             complement(545510..546364)
                     /codon_start=1
                     /gene="CPE0425"
                     /note="284 aa, partially similar to gp:CLOTETP_1
                     Clostridium perfringens tetracycline resistance protein
                     (tetA(P) and tetB(P)) genes, complete cds's, and three
                     unidentified coding regions from Clostridium perfringens
                     (102 aa); 60.8% identity in 102 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80131.1"
                     /transl_table=11
                     /translation="MYRTLLNPQIDFVFKKIFGTEKNKPILINFLNAVIKPTTPIKDV
                     EIKNNDIDKDFLEDKFSRLDVKATTSNKEHINIEIQVKNEYNMIQRTLYYWSKMYSEQ
                     IQNRDNYSKLERTVCINILNFKYLKNDKYHNAYRLKEITSNEELTDLQEIHFIELPKF
                     NEIGNKENVDVEKMDALEKWLEFLVEPESNTVRQLELSNEEIKLAKSELYRLSMDSKE
                     REQYNMREKAIYDRISALESSKEEGKLEEKLEVAKKLLIANVDIDIINSSTGLSKDEL
                     LKIKNSLK"
     CDS             546981..548264
                     /codon_start=1
                     /gene="CPE0426"
                     /note="427 aa, similar to gpu:AP001509_228 BH0790 gene
                     product from Bacillus halodurans (454 aa); 52.8% identity
                     in 396 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80132.1"
                     /transl_table=11
                     /translation="MSLSTNELKEIVRKIGKDLSGKIEDKKLQELFYNCFINTMDTTV
                     EVSEGDAFVITGDIPAMWLRDSTSQVEHYLPFVKEYPELKAIFTGLINRQVKCIFIDP
                     YANAFNKEPNGQKWDNDITKDSPWVWERKYEIDSLCYPVRLIHKYWKESGDETFFNDD
                     IKKAFNMIIDLWRVEQYHREKSDYSFQRLNCSVTDTLSHEGLGTPVTYTGMTWSGFRP
                     SDDACEYGYLIPANMFAVVALRYISEIAEKVYKDEELKEKADSLREEIDNAIEKHGKV
                     YKEGFGEVYAYETDGMGNYNFMDDANVPSLLSIPYLEYKGIEDEVYQNTRKFILSKNN
                     RFFFEGKAAKGIGSPHTPDQYIWHIALSMQGLTTNNQEEIDQLIKLLKETDAGTGYMH
                     EGFHVDDPTKFTRDWFAWSNSLFSHFIYEKVINKK"
     CDS             548732..549310
                     /codon_start=1
                     /gene="CPE0427"
                     /note="192 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80133.1"
                     /transl_table=11
                     /translation="MKKVSLILINIILVCNLIACGAQGNEIAINFIDNEIEVEENEKR
                     DITIQSKDKYKQFRNSNTKIKKEDLKTYFYNDKTLKDFEVPKKTIEEYENWFINMARD
                     RGESAKDISDAFRSVDMLIGEDIVKFPVIIDTVNFNDREAYAIAYLCEEGENLDMEAQ
                     EAMELKRFDEVLVIGVYKDSSDIFYKDKYSLK"
     CDS             549541..549696
                     /codon_start=1
                     /gene="CPE0428"
                     /note="51 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80134.1"
                     /transl_table=11
                     /translation="MPKDSQPDNKVARMEKCNFQTPITSEEGKNHNRTAKKHSVKREG
                     FQSPHIN"
     CDS             550064..550615
                     /codon_start=1
                     /gene="CPE0429"
                     /note="183 aa, no significant homology. 2 putative
                     transmembrane regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80135.1"
                     /transl_table=11
                     /translation="MKINGGFIMVNEKFGILAKIFLLILILVPITFRVYDLYYLNSSW
                     DINSKVVKRGKVYRDYIKEKKLTGVPNIYYKYNSLTPEEMMTLDVLANTKGYNIEEVL
                     PEVEKYVLSKNNEKNGAKLNEDEKIEVNQCVKQIKEEVNENLEKNSSYIYWMKMLMSV
                     FTALMLVLSIYAIYMTIVFINEK"
     CDS             complement(550703..551245)
                     /codon_start=1
                     /gene="sipS"
                     /note="180 aa, similar to sp:LEPU_BACSU SIGNAL PEPTIDASE
                     I U (EC 3.4.21.89) (SPASE I) (LEADER PEPTIDASE I) from
                     Bacillus subtilis (187 aa); 35% identity in 143 aa
                     overlap. Putative N-terminal signal sequence was found by
                     PSORT. putative transmembrane region was found by PSORT"
                     /note="CPE0430"
                     /product="probable type I signal peptidase"
                     /protein_id="BAB80136.1"
                     /transl_table=11
                     /translation="MNLLSESNISTLNKKSHLKIKNLILFSVIVFLGSYFLTNYLIFK
                     AYIPTGSMRPTIMEEDEVIVSKIYTSINRGDIFVFSHESSEELLIKRVVGLPGEKVEL
                     KDGLLYVNDVFIDEPYVKNNESMNKTFYVPEGNYLFFGDNRARSEDARRWENPYVPKK
                     NLDGKALFTVYPKDRIGFLK"
     CDS             551453..552295
                     /codon_start=1
                     /gene="CPE0431"
                     /note="280 aa, no significant homology. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80137.1"
                     /transl_table=11
                     /translation="MNEISDLVKITSILGIAATTYLVYENNSIFINEYELFTRKTPNS
                     FRGFKILHLNNLYGKTFGSENYRLIEKINSLKPDIIVTTGNMLTSSLDKDFVFLELCK
                     NLRSFYPIYYSIEGCKNLSGKKYEKYRDYLKGLVDIGVILLNNSKVSLIKKEDKLNIY
                     GIYIEDEIKSFSFKGGCKKENIFSKEDLVNKLGSPNRSEFNIVLANDVINFEAYVKWG
                     SDITFSGYTRAINRYIFNNLMERKKGIFIEKDSSMILSRGLGNDFFKMRIMNRPEITL
                     ITIR"
     CDS             552580..553419
                     /codon_start=1
                     /gene="CPE0432"
                     /note="279 aa, similar to gpu:AE004250_8 beta-ketoadipate
                     enol-lactone hydrolase, putative from Vibrio cholerae
                     (272 aa); 34.5% identity in 252 aa overlap"
                     /product="putative beta-ketoadipate enol-lactone
                     hydrolase"
                     /protein_id="BAB80138.1"
                     /transl_table=11
                     /translation="MLYYKVVNNKYLHKDKEWILMLHGIGGNLNIFKKQIDVLSENYN
                     LLLVDLHGHGNSQNHTLKNMKKTKGEISFKYICEDIVEILDKLNIEKVNVLGISLGTI
                     VGMQFEKYFPNRVSSMILGGGIVGMNLKSKFFLNLALVTKNIIPREIFYKIVAYMSMP
                     CKNHKLSRNIFLKAAEKLDKNECFRWVELMREHLENYKYVKNNVKKIFIMGDQDHVFL
                     PTIKKFVPEEDIVVIKNCGHICNIDSFKTFNHLTLNFLINNHGYMFGAKERRKYVYKY
                     NFT"
     CDS             553503..554798
                     /codon_start=1
                     /gene="CPE0433"
                     /note="431 aa, partially similar to sp:Y164_METJA
                     HYPOTHETICAL PROTEIN MJ0164 from Methanococcus jannaschii
                     (395 aa); 29.5% identity in 234 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB80139.1"
                     /transl_table=11
                     /translation="MRLKNICFMAMATILCTSVLTGCGTSSAKEDSDNELYIITEDKS
                     SISLSNSKPGMFGVTEDGEIFMEKGYEGKVAYIDKKGKKSIGFKFDKGSEFSYGMAGV
                     KEGNTYKIINQKGKTLVEKEDGVLSPLNNNLIRYEKLANEILTNENTTEAIESLTQSG
                     KTLKTTGILNTKGEIIVEPGRYDEIIKDIGEGYILVKKNKMYGLLNAEGNEIIPCEYT
                     SIGEINEGFIPVSKGNLCGALNEKGEIIVPIEYFYVGSMNEGVAPARLDESGIGFLNK
                     EGSWAIMPDFDGVTSMNNGVAFARKDNKHIIIDKDGKEVETKINFENKVSINGFSDSG
                     LAVVDILDGESKYMSVINTKGEEIKNLEKKDYSALEVYPSGLIVSVNQEGKKGLLKED
                     GSVILEEEYNDIRVISKDVILVDKDGTYSYIDSTGKTLY"
     CDS             555174..555662
                     /codon_start=1
                     /gene="CPE0434"
                     /note="162 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80140.1"
                     /transl_table=11
                     /translation="MESKENSKKSSEAKNKLEKIYSTSLPDGYRFTDFRIGDENNWAY
                     IQYSAGVFKDYQLAIRRIFKEENSLKGNFKNRCVFLENENGERIGTIMIVPSLSEEEG
                     VQEIKYLALLPKYQEQGLGKLLISKAYKMVDDVEGATRINLEAYNDKSIVLFENLGFE
                     RS"
     CDS             complement(555721..556056)
                     /codon_start=1
                     /gene="CPE0435"
                     /note="111 aa, no significant homology. 1 putative
                     transmembrane region was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80141.1"
                     /transl_table=11
                     /translation="MYIDLNFIYLLLALLGCVAIVYLILTLNKVLKLVSNINSLLDQN
                     KDNLTKTINDLPTIANNVNDACQNIKDISDVATETTADLIVAKENIESNVETVKEIAK
                     IINQVFFKK"
     CDS             complement(556062..556478)
                     /codon_start=1
                     /gene="CPE0436"
                     /note="138 aa, no significant homology. 1 putative
                     transmembrane region was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80142.1"
                     /transl_table=11
                     /translation="MSLAKLIDEKRKAKARAERNKKAKVAVTGAAVGTLAGVLGGLLF
                     APKSGKETRNDIKEGSKKAAQKLNDKSVELKENLNTQVAKGKENISDAKSKIKEYLNS
                     KKCKNIEEAVEENLNVPVEVADEATSLETEEVKESN"
     CDS             557024..558361
                     /codon_start=1
                     /gene="hlyB"
                     /note="445 aa, similar to gp:AF051356_4 putative
                     hemolysin from Streptococcus mutans (445 aa); 32.8%
                     identity in 412 aa overlap. Putative N-terminal signal
                     sequence and 1 putative transmembrane region were found
                     by PSORT"
                     /note="CPE0437"
                     /product="probable hemolysin"
                     /protein_id="BAB80143.1"
                     /transl_table=11
                     /translation="MDPSPSILPKIILILVLILINAFFAAAEMAMVSVNKSKIKMLAE
                     KGNKKALLLKKVLKSPGNFLSTIQIGITFAGFFASASAATSISETLAQFMYKLNIPYG
                     NEISVILITVLLSYITLVFGELLPKRIALQKPEEIALMAIRPINVISKISTPFVKILS
                     ASTNLFIKILGLNKSEDKETVSKDEIKSMISIGQESGVIDKTEKDMLDNIFEFDHKVV
                     KEVMTPRGEVFAIKSTTPNETIAKKLISEQFSRVPVYNETRDNIVGILYLKDFFEAVV
                     KVGVDNIKLDQLIRPAYFVLENKAIDDLFKELQDSKQHMAVIIDEYGGFSGIVTIEDL
                     IEEVMGDILDEYDDSENYIDKIDNNTYVVDGLLTLDKLNDYLNLNLESQNIETIGGFV
                     VNLIGNIPQSENQMVEYDNLSFQVCKTNKKRIEKLKIYLNNSTSFNSDVILNN"
     CDS             558636..559688
                     /codon_start=1
                     /gene="CPE0438"
                     /note="350 aa, similar to pir:S74691 iron transport
                     protein from Synechocystis sp. (strain PCC 6803) (360
                     aa); 37% identity in 338 aa overlap"
                     /note="iron-binding protein"
                     /product="probable ion-uptake ABC transporter"
                     /protein_id="BAB80144.1"
                     /transl_table=11
                     /translation="MLKRKKLLALTLTALVSMGVLAGCGQKNQEAKGEETGSGEKIVN
                     VYSSRHYDIDKQLFKDFESDTGIKVNLVDGKSDELIERMAREGDNTSADVFLTVGAEN
                     IAQLNEKDLIKDISSEKINENIPSEYRGKNWVGLTSRARIIVYNKEKVNPETIKTYND
                     LTKNEFKGKVLTRSSSSSYNNALLSSFIQLDGADKAKEWAQGIVNNFARTPEGNDRDQ
                     AKAIMAGIGDVGIMNSYYIAKMISSSDAEEAKVGKEIGVLFPENTHLNLSFGAVTKNA
                     KNEENAVALLEYLTEEKAQKAYVDENGEFALNTKVGKSELQKSWGDFTVQNLNYETLG
                     ESKQEATLIFDQVGWK"
     CDS             559688..561280
                     /codon_start=1
                     /gene="CPE0439"
                     /note="530 aa, similar to pir:E81435 probable iron-uptake
                     ABC transport system permease protein Cj0174c from
                     Campylobacter jejuni (strain NCTC 11168) (538 aa); 34.6%
                     identity in 529 aa overlap. Putative N-terminal signal
                     sequence and 10 putative transmembrane regions were found
                     by PSORT."
                     /note="permease"
                     /product="probable iron-uptake ABC transporter"
                     /protein_id="BAB80145.1"
                     /transl_table=11
                     /translation="MKKIKFNGWALLSTIISLMIVLPNIDIIIHLFQKPNKTWYHIKE
                     YLLKDYIVTSIIVVFFTVLLSIIIGVTLSWFISAYDFPFRKFFRWALILPLAIPPYIG
                     AYTYSGMVSYTGVIQRFFRNILGVELNQKYFDIMSIEGAIFIFTLFLFPYVYMVTMTF
                     LEKQSAGLIESARLLGSSAIGIFFRVIIPVSRGAIVAGSTLIALEVLSDYGVVSYLGV
                     QTFSTAIFKSWISLGDVDSAIRLAGILMVVVFIIISSEKALRGRKKYSFTNTKVRPIK
                     RKNLKGFSKAIVTVYVLIIFSLGFLIPVLQMIAWAIASYKNIYYSQFLSMIFNSVILA
                     SGCSLLIVIMALIVANYVRTRSGLLSKIYAKVTLIGYSIPGAVVAITMILFFVDIDNK
                     IKGLALSTSIIMLVFAYVIRFLAIGYQNIEGGFEKIGNKFTEASRTLGYGVTKTFFKV
                     DIHMLKPAILGAFALTFVDIIKELPLVLTLRPFNFYTLSTKVFEYANDEMIPESAIPS
                     LIIVFVSFVAIYFLYKVADKED"
     CDS             561283..561963
                     /codon_start=1
                     /gene="CPE0440"
                     /note="226 aa, similar to gpu:AP001508_235 ABC
                     transporter (ATP-binding protein) from Bacillus
                     halodurans (349 aa); 46.7% identity in 225 aa overlap"
                     /note="ATP-binding protein"
                     /product="probable ABC transporter"
                     /protein_id="BAB80146.1"
                     /transl_table=11
                     /translation="MFIEIKELYFKYPKSKNDIIDNFNMSLEKGEILSILGESGSGKS
                     TILRIIAGLEESYKGEIKIGGKIVFSDNNFVEPEKRGVGMVFQDYALFPHMTVKKNIQ
                     FGLKGKNKEEKEKIAMDMLKLVNLVEHKDKYPYELSGGQQQRVAIARAIAPKPSVLLL
                     DEPFSNLDADLQEKIRGEIKDILIKAGITSIFVTHDRSDAKALANKFIELKEGKIIKA
                     APINELRC"
     CDS             562253..562942
                     /codon_start=1
                     /gene="CPE0441"
                     /note="229 aa, similar to gp:MBHRDED_1 hypothetical
                     protein from Methanosarcina barkeri (225 aa); 43.9%
                     identity in 198 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB80147.1"
                     /transl_table=11
                     /translation="MDGIGIGIPKMVSGTHYGNLQKVRGGKRTFGITPHIPGGFITPE
                     QLEKIAKVTKKYNGVIKITSGQRLLITNLKGEDLPKIWDELGMEPAVKKQNSVKNVEM
                     CPAGFCKRSKFNTIGTGMKLLNKYKHMDMPCRTKIGVAGCRNACGSVYSKDVGVIADK
                     TGFLVTAGGSAGHNPRMADILIKDVDEKEALRIVDKIFEVYKGEGEAGEKLGDFIDRI
                     GIEVFKEKTLA"
     CDS             563132..563305
                     /codon_start=1
                     /gene="CPE0442"
                     /note="57 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80148.1"
                     /transl_table=11
                     /translation="MSNVCLCKGVSEEKIVEAVKNGTLSFEEVGEKTGAGTGACCGAR
                     CKCKIEELIEENK"
     CDS             563577..563948
                     /codon_start=1
                     /gene="CPE0443"
                     /note="123 aa, similar to gpu:AP001509_89 transcriptional
                     regulator (GntR family) from Bacillus halodurans (123
                     aa); 58.2% identity in 122 aa overlap"
                     /note="GntR family"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB80149.1"
                     /transl_table=11
                     /translation="MNIVVSNTSGVPIYEQIAKAIKNEILSGDLKENSALPSIRSLAS
                     ELRVSVITTKRAYEELERDGFIYTLPGKGSYVAEQNKELLMEEKLREIEEKLGEAIDI
                     ANSIGLNFEDLVGMLKTLKEL"
     CDS             563982..564845
                     /codon_start=1
                     /gene="CPE0444"
                     /note="287 aa, similar to gpu:AP001509_90 ABC transporter
                     (ATP-binding protein) from Bacillus halodurans (288 aa);
                     46.9% identity in 286 aa overlap"
                     /note="ATP-binding protein"
                     /product="probable ABC transporter"
                     /protein_id="BAB80150.1"
                     /transl_table=11
                     /translation="MENVLEIKNISKNYKGFSLKDVSFNIPKGFVMGLIGPNGAGKTT
                     TIKAIMNLINLDSGEIYIFGEDIKKNEISIKDRIGFVYDDCCAFEDFTIKENKKIISK
                     FYSKWDEEKFKYYLEKFELNENKKLKQLSKGQKMRFSLALALSHKAELLILDEPTSGL
                     DPVFRSELLDILFEIIGEEEVSILYSTHITTDLEKLADYITFLNKGKVEFSLEKDLLL
                     EEYFLVKGPLDILNKDLEKELIGLRKTRYNFEGLTNNMRNLKELFGEKIIFEKATLDD
                     IVVYYSKKDVK"
     CDS             564847..565473
                     /codon_start=1
                     /gene="CPE0445"
                     /note="208 aa, no significant homology. Putative
                     N-terminal signal sequence and 5 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80151.1"
                     /transl_table=11
                     /translation="MKELLKLDFFIQKKYIKSSIIVFLFLGITFALTQGMNYLYTMGT
                     FIVFYLTIIPIEVERKIKFNICLNSLPTKKSNYIYSKYLATLIYIIVVNLFLYLFCTI
                     LGVISGSDFTLTLRVILPNIIVQLFYVSLTLPVYMTISHKFYRVVNIIFTILIMMISS
                     ILFNSLENENLQTLFNITNGIYGLAFGILALIISLIVSLNIYKKSEVS"
     CDS             565475..566116
                     /codon_start=1
                     /gene="CPE0446"
                     /note="213 aa, no significant homology. Putative
                     N-terminal signal sequence and 5 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80152.1"
                     /transl_table=11
                     /translation="MKNLIIKDLKNIRVIFIFYILTMTFGYSPFFIDLPKDRYDFLIN
                     SVFIYFTLLASMISVNFIIAKNTNKGAMTNKLLRSLPIDARSVVGTSFILPILIFLIF
                     SLPNILAGMGVSFMLGEKIIVNTFNLLLTFIIFYIYASITFSMAIIYPESSVVSYLRS
                     VPLFILIIGLALVEKFMKNINYDVSNILNSLPLVVLILAVISIFILIVFTSFP"
     CDS             566258..566638
                     /codon_start=1
                     /gene="lguL"
                     /note="126 aa, similar to sp:LGUL_HAEIN
                     LACTOYLGLUTATHIONE LYASE (EC 4.4.1.5) (METHYLGLYOXALASE)
                     (ALDOKETOMUTASE) (GLYOXALASE I) (GLX I) (KETONE-ALDEHYDE
                     MUTASE) (S-D-LACTOYLGLUTATHIONE METHYLGLYOXAL LYASE) from
                     Haemophilus influenzae (135 aa); 47.5% identity in 122 aa
                     overlap"
                     /note="CPE0447"
                     /product="lactoylglutathione lyase"
                     /protein_id="BAB80153.1"
                     /transl_table=11
                     /translation="MASKMLHTCIRVKDLDKSLKFYKEALGLVETRRRDYPEYKFSLV
                     YLSDKEDGYEVELTYNYDQEKPYNLGNGFSHIAVGVEDIEAERERHISLGYEVTPMKG
                     LSDGAATYYFVTDPDGYKVEVIKL"
     CDS             complement(566776..567633)
                     /codon_start=1
                     /gene="CPE0448"
                     /note="285 aa, similar to gp:AE001762_11 transcriptional
                     regulator, putative from Thermotoga maritima (299 aa);
                     26.4% identity in 239 aa overlap"
                     /note="AraC/XylS family"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB80154.1"
                     /transl_table=11
                     /translation="MDRFDRQLELADGIETEYLRILYYTFDKNYKDTYKSYEYKRLCT
                     IVDGEKNVRINNGENIIYDSSKYMLLPPNSSVEMKIEKPTKALVLELNEDLISTVSEK
                     LSYELDVDLNKSILEKPFFNENNELIELTTKRIVETATKDTNNKEFLLDLYAQEITYS
                     LLNTKGAKDIISSDFNNPINRSIQIMKGNLKNNITVSEIAYTLNMSLPSFSSKFKKVM
                     GMTPNDYLTNLKLNEAARLLKFSSVTEIAYDLGYENISHFIKLFKKKFGLTPKQYSLK
                     YSGEVIQIQ"
     CDS             567822..568970
                     /codon_start=1
                     /gene="adh"
                     /note="382 aa, similar to sp:ADH2_ECOLI PROBABLE ALCOHOL
                     DEHYDROGENASE (EC 1.1.1.1) from Escherichia coli (383
                     aa); 63.8% identity in 378 aa overlap"
                     /note="CPE0449"
                     /product="alcohol dehydrogenase"
                     /protein_id="BAB80155.1"
                     /transl_table=11
                     /translation="MSYKFFMPAISLMGADCLKDAGDQVGELGFKKALIVTDKVLGQI
                     GIVKKVTDVLDNKNIEYAIYDETKPNPTVKNVNDGLALLKEKECDFVISLGGGSAHDC
                     AKGIALLATNGGEIKDYEGVDKSKKPQLPMVGINTTAGTGSEMTLFAIITDEERHIKM
                     ALVDKHLTPIIAVNDPMLMLAMPKSLTAATGMDALTHAIEAYVSTSATPITDACAEKA
                     IELISNYLVNAVENGENVEARDMMAYAEYLAGMAFNNASLGYVHAMAHQLGGFYNLPH
                     GVCNAILLPHVQEYNKDTSASRLAKIAKIMGGNIEGLTDEQGADLCIDMIKSLSQTIG
                     IPEGLGVLGVKESDFETLATNALNDACSLTNPRKGNLEEVIAIFRKAM"
     CDS             569554..569877
                     /codon_start=1
                     /gene="CPE0450"
                     /note="107 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80156.1"
                     /transl_table=11
                     /translation="MSIAIMACRKVIGKCAASGCFKAYNNSTAAFSIYGENKEDLASF
                     FYCAGCKDTLVEGENWTHKVKQLKKNGVETIHISHCIESKCDDLKKHERILEKEGFKI
                     VHGTH"
     CDS             569990..570382
                     /codon_start=1
                     /gene="CPE0451"
                     /note="130 aa, similar to sp:YWKD_BACSU HYPOTHETICAL 14.8
                     KDA PROTEIN IN TDK-PRFA INTERGENIC REGION from Bacillus
                     subtilis (128 aa); 64.3% identity in 126 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80157.1"
                     /transl_table=11
                     /translation="MNLKKIHHVAIIASDYKKSKDFYVNLLGLKIIREVYREERDSYK
                     LDLEIGDSQIELFSFKNPPKRPSYPEACGLRHLAFEVENIEKQVRELKEKGIKVEEIR
                     IDEFTGRKFTFFSDPDDLPIELYEITCN"
     CDS             570703..572580
                     /codon_start=1
                     /gene="entC"
                     /note="625 aa, partially similar to gp:AF192766_1
                     enterotoxin from Bacillus cereus (419 aa); 31.5% identity
                     in 130 aa overlap. Putative N-terminal signal sequence
                     was found by PSORT"
                     /note="CPE0452"
                     /product="probable enterotoxin"
                     /protein_id="BAB80158.1"
                     /transl_table=11
                     /translation="MKRKKLSIFILSAAIVTSSVSYGMTAKADEVKETKGYNYNVNLS
                     EQKAVANNKISVKKVNGEILGYANPFTMLQILNMNGKTVEVITQSGLRGYVDANEFTL
                     VESAVNDKLIEKNIEGHVTNVSTVLNLRKEPRIGAEIINRLLNNTKVNILGKQGSWYK
                     IELNGQKGYVYGMFLNEGTMKENSSKTIANKKSEVKSKDKKEKKSSVKKEAKKEVVSG
                     VKAKVVQKQREEAKANMTSEAKPAINKDAKSNNKVEVKSEVKKEAKNEVKTEMNSSTK
                     VETSQVVTSEMVQAVNTEVKSEKNQEANLQVRPEIKSEEKTEMISKENLNVIPEAKKE
                     GISEEIKPEVNTEVESKPEMNKEVKAEEGKTAPEVKLEEKQEVKPVEASEEKVEVKKE
                     EVQDPKAKEMDELLKSEEYKFLRMSISYGERLVDRNDVYTKDSLKILRTELEKAKKVF
                     QDKDNLTMKLVQDTRDDLERAIVDLVKISDVKKPVKSKAKVEVKKESNTEKKQEVKEQ
                     PAKAEVIVPEVKENKEIKKEEPVKAKEVVKEKKSREEEIEEILKSEEYRFLLKDIAYG
                     ERLSEKITVYTRDSLKVLNAAIEKAGRIVRQKEKLTVKLVQDTRDDVDRAIVDLVKKN
                     N"
     CDS             complement(572798..573583)
                     /codon_start=1
                     /gene="CPE0453"
                     /note="261 aa, similar to gpu:AP001519_11 transcriptional
                     regulator of multidrug-efflux transporter genes from
                     Bacillus halodurans (271 aa); 33.8% identity in 240 aa
                     overlap"
                     /note="MerR family"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB80159.1"
                     /transl_table=11
                     /translation="MDKYFSIGEVSKITGLSIDRLRNYDKIGLLKPSYIDPNSGYRYY
                     SENKFRKLRIIKYLRKIGTPLKEIDLILNKNIDSQEFAKFLELKIRDIEKEIESLNMI
                     KEDISEIKHTFECNFKLSNINYIHKKYINERYVVKKKLNKNINFVVSHREQVFSKFKS
                     EINNLEPPRSLEKGLYLHSLEDLESNNTEVYMLLKDYENLHNFIIPSGNYLCLSYKEN
                     ERDKAIFKLKSYIKENNIKVKGPILNLVLTTLPKEEFQFQILI"
     CDS             573696..575516
                     /codon_start=1
                     /gene="CPE0454"
                     /note="606 aa, no significant homology. Putative
                     N-terminal signal sequence and 8 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80160.1"
                     /transl_table=11
                     /translation="MTIKQMNIKRFKLPLIFAVLSVVLMGLYKTIFGVENTIIGLIIA
                     MASYAFLRLDLTSYPIYKSMIFLILNLFLAISAYISAINPFVGLIINFLILFTVSFIY
                     TTEFKNVISYIFLLLYVYMLEYPISLDELPRRLVAMGVGVFIIIGIHILFNRRNFKKN
                     SNNIIIRSIRNIQKEICHIINESYRERENIYIDSELRKLLVLIEGRNNNKFIENHKDD
                     IYFNIVLILERINSIINKVGKINNKSKYVIDYLNRLNHDLENITLFLERKVDCINEEK
                     DGLNKPSMINNFTDKEYTFLGECTELIRLLEKNINNLYEYRRKKSRKRIKVKFNLKEL
                     LIGNSSLKVKDLRVAYSLKLAIAVSLIMFIVDLFKIHQGRWIVTSVYVVIQPYEEETL
                     TKAIKRFKGTIIGVIIYISIFTFFPHIIPLELLLLILMFLYFVQKDYEKKVVCTALMT
                     LSLGLSRSTVGSLAFYRFFFVIIGIVIALMVNKLIFPQSVKNSIYDLKERYLELTNKL
                     LCELKSILYEEKYNENTVKLLLDCNLIESKLMENKLIAENLELKDLVYKQSIILSKIR
                     CLILFINYSNWGISSKHINVDKNLLNVIFNKIEEELMEIY"
     CDS             575822..576331
                     /codon_start=1
                     /gene="CPE0455"
                     /note="169 aa, similar to N-terminal of sp:APL_LACLC
                     ALKALINE PHOSPHATASE LIKE PROTEIN from Lactococcus lactis
                     (242 aa); 30.5% identity in 154 aa overlap. Putative
                     N-terminal signal sequence and 2 putative transmembrane
                     regions were found by PSORT."
                     /product="alkaline phosphatase-like protein"
                     /protein_id="BAB80161.1"
                     /transl_table=11
                     /translation="MDFITITNYFAEYGLLFLFVIILLEYMNLPGLPAGIIMPAVGVL
                     VSKSEMNLITALLVSVIAGLIGSWILYCIGRFGGEVILKKYLNKFPSHESFVNSKIDY
                     LREKGYTGILISKLIPMARTVISIPAGVLKLNFLKYSAYATLGIFIWNTVLISSGYFL
                     GEELLKFLG"
     CDS             576404..577036
                     /codon_start=1
                     /gene="CPE0456"
                     /note="210 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80162.1"
                     /transl_table=11
                     /translation="MKAVVKRVYNGYLNFVLKTSTVSFENFYEIDDEIMDNCILGFWR
                     ENSYSMNLLLKKLNRYYKVKKNQELDVNVVVTDDSRGEYIEYILNSYGASALKMPDDV
                     NKKEFIKELREKSKEDSLVALALDGPIGPLHEPKKIAFSLAKDSNKPFVGIKVRHSKK
                     LKLKNKIDNYGIPLPFTKIQFSADVFGNIDNEVLTNFKEYKEIVKERLCF"
     CDS             577266..577970
                     /codon_start=1
                     /gene="CPE0457"
                     /note="234 aa, similar to gpu:AP001511_42 two-component
                     response regulator from Bacillus halodurans (232 aa);
                     55.7% identity in 230 aa overlap"
                     /product="two-component response regulator"
                     /protein_id="BAB80163.1"
                     /transl_table=11
                     /translation="MEKYNVLVVEDEKEIAEAIEIYLKNQGYNVFKGSNGLEGLEIVE
                     KEEVHLAVVDIMMPKMDGATMVMKIRESYDFPIIMLSAKSEDMDKILGLNIGADDYVT
                     KPFNPLELLARVNSQLRRYSKYLNMVKKDEKKTNSYSIGGLEVNSDRKEVILDGDVVK
                     VTPIEFKILQLLIKSPGRVFSAEEIYERVWNENAVNTDTVMVHVRNIREKIEIDPKNP
                     KYLKVVWGVGYKIEKQ"
     CDS             577945..580176
                     /codon_start=1
                     /gene="CPE0458"
                     /note="743 aa, similar to gpu:AP001511_43 BH1154 gene
                     product from Bacillus halodurans (750 aa); 29.8% identity
                     in 652 aa overlap. 6 putative transmembrane regions were
                     found by PSORT."
                     /product="two-component sensor histidine kinase"
                     /protein_id="BAB80164.1"
                     /transl_table=11
                     /translation="MAIKSKSNKENLQVNKENRTNKTKWVFTIITLILIGIISICLLL
                     SYPIIKKNAPSYITSYSLLDNYNFREKIINTNYGIYYDYLEKKAEENDKELNPIEDLF
                     TLKRENISNSEESPEYNLNEDKRELNSHIKELINKVHSLGNLRVYAMDEEGNTVYESK
                     GDQNWLLETLAKGSYIENGDLENYYRFYMVLKYNNRGKVSLEKIYGEDSPRVSNLLLD
                     MDSQYFAYHNEYEAKPIENMTYVYAVPKTLEYQDNLYYSEMNNKIMALGSASAPFIMI
                     GIIFTCLLALLIPFKYTREVLGFNKFLKIPFEINFIIASIMLAFTIESGRLIIIPTLQ
                     GGLSEALKMTSLPHLDIVTNIINVLYWMVIYGFVFFEVIYVKYIFNIGFKNYIRKHLL
                     VYKVKDVIFFILRKFINYIKGIDLNKNSDKVLLIILGINFVIVSILCSVWFFGIFGVV
                     IYSGILFYFGRKYIDKWKKDYNKILEKTKEISNGNLDSKDDEDCGFFNPMRDELNNIQ
                     KGFKAAVEEEVKSQRMKTELISNVSHDLKTPLTSIIAYVDLLKGEEDEEKRKAYLETL
                     ERKSQRLKHLIEDLFEVSKATTGNINLNIMDVDISYLMKQVVLELDDKINEAGLDMRL
                     SLPEEKVILPLDGQRTYRVFENLIINVVKYALPNSRVYIDIKDGRENVDVIIKNISAD
                     EITFNINEISDRFVRGDKSRNTEGSGLGLAIVKSFVELQGGKFHIEVDGDLFKAIISF
                     KKK"
     CDS             580610..580855
                     /codon_start=1
                     /gene="CPE0459"
                     /note="81 aa, no significant homology. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80165.1"
                     /transl_table=11
                     /translation="MIKSIKKNLKPKILISNLILIIGIVIFVTLYGAVFGSANSLVGV
                     CAITAMLMFVDVHLSLKLNEAIITTVLSFGLMGVQVK"
     CDS             580950..581645
                     /codon_start=1
                     /gene="CPE0460"
                     /note="231 aa, partially similar to gpu:AE004017_3
                     conserved hypothetical protein from Xylella fastidiosa
                     (740 aa); 29.8% identity in 171 aa overlap. 6 putative
                     transmembrane regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80166.1"
                     /transl_table=11
                     /translation="MPFILCYVFIEGTPITWSELPRRLIALFVGGALIALVYYFSHRK
                     KDDSDHMNISEMIKTMNKNTLQFNFSLRMALAVSIAMLLGSILGFQKSMWISITAMSI
                     TQPHFDDTKTRVKERFFGTLIGSAIFVLIFVYLVPQQFSSIVLLILSYIYTFIKEYKI
                     KMIFITMSSLGAAMILFQPGVSVPMRIAFIVMGIGIALVVNKVIYGRLKLEESNEELD
                     ETIKDIDKVNDEF"
     CDS             582364..583026
                     /codon_start=1
                     /gene="CPE0461"
                     /note="220 aa, similar to gpu:AP001519_184 capsular
                     polysaccharide biosynthesis from Bacillus halodurans (232
                     aa); 19.5% identity in 215 aa overlap. Putative
                     N-terminal signal sequence and 1 putative transmembrane
                     region were found by PSORT"
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="BAB80167.1"
                     /transl_table=11
                     /translation="MEEKTLDIQEILYALKKRYKLIIIIMLLPILFSAYKAYKMKPSY
                     QSRVKFFIGKEGIKGTYSVGELEEYKKMIGAYVEIFNNEDVVSKLLKKANIDLPTNYV
                     RSGLSFIPGNGSIPTLEISYRSYNKEEVDQIIKVMTDEFESIVGEYIVNSNIEILDYP
                     KSRTIMPNKKKVILVGVIAGLVIALGVIFILDYLDNSIKNKKELEKILPIPVIGEIPI
                     HD"
     CDS             583049..583726
                     /codon_start=1
                     /gene="CPE0462"
                     /note="225 aa, similar to gpu:AP001519_183 capsular
                     polysaccharide biosynthesis from Bacillus halodurans (235
                     aa); 52.1% identity in 188 aa overlap"
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="BAB80168.1"
                     /transl_table=11
                     /translation="MFLVDKDPKSIAAESYRVLRTSLEYSSIDKELKSIVVTSSEPGE
                     GKSTVAGNLASIIAQNNKKVIIIDCDLRRPTIHKKFGISNSIGLTEYIIGKNDLNNVI
                     QILNENFSVITSGRIPPNPSEILSSKSMENLLKALSVCYDYVILDTPPLTAVTDAQIL
                     AGKCDGTILVVRAESTSKESIIKAYKELEKVRANVLGSVLNGIKGNNKNYYYAEDNKK
                     KKLKVRS"
     CDS             583751..585664
                     /codon_start=1
                     /gene="CPE0463"
                     /note="637 aa, similar to gp:AF155805_2 Cps9E from
                     Streptococcus suis (608 aa); 43.4% identity in 588 aa
                     overlap. Putative N-terminal signal sequence and 3
                     putative transmembrane regions were found by PSORT."
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="BAB80169.1"
                     /transl_table=11
                     /translation="MEKEGKVKALFLMSLDILIIVNSYILAFTIRFNFDFIMDKRNEL
                     ILFLPVIVIIYLIMLSIFKMYKSIWTIVGIDEVAFGLIACLIATGIILITSTIISSIY
                     YIDYITVLLAGLFIMIFTIGIRVSFRIYRRMISHGRVLLNSSNISNLEKILIIGAGSC
                     GQLIIEEIRKQNPIKQKVIGVIDDNPSKIGTYLRGIKILGNRNKIIEISEEKNVDLIL
                     IAMPSVDGKTKKEIIEICQSTRAKVKIIPGMYELIGGKVSLNRMRDIDLRDLLGREEV
                     ILDKKGIKDYIENKVVMVTGGGGSIGSELCRQIAKFSPKLLLILDIYENNAYELENEI
                     ISNFKNLKEKVLIASVREEKRLENIFNEYKPQVIFHAAAHKHVPLMERNPEEAIKNNV
                     IGTLNVAECAHKYGAERFVLISTDKAVNPTNVMGASKRMCEMIIQAIDKNSNTEFVAV
                     RFGNVLGSNGSVIPLFKKQIAKGGPVTLTHKKITRYFMLIPEAAQLVLQAGAYAKGGE
                     IFVLDMGNPVLIYDLAKDLIKLSGFEPEVDIKIEITGLRPGEKLYEELLMDEEGLRKT
                     SHEKIFIAKPGEYDFEMLKLGVNALKKIADLGDVETLKTALQFIVKTYKRLDTENNSV
                     FNEVALHEASEAI"
     CDS             585795..586937
                     /codon_start=1
                     /gene="CPE0464"
                     /note="380 aa, similar to pir:F70037 spore coat
                     polysaccharide biosynthesis homolog yvfE from Bacillus
                     subtilis (301 aa); 57.3% identity in 286 aa overlap. Also
                     similar to many aminotransferases"
                     /product="spore coat polysaccharide biosynthesis protein"
                     /protein_id="BAB80170.1"
                     /transl_table=11
                     /translation="MGKKRIFLASPHMGGLEEVFVKEAFQSNWIAPLGPNVNAFEKEI
                     ADYVGIKSAAALVSGTAAIHMALKCIGINKGDKVFCSSLTFAASCNPIIYEKGKPVFI
                     DSEPNSYNMSPIALKKAFKRCEEDGQFPKAVIVVNLYGQSADLYKIKEICDFYKVPII
                     EDAAESLGATYQGKMSGTIGDYGIYSFNGNKIITTSGGGMLVSNNEDMIEKTRFWSTQ
                     SRENERHYEHKELGYNYRMSNVVAGIGRGQLRVLEKRIENKKYIFESYKEAFKAIDYI
                     DMAPICQYGEPNYWLSIITLKEESKVKPIDIIKALEKENIESRPIWKPMNLQPFYKDF
                     EFFNHNEEGISVGEDIFSRGVCLPSDTKMTEEDINRVSQIIKELFL"
     CDS             586974..588206
                     /codon_start=1
                     /gene="CPE0465"
                     /note="410 aa, no significant homology. 1 putative
                     transmembrane region was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80171.1"
                     /transl_table=11
                     /translation="MERSQRQIIKLLNLAIHGEKLSDFKSISKWNEIMCEANAHEISA
                     LIYSSIYGIKSLEGLSKEELNQWKKSTFFTGVGQISHYNQVGKLLEKFNEENIDVIVL
                     KGLVVRDLYPKPEFRTMGDSDVLVHEEDLERVTELLQELGYKLEECEDEHGAHLVFSH
                     EKYRHVEVHWTLVNDDYFIGTKEFEKDIWKNSMKIKIVKAEVLSLGWEDLALHLCLHM
                     AVHIVCGGFGLRQLCDLVLLVEQKGDEINWGNFMFKAIECGAEKFILAIFKCCEELFN
                     IEIPIEISNSGSIENELVEDLIQNIFNSGVFGKKDVIGTLGADFAYSKDEKEKKKSIS
                     EKYLDLVFPKVENMSEKYKYAQDNKILTPVAWAHHLGAGVLNKDYSLKNKIRFLTKSV
                     TVSKKKRKLLEELNLTKK"
     CDS             588224..588637
                     /codon_start=1
                     /gene="CPE0466"
                     /note="137 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80172.1"
                     /transl_table=11
                     /translation="MSLCKGQIKIGKKKVKKRTIRFLFQRYLKNNYRYIHSEFNNKYK
                     YEILEPIKIDNLEFFIDLNFNGVNPKEIELRSVDYIDNNEFKLYEEWTKRNLGVDIGD
                     LSLQKRSFRWGTIKVKLTKLNKDDPGCITIKLKYK"
     CDS             588699..589616
                     /codon_start=1
                     /gene="CPE0467"
                     /note="305 aa, some similarity to gpu:AP001508_4 ABC
                     transporter (ATP-binding protein) from Bacillus
                     halodurans (213 aa); 22.8% identity in 123 aa overlap. 1
                     putative transmembrane region was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80173.1"
                     /transl_table=11
                     /translation="MKKWFYKVYGLIVESDIEIPELLSIDKNENKVDIKIKKDIIPKD
                     VIEKIPSYSWFKYDVDSMVFTVKNIGSFYIYDGKNIVVQPSENADNQGIKTFILGTSF
                     GMILLQRNKVAIHGGAILIGENAIILTGQSGAGKSTLTNAFRQYKYQFMADDVCSTIE
                     LQDEIFIEPAYPQQKICRDAMEKMGYMIDDFELIDEDRGKYVIPTHESFVKEKRKLQA
                     VFEIQPYDGEEVKIEEVSGGEKMKTILRNIYRIEIISPHGIPPAYFKKVINIAKNTLV
                     FRIKRPRGQFSVDRQIELIEKELMLKCNV"
     CDS             589646..589933
                     /codon_start=1
                     /gene="CPE0468"
                     /note="95 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80174.1"
                     /transl_table=11
                     /translation="MVSKLISLDSIVSQKEGIDVTELNGEKVMMDLDKGKYFMLNETG
                     STIWDAINEPKSVSEIIEATIKEYDIDRETCESKVLEYLEKLRHEEIVFIN"
     CDS             589908..590363
                     /codon_start=1
                     /gene="CPE0469"
                     /note="151 aa, no significant homology. 1 putative
                     transmembrane region was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80175.1"
                     /transl_table=11
                     /translation="MKKLSLLIRKIKTFFKIDFESKVMFCKAFILCGFYRFIILNISF
                     SKVKKLLGEKGKESDFKIDIEHYKIVKEVGFIVKLASSHTPWESKCLVQAMTAQKILK
                     DKGIKTTLYLGVAKERNNMVAHSWLRYGQMFVTGGNGDLNYTRVGCFAK"
     CDS             590494..590679
                     /codon_start=1
                     /gene="CPE0470"
                     /note="61 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80176.1"
                     /transl_table=11
                     /translation="MKEWRNPELMILGVKNTETTNPVDEDCEKCECFGHSHGTIPNIC
                     DCCDDDDPICPGNPMRS"
     CDS             590799..591017
                     /codon_start=1
                     /gene="CPE0471"
                     /note="72 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80177.1"
                     /transl_table=11
                     /translation="MKKWENPELMILGVESTKQDSDPTGETLVFCSECGENHQPDRCI
                     LFPKPPHKPAEPGEGPYPLPTPTLPALS"
     CDS             complement(591064..592935)
                     /codon_start=1
                     /gene="CPE0472"
                     /note="623 aa, similar to pir:F75142 abc transporter
                     ATP-binding protein PAB2148 from Pyrococcus abyssi
                     (strain Orsay) (580 aa); 24.7% identity in 547 aa
                     overlap. Putative N-terminal signal sequence and 4
                     putative transmembrane regions were found by PSORT."
                     /note="ATP-binding protein"
                     /product="probable ABC transporter"
                     /protein_id="BAB80178.1"
                     /transl_table=11
                     /translation="MKNLKELLKKIKWIYLQSKLILPVLILIVFISSFFSLIGVYDAI
                     VSKNLIDSAISGNTNSVLKWLVIMASIMLLNIISYPIISLINTYTSTKMSQTLQKKIY
                     AHINYSNWQESSKHHSMNLLTRLTNDVSTITGTVMQTIPSIISLSITLLASFTTLIYL
                     SPAIAVVAIFIGPFLLLISRLFAKKLKKIYKEIQEEDVKYRTFIQESIKNLIIVKTFC
                     LEKVNLDKLSKIQKRRFELSLKNTKIGIKSGITLSICSSIAYFTIFCWGALNLSKGIG
                     TYGTLMAMLQLYNKVQGPFSALASKFPSLVGAIAATERLMEIEELSLEKHKDLKEGIN
                     KLCIPKVNNKKIIDNKIHDTNSDDIFYSKDSYPKKIDFGINFSNVSFSYDKDKPILKD
                     LNLSIESGEIIGLIGPSGQGKTTLIKIILSLLNIDNGNICLNLKENTQSLLALDSLNE
                     REEKNSYNYNSELSPLHRELISYVPQGDTLFSGTIEENLRYGKPNATLDEIIKATKKA
                     CAFDFIEELTDGFNTVIGENGLGISGGQAQRIAIARAFLRDKPILILDEATSALDPET
                     EIKVINEVKNLSHKPICIIITHRPLALGICTRILELKDSSIKEISKNELKKLNEIKI"
     CDS             593436..594053
                     /codon_start=1
                     /gene="CPE0473"
                     /note="205 aa, similar to pir:T44837 probable
                     UDP-galactose phosphate transferase from Acinetobacter
                     lwoffii (203 aa); 55.1% identity in 196 aa overlap.
                     Putative N-terminal signal sequence was found by PSORT"
                     /product="probable UDP-galactose phosphate transferase"
                     /protein_id="BAB80179.1"
                     /transl_table=11
                     /translation="MSKKKNRIFIKRILDICVALGLLIVLFPVIVIVAVLVKTKLGSP
                     IIFTQERVGKDNKIFKMVKFRTMKECIDKDGNILPDEERLTSFGKKLRSSSLDELPEL
                     INILKGDMSLVGPRPLLVDYLPLYSKEQIRRHEVLPGLTGWAQVNGRNNLIWNEKFEL
                     DVYYVENWSLTLDLKIFFLTFYKVFKREGINQDGQVTMEYFNGEN"
     CDS             594105..594743
                     /codon_start=1
                     /gene="cysE"
                     /note="212 aa, similar to pir:E70037 serine
                     O-acetyltransferase homolog yvfD from Bacillus subtilis
                     (216 aa); 33.2% identity in 214 aa overlap. Putative
                     N-terminal signal sequence was found by PSORT"
                     /note="CPE0474"
                     /product="probable serine O-acetyltransferase"
                     /protein_id="BAB80180.1"
                     /transl_table=11
                     /translation="MKDLIIVGAGGFGREVAWLVEDINNNNREWNLLGFIDENEQNHG
                     NELNGYKVLGGFDYLNNKKNIYYVCAIGNAKVRKEIVEKKCSKYNIKPANLIHPSVIM
                     SKKYNKMGEGCIICASNIITVNVTLGDHIIVNLDCTIGHDVVINDYVTIYPSVNVSGN
                     CNIGECVELGTGTQVIQGNNIGDRTIVGAGSVVIRNIEGDKVAVGVPTKVIK"
     CDS             594774..595931
                     /codon_start=1
                     /gene="CPE0475"
                     /note="385 aa, similar to pir:C70036 capsular
                     polysaccharide biosynthesis homolog yveN from Bacillus
                     subtilis (381 aa); 34.4% identity in 369 aa overlap"
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="BAB80181.1"
                     /transl_table=11
                     /translation="MKKILYITTVSRTINAFLVPHIEMLLENGYKVECATCVDKKVNQ
                     VLINKGVKIFNIPFSRSPLSFGNIKAFKELIKLQKENKYDIVHVHTPVASIYGRLLKI
                     RFPKLKTIYTAHGYHFLKGGPKLGWIIYYPIEKVMAKLTDVTININKEDYEITKTKLN
                     PKKCYLVNGVGLDLNQYKPLSKEKQESKRKELGLEKDDFVVIMIAELNENKNQIQLIK
                     AMELLKDKYPNIKAISIGEGHKFEELQQEINNRGLKNNFKLLGFRTDVNELINISNIG
                     ILLSYREGLPRNIMELMANGKRIVATDIRGNRDIVCNDFIGALVEVNDYEATAKAVEK
                     FYLTSANKNKILKEVERYSISNILTELSFVYDSLQEGGNQNEKMSSYITNE"
     CDS             595897..597003
                     /codon_start=1
                     /gene="CPE0476"
                     /note="368 aa, similar to pir:F70441 capsular
                     polysaccharide biosynthsis protein from Aquifex aeolicus
                     (316 aa); 31.2% identity in 202 aa overlap"
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="BAB80182.1"
                     /transl_table=11
                     /translation="MKKCLHILPMNKLSGAEKMALLICKNMKKFTPVVVCGGKSLSEI
                     FKKEGIESYDTTFSNKNIFKTLRFLKNIIEKNNIKIIHAHDNNASLNAYLVKRTFRLD
                     IKVISHIHNCYPFLKGKNFNKLLDSYFRPRYDYNISCGSLVYEFYKKNTKYFRTDKTE
                     VLSNAMDIKEINKFDFNKSKEIIEKFKIPKNKKILGFIGRLDEQKGINPFIKELSKYK
                     EYFNDCTFLLVGSGSQEQEIKILIKELNLEEYFILTGFQEDTYKFYPIIDVFFLPSLY
                     EGLPMVLLEAMAFKKTIVSMDVGSIGELINDKTGILIKKGDYKTFINSLKYIKDDENK
                     VERYGEEASRFVRENYNIESYVEKIEKKYKSLIS"
     CDS             597023..597907
                     /codon_start=1
                     /gene="CPE0477"
                     /note="294 aa, similar to pir:S51262 probable
                     beta-glycosyltransferase trsC from Yersinia
                     enterocolitica (292 aa); 33.3% identity in 258 aa
                     overlap. 1 putative transmembrane region was found by
                     PSORT"
                     /product="probable beta-glycosyltransferase"
                     /protein_id="BAB80183.1"
                     /transl_table=11
                     /translation="MEKLLTVFTPTYNRVHTLHKCYESLKNQSCKDFKWLIIDDGSTD
                     GTKDVVKRWIHEKNDFEITYIYQSNKGMHGAHNTAYENIDTELNICIDSDDYMPRDAV
                     EKINKNWNRVKHNKKISGLVGLDSYENGDVIGKKFPEGLKEATLFEINNKYKIPGDKK
                     LVYRSELTKKFPYPIFEGEKYVGLAYKYYKLDEEHRLALINDILCVVEYLEDGSSKNM
                     IKQYKNNPKGFAFYRIENIKNSKATLKFKFKESIHYVASSFISKNKNFLIESPEKILT
                     LLSIPMGMLLYLYIKIKG"
     CDS             597933..599000
                     /codon_start=1
                     /gene="CPE0478"
                     /note="355 aa, similar to pir:F70036 capsular
                     polysaccharide biosynthesis homolog yveQ from Bacillus
                     subtilis (367 aa); 34.6% identity in 286 aa overlap.
                     Putative N-terminal signal sequence and 8 putative
                     transmembrane regions were found by PSORT."
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="BAB80184.1"
                     /transl_table=11
                     /translation="MAAFYFALIGSYVFSLIARIIKNKKNYPNLYFSIFAILILALIA
                     GLRWGIGDTPAYVHLYSLIEPGYDPKGGYELGFVLFLAILKSISKDPQFMIFVTGIIT
                     TILNLWTIRKYCKDSYFELAIFVYVASGYYLVTMNGIRQSLAASIIFAGTSFILRGEF
                     KKYLFLCILMTTFHTSALVMIPAYYVVRNEAWSKRIYQLLILFLIGMFLYEPLMAVVY
                     KLLGNSKYADYQNFNEGGSNILRVIVFAIPVILSYIKRDKLKEWPEANVFVNMSLISF
                     FIMGFSLYNWIFARFTIYFQVYSFVLLAYIIKMCFGGSERRLIYYGFLVCYFLFFIYE
                     YKISLGIVYVSNFSISKYFYY"
     CDS             599019..600128
                     /codon_start=1
                     /gene="CPE0479"
                     /note="369 aa, similar to pir:E70036 capsular
                     polysaccharide biosynthesis homolog yveP from Bacillus
                     subtilis (384 aa); 33.2% identity in 368 aa overlap. 2
                     putative transmembrane regions were found by PSORT."
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="BAB80185.1"
                     /transl_table=11
                     /translation="MRKILHIVGGMNIGGTETMLMNLYRKINKDISFDFISYYEREAY
                     YDKEIESLGGKIIKLGSPNRKGIYKSIKDLCKIIREYGPYDAVHAHTLFNCGIVMIAA
                     KICGVEVRISHAHTNLDNNISFLRKIYMTSMRGIIKIFSTNYLACSDDAGKYLFGQAI
                     TGNKNYIKLPNYIDYLKFLQCNESNIRKELGISEEEIVVGHIGTFKSSKNHSFLIDIV
                     NNMIKKNGNVRCILVGEGELKKEIQYKCRELGIEKKVYLLGLREDTEKILNSLDLFVF
                     PSTYEGLGLVMLEAQACGLPCLVSEAIQPEADLGLGLVKKMKLKDGDNIWSEEALKLV
                     KNKNKNKQLIEEAFENNGYDLENIINTLLKVYRIN"
     CDS             600146..601336
                     /codon_start=1
                     /gene="CPE0480"
                     /note="396 aa, similar to pir:F70441 capsular
                     polysaccharide biosynthsis protein from Aquifex aeolicus
                     (316 aa); 30.8% identity in 201 aa overlap"
                     /product="capsular polysaccharide biosynthsis protein"
                     /protein_id="BAB80186.1"
                     /transl_table=11
                     /translation="MKKVLIGSFDMEVGGVERSLISMLDNFDYDNHEVDLMLYSHTGD
                     FMPLLNNKVNLLKEDRKYSTFRKSIVETFKQGNILLGSSRILARIFANLKGKINKTNE
                     YGVYQMQLMWKYALPFLPKIEKEYDVAISYLWPHYFIAENVKAIKKIAWIHTDYSTIE
                     TDVNLDLKMWDKFDHIIAVSEECKNAFLTKYPILKEKIKVIENITSPDFIKKMAKENI
                     ECIEEDNSFKVLSVARLSHAKGIDRAVKALKILHERGLTNIKWYVVGYGGDEEIIRKL
                     IEENNFQESFILLGKKFNPYPYMKKCDLYVQPSRYEGKAVTVGEAQILGKPVMITNYT
                     TAKSQVKEDFDGYICDSTIEGIADGIEKLFEDKALRDKLAYNCKKSDYRNSNELNKLY
                     DLIN"
     CDS             601394..602422
                     /codon_start=1
                     /gene="CPE0481"
                     /note="342 aa, similar to pir:T50039
                     beta-1,4-galactosyltransferase cps14J from Streptococcus
                     pneumoniae (318 aa); 34.5% identity in 310 aa overlap"
                     /product="beta-1,4-galactosyltransferase"
                     /protein_id="BAB80187.1"
                     /transl_table=11
                     /translation="MLPKVSLIVPIYKVQDYLNKCIDSIINQSYKNLEIILVDDGSTD
                     RCGEIIDLYEKQDNRIKVFHKKNGGLSDARNYGMNFITGDYVIFVDSDDWLSEDMVSD
                     LMKTSLELNADIVQSGFYYAYDDYLLYDNRYYLEDMSPVVLNREELMYELVINEKVKN
                     FAWGKLYKSVLIKDISFKIGVLFEDVFWAHKVMDRVDKYVIIHKPMYYYRQRKDSIVA
                     IYTERNLDILKGLQERHKFIEKKYISLINESYKIIFKTSLIHYYLLKKKKNIKNRDYY
                     MNDIKEYIKSNFRNIEKSLKNERELIWQLHLFQINPNLNRIYILSSKILKKLGLKKAE
                     LGLMRIDL"
     CDS             602440..603594
                     /codon_start=1
                     /gene="CPE0482"
                     /note="384 aa, similar to pir:T50042 hypothetical protein
                     tasA from Streptococcus pneumoniae (359 aa); 39.7%
                     identity in 317 aa overlap"
                     /product="probable glycero-phosphotransferase"
                     /protein_id="BAB80188.1"
                     /transl_table=11
                     /translation="MNYKKTNFNKSLVIAITKIFNHLPVKKNKIFFYSYYGSQYGCNP
                     KYISEYIAKNLPGKFDLVWAFSSLEPNGNIDGVRKVRVTSLRYIYELCTSKIIITNFR
                     TTDTFIKRKDQYYIQTWHSSLRLKQIEKDTESTLPKDYVKMAKEDSKKIDLLLSGCKY
                     SSDIFKRAFWYQGEIFEHGTPRNDIFLKNNIVENKKIRCKLNINEDKKIILYAPTFRK
                     NNKLDVYNIDYSLILNTLRNKFDNEWIFLVKLHPHLISKSKYLALGEGVIDVTSYDDI
                     QELLMVSDILISDYSSLMFDFALSEKPCFLYVPDINEYIKEDRKLYFNINELPFIAVK
                     NNDELKSAIEDLNLKSYRENLSKFFQKIGSFEDGRCCENLLKRIEKVCFK"
     CDS             603657..604079
                     /codon_start=1
                     /gene="CPE0483"
                     /note="140 aa, similar to pir:A70419 glycerol-3-phosphate
                     cytidyltransferase from Aquifex aeolicus (168 aa); 46%
                     identity in 139 aa overlap"
                     /product="probable glycerol-3-phosphate
                     cytidyltransferase"
                     /protein_id="BAB80189.1"
                     /transl_table=11
                     /translation="MKKYKVGYTTGVFDMFHIGHLNIIKRAKEQCNYLIVGVSTDELV
                     QEYKNKKPIIPFYERCEIVKALEYVDKVVAQENRDKFWAWKKLNFDVMFVGDDWKGKS
                     LFVEVEEEFKKVGVDIVYFPYTKDTSSTILREKLNSIS"
     CDS             604095..605087
                     /codon_start=1
                     /gene="CPE0484"
                     /note="330 aa, similar to gp:AF155804_7 Cps1K from
                     Streptococcus suis (279 aa); 42.4% identity in 231 aa
                     overlap. Putative N-terminal signal sequence was found by
                     PSORT"
                     /product="capsular polysaccharide biosynthsis protein"
                     /protein_id="BAB80190.1"
                     /transl_table=11
                     /translation="MKPEISIIVPIYNVEKYLSKCIDSILNQSFTNFELILVNDGSND
                     RSGIICDEYTLKDERIRVIHKKNGGVSSARNSGISLALGKYIGFVDPDDYIKEEMYEI
                     LYNLCKKYKTDISICKLGREINGTLINNEENGEIIELDNVNGLKELFKGILYRFSLCN
                     KLFKRECFRGVIFPEGRIHEDLSTTYRLFANAKKSIYFDYVGYIYVKRENSILTTTYN
                     EKRLQAFIGWNEILEFMINKYPMLEDNVVACFGYSCIDHSNYILNQVIGFNNKIRLLN
                     FIRYEVKQRFSLLVKNKILINKLKLILILLMLNSRFLIISKYKGKGVYRKRIRI"
     CDS             605106..606296
                     /codon_start=1
                     /gene="CPE0485"
                     /note="396 aa, similar to pir:F70441 capsular
                     polysaccharide biosynthsis protein from Aquifex aeolicus
                     (316 aa); 34.4% identity in 221 aa overlap. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="capsular polysaccharide biosynthsis protein"
                     /protein_id="BAB80191.1"
                     /transl_table=11
                     /translation="MKKNIIFVIDSLVCAGAEKSLITLLSLLDYSKYNVDLQLFAYGR
                     PLEVFIPKEVNLLKPFPYTEFCNKSIKESLKKSVKDMDFSMMISRIKYSVALRKDKGG
                     NAKKARLFWTNNSSVIESNTKKYDIAISYAQGVPTFYVADKINATKKFAWVNVSYRLD
                     YKEKSFQEKYYKKYNKIVTVSDSARDIFLETFSELKENIEVIYDINDCSLIRKLAESG
                     ESYTDDFDGIKILTIGRLANQKGYDLALEACKKLKERNLKFRWYVLGVGPLKEEIEKY
                     ILENDLQEHFKLLGISANPYPFIKDCDLYVQTSKFEGFGLAIAEARILNKFVVTTEFD
                     AVYNQMIHRKNGLVVKMNSNDIANGIIEILSDEKLRKDIKCYLEKEKKGNSEEIEKFY
                     KLII"
     CDS             606317..607504
                     /codon_start=1
                     /gene="CPE0486"
                     /note="395 aa, similar to gp:AF143904_1 putative
                     galactosyl transferase from Actinobacillus
                     pleuropneumoniae (383 aa); 26.5% identity in 351 aa
                     overlap"
                     /product="probable galactosyl transferase"
                     /protein_id="BAB80192.1"
                     /transl_table=11
                     /translation="MKKILFMIINMNIGGMEKALLNMINEMDKKQYEITILMLEEYGG
                     FIKDIPSHVKREYMSGYKNIKRVLNQPPRYIIYELIKDKSYIKAFNIFFLTLITKILG
                     DRTLFFKYIFKSYSKDSKIYDLAIAYAGPTDYITYYVLDKINARKKVQWIHFDVSKVG
                     FNKQFAKNKYKKFDKIFLVSNEAKSKLISEVPSLKEKVDIFYNIISNEDIKKSLLKAD
                     GFNDNFKGIRILTVGRLSFEKGQDMSIKAAKMLFENGIDFRWYCIGEGNQRKNYEELI
                     EEYDLNKRFILLGSNNNPYKYMEECDIYVQSSRHEGYCITLAEARILNKPIVTTNFTG
                     AREQIIHEKTGLICDCNESSIYTQVRRLIECNNLRDEFKKNLKYANGIEQNHLYKLDN
                     IIN"
     CDS             607514..608437
                     /codon_start=1
                     /gene="CPE0487"
                     /note="307 aa, partially similar to pir:T48446
                     hypothetical protein T32M21.100 from Arabidopsis thaliana
                     (764 aa); 33.6% identity in 238 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB80193.1"
                     /transl_table=11
                     /translation="MLENIYNKFFYKEAIWGIGTCKINNLNNTSNLEKNFKQVLSHKD
                     VTDVKAVFLADPFVINHNNIWYMFFEILESKSRKGVIGFATSNDGEQWKYEKVVLKEK
                     FHLSYPYVFEDNGEIYMIPETGQSGYIKVYKSTNFPYKWECISNIIVGEYWDSSIFKY
                     DNKWWILSRTSKPKKNSLALFYSENLLHGWKEHRMSPLIIGDSSKTRPGGRVFVDKDR
                     IIRFSQDHSKYYGEKVKAFEIRELNDDKYDEFELGIIINKSDSYKTWNKDGMHTFEIN
                     KIKEDEYLLVADGFYYKDINKIVAKIKNIFM"
     CDS             608456..609622
                     /codon_start=1
                     /gene="CPE0488"
                     /note="388 aa, similar to pir:F70441 capsular
                     polysaccharide biosynthsis protein from Aquifex aeolicus
                     (316 aa); 31.3% identity in 179 aa overlap. 1 putative
                     transmembrane region was found by PSORT"
                     /product="capsular polysaccharide biosynthsis protein"
                     /protein_id="BAB80194.1"
                     /transl_table=11
                     /translation="MKKIAIVTRCIIAGGIEKALISMINSIDRSKYKITIFVMAKGGE
                     FEKFISGDIEIIPIYGYEKTTKEKIINNIKEGNIINAVKILFYTYIALNSRPGYEQEK
                     YLAKILPKHKEVYDLAIAYHVPASFPVIYVINHLNARNKVGWIHSDATKYKKQIDKYY
                     DYYKKFNKIYLVSKEGKEKFIGLYPDLSRKSEVFHNIISRDEIINLSQKGSGFRDKFK
                     GIRILTVGRITHEKGHILIPEICKKLIDNKYNIRWYCIGDGDKRDELQEQINNYNLDN
                     IVHLLGVKTNPYKYMKECDIYVQPSKEEGYCITIAEAKCLSKPIIFTNVTGAEEQIKH
                     GKTGFIAEFDIDSIYKYLVKLIDDRELRDKLSENLTNEIVDTREEINKLYSILR"
     CDS             609639..611177
                     /codon_start=1
                     /gene="CPE0489"
                     /note="512 aa, similar to gp:AF048749_8 putative flippase
                     from Bacteroides fragilis (511 aa); 26.8% identity in 459
                     aa overlap. Putative N-terminal signal sequence and 11
                     putative transmembrane regions were found by PSORT."
                     /product="probable flippase"
                     /protein_id="BAB80195.1"
                     /transl_table=11
                     /translation="MRTKHAFRNIAMGIFSQLVIIILGFISRKIFLDNLGSEYLGING
                     LLTNILSAMVLIEGGLGISIVYNLYKPLAEDDKEQIIALIQLYKKAYWILAFFILVIS
                     FSFYPFLGKIMKSSGDVKGIFLVYCIFVFKSVLSYVYSYKWALINADQRGYFLAKNNL
                     IFQVISMVLKIIILMATKNYILYLLIELILFIIQNIFNSNIVNKRYNYIKTKEKYKIK
                     KETRENIIKNVKAMFIQNIGSYAIFGTDNILISSFISVSAVGLYSNYTMIMGQLASLI
                     GQFIGGISNSVGNLIATEDKEKAYSVFNLVYLMNFWVYSFATIFLFNLLEPFINWWLG
                     DGYLLNNFTFIILLINFYLSGMRRTILTFKSKGGFFSQDKYAPILEGVINLITSLLFV
                     KYFELAGIFLGTTVSYLLFSFWNQPRIVYRNLFQKRLKTYFIKYIVYLFIMLLVGWVT
                     TNACDLIVSGYSFTSLIVRGVVCVIIPNIIYFIIFFKTKEFQYLWISIKDQMNNLNVY
                     KVRG"
     CDS             611190..612995
                     /codon_start=1
                     /gene="CPE0490"
                     /note="601 aa, similar to gpu:AF244637_1 hypothetical
                     protein from Carboxydothermus hydrogenoformans (162 aa);
                     33.9% identity in 109 aa overlap. Putative N-terminal
                     signal sequence was found by PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80196.1"
                     /transl_table=11
                     /translation="MKLKRKLWITVISISIIIFCIVMTLFISTANMDYGSNFSNSIDY
                     SEMWTNKEIMVIVPHQDDEINLAGATIKRLIDNGNNVKVVFATNGDFKGLGTKRIKEA
                     VEAVRILGVNSENVIFLGYGDRWEETKEHIYNSDDNKIISSYIGKNETYGTDKYLDFR
                     SSISGEPSSYTRGNYKNDMKDVIEMYFPDIIFAIDFDSHADHKSTSLIFEEAFCEVLR
                     ENKEYNPKVFKGFAYKTAWKAKDDFYGFNLESTLIPEKDSLINKNYDLDVPQYLWSER
                     VRLPVAKEALSYTQNSNLVNKSLKAHKTQKASRRTVNIVNSDKVFWERETSSITYEAE
                     VIASSEEFKYINDFKLIDSSNVNDIKLIDECVWIPDNEDNDKSFRINFASAKDIEKLV
                     IYDNFSLEDNILESTIRFSDGSEEKVNNLNHDGTKTVITFPTKKDIEFLEFKINKYEG
                     NNPGICEFEVYEKNESKETEYIKLILDNENETFIYRYTVDNEKEIPLNLYSYPKLDGI
                     LGVENCNISTNNDNIQFKENKLIISDNIKPGKYKVRVELKDNTKIFDEIEIFIPNKLQ
                     KGYIKLTQEFEKIIKKIPGKIEGEFYKIKKLILRE"
     CDS             613798..614496
                     /codon_start=1
                     /gene="CPE0491"
                     /note="232 aa, similar to pir:F70066 capsular
                     polysaccharide biosynthesis homolog ywqC from Bacillus
                     subtilis (248 aa); 31% identity in 232 aa overlap.
                     Putative N-terminal signal sequence and 2 putative
                     transmembrane regions were found by PSORT."
                     /product="capsular polysaccharide biosynthsis protein"
                     /protein_id="BAB80197.1"
                     /transl_table=11
                     /translation="MEENTISLQEIAYALKKRWKLIALITIAATLVSAILSFFVIKPQ
                     YEAKTKLFIGKQETTQENASYNNNDVMMYQKLMKTYAELVKTSDLVTKAVKSANLDYN
                     QKEIKGILNNLNVTPSADTQILDLSYKGGNPKDVLKVTEAITSEFISESKELIPNGNI
                     QVIQKAQLPEHPVSPNKKLNILIAFVLGLMIGVGVVLLLEYLDNTFKSREELEKTLEL
                     PIIGTIPDYDNVGK"
     CDS             614510..615163
                     /codon_start=1
                     /gene="CPE0492"
                     /note="217 aa, similar to pir:G70066 capsular
                     polysaccharide biosynthesis homolog ywqD from Bacillus
                     subtilis (237 aa); 44.1% identity in 213 aa overlap"
                     /product="capsular polysaccharide biosynthsis protein"
                     /protein_id="BAB80198.1"
                     /transl_table=11
                     /translation="MLILESNSQSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGE
                     GKSTTSANLALSFAQDGKRVIIIDCDLRKPVVHKNLGISNSIGLSEFLIGKAEFSKVV
                     YKHESGLHVLPSGLVPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
                     STKVDGTILVVKYGYTKKDAVIEAVKGLRAVKANIIGTVFNGEENQRGKYYHYYKKD"
     CDS             615362..616030
                     /codon_start=1
                     /gene="CPE0493"
                     /note="222 aa, similar to C-terminal of prf:2512318F  
                     Cps2E protein from Streptococcus pneumoniae (455 aa); 47%
                     identity in 198 aa overlap. 1 putative transmembrane
                     region was found by PSORT"
                     /product="capsular polysaccharide biosynthsis protein"
                     /protein_id="BAB80199.1"
                     /transl_table=11
                     /translation="MYESVEKVQEREEYIKADQGNRIYLFFKRVIDILGSGFGLIILS
                     PLFLIVAIAIKIEDSKGRVLFSQKRVGQYGKEFNMYKFRSMVSNAEELKAKLMEQNEM
                     SGPMFKMKHDPRITKVGKFIRKTSIDELPQLINILKGEMSLVGPRPSLPKEVAKFEPW
                     MLERLEVKPGLTCYWQVMGRNDIDFEDWMKLDIKYVHDRNFWLDIKLIFKTFFVLFGD
                     ESAS"
     CDS             616051..617397
                     /codon_start=1
                     /gene="CPE0494"
                     /note="448 aa, similar to pir:G59102 hypothetical protein
                     pXO1-95 from Bacillus anthracis virulence plasmid pXO1
                     (443 aa); 52.8% identity in 445 aa overlap.Also similar
                     to pir:A70067 NDP-sugar dehydrogenase homolog ywqF from
                     Bacillus subtilis"
                     /product="probable NDP-suger dehydrogenase"
                     /protein_id="BAB80200.1"
                     /transl_table=11
                     /translation="MKIVVAGTGYVGLVTGACLSEIGHNVTCVDVDEKKVEIMKKGIS
                     PIYEPGLDELLEKNYKEGRLDFTTDYKNAYKNADIVFIGVGTPERSDGSANLDYVFTV
                     CSQIAENLENDCLVVVKSTVPVGTNDKVEAFLKENVKDGIHIEVASNPEFLAQGTAVV
                     DTLKASRIVIGVESERAENTLREVYERFNQPIVATNRRSAEMIKYASNDFLALKISFM
                     NEIANFCEIVGADIEDVAKGMSYDPRIGDKFLRAGIGYGGSCFPKDTKALHWLANDNG
                     YEIKTIKATIEVNQNQKLKMFREAKKRFGDLKGKKVAVLGLTFKPGTDDLREAPSIVN
                     VRRLLDEGAKIVAYDPVGIENFKKLYPTEIQYVNNPGEALKEADMAFLFTEWKEIKGI
                     ELSVYETLMKTPIIFDGRNCYEIKDVEKSNVEYHSVGRKIVYNLDEAKVEAAATLI"
     CDS             617414..618460
                     /codon_start=1
                     /gene="CPE0495"
                     /note="348 aa, similar to pir:H70352 mannose-6-phosphate
                     isomerase/mannose-1-phosphate guanyl transferase from
                     Aquifex aeolicus (453 aa); 37.2% identity in 339 aa
                     overlap"
                     /product="probable mannose-1-phosphate
                     guanylyltransferase"
                     /protein_id="BAB80201.1"
                     /transl_table=11
                     /translation="MLCALIMAGGKGTRFWPLSTEEKPKQFLNLIGDKTMIQMTIDRV
                     KPIIPIERIFVCTGEKYIDLVKEQLPELPENNIIVEPEGRNTAPCIALSALVIKRYYK
                     DATMVVLPSDHLISNEDRFRNILLDGEEYLKENGKSILTLGMTPNRAETGYGYIKFTE
                     DKSLVNNSEVIKVEKFVEKPNKERAEEYLKDGSYLWNGGMFLWTIDNIINRIKEHIPN
                     TYESLKEIEEVKEEKLQELINNNYKKTDSISVDYAILENADEIRVIPSDIGWDDIGTW
                     RSVERYREKDINNNIIDENVRVIESKSNMAINKEKRVVMIGIEDIMTVETEDTIFIVK
                     KDYMDNLRDYKEVL"
     CDS             618495..619220
                     /codon_start=1
                     /gene="CPE0496"
                     /note="241 aa, similar to prf:2518331F   ManNAc
                     transferase from Streptococcus pneumoniae (247 aa); 32.4%
                     identity in 241 aa overlap"
                     /product="N-acetyl-mannosamine transferase"
                     /protein_id="BAB80202.1"
                     /transl_table=11
                     /translation="MNFLNIEVDNLTMNEAIDRAEELIIKKKPSYVVTPNVDHIVKLE
                     NDKEFQEVYKNADLILTDGMPLIWISKIKGNPIKEKISGSDFFPKLCERAAEKGYSLF
                     LLGAAEGVAAKAAKNLKEKYESLDIVGTYSPSYGFEKKDDEIKMIIEMINEAKPDILA
                     VGLGAPKQEKFLHKYRNDLNVPISLAIGASIDFEAGNINRAPKWMQNSGFEWAYRLIK
                     EPKRMFKRYVIDDMKIFKLIIKY"
     CDS             619235..619669
                     /codon_start=1
                     /gene="CPE0497"
                     /note="144 aa, similar to N-terminal of pir:B71691 capm
                     protein (capM1) RP344 from Rickettsia prowazekii (389
                     aa); 26.8% identity in 138 aa overlap. Truncated by
                     frameshift mutation (confirmed by PCR-direct sequencing)"
                     /product="hypothetical protein"
                     /protein_id="BAB80203.1"
                     /transl_table=11
                     /translation="MSKNILYFTRTMGMGGTENVVLQLCEIMKKNNNVVVCSCGGINV
                     EKLNNMGIKHYTIPDIEKKDPITIILTLRMILKVIREEKIDIVHTHHRMAAFYTRLLG
                     KKRNIRYINTCHNTFDNKKMLTKFSYKRIELIACGEMVKKTW"
     CDS             619663..620319
                     /codon_start=1
                     /gene="CPE0498"
                     /note="218 aa, similar to C-terminal of pir:F64500
                     probable hexosyltransferase (EC 2.4.1.-) MJ1607 from
                     Methanococcus jannaschii (390 aa); 27.8% identity in 209
                     aa overlap. Truncated by frameshift mutation (confirmed
                     by PCR-direct sequencing)"
                     /product="probable hexosyltransferase"
                     /protein_id="BAB80204.1"
                     /transl_table=11
                     /translation="MVEIYNIDSNRISVIYNSVKEFNNNVNEIEIIKRLKEENYLLVG
                     NIGRLSTQKGMEYFIKALPLIIKENKKVKFLIIGEGEKKEELIEIAESIGVIDNVIFM
                     GYRNDIQNIMIQLDLIVLTSLWEGLPLTPIEAFSVGKTIVATAVDGTVEIVDNEINGV
                     LVESKNVKEIASKINELLLNDERRYNLGLNAKAKYEEKFSFESFCKKYKNYYNGIKDN
                     "
     CDS             620321..621448
                     /codon_start=1
                     /gene="CPE0499"
                     /note="375 aa, similar to C-terminal of pir:A75059
                     probable hexosyltransferase (EC 2.4.1.-) PAB0973 from
                     Pyrococcus abyssi (strain Orsay) (390 aa); 39% identity
                     in 141 aa overlap"
                     /product="probable hexosyltransferase"
                     /protein_id="BAB80205.1"
                     /transl_table=11
                     /translation="MKLLFIHNTIPEYRIEFMNNLSNLIDTEFFISDKSLQEKIYGMT
                     LESEIKNLKIDYISSTKRAKNIKNKIINSKCDVIILPPVDNIKEYINGVWALIYGKKN
                     NKKVIYWTEKWEADLDKQPSMKKIKNFIQRIMIASLAKKCNICIAAGSKSKDYLRKIG
                     IKEQKIKIAYDSSTSKKKYKEFDLRKKYNIPSEAKIILYLGRIVARKGADILIKAFNN
                     IYGDIDDVYLLVCGDGDYIDECKKIASKLENNKIIFTGQIDYKLRSEYYSQSNIFVLP
                     SYSLNGVIEAWGLTVNEAMECGLPVIATSAVGSAHDLIQNGFNGYVIKENDIDDLEDK
                     ILKIMKSDNYEVIKEQCVKTSVKYSVDNMAQSFFEAINLNE"
     CDS             621466..622695
                     /codon_start=1
                     /gene="CPE0500"
                     /note="409 aa, similar to sp:YC08_KLEPN HYPOTHETICAL 42.6
                     KDA PROTEIN IN CPS REGION (ORF8) from Klebsiella
                     pneumoniae (373 aa); 28.6% identity in 399 aa overlap"
                     /product="probable hexosyltransferase"
                     /protein_id="BAB80206.1"
                     /transl_table=11
                     /translation="MKILIVNTWYYPNLMGGAEHSVKLLAEGLVKSGNEVAIFCIDNR
                     ESGIKKQIINGVTVYRCDAGKYNLYKAYETNTNMIYKVFQKNIEIYNPTIKKQYFKVC
                     EDFKPHIIHTNCLSGISLNVWKYNKLMGIQTVHTIRDYWLLSPRSVIEDEKKINIIYK
                     IYLKFFQKYCKKQSMLVKYVTAPSKFTLNTLLNNGFFENAKRKLCISNSIEVDLDKLI
                     KIIDEKKRKNSKNIKFIYAGWLSKEKGIQNLIEAFKKIDKKNIELIICGDGRLKKYVQ
                     DSSEIDTRIKYLGKLNPEELKQQYIDADVLIIPSIWEEPFGRVVIEGNSYGLPVIASN
                     RGGIPEIINIMKSGIEFDALNIEELSKDIELMSDRERYKLYLDNILNNIEYFDIKKQI
                     ENYMKLYLEGINSITVK"
     CDS             622784..623764
                     /codon_start=1
                     /gene="CPE0501"
                     /note="326 aa, similar to gp:AF155804_7 Cps1K from
                     Streptococcus suis (279 aa); 39.7% identity in 229 aa
                     overlap"
                     /product="capsular polysaccharide biosynthsis protein"
                     /protein_id="BAB80207.1"
                     /transl_table=11
                     /translation="MVKVSIIIPIYNVENYLDKCLDTAVNQTLGCIEIIGIDDGSTDK
                     SRDILNKYAKKYSFIKIINKENGGLSSARNTGIINAKGEYIYFLDSDDYIEYDSMKIC
                     YEIATKNKLDIVSFDAESFVDGEGFTKKLKKYDRKDILDGNIKMGCEYFCELIKNKCY
                     TASACLNFYRREFLIDNNLFFYDGILHEDELYTVKAYTLANKVRYIPYKLYFRRLRSN
                     SITTQSISEKHLYGRLIAARESYRHYLGYKDVFDNDTNTCLLNHISNMYYFMLKDIYE
                     NKRIYNKRYIIEDKIINDIKSKKDIKSFKLDLQYRFPLIIYTIKKYLKKD"
     CDS             623775..624878
                     /codon_start=1
                     /gene="CPE0502"
                     /note="367 aa, similar to gpu:AP001519_178
                     lipopolysaccharide biosynthesis from Bacillus halodurans
                     (373 aa); 28.6% identity in 360 aa overlap"
                     /product="probable lipopolysaccharide biosynthesis
                     protein"
                     /protein_id="BAB80208.1"
                     /transl_table=11
                     /translation="MKTKKNILFVMNNLNGGGAEKVLVDIINNLNFEKFNIDLFLVKK
                     QGIYLENIDKRVNVFSAIDGQNKIYSKIIEKVLIKYFPGFFYKLNIRKKYDVEVGFLE
                     GIPTKIVAASKGKSKKIAWVHIDLLKKHWTKQFFKSGEEELVYNKMDKIVFVSEEAKK
                     SFNKVFNNRSLQEVIYNPIINEGILEKACEENIKFDKFTIVSVGRLNYQKGYDMLIKA
                     HSKLIKKHSYNLLIIGEGPEKESLNKLINDLKLNDSVVLKGFESNPYKFVRAADLYVS
                     SSRTEGYPLALLEAIVLKKAIVATDVTGNREILDNGKYGVLCRDDAKSLEESIDNILS
                     NKVKINELEKLATIKMQQMDYRKIILQIEKVLR"
     CDS             624883..626367
                     /codon_start=1
                     /gene="CPE0503"
                     /note="494 aa, no significant homology. Putative
                     N-terminal signal sequence and 12 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80209.1"
                     /transl_table=11
                     /translation="MNNFKQFFKINFINLFLVIMLMLNNKLFDNVNFIKYSSGFIIIF
                     LYLIYLMTKNEIIIIKYLISYSLIVTTFVDYLFIYKTITVGFELKYIMEFIVIILSVK
                     LITNYKKYIKIIKDPIFIIAIIAIILNLIYCIFNKDYSINDYLNGIRMYFRFIPVYIV
                     LSYNVLSLDSDYYYYYYINLIIMIIQLFIGTGRDNINGIFGLIGTTTATIFLLILVVV
                     NTIKYINKKIKLGQFIITIAGTLILFVIQENKSFLIITPFIVILLMLIKKANIIKKSF
                     SIILSVLLMLGALKTILIVFPEVSNLINKDTYRIAIEEYFLKNNNPAVFTMGRFEALS
                     YLNKLENNTLFKEMFGEGLGIALPSENWYYEGQAKKNMNGKTIFNDNGSLIYNKYTNK
                     LGYHLSSVVVLFLETGWIGIISLILIILIILKKSIYLIIKTNEEKYNIWGAIGIVLCF
                     SYPISILYVDGLQNRVFMLLNLILLGMINKNYILLINNKNIRII"
     CDS             626387..627433
                     /codon_start=1
                     /gene="CPE0504"
                     /note="348 aa, similar to pir:G70036 spore coat
                     polysaccharide biosynthesis homolog yveR from Bacillus
                     subtilis (344 aa); 32.8% identity in 262 aa overlap. 1
                     putative transmembrane region was found by PSORT"
                     /product="spore coat polysaccharide biosynthesis protein"
                     /protein_id="BAB80210.1"
                     /transl_table=11
                     /translation="MENVKVSIIVPAYNIESYVERCLNSLINQTYENIEIIIVDDGST
                     DNTLVKISDMARKDKRIKVLEQENRGSSEARKKGYEMSTGEFILFVDGDDWIRNDTIE
                     VLLEYSNDDIDIVAFGYNEIFNENEIQKNSLLYDKNNEKIELRDTQFLREILTNNISI
                     NIWNKFIRKKFIDKNNVVFPMKMSYAEDLALLISLAAKEPNVIVIKEKLYFYFKRENS
                     ITSIISPKILETKDAMYFIKNILIENKLYNIYREEFEYCVYIHNWYFRYRIIYFGNNQ
                     YSKKLFEIWNNFNISIRNNKYFKKDEKNLDCYWRFFYLNAINNYYLGKILALIIKIKL
                     KISKERNENKKSIN"
     CDS             627408..628928
                     /codon_start=1
                     /gene="CPE0505"
                     /note="506 aa, similar to gp:AF048749_8 putative flippase
                     from Bacteroides fragilis (511 aa); 28% identity in 443
                     aa overlap. Putative N-terminal signal sequence and 12
                     putative transmembrane regions were found by PSORT."
                     /product="probable flippase"
                     /protein_id="BAB80211.1"
                     /transl_table=11
                     /translation="MRTKKALINSSINIVTYLILFIPNLILRKVFLNTLGNEMLGLNS
                     FYSNIIGWLSIAELGVGSAIIFSLYKPFAENNRRKINMYIRFYGKFYRTIGFIILGLG
                     IIISPFLNFFIENKVDIEIITVGFLIFLLNSFISYMFSNRLCILNVAQESYKLTLGTT
                     ISQLIIFLLQYILLKNHPSFILYITIQLIVNLIYYIIINIYISRKYPWLNKDKEDLDY
                     NTKMGLFKNIWALFMHKIGGVVVNSTDNIVISKFVGLGILANYANYNTVIAALQKVIL
                     LGLNGITASVGNMLNSSDKKKAYDIHKKIFFLNFWIVSFVVISLYNTLNQFVGLWVGK
                     QYLLDSLTFIVILINLYFVTMRGSVEQFQNGSGNFYQDRYAPLVEAFINLAVSIFLVK
                     KIGIAGVFIGTLVSNFTVIFWTKPYIVYKYVFHKPISGYFVMYFKYLVIGIVPLVLTN
                     WLTCSVKYNLSIKSFVINCLINIIVINFTYLIIFYRTKEFKYYLLLFIKIIRNLNK"
     CDS             629121..630041
                     /codon_start=1
                     /gene="galF"
                     /note="306 aa, similar to gpu:AP001519_167
                     UTP-glucose-1-phosphate uridylyltransferase from Bacillus
                     halodurans (297 aa); 60.1% identity in 288 aa overlap.
                     Putative N-terminal signal sequence was found by PSORT"
                     /note="CPE0506"
                     /product="UTP-glucose-1-phosphate uridylyltransferase"
                     /protein_id="BAB80212.1"
                     /transl_table=11
                     /translation="MNKKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIE
                     EAIASGIEEILIITGRSKKCIEDHFDKSVELEMELEKSGKNELLDLVRDISDMVDIHY
                     IRQKEPRGLGHAIHCAKTFVGDEPFAILLGDDVVYNEEKPCLKQLIDCYNEYKTSVLG
                     VQTVPESHVSKYGIVDGKHIEGKVYKVKGLVEKPSVEEAPSNVAILGRYIVTPRIFDI
                     LEKTKPGKGGEIQLTDALLELMGQEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPE
                     LREGFVEYLNNLSEKESLFKKEVEKEIVTV"
     CDS             630408..631055
                     /codon_start=1
                     /gene="CPE0507"
                     /note="215 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80213.1"
                     /transl_table=11
                     /translation="MAEKKQRFINKTARELRLLGEKGNKEALNELIIRGKKGDKCAMA
                     EIVSIYEGLIHKYSTRFFINGYDVDDLKQIARSVIIESISKFDGDHGSEFIFFISTNV
                     KNKLGTMCKKKENRLDFSSLDSPIGEGITIGETIKDEISIEDEYVEREKMRAFVKALA
                     NISKSDREFILYVYKDRGNFQKYCQEHKHITTYSKARWRKERILKKLREEMKNFE"
     CDS             631476..633719
                     /codon_start=1
                     /gene="CPE0508"
                     /note="747 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80214.1"
                     /transl_table=11
                     /translation="MNKLREKGVSLLEPKNKGVLTVNFKHPILKDYKGNGRIITKSLG
                     SDVGKDYEAANKFLNEIKSIINNSDCYENYYGFLKSLEKYSEKSMKIVFDNTHFMEEF
                     YYDLKKSILEKFIGISNNNINKKLEEELKEFSKLLKLEEVELRENSNKSFKIFIREDI
                     KSRFNFEFKKKIQLLGGDYEYRKKLISNLIGSSGEFNETYKNTNEAREDKLVNKFFNN
                     IETPNFEVIFKQDSNKFKFIGTPYSQCIINKKIDRKRILEEFLFRINSLDNIFQYKIE
                     FRERKSGKSYVFNNNELFVKGNLICNKDLDKCFLDNIEDLAYIYFHIGYKENYNEKSQ
                     EELKSKFFYILESLFNEKYNPNNSNLIFSDIRLEGNFRGEEILHNKEKDFILADYSGN
                     INEFRNQLLSYETRRNLASSDEIIWLFNSEEEAFERNLEVLKYLIINGYLNKTNIYIY
                     EKPIYKDYFSSEFNNSESNFMNVLNEKEAYHMPNIFNSFLKDNFQNLLEELGEEEASI
                     IIRGREEYYLNLIMERVIFPCDEEKKVLSNKWEIEKIINQSEEVLINKIKEKSSLINE
                     YKPSYKYGRLAILSLGINRKVKREFIRRVRRSYDKNLKEFSLRMAYNFGGREYKSLCP
                     ERLLETSIKNSIKTFLLSPYKIRKDINILEFEKSIEYIMESISEEIIEEVEILIREDN
                     LLKWKEAAELLKDDIIEGRNLIEEIIEETFVVSNDIFREDKVLKIIKEVLKNNSIFKA
                     IKGEFAI"
     CDS             633797..634813
                     /codon_start=1
                     /gene="galE"
                     /note="338 aa, similar to sp:GALE_BACSU UDP-GLUCOSE
                     4-EPIMERASE (EC 5.1.3.2) (GALACTOWALDENASE) (UDP-
                     GALACTOSE 4-EPIMERASE) from Bacillus subtilis (339 aa);
                     58.6% identity in 338 aa overlap"
                     /note="CPE0509"
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="BAB80215.1"
                     /transl_table=11
                     /translation="MNILLTGGIGYIGSHTIVELLRDDNNSVVVIDNLVNSRKEVKDI
                     VEKITGKSIKFYEGDLVNFEDIDKVFKNEKIDAVIHFASLKAVGESVEKPLEYYNNNI
                     IGTLNLLTSMRNHNVKKFIFSSSATVYGESEIVPVHEGLQAGFATNPYGRCKAMIEDI
                     LRDLYISDNSWNIVLLRYFNPVGAHESGLIGELPNGIPNNLMPYVSKVADGELDYVRV
                     FGDDYNTPDGTGVRDYIHVVDLARGHVAAMKKLKDGSGISTYNLGTGQGYSVLDIIKA
                     FSKASGKEIPYKIVDRRAGDIAISFADPSKAEKELGWKAEKNLEDMCKDFWKWQCVGM
                     KNFK"
     CDS             635095..636039
                     /codon_start=1
                     /gene="galF"
                     /note="314 aa, similar to gpu:AP001519_167
                     UTP-glucose-1-phosphate uridylyltransferase from Bacillus
                     halodurans (297 aa); 60.6% identity in 284 aa overlap.
                     Putative N-terminal signal sequence was found by PSORT"
                     /note="CPE0510"
                     /product="UTP-glucose-1-phosphate uridylyltransferase"
                     /protein_id="BAB80216.1"
                     /transl_table=11
                     /translation="MNNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIE
                     EAIASGIEEILVITGRSKKSIEDHFDRNVELEMELEKSGKTELLDLVRDISDMVDIHY
                     IRQKEPRGLGHAIYCAKTFVGDEPFAILLGDDVVYNEEKPCLKQLIDCYNEYRTSVLG
                     VQTVPEENVSKYGIVNGKHIEGRVYKVKGLVEKPSPEEAPSNVAILGRYIVTPRIFDI
                     LENTKPGKGGEIQLTDALLELMSEEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPD
                     LRDGFIDYLRELSATENIFTEANGKEKKDKEEELVTEA"
     CDS             636364..637056
                     /codon_start=1
                     /gene="CPE0511"
                     /note="230 aa, no significant homology. Putative
                     N-terminal signal sequence and 2 putative transmembrane
                     regions were found by PSORT."
                     /product="hypothetical protein"
                     /protein_id="BAB80217.1"
                     /transl_table=11
                     /translation="MIIISQNTFLVVGIILFCLFRGAIKIKGIIKEEYIYKQIYSNEE
                     FIFDLFCIYLIGVASKVYFPLTIAWGNKLVYNPPEVWLSPLWSIKQIYHQGGLGGVIY
                     QLIGNSIMLSPMAFFLCYFYSIDEEKLTLGKGIIDKINKILESFELHNKKKIKEDSYI
                     PSLNTVLKFCFFMSLFIESSQVILSLVFPNTKRFFEVNDLICNTLSGVWGYYIYIKIA
                     KLNIIRRKIFKL"
     tRNA            637202..637274
                     /gene="trnA-Met"
     CDS             637566..639770
                     /codon_start=1
                     /gene="agaN"
                     /note="734 aa, similar to gp:AF130985_1
                     alpha-galactosidase (EC 3.2.1.22) AgaN from Bacillus
                     stearothermophilus (729 aa); 60.4% identity in 720 aa
                     overlap. Putative N-terminal signal sequence was found by
                     PSORT"
                     /note="CPE0512"
                     /product="alpha-galactosidase"
                     /protein_id="BAB80218.1"
                     /transl_table=11
                     /translation="MRIMSINYNENFKTFHLRTKNTSYVLKVMETGHLSHLYWGRKLK
                     VDNLEYFVRRRGFGSFAADTDNISGFQLELIPQECPTFGATDLRSPSLEFQYEDGTSA
                     TDLRYNSHRIYEGKQSLSGLPAVYVESEEEATSLEITLVDSLKNLEVILTYNVFEDFD
                     AITRSLKIVNNSDEKINIERVLSANVDFTTDEFDFIQLSGSWGRERHILRNPLRSGSQ
                     AIESRRGASSHAQNPFMALCSKETNEEYGDVYGFSLVYSGNFLANVEVDMYRNARAQM
                     GINPLDFKWLLESKEEFQAPEVVLVYSSKGLNGMSQIYHNLYRKRLCRGNYRDKVRPV
                     LINNWEATYFDFNEVKIKEIAKEASKLGMELFVLDDGWFGNRNDDKSSLGDWFVNENK
                     LKGGLSKLAKDINNMGLEFGLWFEPEMISPISKLYEKHPNWCIHIPGRTRSQARSQLI
                     LDLSRKEVCDYIIESVSKILESANISYVKWDMNRNMTEVGSLGLTSERQRETAHRYIL
                     GLYRVMEEITSRFPNVLFESCSGGGGRFDPGILYYMPQTWTSDDTDAIERLKIQFGTS
                     MVYPQISMGCHVSAVPNHQANRITPLETRGVSAMAGNFGYELDITKLSEEEKEELKEQ
                     ISLYKEIRETVQFGTLYRLKSPFNSNEVAWMMISEDKNEIVVSYVRQWALVNESFSNL
                     KLTALDKDSEYEIIGEDIVLSGDELMYIGLNIPELYGDYVSKLWRLKRKTLK"
     CDS             complement(639916..640665)
                     /codon_start=1
                     /gene="CPE0513"
                     /note="249 aa, similar to gpu:AP001518_125 BH3294 gene
                     product from Bacillus halodurans (254 aa); 35.4% identity
                     in 209 aa overlap. Putative N-terminal signal sequence
                     was found by PSORT"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80219.1"
                     /transl_table=11
                     /translation="MKNSLRIKKIISLILLIIIFFCAMKIYQKRLEYYTDSRDYDNLR
                     SLSPLSDSSVNKSPEEHKQDAESEKNLKNINPDYRFWIKVEGTNIDFPVVQGKDNDFY
                     LHHNFNKEKSFSGSIFVDSENNLNDDSNIVVYGHNMRNDTMFAQIKHFKNENFFNANK
                     YVTLYREGKKSTFEIFSVYQENAKDLESEIKTKFSNKEDYEKYLKEQESKSLFKRDGI
                     DLNSNDRILTLITCGYDFVNARIVVVAKEID"
     CDS             640904..641428
                     /codon_start=1
                     /gene="CPE0514"
                     /note="174 aa, similar to gp:AF085497_1 signal peptidase
                     type I from Bacillus amyloliquefaciens (194 aa); 37.2%
                     identity in 137 aa overlap"
                     /product="probable signal peptidase type I"
                     /protein_id="BAB80220.1"
                     /transl_table=11
                     /translation="MKKGIKIFYNILFYGFLTILIAFLLLGFFAKKSDSGISIGGYRV
                     YDILTGSMSPTIKPGNLVVVKETLPNEVKKNDVITFKSDITNNVTTHRAIDIVNSDGK
                     TEFITKGDANNTQDPVPLDEKLLVGKVVFQVPYLGAFLSSLQKNKLIFIGLLVVIILI
                     DFIFNKYLGIRKKS"
     CDS             641482..642117
                     /codon_start=1
                     /gene="CPE0515"
                     /note="211 aa, some similarity to N-terminal of
                     gpu:AP001514_135 spore coat-associated protein from
                     Bacillus halodurans (210 aa); 27.2% identity in 103 aa
                     overlap. Putative N-terminal signal sequence was found by
                     PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80221.1"
                     /transl_table=11
                     /translation="MSKKKIIGLCIAGVLAVGSIGGSLAWFTSSDSVTNPFSTASTDN
                     PSDPNSGIKIHEDFNKEDADNTLPGDTVTKQVNVINKATYDQLIRVKIKKVWKDAKGE
                     EKSDLDTKNINLNFENNLTDSNKPEEGKWIEGSDGYYYYNGIVNPDGQTANLLESVTL
                     SKDTTNEFKGLKFDVVVDSEGVQAANGAVNDSWKDAPQVIKKLGAGTNAHK"
     CDS             642165..642890
                     /codon_start=1
                     /gene="CPE0516"
                     /note="241 aa, no significant homology. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80222.1"
                     /transl_table=11
                     /translation="MKNLIKSFLFTMAFLLIICKPGVASTFATPNVELEGNADGIVFI
                     QGDEPFLWSDNILPGDKLERNILLNNKHKDSYKIFMRAERVSKKESYDLLEKIELKVI
                     YDGNCIYDGFVRVSIIPRWIDENENPWTGDSNLIQLNLDEDNVIALNKDDINNLWVYG
                     EDGYFYYMAKLKSGKSTKELLKSVEIKKDSIEDSLKEKYNGKKIKIDVNVEAIQPNEE
                     ALIKKWTGINEKIKDKYIEILSK"
     CDS             642907..644751
                     /codon_start=1
                     /gene="CPE0517"
                     /note="614 aa, no significant homology. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80223.1"
                     /transl_table=11
                     /translation="MKNIRKIFCVFLIISLFISVPVLNASGIENKGFDDQFKDIGNES
                     KGRICDYDGTEILKEVSQEPDEDGNYEITLTVKGKPKKVTKPVDILLIIDASNSMYYN
                     MDELKASMNSLVDKVIDNIPDSRIAVVAFGTYSEEVFSFNNKNNFTSKEEYKKAIKKS
                     YNNIEGRGNTNIESSWRLADEIFKNELNNNFNSKKDVIFFSDGYPNESMNMLLESKYL
                     EGGREYYEQYKKHLEQIYKTKIKKDSDYEKILMDELNNGNYKSIDEWALYEYEKFYNN
                     YPDTNIFSVALIDNIPYEDKNSAKELLSKMQNSGYFTIDSRFGQDNNENNSKSLKEIY
                     DKIANNIILDKEMAKGLKITDVVSKDFEIVKNGAYDGKNSKIVNLSDNSVIDLKENIE
                     GDKISWDRGENIIDSTDGIQFKFKIKPKDQYWGTGENKVYTNDIATISYKKPKEKNKI
                     ITGIFNKPNLSVPYKLGKIKVTKKFFDENGKEIKVDDKKTYTVCIDGGDLGKYYLKVD
                     GNGNAKVLDFYMRDENTDISNNTDTEKGYLKVTESSENKRIYKVSEIDTMDSETKSIF
                     VNGSKKDSFELNMKNNNIDIVINSSIKDEKYFYDNKEKINDFGILKLN"
     CDS             644991..645707
                     /codon_start=1
                     /gene="CPE0518"
                     /note="238 aa, similar to pir:S60139 virR protein from
                     Clostridium perfringens (252 aa); 31.9% identity in 238
                     aa overlap"
                     /product="two-component response regulator"
                     /protein_id="BAB80224.1"
                     /transl_table=11
                     /translation="MLNIAICDDEKVQRNILKDMLYKICNKNNMDVIIDEFCSGVDLL
                     NVYKRNTKKYSIVFCDILMDEMNGIELLRKIGELDAFIQAILITGSEEYVFQGYDVGA
                     LNYLMKPVSFEKLEKEFLRAIKSLNFTSPSRYAININGKTNFIDLSEVLFFEVNNKTI
                     TANLEKESIDFNMKIATLEEELKSRNFLRCHRSYLVNISHIDSILQNKIILKNSVEIP
                     VGRVYKKELKTFLMNRIGDM"
     CDS             645712..647007
                     /codon_start=1
                     /gene="CPE0519"
                     /note="431 aa, similar to pir:C55521 virS protein from
                     Clostridium perfringens (440 aa); 32.5% identity in 234
                     aa overlap. Putative N-terminal signal sequence and 6
                     putative transmembrane regions were found by PSORT."
                     /product="two-component sensor histidine kinase"
                     /protein_id="BAB80225.1"
                     /transl_table=11
                     /translation="MYVRNVIELFYVIYISFIGISSFFYLDKKIDLKKRVFTTIILNF
                     FLLLINYIFYINELSCFFEALIIYIYYVYLYKKNTTSILMSSIYLLNLSLGKYILMFI
                     YSVMIFDLEVLKIMNNIMFLCFIILLILMITVVVFIVNFFKECIINVNDLTIKKQTKL
                     VFAIGIAVLLSEKVFDNIALNAGLVYRVNISTISIAVNLAIIHFITYKRFKEYKANSQ
                     INILEKQLDYQKNYYEKVINNYGEARKAIHDMNNHMSVIKYFLENKDYKNMDDYIQSL
                     SERIVTNKDNNICSNKVINAICLDKCERCKKEGINIRFDTIINKKLKIDDLDLCIVLG
                     NLIDNAIEACEKINDKEIQKVIQVSARIYLNQIYIKVINSKNNKVEKRNNKFLTSKKD
                     KKNHGIGLENVKEAVHKNHGDIEIKDSKNTFEVSLYMKC"
     CDS             647185..647991
                     /codon_start=1
                     /gene="CPE0520"
                     /note="268 aa, no significant homology. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80226.1"
                     /transl_table=11
                     /translation="MKNGRRVKNPKRNSSSRSKSKVLDISIIILIIALALVIAVGTIR
                     DKKTLAKNMEIYSSDSSNNSEDNKKQATTSNPYEKIKKGEEVNILVLGNGVGLSEGKT
                     DESGNWTSSLSKWLEETYKSKANITNLSQDKATVKVGLEELEKNKDNFDLAYIIFGEN
                     DQKEIKPNEFKEDYEKIVKNLKERNKDISIVPIIENSLRKKNEYTTIIEDIGKANDLK
                     VLDMATVFTKDPAPYAKLTTKGGIYPNNVGYSLYFSNIKSLIEANISALN"
     CDS             648362..648808
                     /codon_start=1
                     /gene="CPE0521"
                     /note="148 aa, similar to C-terminal of gpu:AP001507_220
                     BH0220 gene product from Bacillus halodurans (701 aa);
                     31.7% identity in 142 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80227.1"
                     /transl_table=11
                     /translation="MVNFIRDLLNENNIILKAKAFNKEEAVRLAAEPLLKDGSITDEY
                     VKDILEKINDLGPYMAIMPGVVIAHSRPGDYVFKECISMLTLENPVEFGHEDNDPIEI
                     IFVIGAKENTGHLDALQDLARVLINEDSVNKIKNAQNKKEIMELFM"
     CDS             648983..649255
                     /codon_start=1
                     /gene="CPE0522"
                     /note="90 aa, similar to gpu:AP001507_222 BH0222 gene
                     product from Bacillus halodurans (89 aa); 41.7% identity
                     in 84 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80228.1"
                     /transl_table=11
                     /translation="MKIMTVCGFGVGTSLLLKMTVDSILEEEGINGEVEAIDMTSACG
                     NSADLILTSKEIGKEIEGQVSGKLVYISNFMDKEEVKEKILKAIRN"
     CDS             649296..650567
                     /codon_start=1
                     /gene="CPE0523"
                     /note="423 aa, similar to gpu:AP001507_223 BH0223 gene
                     product from Bacillus halodurans (432 aa); 35.8% identity
                     in 374 aa overlap. Putative N-terminal signal sequence
                     and 9 putative transmembrane regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80229.1"
                     /transl_table=11
                     /translation="MKEILDFCVSFFRNPALFMGLVVAIGLILQRKPIDAILKGIFKG
                     IIGMVILLKGVDIVVSSITPLANAFSGLFNTQSNSTLGDFNVFLGQYGSYVGLILLCG
                     FVINIIIARYTRFKTIYLTGNILFWYPMLFLAVGIENNVSGLKLFIFTLIMYILVITI
                     FPYILRKHVKYVTGNDSFTIGHTASIYCLLGSYIGKLVGQKDKNIENLNLPKSLSFFR
                     DTNITAAIVMFIVYIIVGLFIGKESRIAIYGSEPLITYSLIQGITFAAGMIILLTGVR
                     MILGEIIPSFKGIADKLAKGSIPALDIPMIFPYGPNALLIGFIIALITSIGTLFLLGA
                     SGVLTFALIPLVVACYFDVAPGAIFANARGGWPAAIITSALGGIILMVLAAISLNLVS
                     GTVGNFIQTYGGNEFSIWVIIGDLVGKLFSI"
     CDS             650923..651717
                     /codon_start=1
                     /gene="CPE0524"
                     /note="264 aa, similar to gpu:AP001516_88 BH2659 gene
                     product from Bacillus halodurans (257 aa); 29.1% identity
                     in 258 aa overlap"
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80230.1"
                     /transl_table=11
                     /translation="MKNLKGIVFFDVDGTLIDCGKGLYKPSNKTKEAIKKLKENGYLT
                     ILATGRPMSFVDDGLKELELDGYIASNGTYIELNNEVILNDDIKLEKLKEIMDYCVEH
                     NINFILEGQKTSYVLNNDVAKKMVENFSLPEESFTGDWTEEELSANKLVIVDNNKDDF
                     KDIFERFKDEFVFMQHPGHSSYDMYRRGCTKAHGIEHLIKELGLSDKDTYAFGDGEND
                     IEMFQRVKYGIAMGDAHETLIPHAYKQTENVPNEGIYKALLELGLI"
     CDS             complement(651851..652297)
                     /codon_start=1
                     /gene="CPE0525"
                     /note="148 aa, similar to gpu:AP001517_194
                     transcriptional regulator from Bacillus halodurans (151
                     aa); 24.4% identity in 119 aa overlap"
                     /note="MarR family"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB80231.1"
                     /transl_table=11
                     /translation="MNTIENLMGATEELYTLLLCLNRKVFSHDDIIKRLSIPPSHAKV
                     IFHLHCGGEASVSEIAKNLSISKSNMTPIIDKLIQENLVERFTDPNDRRIIRVRVTEK
                     GHEFCLKQREKTKKHLEEKISFLSPEELERIKDLAKELNSIFSKIE"
     CDS             652622..654919
                     /codon_start=1
                     /gene="CPE0526"
                     /note="765 aa, similar to gp:SC7A8_2 putative ABC
                     transporter from Streptomyces coelicolor A3(2) (577 aa);
                     42% identity in 531 aa overlap. Putative N-terminal
                     signal sequence and 5 putative transmembrane regions were
                     found by PSORT."
                     /note="ATP-binding protein"
                     /product="probable ABC transporter"
                     /protein_id="BAB80232.1"
                     /transl_table=11
                     /translation="MSKLIKYLKPFTASILAVIVLLFAQAMFDLSLPDYMSNIVNVGI
                     QQGGIENAVPKVISKSEFDKLTLFMSKDEKEKVESNYTLLDKGTLSQSEYDEYVKDYP
                     ALEKENICKLNTKDKEIINELNPIMGKAMIVVGGIEEKGLQGVMGNSSLTGASDNSKA
                     NMEESAPKEGQIQGMPANTDPFFMIKNMPEAQKNDMLKQINEKFESMPESMVTQTAAT
                     FIKAQYTDLGMNIEKIQSQYILKTGGIMILLAFGSMIAAVSVTLIAARVAAGFGRNLR
                     SKVFGKVVRFSNAEFDKFSTASLITRSTNDIQQIQTLMVLLLRIVFYAPILGLGGIFR
                     VVKTDTGMSWIIAVALAAILSLVIVLFGLAIPKFKLVQKLVDKLNLVARESLTGMLVI
                     RAFNTEKYQENKFDGVNKDLTRTNLFVSRIMGGMMPLMMLIMNLITILIVWVGAHNVN
                     DGVMQVGDMMAFIQYTMQIIMAFLMISMVSVMLPRASVSGQRIAEVLETKESIKDPEK
                     NDEFNKNKKGYVEFKNVSFKYPGAEEYVLKDISFTAKPGETTAFIGGTGSGKSTLVNL
                     IPRFYDVTEGEILVDGTDIRKVSQHDLREKIGYVPQKGILFSGTIESNLKYGNEDALL
                     EELEEAANIAQASEFINTKALKYAEEISQGGTNVSGGQKQRLSIARALVKNPDVYIFD
                     DSFSALDFKTDAAVRKALNDKTSHSTMLIVAQRISTIMGANQIIVLDEGKIVGKGTHK
                     ELLENCEVYKQIALSQLSKEELSNE"
     CDS             654912..656768
                     /codon_start=1
                     /gene="CPE0527"
                     /note="618 aa, similar to gp:SC7A8_3 putative ABC
                     transporter from Streptomyces coelicolor A3(2) (642 aa);
                     49.2% identity in 594 aa overlap. 5 putative
                     transmembrane regions were found by PSORT."
                     /note="ATP-binding protein"
                     /product="probable ABC transporter"
                     /protein_id="BAB80233.1"
                     /transl_table=11
                     /translation="MSKERKGGMGGPMGRMGGGPRAVEKAKDFKGTMKKLGVYLKPYS
                     LSIAIVILFAIGSAAFSIVGPKILGKATTKIFEGLVQKITGVPDASIDFGYIGNIAMI
                     LVALYLVSSLFGIIQSFIMSGVAQKVSYNLRKQISEKMDTLPLNYFDTRTNGEVLSRI
                     TNDVDTVNQTLNQSLSQIITSVVTLIGVLIMMFSISWIMTLATFIILPVSMVLISLVV
                     KKSQKYFKSQQEYLGHLNGQVEEVYGGHNIMKAFNREEASTKDFDELNNTLYKSAWKS
                     QFLSGMMMPIMSFVGNLGYVLVSILGGWLTIKSVITVGDIQAFIQYVRSFNQPIAQMA
                     QVANIMQSTAAAAERVFEFLDEEDEVKDPVNSVDPSEIRGEVEFEDVHFGYNEDKIII
                     NDFSVDVKPGQKVAIVGPTGAGKTTIVKLLMRFYDINSGSIKIDGHDIRDFKRADLRN
                     LFGMVLQDTWLFNGTIMENLRYGRLDATDAEVKEAAKAAHVDHFVKTLPDGYNMVLNE
                     EASNISQGQKQLLTIARAFLKDPKLLILDEATSSVDTRTELLIQKAMEKLMEGRTSFI
                     IAHRLSTIRDADLILVMKDGDIVEQGNHEELLEKGGFYSSLYNSQFEQSSAS"
     CDS             657262..658143
                     /codon_start=1
                     /gene="CPE0528"
                     /note="293 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80234.1"
                     /transl_table=11
                     /translation="MKFRFLYVGDKILSHREEGLFRVLNCEEYSLNKKVLDYKEICNR
                     KKYKNGFSEEKFNRIYLSKRGSVINFYSLGSKEFNETYLNDTNRFKDLLDLNKNSENE
                     EIKIIFFDLFNKDANKDQLFITSFMNKLGEILKYINWDKILIIFNEEIIFNKVTNIDS
                     RFRECSLVLNNYDVNLNEFIHILIDFLLLKDDLGDKWTEYRKKIANSKLTLGKVKGED
                     FSGDVIMRILGEFSKIQRDNLFKLILMSKEGINLNEIALIEDALKEYISLDSKLIIKQ
                     LTKDFFNDEVRYILLSK"
     CDS             658398..659447
                     /codon_start=1
                     /gene="CPE0529"
                     /note="349 aa, similar to gp:AF132735_8 malate permease
                     from Clostridium cellulovorans (290 aa); 24% identity in
                     254 aa overlap. Putative N-terminal signal sequence and 7
                     putative transmembrane regions were found by PSORT."
                     /product="probable malate permease"
                     /protein_id="BAB80235.1"
                     /transl_table=11
                     /translation="MLEIIQKTLTDNAIIGAIFSSIAIIFLGFYIRKRNILTGAASKI
                     LTKVVLTVAIPALAFTSFMKDINQKELHEGINILIWGFVIYILLIVLTKFIFARVKGD
                     KQDVFRVLTIFGSTTFFGVPIVKAVYGSVGAMYSSIFNIAYRVFLYSYGYIKMSGVKM
                     DKENLKKNLKEMLLNPVIIATFLGLFIWLFQGMLPQVQIGDKSYAFLRIDQTLPWLYK
                     PLTYLDKLCSPLAWLAIGITLAEVPFKQAVGQKEPWVYSLIKIILVPVINLGLLVVLN
                     KTGILPVSFEGMATTVIMLATPTATVAAAYAISFDKEALLTSNCSLLSTVVAVVAMPF
                     WIVILQIIKNIGLFA"
     CDS             659756..660754
                     /codon_start=1
                     /gene="ldhD"
                     /note="332 aa, similar to sp:LDHD_ECOLI D-LACTATE
                     DEHYDROGENASE (EC 1.1.1.28) (D-LDH) from Escherichia coli
                     (329 aa); 36.4% identity in 330 aa overlap"
                     /note="CPE0530"
                     /product="D-lactate dehydrogenase"
                     /protein_id="BAB80236.1"
                     /transl_table=11
                     /translation="MIKLVCYGVRETEVPYFHKLNEEFGYDLTLVEKNLNHENVEEAI
                     GAEAIMVRGNCMADRQNLELLKSKGLKYVLTRTVGFDHVDLDAAKDLGLQVARVPGYS
                     PNAIGELAVSLAMMLLRHTAYTTNRTSNKNFVVDGFMFSKEIRNCTVGILGAGRIGLT
                     TAKLFKGLGAKVVAYDVFQSDAAKEIVEFMPLDEVLKVSDVISVHMPYIKGQNYHMIN
                     EEFISKMKNDAIIINTARGELQDIEAIVKALEEGRLGGFGADVLEGESAVFFKNLEGQ
                     KLENESYEKLISLYPRALVTPHMGSYTDEALRNMIGISYENLKEYLEGNTCKNAIA"
     CDS             661050..662600
                     /codon_start=1
                     /gene="CPE0531"
                     /note="516 aa, similar to pir:A70009 two-component sensor
                     histidine kinase homolog yufL from Bacillus subtilis (533
                     aa); 28.7% identity in 492 aa overlap. Putative
                     N-terminal signal sequence and 1 putative transmembrane
                     region were found by PSORT"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BAB80237.1"
                     /transl_table=11
                     /translation="MKVKFENKILLWAILITFIPLALSFTLFIEDKLSYMDEDVRNTL
                     KETAFSISEIPFIQEDLSNGEINSRIQEYTKHFIEAINDVDIIVVADMRGVKYSHLDE
                     KQIGQVFVNEDKKEVLTQGSSYYSLMKGSMGETLRWFQPVMYNGKQVGFIMVGKYYNE
                     IQLLTHKTLIKYMGLFILVFLITILISKLFARKVKKAILGMEPEEIAALYKEKKIILN
                     TVSEGIIALNKNNEITEINDNCYKLIDGFSKYKVLKKLLPYIEENKPVEMKEIILQGK
                     KVFVTIQPIMKKGEYLGSVITLMDRNDIRKIAKEITGVDEVVKNLRANVHEFRNNLHV
                     ILGLIQLGEYEEARKYILKTQKIHENNSLKFSNVEDYYVRGLLLSRELVAKERGVNFI
                     LTEESFLFGNHNYVDSYDIVTILGNLIENAFDSCVCSSIENKEVEVTLYEDDEKIEMQ
                     VRDNGKPIDNNIKERIFELGVSSKGEGRGTGLSLVKNRVELYDGCIDIEEFNEEKIFI
                     ITILKGEK"
     CDS             662600..663268
                     /codon_start=1
                     /gene="CPE0532"
                     /note="222 aa, similar to pir:B70009 two-component
                     response regulator [YufL] homolog yufM from Bacillus
                     subtilis (235 aa); 38.2% identity in 217 aa overlap"
                     /product="two-component response regulator"
                     /protein_id="BAB80238.1"
                     /transl_table=11
                     /translation="MGKKILIVEDDPMVALINKRFLENMGFKDILGPVQTEEEIIKVL
                     DKENIDLILLDVYLPKKNGIDILKSLRYKKYLTDVIMITAANSVEEVKRAFAYGVTDY
                     LVKPFEFERFEEAINKYKQKNNLLNKREALSQQDIDVISKSLEEKIELPKGLNQKTLD
                     RIMEFLKENQGKVWTLREIAYELKISNVTIKKYMDYLEDVKKVNVTLTSGNVGRPEYK
                     YTLG"
     CDS             663349..663528
                     /codon_start=1
                     /gene="CPE0533"
                     /note="59 aa, no significant homology. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80239.1"
                     /transl_table=11
                     /translation="MEYNKHRYLGFLGLLSLIGLKGFTGGNALWYIFFLNFLWFTLFY
                     ENSWLYVGAPFKFNK"
     CDS             663686..664216
                     /codon_start=1
                     /gene="CPE0534"
                     /note="176 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80240.1"
                     /transl_table=11
                     /translation="MNKRKIVASILTTSLLVTSLVGCVGSNNKANTSGNDSKVQESVE
                     NQSDFNDLRTYVGKTYNEVSENKGTGNENIEDVEGKKVIVSSSYSTRMFNYNANLILE
                     LDDSKNISAVSVHFKGIEPENILENIKKVLGEPKISKDKENGDSKVYSWEKDGYQYKL
                     SQVGEETIITVNKSAI"
     CDS             665353..665994
                     /codon_start=1
                     /gene="CPE0535"
                     /note="213 aa, similar to pir:F81434 probable integral
                     membrane protein Cj0167c from Campylobacter jejuni
                     (strain NCTC 11168) (187 aa); 43.5% identity in 186 aa
                     overlap. Putative N-terminal signal sequence and 5
                     putative transmembrane regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80241.1"
                     /transl_table=11
                     /translation="MSILSIVLTGFGLAMDAFAVSVAKGITLTRVKAKDALKVALFFG
                     GFQALMPLIGWGAGRYFADYIKAFDHWIAFILLSFIGGKMIFEALKEDDEEKAEVAVS
                     MEVSKNKEREFANMKRKEELSAKNLTVLAIATSIDALAVGVSFAFLGISIVQTIIIIG
                     IITFVLCFLGVIIGEKLGDIFKNYAEIVGGVILILIGINILLEHTGIIEKLFS"
     CDS             666446..667372
                     /codon_start=1
                     /gene="CPE0536"
                     /note="308 aa, similar to pir:C64895 hypothetical protein
                     b1432 from Escherichia coli (402 aa); 27.9% identity in
                     305 aa overlap. Also similar to pir:C72305 transposase,
                     IS605-TnpB family from Thermotoga maritima (strain MSB8)"
                     /product="probable transposase"
                     /protein_id="BAB80242.1"
                     /transl_table=11
                     /translation="MKKLKRSYKIEINPTQEQKTKIHQTIGVSRFVYNFYIARNKEIY
                     EREGKFVSGMDFSKWLNNKYIPNNQEMKWIKEVSSKATKQAIMNGDKAFRDFFKKAKG
                     FPRFKKKKNQDVKAYFPKNNKTDWTLERHKVKIPTLGWVRLKEFGYIPVNSIVKSGTV
                     SQKADRYYVSILVEETAIKISNGNTGIEIFNHNNEGVGIDLGIKEFVICSNGNKFKNI
                     NKISTVKKVEKKLKREQRKLSRKYESLKIRNKKEKGGNVTSQNIQKQVVKVQKLHQRL
                     ANIRTDYINKIVSSIIKQKPSYITFEDLKYKE"
     CDS             667372..667644
                     /codon_start=1
                     /gene="CPE0537"
                     /note="90 aa, similar to gp:CPIS1136_1 C.perfringens
                     IS1136 DNA from Clostridium perfringens (122 aa); 59.3%
                     identity in 91 aa overlap"
                     /note="IS1136"
                     /product="probable transposase"
                     /protein_id="BAB80243.1"
                     /transl_table=11
                     /translation="MKNKHLSKAIASQKFFKFKTKLTVKCKENHIELRIVDRFYPSSK
                     TCSQCGKVKKDLKLSDRIYKCDCGFTIDRDLNASINLKNAKEYKIA"
     CDS             667806..668219
                     /codon_start=1
                     /gene="CPE0538"
                     /note="137 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80244.1"
                     /transl_table=11
                     /translation="MYVAFGNRVLDSEEIKKEIELNTDARVVSDLCKSSKREDIIAFK
                     LSIDMDILRGLMKENSDLKDLNDEELFEDYLDLAEEVAGMIFEYMPEDAILDIRSYKW
                     DMSYNDVKLIMVMAHEDLGIAKVNDVMKRLLRQVD"
     CDS             668530..669645
                     /codon_start=1
                     /gene="CPE0539"
                     /note="371 aa, similar to sp:4HDB_CLOKL NAD-DEPENDENT
                     4-HYDROXYBUTYRATE DEHYDROGENASE (EC 1.1.1.61) (4HBD from
                     Clostridium kluyveri (371 aa); 47.2% identity in 371 aa
                     overlap. 1 putative transmembrane region was found by
                     PSORT"
                     /product="NAD-dependent 4-hydroxybutyrate dehydrogenase"
                     /protein_id="BAB80245.1"
                     /transl_table=11
                     /translation="MKLLSLNTEILGFDTSSEFAKELNLNEKDLVFTNRRIYEGSFKS
                     LDLKCNYVLKDKYNFNEPNDEIIDEIFKDIKNIDFNRVIAIGGGSILDVGKLLALKDV
                     DSTKKLFKRELPIIRDKELIIVPTTCGTGSEVTNISIVEIKSENTKLGLAVDELYADK
                     GVLIPELCKTMPYKAFVYSSIDALIHSIEGFLSPNSTPYTDLFAFKAIEMILSGYKEI
                     IEKGEEYRNTIMDKFLIASNYAGIAFGNAGVGAVHALSYPLGGKYHVPHGEANYQFLM
                     AVLNFYKKNNGDGKISELTKLISSIINAKEEDCYLELENLLNNLIRRKNLKEYGMTID
                     EIEKFSQSVMKNQQRLLKNNYVSMEIKDMEEIYKSLY"
     CDS             669654..669842
                     /codon_start=1
                     /gene="CPE0540"
                     /note="62 aa, no significant homology. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80246.1"
                     /transl_table=11
                     /translation="MKFFRMILIAGEVLLVILLLLGIVFKVAECEKKDKSLSNIKEQH
                     IKLDDEQQEKLLYCSIIR"
     CDS             669878..670558
                     /codon_start=1
                     /gene="CPE0541"
                     /note="226 aa, similar to pir:A75167 hypothetical protein
                     PAB0333 from Pyrococcus abyssi (strain Orsay) (259 aa);
                     24.4% identity in 205 aa overlap. Putative N-terminal
                     signal sequence and 2 putative transmembrane regions were
                     found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80247.1"
                     /transl_table=11
                     /translation="MVLVLTFILFLMIFLIIVDFFAILFRLTGVPIEKARFQVTSLLT
                     GTGFTTKESEIIVQHPTRRKLAIWLMGFSYASTATIISFAVNIITSSVIDVGSIAVIV
                     LFIIFVLFFHKSSLLEKFENKIEKFIVQSKIWDKINSKHLTLITNTKGFGVYEIYLSN
                     KATLIGKSIRDSDLKANEIEVLNIDKGDKFVNFPTPDYTFEVCDKVTVYGNVKNIKAM
                     FKHINEVK"
     CDS             complement(670673..671125)
                     /codon_start=1
                     /gene="CPE0542"
                     /note="150 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80248.1"
                     /transl_table=11
                     /translation="MDLKALNPNGNAFLVSFTKAKKTYKKFISPTLNDLGLTHNEFEI
                     LVFLQENLEYNTAKDIVEFSGLSKGLISRSIESLLKKEMLSIKKDDKDKRIFRLYISP
                     SANETLNVLNKVSNRFFKLLLEDLKDEELMFFDEVLNKMIKNLNNLKI"
     CDS             671379..672512
                     /codon_start=1
                     /gene="CPE0543"
                     /note="377 aa, similar to gp:AF051356_3 putative permease
                     from Streptococcus mutans (364 aa); 27.9% identity in 319
                     aa overlap. Putative N-terminal signal sequence and 8
                     putative transmembrane regions were found by PSORT."
                     /product="probable permease"
                     /protein_id="BAB80249.1"
                     /transl_table=11
                     /translation="MEFKNNKIKDYIFLSTYIILLIFFFINIKDIINFLYKFLGILKP
                     FIWGIAIAFILNIPVKLIEKNLGNSKFFKGMKRSFSITLTFLFFILAITLFILFVIPQ
                     LLSSISTLMNSIPEYLSQFEKFLEVNAINNSQSQVMMQNIINELLNMWKEILKVTSQI
                     VGTSLGYLLDFTLGITYGVINFFLSLILAIYMLASKEILISQLKLIIYAFVSKNKADR
                     IIELGNMCNEMFSKFILGQCTEALVIGVLCFIGMIILKMPYALLISVVIGVTALIPVF
                     GAFLGTIPSAFIILIIDPIKALWFIIFIIVLQQLEGNLIYPRVVGSSIGLSALWVMFA
                     MIVGGSLFGIIGMLIGIPIFGVVFKILKRVANRKINEKGIERR"
     CDS             672917..674308
                     /codon_start=1
                     /gene="CPE0544"
                     /note="463 aa, similar to gpu:AE004180_4 proton/peptide
                     symporter family protein from Vibrio cholerae (514 aa);
                     33.2% identity in 407 aa overlap. 8 putative
                     transmembrane regions were found by PSORT."
                     /product="probable proton/peptide symporter"
                     /protein_id="BAB80250.1"
                     /transl_table=11
                     /translation="MAEAIKSTDFEVEKGNGRLKHPAGLYLLFFTEMWERFSYYGMRA
                     LLMLYLTASFVTGGLGYDVPSAARIYGAYTFLVYFTPIIGGEIADKFLGQKKSIMLGA
                     AVMILGNLTLFGWQTRWALYLGLGFIIVGNAFFKPNISTIVGQLYEDGDKRKDSAFTI
                     FYMGINLGSLIAPIICGLLAENFFATKSGEVILHYGFRYGFLAAGIGIILGEIIFITL
                     SPKYLAHVGEIKREKNKKDVAKEKKPLTKQEKKRVAVILILASFVVFFWAGFEQAGTT
                     LTLFAENATNRSLFGWTVPVAFFQSINPLFILILAPLFSKLWFTLANSKRGDLSIPTK
                     MAMGMIVLGCGFLLMVFATMSLGGNVENPAVKASMFWLVGTYLFNTMGELCLSPIGLS
                     MVSSLAPAKYASLLMGVWLASNGVANYLSGFIASFVEKLGALELFGSIAGVSIVLGLV
                     LLLLSKKITAMME"
     CDS             complement(674471..674686)
                     /codon_start=1
                     /gene="CPE0545"
                     /note="71 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80251.1"
                     /transl_table=11
                     /translation="MSDNKLKEDLVKVYKEWKDLEKKAGKKIKHHHELKKEEKEDEIQ
                     RFSDYAGLSVPITEEMLLYLDEEYFRV"
     CDS             complement(674700..674930)
                     /codon_start=1
                     /gene="CPE0546"
                     /note="76 aa, no significant homology."
                     /product="hypothetical protein"
                     /protein_id="BAB80252.1"
                     /transl_table=11
                     /translation="MGEEKIKKELLDLYSKWRVSEKSFFEKLKLNHDFKKLEKEQIKL
                     ITKKFSEFAKIDTPLTEKEILELEEYYNNTFI"
     CDS             675180..676730
                     /codon_start=1
                     /gene="CPE0547"
                     /note="516 aa, similar to C-terminal of pir:C70319
                     nitrite reductase (NAD(P)H) large subunit from Aquifex
                     aeolicus (1002 aa); 24.8% identity in 452 aa overlap"
                     /product="hypothetical protein"
                     /protein_id="BAB80253.1"
                     /transl_table=11
                     /translation="MNTLNDILSKEIEEFREKGHKFLNKEMTVGEFKKASGGMGVYAH
                     RGGKEFMVRLRVPSGVAGLSLLEEAYNWAKKYNLEKIHLTTREAIQLHGISIDAVCDI
                     MQEGLNKGIYTRGGGGNFPRNVALNPLSGVQIGETFDVTPYALASNAHYMSKIYTYNL
                     PRKIKTAFSNTEEDSAHCTVTDLGFLAVENNGKRAFKLYIGGGLGRNPRTSVEFDELI
                     DEKDVLYCLEAMTNLFVAEGDYKNHGKARIRYIVERMGEEEFKNCFRKHLEEVKAKGG
                     LDLKVEDIKYSKKGEKTNIKHERLIPQKQEGLYTVLFHPVGGQLSLDVLKELIEKIEK
                     IEEVEVRLGMDENLYVRNLNGKEAEAILDFTQGKGGETLAERSVACIGTPTCQMGVLE
                     SQKTLREFVELLKENSIKEGLLPRVRFSGCPNSCGMHEIGDIGFAGKKKKVGDVLSNV
                     FELHFGGKLGIGETRLGDYYGDILQDKVPEFLIKVAKAVEAKNSTFEEWIKDNSEEFK
                     AIVEEYNV"
     CDS             677043..677858
                     /codon_start=1
                     /gene="speD"
                     /note="271 aa, similar to pir:D83564 S-adenosylmethionine
                     decarboxylase proenzyme PA0654 from Pseudomonas
                     aeruginosa (strain PAO1) (264 aa); 57.3% identity in 267
                     aa overlap"
                     /note="CPE0548"
                     /product="S-adenosylmethionine decarboxylase"
                     /protein_id="BAB80254.1"
                     /transl_table=11
                     /translation="MLGLKEKICLYGFNNLTKTLSFNIYDICYAKTEREKEDYIKYID
                     EQYNSERLTKILCDVTEMIGAHVLNISKQDYEPQGASVNVLITEEALPVALIDPSCNK
                     GELSYLELRDSVVGHLDKSHLTVHTYPEFHPNNDIISFRVDIDVSTCGKISPLNALDY
                     LIGSFDSDVITIDYRVRGFTRDVDGRKCYIDHDIKSIQDYIDGETLKKYDAMDVNVYQ
                     SNIFHTKMMLKDIVLNNYLFNSDPYELSPNDRREIRDRISKEMIEIYGGVNIY"
     CDS             677876..679330
                     /codon_start=1
                     /gene="dclY"
                     /note="484 aa, similar to sp:DCLY_BACSU LYSINE
                     DECARBOXYLASE (EC 4.1.1.18) (LDC) from Bacillus subtilis
                     (490 aa); 44.1% identity in 479 aa overlap. 1 putative
                     transmembrane region was found by PSORT"
                     /note="CPE0549"
                     /product="lysine decarboxylase"
                     /protein_id="BAB80255.1"
                     /transl_table=11
                     /translation="MKRLSQENAPIYEALKWYKNQRIVPFDVPGHKQGRGNTELREFL
                     GEDCVSVDVNSMKPLDNLCHPTSVIKDAEELAAEAFGADKAFFMVNGTTSAVQAMIMS
                     VCKDGDKIIMPRNVHRSAINSLIITGVTPVYINPGIHGRLGISLGMAMEDIKKAIKEN
                     PDAKAIFVNNPTYYGICSNLREIVKLAHENNMYVLVDEAHGTHFYFDKRLPVSAMEAG
                     ADMAAVSIHKTGGSLTQSSMLLMKCNRIKPDYVRTIINLTQTTSGSYLLLSSLDIARR
                     NLALNGEKIFEEVVGIAEYAREEINKIGGYYAFSKEINNGDDIYDFDVTKLTINTLET
                     GLAGIEVYDILRDDYGIQIELGDVANILAIISVGDTRYNIERLVSALSEIKRIHEKDK
                     KDIFDHEYIDPIVKVKPKEAFYADKKKVLLRESEGLISGEFVMCYPPGIPILAPGELI
                     TKETIDYIEYSKKKGSLVTGPEDMEIEYINVLDC"
     CDS             679345..680196
                     /codon_start=1
                     /gene="speE"
                     /note="283 aa, similar to sp:SPEE_BACSU SPERMIDINE
                     SYNTHASE (EC 2.5.1.16) (PUTRESCINE
                     AMINOPROPYLTRANSFERASE) (SPDSY) from Bacillus subtilis
                     (275 aa); 45.5% identity in 279 aa overlap"
                     /note="CPE0550"
                     /product="spermidine synthase"
                     /protein_id="BAB80256.1"
                     /transl_table=11
                     /translation="MELWYTEEHTDKVRFSIKVDEQLYSGKSDFQRIDVFKSQEFGTF
                     FTLDGLMMVTEKDEFIYHDMIVHVPMATNPNIKNVLVIGAGDGGTVRELTRYETIEKI
                     DMVEIDKLVVDVCREYLPQTANKLDDPRVSLFFEDGLKFVRSVENKYDLIIVDSTDPF
                     GPGEGLFTREFYGNCFKALKEDGILVNQHESPYYEEYARGMKRAHKRIKECFPVCRVY
                     QAHIPTYPSGHWLFGFASKKYDPLNADIEKWNDLGLKTKYYNTDLHKGCFALPNYVKE
                     MLENVDE"
     CDS             680183..681040
                     /codon_start=1
                     /gene="speB"
                     /note="285 aa, similar to pir:H70057 agmatinase homolog
                     ywhG from Bacillus subtilis (290 aa); 48% identity in 271
                     aa overlap"
                     /note="CPE0551"
                     /product="probable agmatinase"
                     /protein_id="BAB80257.1"
                     /transl_table=11
                     /translation="MLMNRNVSTFIGCEAEYDESSIVVFGAPFDSTTSFRPGTRFASQ
                     VMRGESWGLESYSPYQDLDLYDFNIFDGGEIELPFGNSEGALALIEDFSTKVVEDGKI
                     PAMIGGEHLVTLGAFKGVFKKYPDVHVIHFDAHADLREDYLGQKLSHATVIHRVWDLV
                     GDNKIFQFGIRSGEKEEFLWAKDHVYTNKFNCDTLDYALERVKDKPVYVTIDLDVLDP
                     SVFPGTGTPEPGGIQFNELLNSILKLRGLNIVGFDINELSPQYDQTGASTAVACKVLR
                     EMLLVANNK"
     CDS             complement(681358..681621)
                     /codon_start=1
                     /gene="CPE0552"
                     /note="87 aa, similar to pir:G69983 hypothetical protein
                     ysdA from Bacillus subtilis (89 aa); 46.9% identity in 64
                     aa overlap. Putative N-terminal signal sequence and 2
                     putative transmembrane regions were found by PSORT."
                     /product="conserved hypothetical protein"
                     /protein_id="BAB80258.1"
                     /transl_table=11
                     /translation="MKELFVGYLIVINLVAIILMYIDKQKAKKHQWRISEDTLIGVSI
                     IGGGIGALWGMHVFRHKTKHAKFTIGIPLIIAIQALLILYFIR"
     CDS             681830..685351
                     /codon_start=1
                     /gene="nanJ"
                     /note="1173 aa, similar to sp:NANH_CLOSE SIALIDASE
                     PRECURSOR (EC 3.2.1.18) (NEURAMINIDASE) from Clostridium
                     septicum (1014 aa); 50.9% identity in 953 aa overlap.
                     Putative N-terminal signal sequence was found by PSORT"
                     /note="CPE0553"
                     /product="exo-alpha-sialidase"
                     /protein_id="BAB80259.1"
                     /transl_table=11
                     /translation="MKSKKIIATLVASLVISNMGGYLVKANPNVNHKAVIIEDRQAII
                     ETAIPQSEMTASATSEEGQDPASSAIDGNINTMWHTKWNGSDALPQSLSVNLGKARKV
                     SSIAITPRTSGNNGFITKYEIHAINNGVETLVAEGTWEENNLVKTVTFDSPIDAEEIK
                     ITAIQGVGGFASIAELNVYEIKGEVDEIANYGNLKITKEEERLNITGDLEKFSSLDEG
                     TIVTRFNMNDTSIQSLIGLSDGNKANNYFSLYVSGGKVGYELRRQEGNGDFNVHHSAD
                     VTFNKGINTLALKIEKGVGAKIFLNGSLVKTVSDPNIKFLNAINLNSGFIGKTDRANG
                     YNEYLFRGNIDFMNIYDKPVSDNYLLRKTGETKAPSEDSLLPDDVYKTQPVELFYPGY
                     LESRGYRIPALETTKKGTVLASIDVRNNGDHDAPNNNIDVGIRRKEVNGEWEEGKVIL
                     DYPGKSAAIDTSLMSATIEENGIEKERIFLIVTHFPEGYGFPNTEGGSGYKEIDGKYY
                     FILKDAQNNEYTVREDGIVYNSEGNQTDYVMKNDKTLIQNGEEVGNALLSNSPLKAVG
                     TAHIEMIYSDDDGKTWSEPEDLNPGLKKEWMKFFGTAPGKGIQIKNGEHKGRLVFPIY
                     YTNQNNFQSSAVIYSDDFGETWKLGESPIDTASVSSETVSSGTQLTECQVVEMPNGQL
                     KLFMRNTGSYTKIATSFDGGATWHDEVPEDTSLREPYCQLSVINYSGKINGKDAIIFS
                     NPDASSRVNGSVKVGLINENGTYDNGEPRYEFDWIYNKTVKPGSFAYSCLTELPDGNL
                     GLFYEGEGAGRMAYTEFDLNYLKFNASEDSPSASVQSIEVLDEDLAYNSGEEVSIKVN
                     FNQLVSIIGDRKITLDIGGVDVPLNMVNYEGKSSAIFKGTIPEGINQGNYEIKLKENN
                     TLELNTVYNKVSTFNGLDNTGINVQIGELKTTVGNSTIKVNDEVQVGSAFEAILGIEG
                     LNGDTEVYSAEYLFEYNVEAFILNEITSFNDSLFVKSKEVEPGKVRILVASLGNEIEK
                     DSDLVKVNLTPKISSELEVLGLTTALVGAGDGNTHDLELSSKEVKINEEASGEIVVNP
                     VQNFEIPEINKKNVKLTWNAPITTEGLEGYVIYKDGKKLSEVPAESTEFVVSKLNRHT
                     IYNFKVAAKYSNGELSAKESKTIRTAR"
     CDS             685497..686138
                     /codon_start=1
                     /gene="CPE0554"
                     /note="213 aa, no significant homology. Putative
                     N-terminal signal sequence was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80260.1"
                     /transl_table=11
                     /translation="MKKKLLGMLLAGTLMVGAVGSYAWFSDKAEVDSGIKLTMGTLDV
                     DVKEISDGWNIVDETSEIINKKSTKHFKNVRPGDSFQREFVIANSGTLKQKVSVKLNP
                     EVARKVVTTIGDQAVLFDDLFNLKFELGELELPMKINENETFEFELDSLYTEAEDSDK
                     VTSAADLKVTLEVDKDAMDNRFNHDGNKFVEIFDFLKDKSVPLVLVEAEQVNK"
     CDS             complement(686246..688915)
                     /codon_start=1
                     /gene="CPE0555"
                     /note="889 aa, similar to sp:ATCU_BACSU POTENTIAL
                     COPPER-TRANSPORTING ATPASE (EC 3.6.1.36) from Bacillus
                     subtilis (803 aa); 51.6% identity in 808 aa overlap. 7
                     putative transmembrane regions were found by PSORT."
                     /product="probable copper-transporting ATPase"
                     /protein_id="BAB80261.1"
                     /transl_table=11
                     /translation="MSAIIFMINKSIKIKGMSCAACAARIEKVLGKMNGISKANVNLA
                     TEKLNLEFDENKISFKEIEEKINKLGFSVVRNLKKESFRVSGMSCASCAARIEKVLNK
                     LSGIYNATVNFANESLQVEYDEDEISLKEIKEKVKKLGFELKGNNKSTSFKVEGMTCS
                     ACAARIEKVTSKMDGVESSNVNFANSTLNISFDKDKLSTNDIKAKVEKLGYKLLDASQ
                     EDEHEKAKENETKRMKNRLIGSAIFTIPLFIISMGHMVGLHLPNIIDPMHNPLNFALI
                     QLLLTTVVIFICRDFFIHGFKNLFMRSPNMDSLIAIGSGAAYVYGLFAIYHIYIGDHS
                     YAMQLYFESAGTILTLISLGKYLETLTKGKTSDAIKKLMGLAPKTATLLVDGKEKIVS
                     IDDVKVFDLILVKPGEKLPVDGKVVEGYTSIDESMLTGESIPAEKKVGDTVFGASINK
                     NGRIIYEATKVGKDTVISQIVKLVEDAQGSKAPIAKLADTISGYFVPIVISLAVIASL
                     AWYFSGESKTFALTIFISVLVIACPCALGLATPTAIMVGTGKGAENGILIKSGEALES
                     TQNLNTVVFDKTGTITEGKPKVTDIICENISKDELLLLAASAEKGSEHPLGEAIVRDA
                     EEKNLELKNVLDFEAIPGKGIKCSIENKSILLGNYKLMKDKNINLKNLLATSEELASK
                     GKTPMFIAINEKIAGIIAVADTVKETSKKAIETLQKMGLEVVMLTGDNLKTAKAIAKE
                     VGVDRVIAEVLPQEKAEKIKSLQDEGKKVAMVGDGINDAPALAIADIGMAIGSGTDIA
                     MESADIVLMKGDILHVVGAIQLSRQTMKNIKENLFWAFGYNTLGIPVAMGVLHIFGGP
                     LLNPMIGAFAMSFSSVSVLLNALRLKKFKPNYK"
     CDS             689207..689863
                     /codon_start=1
                     /gene="CPE0556"
                     /note="218 aa, similar to gp:AF112858_1 NAD(P)H
                     dehydrogenase from Bacillus stearothermophilus (211 aa);
                     35.5% identity in 186 aa overlap"
                     /product="NAD(P)H dehydrogenase"
                     /protein_id="BAB80262.1"
                     /transl_table=11
                     /translation="MKKLLYITVNSKPEKLSSSKTIGRAFISRFVELNPEFEIEEVDL
                     YKDFIPRLEHKHFSGRSSVVDCETASIDAKTKEEVKRIIELSEQFKNADLYVIAAPLW
                     TLSFPAPLKEYIDCVVQNKITIKVTPEEVKGLLDDKQREMVYIQSSGGEIPWLTKGIF
                     NKGLNYVEDVMKFLGIKKFHQLLVDGTGFSIEEKFKAEDKAVEKIDNVIKDIHFSNKG
                     "
     CDS             691147..692283
                     /codon_start=1
                     /gene="CPE0557"
                     /note="378 aa, similar to gpu:AF249729_1 ATPase OpuCA
                     from Listeria monocytogenes (397 aa); 47.5% identity in
                     354 aa overlap"
                     /note="ATP-binding protein"
                     /product="probable glycine betaine/carnitine/choline ABC
                     transporter"
                     /protein_id="BAB80263.1"
                     /transl_table=11
                     /translation="MIEIKNVSKQIGDRKILDNISLTIDKGSLVVLIGSSGCGKTTTL
                     KLINKLITPTSGEIFINEKSLAKENPIELRRNIGYVIQNNGLFPHLTIKENIELIPRL
                     KKGKDVEKIEKTTLDLLNMVGLDSEIYLNKYPSELSGGQQQRVGFARAFATDAEIILM
                     DEPFSALDPITRTSLQEELFNIQEELKKTIIFVTHDMDEALKIADKICIMNGGKIAQY
                     DTPENILRNPANDFVRDFIGSDRVWNNPDFIKAKDIMIKNPVSVKGARTILQGIEIMR
                     SNKVDSLLVIDKENVLKGIVTFKDIKITNEKSRALSEIMSENPLRVNEDDSLVDILTV
                     MNENSVGFIPVVNSEEKLVGLITRSSLLSILSDQFLDMEVNIFE"
     CDS             692276..693829
                     /codon_start=1
                     /gene="CPE0558"
                     /note="517 aa, similar to pir:T44634 choline transporter
                     from Streptococcus pneumoniae (506 aa); 34.7% identity in
                     502 aa overlap. 7 putative transmembrane regions were
                     found by PSORT."
                     /note="osmoprotectant-binding protein"
                     /product="probable glycine betaine/carnitine/choline ABC
                     transporter"
                     /protein_id="BAB80264.1"
                     /transl_table=11
                     /translation="MNSLLQYVISQKTQILDLLVQHIYLTITAIGIAILIGVPLGILV
                     SRVKFLRKPILGFVNLVQAVPSMALLGLLIPILGIGSTPAIFMVVVYSLLPIVKNTYT
                     GISGIDPVVLESAKGIGLTKNQSLFKIQLPLALPIIMSGIRISAVTAVGLMTLAAFIG
                     AGGLGYLVFSGVQTVNNNMILAGAIPACILALIVDFIFGKIEVAVTPKGLSNDNKKKN
                     TFVLKIISVIMIIAILFMGISSFISSRKDKVVIGSKNFTEQLILGNMYADLVQAKTDL
                     QVEKKLNLGGTSVAFGALEKGDVDMYVDYTGTLLVNVMKENNIDNSVDYYNSIKENMN
                     KEHGLTVMEPLGFNNTYNIAISKELADKYKINTISDLSKYSNEFVLSPTIEFQNRQDG
                     LVGLKNYYGMDFKNVKSLDGSLRYSALSNGESQAIDAFSTDGLLKKFDLKTLEDDKKF
                     FVNYSAVPIVNNKTLEKYPQLKDVLNSLSGKINEEKMIDLNYEVDVLGKSPEEVAKAF
                     LIREGLIEQ"
     CDS             694087..694662
                     /codon_start=1
                     /gene="sigV"
                     /note="191 aa, similar to sp:SIGV_BACSU RNA POLYMERASE
                     SIGMA FACTOR SIGV from Bacillus subtilis (166 aa); 34.1%
                     identity in 138 aa overlap"
                     /note="CPE0559"
                     /product="RNA polymerase ECF-type sigma factor"
                     /protein_id="BAB80265.1"
                     /transl_table=11
                     /translation="MEKTMSISYLDIDRKNELNEIRLIKESMKGNKESFGILIKNNKE
                     YLYKMAFLYVKDEQDALEVIHETVYRAFLNIEKLKKAKFFNTWITRILINVSIDFLKK
                     KGKNEMLDESTPIRKERCEISTEEKLDLYNAIDLLNDNYKTVIIMMYFNDMKIKDISK
                     VMEIPENTVKTYLRRAKQALGEVLKEGYLNE"
     CDS             694655..695743
                     /codon_start=1
                     /gene="CPE0560"
                     /note="362 aa, no significant homology. 1 putative
                     transmembrane region was found by PSORT"
                     /product="hypothetical protein"
                     /protein_id="BAB80266.1"
                     /transl_table=11
                     /translation="MNKKDLDKINLPNNLDDIIDEAINMANEDKKKNKIKGKGYKKVF
                     KNIAAGLAIIIGIGVGTSTFAYGVPVIKNAFERIQKEIWNKGNYSKYATEVNQTVSNN
                     GVGITLSEILCDGQNLYVSYVIESKEPFKYIKYKYDPVKDYDITKEQAENIEKMQLDY
                     AAEAKVSFTDSELDNSGVSGLEGRFIDDHTFVGVEEYNLTSLNMSIPDEFEFIINFNS
                     IVEEGWNERDKRHIFKGEWNFKVPVKVDKSLSKCIEVNDMNKEGVGIKEVIATPIKLK
                     LVTTGYDREKNNYWVRVYDEKGNILRTSSGEELSSYGEYLSTIAKEGEDIKKIKVEIY
                     KPFVDENGKDYFHDPRETILYSKEINLE"
     CDS             696091..697512
                     /codon_start=1
                     /gene="CPE0561"
                     /note="473 aa, similar to gpu:AE004175_1 PTS system,
                     trehalose-specific IIBC component from Vibrio cholerae
                     (478 aa); 52.9% identity in 367 aa overlap. 9 putative
                     transmembrane regions were found by PSORT."
                     /note="trehalose-specific IIBC component"
                     /product="PTS system"
                     /protein_id="BAB80267.1"
                     /transl_table=11
                     /translation="MSKFEKDAKLLTEYIGGKENVAAVTHCATRMRFVLNDTSKADVE
                     KIKAIPCVKGTFTQAGQFQVIIGPEVATFYNDFVGQTGVSGESKEEVKKAAKKNMNIV
                     QRAVAGLAEIFAPLIPAIIVGGLILGFRNVIGDMKLFEDGTKSLVEISQFWAGTHSFL
                     WLIGEAIFHFLPVGVVWSIAKKMGADQMLGIVIGITLVSPQLLNAYSAGNGAAAPVWD
                     FGFAQVPMIGYQAQVLPAIMVGFTFVYLERLFKKITPGPIQMIIVPFFSVIPTVLLAH
                     TVLGPIGWKIGSVISGVIVAGLTSSFGWLFAGIFGMIYAPLVITGLHHTLLPVDLQLI
                     SDIGGTFLWPIIALSNIAQASAVLAMIYVNRKDEDEKQISIPACISGYLGVTEPAMFG
                     VNLKYLYPFIASMIGAGVAGMFSMAMGCMANSVGVGGLPAILSMQSSSMLMYLVAMGI
                     AIVVPFVLTIVFSKTKLANMASK"
     CDS             697716..699383
                     /codon_start=1
                     /gene="CPE0562"
                     /note="555 aa, similar to gp:AF216220_1 alpha-glucosidase
                     from Bacillus sp. DG0303 (562 aa); 62.5% identity in 552
                     aa overlap"
                     /product="alpha-glucosidase"
                     /protein_id="BAB80268.1"
                     /transl_table=11
                     /translation="MKDFKKSVVYQIYPKSFKDSNGDGLGDLRGVIEKLDYLKTLGVD
                     YIWMTPFYVSPQKDNGYDIADYYKIDPRYGTMEDFEELVKEAKSRNIDIMLDMVFNHT
                     STEHEWFKRALKGEEKYKNYYIFKEGKKGEPPTNWISKFGGNAWEYVEELGEYYLHLF
                     DVSQADLNWDNKELREEIYKVVNFWIDKGVKGFRLDVINLISKPEKFENDYEGDGRRF
                     YTDGHRIHEYLKELNERTFGKDVEIVTVGEMSSTTIENCIKYSNPKEKELSMVFNFHH
                     LKVDYKDGQKWSLMDFDFIELKKLFNNWQRGMIKGGGWNAVFWCNHDQPRVNSRFGDV
                     KKYFNESSKMLATSIHMMSGTPYVYQGEEIGMTNPGFESIEEYRDVESINYFNILKEE
                     GIDKKEIMEILKSKSRDNSRTPVQWNEEKNAGFTTGTPWINIANNYREINVERALENK
                     DSVFYHYKKLIELRKNEDVIAYGDYIPLLEDHPKVYAYERNYNGEKLLVINNFYGEEC
                     LVDLSKEIEGLENYNKSILISNYKDSTLDLLNLKLRPYESIVYKLEK"
     CDS             699647..700354
                     /codon_start=1
                     /gene="treR"
                     /note="235 aa, similar to sp:TRER_BACSU TREHALOSE OPERON
                     TRANSCRIPTIONAL REPRESSOR from Bacillus subtilis (238
                     aa); 54.5% identity in 233 aa overlap"
                     /note="CPE0563"
                     /note="GntR family"
                     /product="probable transcriptional regulator"
                     /protein_id="BAB80269.1"
                     /transl_table=11
                     /translation="MSSKYLKIYNDIVGKIDSGIFEANTKLPSESQLMDEYNVSRDTV
                     RKSLNLLEQNGYIEKSKGKGSFVLDMNKFDFPVSGIKSFKEIENSLGKECETILEELT
                     LKSPSDSLMKKLEVSPNKYVWSVVRVRNIDGEKIILDKDYLNSEFVPRLTEEICKDSL
                     YKYIEGELGLKIAYAEKEITVQTATEEDQRLLDLRGYDMVAVVKSYTYLEGRKLFQYT
                     ESRHRPDKFKFVDFARR"
     CDS             complement(700806..702992)
                     /codon_start=1
                     /gene="spoVD"
                     /note="728 aa, similar to gpu:AP001516_1 stage V
                     sporulation protein (soprulation specific
                     penicillin-binding protein) (spore cortex) from Bacillus
                     halodurans (644 aa); 38.6% identity in 360 aa overlap.
                     Putative N-terminal signal sequence was found by PSORT"
                     /note="CPE0564"
                     /product="stage V sporulation protein D"
                     /protein_id="BAB80270.1"
                     /transl_table=11
                     /translation="MKRSYRDM