LOCUS       AY576273               63649 bp    DNA     linear   ENV 04-MAR-2005
DEFINITION  Bacteriophage Phi JL001, complete genome.
ACCESSION   AY576273
VERSION     AY576273.1
KEYWORDS    ENV.
SOURCE      Alphaproteobacteria virus phiJl001
  ORGANISM  Alphaproteobacteria virus phiJl001
            Viruses; Caudovirales; Siphoviridae; Yuavirus.
REFERENCE   1  (bases 1 to 63649)
  AUTHORS   Lohr,J.E., Chen,F. and Hill,R.T.
  TITLE     Genomic analysis of bacteriophage PhiJL001: insights into its
            interaction with a sponge-associated alpha-proteobacterium
  JOURNAL   Appl. Environ. Microbiol. 71 (3), 1598-1609 (2005)
   PUBMED   15746365
REFERENCE   2  (bases 1 to 63649)
  AUTHORS   Lohr,J.E., Chen,F. and Hill,R.T.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-MAR-2004) Center of Marine Biotechnology, 701 East
            Pratt Street, Baltimore, MD 21202, USA
FEATURES             Location/Qualifiers
     source          1..63649
                     /organism="Alphaproteobacteria virus phiJl001"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:279383"
                     /environmental_sample
     gene            1..375
                     /locus_tag="JL001p01"
     CDS             1..375
                     /locus_tag="JL001p01"
                     /codon_start=1
                     /transl_table=11
                     /product="gp01"
                     /protein_id="AAT69459.1"
                     /translation="MVEITVTGGGSTTVDAESATVNVNGDGDTIVNEVQMVGGIPVYT
                     DLAELPVDGSVLIAIFQPEFGIYNGGDDTIYNGLLFYQGFTTGNFGDSTASFDVWDQA
                     AKTSVSTVISPNGWRAVGLAQS"
     gene            372..854
                     /locus_tag="JL001p02"
     CDS             372..854
                     /locus_tag="JL001p02"
                     /codon_start=1
                     /transl_table=11
                     /product="gp02"
                     /protein_id="AAT69460.1"
                     /translation="MIWLLKNWRKVAIGLAAVAILGIISAGYIHYTGLVNENARIKQE
                     KVILEKDLESQRITIAAQVDAIDMWEAGAERLRLELERQREVEADARAEADRLRRLFG
                     EHDLDALAGARPESIERLVNRGSARLGRLLECASGAVGHPECPGEDAQDTDASQANAN
                     "
     gene            904..1020
                     /locus_tag="JL001p03"
     CDS             904..1020
                     /locus_tag="JL001p03"
                     /codon_start=1
                     /transl_table=11
                     /product="gp03"
                     /protein_id="AAT69461.1"
                     /translation="MALTPRQYQNLSNNLAEVLRYVKQADSQLDYYRRELGQ"
     gene            1017..1277
                     /locus_tag="JL001p04"
     CDS             1017..1277
                     /locus_tag="JL001p04"
                     /codon_start=1
                     /transl_table=11
                     /product="gp04"
                     /protein_id="AAT69463.1"
                     /translation="MSDDRVIHLTEAQLKEIMEEAVNEALIKIGVDPSDPIEVQKDMQ
                     HLRDWRQSVESVQKRGLMVIVSTLTAGLLAALWIGFKELTKQ"
     gene            1294..2931
                     /locus_tag="JL001p05"
     CDS             1294..2931
                     /locus_tag="JL001p05"
                     /codon_start=1
                     /transl_table=11
                     /product="gp05"
                     /protein_id="AAT69465.1"
                     /translation="MSQLKEQVLEAWHRLGSKAAVARELGINPKTVYKHLKNAGIGDT
                     PVATGRVHYLPPQEKELPPEGEVARYILTCAQNNTKLHKRFWDSLVTYANHLGAELMV
                     SRFTYNKASYSSAKSVKPGKGPTSDDKDKAWWDRELDPYICDDAMDSSGRWQLAPGLL
                     WCAEMNILPTAARPLSGLQTYTGSDSGIFPHSKIAMESVATARYEPAKFNYTTGCVTQ
                     RNYIAKKTGLKAEFHHTYGALIVEVLSDGRWWVRQLNADARGRFYDCAEQVVFVEPDR
                     VTPVTQVAAVNWGDVHASEIDEDVKIANWGEGGIIDVLRPKKQIMHDLLSFRSRGHHD
                     MKSFGVMYQKFLGGEDSVEDEVNQTKAVADMAHREFCEMVVVNSNHDRHGERWLDEAD
                     YRKDLLNAEYFLEAQLARIRAYKMGAPWDFHKWSLQHAGVSRQVRFLERNESYQILGI
                     ECGLHGDEGPNGSRGTTANLSRLGARVNKGHDHSAAILDGVYSAGSCAVDLPYMNGPS
                     SHSASHIVTYPNGKRTIITLRGRDWRAAGPDSKSERT"
     gene            complement(3070..3249)
                     /locus_tag="JL001p06"
     CDS             complement(3070..3249)
                     /locus_tag="JL001p06"
                     /codon_start=1
                     /transl_table=11
                     /product="gp06"
                     /protein_id="AAT69548.1"
                     /translation="MGIVFHSASPFLEPSIAQGRERAKFSVADLTDLMGVLRQVRDCQ
                     AITIQYLIDLMDLIK"
     gene            3232..4773
                     /locus_tag="JL001p07"
     CDS             3232..4773
                     /locus_tag="JL001p07"
                     /note="gp07; similar to Vibriophage VP5 superfamily II
                     DNA/RNA helicase encoded by GenBank Accession Number
                     AY510084"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="AAT69464.1"
                     /translation="MEHYPHTMPPFNHQEEELDQHWDKPWRAIFWEQGTGKMKAGYDF
                     ALTQWQAGIIDTLIVLAPNGVHRDWVEEGFKKGDPNNPFNQPLVPPEWHDQIDAAWYH
                     GGKAGNKSHQKKMRDLFYSKKFVVLTMSYDSAKTKKNKASGWIGGKLFLEKMLRERRC
                     AFILDEASCIQSPTSQITKTLVGRGGKGGIARHAVSRRIMEGTPVDEGPFNVYPQMQF
                     LDQEFWKDRGFASWASFKTYFGVWREGFNGVTNKSFQQCVGYQNLDELKRILKPHSSR
                     VLKKDALDLPDKLYQHVRFEMSPEQWKMYEQIREELMAMVRADGSDIETLLTAELPIV
                     NVLRLYQITAGYLPFQEDVNGEPVERVHTFKENPRLETALAELRRQTDKTVVWCRFTR
                     DIDLLTAALGKFAVRFDGSISEDERAQNKQEWLKGDAQYLVPQIQAMARGHTLNIAPY
                     VLYYTNDARLRLRRQSEDRTHRGKMNFSVLYGDMLASDTVDEKRVKSLRKKLAVAETI
                     MGDNE"
     gene            4770..5126
                     /locus_tag="JL001p08"
     CDS             4770..5126
                     /locus_tag="JL001p08"
                     /codon_start=1
                     /transl_table=11
                     /product="gp08"
                     /protein_id="AAT69462.1"
                     /translation="MTVYAVQSPRHRQHGQMVPKYDLAPAEEFGEVVELLSPTAKPFN
                     PKPLIDELYVKLEKFSDDDHIICIGNPILLSMAVTIASDVNNGRVKLLQWHGHQGKYI
                     SVQVDMGFTSASDEAM"
     gene            5243..5479
                     /locus_tag="JL001p09"
     CDS             5243..5479
                     /locus_tag="JL001p09"
                     /codon_start=1
                     /transl_table=11
                     /product="gp09"
                     /protein_id="AAT69485.1"
                     /translation="MLYRDWKYEACPVAEGRVDHTAYNLVTKSHVAVHHQPTEAMTES
                     SFKFHVQNDFRMKQNGINYSNWCHADIEKERSCD"
     gene            5574..6032
                     /locus_tag="JL001p10"
     CDS             5574..6032
                     /locus_tag="JL001p10"
                     /codon_start=1
                     /transl_table=11
                     /product="gp10"
                     /protein_id="AAT69486.1"
                     /translation="MWEAEKEVAALEAKLKEAKERLRKYSEETIPNTLEDMGLEEVTV
                     TGGLKVKIRTSVHASPKKENREAVYDWLEKHGHGGLIKRHAIFTVGRDNERQAKSWIK
                     RIKAFPGLFERKVESATLRSFVNQSIEEGTEIPMELFGAYTRRVAEVKSG"
     gene            6078..6878
                     /locus_tag="JL001p11"
     CDS             6078..6878
                     /locus_tag="JL001p11"
                     /codon_start=1
                     /transl_table=11
                     /product="gp11"
                     /protein_id="AAT69487.1"
                     /translation="MATKAVAKKEETALAEAWGDYAGATGYEDADRSELAIPFINLLQ
                     SNSELVEENKAKAGQFFNNVMETIHDSLTIIPCARQRVFVEWVPIDDGGGLVAVHEPD
                     SAFVQKAISLNDGSTRDIKVADGKHELIETIYLFVLVLDEDGNAERAVISFSSSKLKK
                     YRQFFTKATSQTVAVNGRKIKLPLWAHRWTVVSEDDVSKTNGRKFKNISLQWDGDTAK
                     ECRLTPRDELFAMGQGFHDMVAGGEAKADLSTVDKAEGSSEDGEEIPF"
     gene            6974..7471
                     /locus_tag="JL001p12"
     CDS             6974..7471
                     /locus_tag="JL001p12"
                     /codon_start=1
                     /transl_table=11
                     /product="gp12"
                     /protein_id="AAT69488.1"
                     /translation="MPIVTTHEKSPTEFSSFVVHMAQLNPSGFRQPGRRPGSTSLPEL
                     AMLGAGEVKLHELRPERSERSRWRRRMAELTRERVRVDQAQGLELRRNTMHGRNRRRH
                     MRYIGLMTGYRQLVGQTAIVWLHPGRETVLAQFDERELVHPKTFKKLGYDKHEFHISD
                     FEDAA"
     gene            7468..8673
                     /locus_tag="JL001p13"
     CDS             7468..8673
                     /locus_tag="JL001p13"
                     /note="gp13; similar to Pseudomonas aeruginosa
                     bacteriophage PaP2 p54 encoded by GenBank Accession Number
                     AY575774"
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease V"
                     /protein_id="AAT69489.1"
                     /translation="MKWGAQQNTALSRVDEWLASGHSPIFRLFGYAGTGKTTLAKHLA
                     EGVSGRVKFAAYTGKAAQVLSEKGCPATTIHKLIYVPKSKSKTRLNGLQQQLVDMVRD
                     LSQTLTQAQIDQRSDVLKCRAQIKEEEENLRGMMFQKNLESELYGCSLLVVDECSMVD
                     MQVGQDLLSFDVPILVLGDPAQLPPVMGGGFFTEAKPDMMLTDIHRQAKDNPIIEMAT
                     RVREDRGLPLGSYGDSAVHRFGTPMEDIARRADQLICGRNKTRRAANKRIRQFKGFEG
                     DLPVVGDRLVCLSNDHEEGLLNGQIWIAAADAQDAGETYLLTAYPEDNEANVKEMTVW
                     ATEPDWHERREAQSFDFGYCLTCHKSQGSQWDHVMVMDESRSFKKDANRWLYTAITRA
                     AERVDVVGM"
     gene            8670..10478
                     /locus_tag="JL001p14"
     CDS             8670..10478
                     /locus_tag="JL001p14"
                     /note="gp14; similar to Halovirus HF2 ribonucleotide
                     reductase encoded by GenBank Accession Number AF222060"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide reductase"
                     /protein_id="AAT69490.1"
                     /translation="MTFSRAIPPTTLVAFDHLSRKNKMHGPTLAISEEIHAEKYRGEG
                     ESFREGMGRVANALKDGEEHYKELREILLDMRFMPAGRVQAAMGSTKNVTAYNCYVSG
                     TIEDSFIDGHGSIMERAKQAAATMRMGGGIGYDFSTLRPNGALIKKLQSRSSGPLSFM
                     QIYDSVCKCVASSGHRRGAQMGVLRVDHPDIEEFIRAKHNEDNLTGFNTSIAITDRFM
                     ECVISGEPFPLTFGGETYRSINAENLWEMIMRSTWDWAEPGTLFIDQINRMNNLKYCE
                     TIAATNPCGEQPLPPYGACLLGSFNLVKYVKPFTGRVFVVGADSRWTFDWDLFATDVY
                     AVVRAMDNVVDRAIYPLFEQEKEAKSKRRMGLGVTALANAAEALGMPYGSIEFLKFEG
                     QVLETLACNSYQASVELAQEKGAFPLYDERYLDSEYVRQVLPEELQEDIGRYGIRNSH
                     LTSIAPTGTISLTADNVSSGIEPVFSYGYDRTVHMPDGVRTERVDDYGVRVFGVEGKT
                     SDQVTAEEHVDVLTVAQGFVDSAVSKTCNVAPDMPWEDFKQIYFRAWEGGAKGCTTFN
                     SGGKRFGVLRSDDDDQSNIEGEACYIDMETGRRECG"
     gene            10494..10916
                     /locus_tag="JL001p15"
     CDS             10494..10916
                     /locus_tag="JL001p15"
                     /codon_start=1
                     /transl_table=11
                     /product="gp15"
                     /protein_id="AAT69491.1"
                     /translation="MEMFVESQVVTPSYSMLTLTDEYMPLLTDGPSNTIRKLSEKYEN
                     MMPGQMVEMTYVPAEYVTEDGKVVEGAILATERLTVSGVVIAPYQQIIAHHLFMNHGA
                     LADQATDHFEKIGKTREFFEKCYGEVNDLDMYMAIYFA"
     gene            10929..11507
                     /locus_tag="JL001p16"
     CDS             10929..11507
                     /locus_tag="JL001p16"
                     /note="similar to Mycobacteriophage CJW1 gp114 encoded by
                     GenBank Accession Number AY129331"
                     /codon_start=1
                     /transl_table=11
                     /product="gp16"
                     /protein_id="AAT69492.1"
                     /translation="MEKNPKDIAATSRVPLHLLPHIGRVWGAMACRDGAIKYAPYNWR
                     DKPISMMEYLGALERHIAALAGGEWFSPDTDPPVPHLGHIIATAAILLDAEACGTLID
                     DRPEKNGAVPQLLVDLREILENMNNAKDTSGGNGTGTEDEPEGSTVPEAEELGGIQAL
                     SANGVDGGRVLEVVRPSELPDDLSGEGSQSKG"
     gene            11578..11778
                     /locus_tag="JL001p17"
     CDS             11578..11778
                     /locus_tag="JL001p17"
                     /codon_start=1
                     /transl_table=11
                     /product="gp17"
                     /protein_id="AAT69493.1"
                     /translation="MFVGRQVAEAFGFRREKLDWFQWTVCDFWKYRCSVIPHTSGCNH
                     FWNSPENREQAQKFFQEIISSK"
     gene            11832..12287
                     /locus_tag="JL001p18"
     CDS             11832..12287
                     /locus_tag="JL001p18"
                     /codon_start=1
                     /transl_table=11
                     /product="gp18"
                     /protein_id="AAT69494.1"
                     /translation="METTMYTIDTMGEKHEIEKKEDLEAVSTKVLVNEYNLLAGKSIK
                     KFSDRATAISRVWELIQGVDVAPKDIPTKSQSTGRKSALNKLAVIRVTADENPKRPGS
                     QAHANFEKYEDGDTIESVQKKGVTLADIRWNLSKGFIELEEPTKDEEAE"
     gene            12271..13137
                     /locus_tag="JL001p19"
     CDS             12271..13137
                     /locus_tag="JL001p19"
                     /codon_start=1
                     /transl_table=11
                     /product="gp19"
                     /protein_id="AAT69495.1"
                     /translation="MKRLSEFFAFARERHQIYRRRSEGIEGPWTTDPILQDYRFTNVF
                     RELDKTTVWFRENVREPLRDDRRVLIATIAFRWFNRIETGEILAGQPRPEVPAGLNNL
                     FLEWNSEYARNRLAQSRDPWVTGAYIIKTPNGMNKLDGVLWCVDQCAADIDRLYREMS
                     ATSLQSAWKSLKEMPYMGPFMAYEVVTDLRHTHMLENADDIDLWANPGPGARRGLSRL
                     LGLDKDTFKSEDPDRCNILMRKILGRSRDPKNWPPFWGRWSMREVEHTLCEWDKYDRV
                     KQGEGKPKQRFP"
     gene            13134..13490
                     /locus_tag="JL001p20"
     CDS             13134..13490
                     /locus_tag="JL001p20"
                     /codon_start=1
                     /transl_table=11
                     /product="gp20"
                     /protein_id="AAT69496.1"
                     /translation="MSQLWEILVPCNWNDGRPVRTRHHREWDRRVRSETGGLTVLAPG
                     KGQWEHEGVLYRDRVIPVRIMATEEQMRRVADITIQHYEQLAVMFYLVSERAFIQDAT
                     EEQQSKFIRGFTSEPA"
     gene            13487..13622
                     /locus_tag="JL001p21"
     CDS             13497..13622
                     /locus_tag="JL001p21"
                     /codon_start=1
                     /transl_table=11
                     /product="gp21"
                     /protein_id="AAT69497.1"
                     /translation="MRLERESIMLEILVKSVIFCGCVLAMFLVGTVVVMIGLPLV"
     gene            13637..14455
                     /locus_tag="JL001p22"
     CDS             13637..14455
                     /locus_tag="JL001p22"
                     /note="gp22; similar to Enterobacterio phage T6
                     Beta-glucosyl-HMC-alpha-glucosyl-transferase: SwissProt
                     Accession Number Q06718"
                     /codon_start=1
                     /transl_table=11
                     /product="glucosyl transferase"
                     /protein_id="AAT69498.1"
                     /translation="MKVFIPSLGRADMLMERGTVANLPQRERIQHTYLVCQHHERKAY
                     EKVCDKWGTNLMVLDKKIKRIVPTRHMIGQVCEKEGFDKFMMLDDDLEFYIRQRQWEQ
                     TDDWWKLTVPSGAELSKLFHLMSDDLDTVEHVGISGREGNNRVREAWVYNTRYMRALG
                     YQTDAYLACEHNRVQVMEDFDIALQMLKQGWQCKVWYEYAQGQTKTQAAGGCSVWRTH
                     KVHNAGAERLAKLHPGFVRVREKQNKTDREGFGTRKEVTVLWKKAYESSQEKEK"
     gene            14472..15071
                     /locus_tag="JL001p23"
     CDS             14472..15071
                     /locus_tag="JL001p23"
                     /codon_start=1
                     /transl_table=11
                     /product="gp23"
                     /protein_id="AAT69499.1"
                     /translation="MNNSQRDKLVRLILSETFSEEECVLWDECAAIGSAVYDDLYTVR
                     ERDLMADLPDGWLPTVGNLEVRFATDHTRIDFNGDMYGYGDERTKFFTRDSVFRAVSS
                     RHKGSCVKVYDANHELCVRWREFESAKKAYLGRVAELRTETKAVIYSCTTTNSLVSKW
                     PEVAPFVKALNIPAPVDKLPATRIDNLSVRLGLKEERAA"
     gene            15068..16120
                     /locus_tag="JL001p24"
     CDS             15068..16120
                     /locus_tag="JL001p24"
                     /note="gp24; similar to Bacteriophage SPO1 Deoxyuridylate
                     hydroxymethylase: SwissProt Accession Number P31654"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="AAT69500.1"
                     /translation="MKVIRARNVNDALPRGLAYLRESGLTRETRNGGAVVAPEPVTTV
                     YEQPRERVLFSKLRDANPFFHLFEALWMLAGRHDLAFVEKFAKNMRSFSDDGETMWGA
                     YGWRWRTFFDFDQLSWAVHRLRRLPNDRRVVVQMWAAGLDQERADAGGKDVPCNIAIH
                     FRINDRGQLDMTVWNRSNDIIWGAYGANVVHMSILQEYVASAVGVEVGRYWQVSDDYH
                     AYSDLFNKMLPLMSASGVAPDDMYLAGVSEPTPLMEQPESWQTWDQDLVMFLDEPGAV
                     GFRNAFFRKVCVPMMMAHKAYSQGRGEARYADAVEILSQMPPYNDWRIACMNWIQTRW
                     DKYKKARDDGPNHDEV"
     gene            16095..16688
                     /locus_tag="JL001p25"
     CDS             16095..16688
                     /locus_tag="JL001p25"
                     /codon_start=1
                     /transl_table=11
                     /product="gp25"
                     /protein_id="AAT69501.1"
                     /translation="MAPTTTRSERLKALREGGWVDRCHTLLKTRRYDVAQHSWNMLNL
                     ALVLFPQHCHPDLIKAIQWHDVPERWVGDSPWPAKHPLSGSELAILLGSMEHRIEAAL
                     YISPNLEPIELDVLKICDMLEFALWCQEEWLLGNTHIEHHFRTAMDVCRTMKLWPEIS
                     DVIEELLKEPISEARPWTQKECIGPGGRVDEEEEFPF"
     gene            16685..17113
                     /locus_tag="JL001p26"
     CDS             16685..17113
                     /locus_tag="JL001p26"
                     /codon_start=1
                     /transl_table=11
                     /product="gp26"
                     /protein_id="AAT69502.1"
                     /translation="MSEANKKQVAGSHYRKGGQFQHWDLITHKYGRGYLIGCATKYLT
                     RWREKNVYTGFQRFWCFLVGVRLPTPEDDLRKAQHYAEKLAEFSKNPPAVFDYQTWLR
                     ANGINADDEFAIRKLLEAESSIQYKRAAEVIEQLAFQVKK"
     gene            17110..17361
                     /locus_tag="JL001p27"
     CDS             17110..17361
                     /locus_tag="JL001p27"
                     /codon_start=1
                     /transl_table=11
                     /product="gp27"
                     /protein_id="AAT69503.1"
                     /translation="MNMIDKQRRIQDLSKEVTKVLAGQDLEIAMTVMVGMVGQLVCHL
                     REGNLAEIEKESQAVAINVRRAAIAKAIHDADQKRGNKP"
     gene            17361..19256
                     /locus_tag="JL001p28"
     CDS             17361..19256
                     /locus_tag="JL001p28"
                     /note="gp28; similar to Vibriophage VP2 DNA polymerase I
                     encoded by GenBank Accession Number AY505112"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase"
                     /protein_id="AAT69504.1"
                     /translation="MQLPMFAPESSWQPPDMSTLPSWKGARRVAFDLETYDPHLKDTG
                     PSVRTGGHIAGYGFAIDGGPKHYLPVRHENGDNLDAAQVLRYIKDQFKTFDGELVGAN
                     LGYDLDWAWAEGIDMPLVKAYRDVLIAEPCINENKFFYSLDSVAGDWLGEQKSKTLMI
                     EAARAYGMRKDSELGSYIHLLPARYVGVYGEDDCALPLRILELQEKEIEQQGIQAVWD
                     LESKVLPVLVRMRQRGVKVDEDRLMEVEIRATKERRDASDLITRVTGVAVGPEDAMKK
                     GILVDALRAAGHQLNADDAVDKHFIARHEGHCEVTAALGRLRKWDTLRKLAIDPVKNH
                     MVNGRIHCSFNQMAADKDNGKGTKGARYGRLSCEHVNMQQQPSRDEDIAPIWRRIYRP
                     DDGGLWAALDYSQQEPRMLVHFAEICGMPGASEAAQKYRDDPDTDNHQMMADMAGISR
                     KEAKIIFLGLCYGMGQEKLCHDLQLPTKIIELKKGPRKGQKMVVAGDEGARLFETFHA
                     KVPFVKQMENLCKDRATERGFITTLLGRRCRFKMGDDGLNYWGTHKALNRLIQGSSAD
                     QTKAAMVAADEAGYELQLQVHDEIDLTVESREQAEKIAEIMRTCVEINVPSKVDVEVG
                     VSWGEAA"
     gene            19253..19492
                     /locus_tag="JL001p29"
     CDS             19253..19492
                     /locus_tag="JL001p29"
                     /codon_start=1
                     /transl_table=11
                     /product="gp29"
                     /protein_id="AAT69505.1"
                     /translation="MSVDRFKDWLREAEPGDQIMYMQADYAGRRPEVARFFMDAAEEG
                     KVFLFQKKVREGVYNYFARRVKPSTGKALKPWRED"
     gene            19509..20243
                     /locus_tag="JL001p30"
     CDS             19509..20243
                     /locus_tag="JL001p30"
                     /note="gp30; similar to Paramecium bursaria Chlorella
                     virus 1 dCMP deaminase encoded by GenBank Accession Number
                     U42580"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxycytidylate deaminase"
                     /protein_id="AAT69506.1"
                     /translation="MATVTHTGDDLATCNGYRIGDCVCLADGEMVEITGFWMSDVTHE
                     WKFLYQDGLQQKAKDFGEIDTDTVCPPRVLQDPPDPDQPPLPDAVRKALDNRANVHIR
                     AAKWDRDYLKLAEFWANLKSKDPSTKVGAVVVSEDNRVVGMGYNGFPVGVEDSRERLE
                     DRPTKYMYVVHAEPNAILTAGLQAKGGTLYCTLFPCNECAKLIIQSGIRRVVSWASDN
                     QRWDEAHQVSRIMFDEAGVANELIVP"
     gene            20240..20683
                     /locus_tag="JL001p31"
     CDS             20240..20683
                     /locus_tag="JL001p31"
                     /codon_start=1
                     /transl_table=11
                     /product="gp31"
                     /protein_id="AAT69507.1"
                     /translation="MSEAGFWSSSVKPALFGWDPIRIETPDRDGTPDVNHIHGWLELK
                     QVDSWPVREDTPLRVEHYTPQQRVWHKRRCLAGGRCQVLIKVKNDILLLNGRVASDVL
                     GHLSRGDLIKHAVGHWTTRQKWKKELKNAILSDRPDRQLGLFDSR"
     gene            20742..20972
                     /locus_tag="JL001p32"
     CDS             20742..20972
                     /locus_tag="JL001p32"
                     /note="gp32; similar to Bacteriophage P27 putative lambda
                     repressor encoded by GenBank Accession Number AJ298298"
                     /codon_start=1
                     /transl_table=11
                     /product="repressor"
                     /protein_id="AAT69508.1"
                     /translation="MGLDRRQVSLMEADKVNFAPKRLRGIQVHEKCLIYRRRAGKTQR
                     EVARDLGVSRLWVNKMENGLESCDQLLWYWEQ"
     gene            21078..23321
                     /locus_tag="JL001p33"
     CDS             21078..23321
                     /locus_tag="JL001p33"
                     /codon_start=1
                     /transl_table=11
                     /product="gp33"
                     /protein_id="AAT69509.1"
                     /translation="MSIVPNGRITTTTFRPQHERMLSDWLESRAGHENIYFQVNDTGE
                     KSITKKPTKADIVAADWVHVDVDPSADPSLFDAERKRILKKLKGHSPAPTLIIDSGNG
                     YQAFWKLAEPVRVTSPSEEAWADFERYNRQLETDLGGDHCFNVDRIMRLPGTINVPNK
                     KKRTQGRTERLAKLVHKADQSVELSLFPQAPLLDGGDQGDVGRARVQLSGNLPRLSEI
                     DDLDQHGEVPQYVKMLCVQGLDPDNPDRYPSRSECFWFVLCELVRCEIPDDVIASIMM
                     DPDFLISGHVLDQRNSNGYMVRQLQRAHECAINPALPSLNDNHFVTMVGGKIKVGYEA
                     EDGEISFMDPGSFEKFYSNQRVEIGQTKEGMPITQKLGKWWMEHKDRRSYKDGIVFSP
                     SGEAPPQAYNLWKGFACQAVAGSAHERWLEHVFENVCNGNDEHYKYTIGWAARLVQNP
                     ATQSETALVMRGKEGTGKNTFVGTLGSFFPRHYFESSSSGQFLGNFNAHLRDKVLVHA
                     NEAFFAGDKKHEATLKMIVTEEMMPIEAKGVDITRCPNYLHVVMSSNSDWVVPAGPDS
                     RRFMVLDVSDKRLQDSSYFAKIKNELNNGGRENLLRFLMDYDLSDYNVRRVPITEALL
                     DQRMRTMPKLGQWWMARLDRGYVINPEDGWSRELEVEHVWHSYVKDMQDQSEHYRATR
                     IELGKFLSRACPGIQRKRVQTGGGGKRPVYHLPTLEECRDQFDDVMGGPFEWSATEAD
                     VQDDIPF"
     gene            23407..23775
                     /locus_tag="JL001p34"
     CDS             23407..23775
                     /locus_tag="JL001p34"
                     /codon_start=1
                     /transl_table=11
                     /product="gp34"
                     /protein_id="AAT69510.1"
                     /translation="MDSNDTTVKLAPKALSGELLDLARQIRDIDQSVSDRAEELQKAA
                     QEAYEIFANEQKAFRTEVYDKLVLAAGFELGDDKQYSLDFTYEDADGGAVYLVPKQRD
                     VGQGGMAEMLERALSGAANN"
     gene            23861..24127
                     /locus_tag="JL001p35"
     CDS             23861..24127
                     /locus_tag="JL001p35"
                     /codon_start=1
                     /transl_table=11
                     /product="gp35"
                     /protein_id="AAT69511.1"
                     /translation="MANVMFKHENGDEAQCNITGFKGVIDARADHLYGCNRYHLQPKA
                     TKEGTIPDGAWFDEDGITITKKAKVKGHEPEKGKERGGFIGRDK"
     gene            24124..24435
                     /locus_tag="JL001p36"
     CDS             24124..24435
                     /locus_tag="JL001p36"
                     /codon_start=1
                     /transl_table=11
                     /product="gp36"
                     /protein_id="AAT69512.1"
                     /translation="MRDLRSDEILYDRTGREIKIGDVVRVTMRVPVLNTEYDAYRQAV
                     AIVKLGTRTDRHMDFDPLLMDGNKRLHEVLDGRILEDVEIVQSLDGEHPQRVSILEQA
                     S"
     gene            24432..24911
                     /locus_tag="JL001p37"
     CDS             24432..24911
                     /locus_tag="JL001p37"
                     /codon_start=1
                     /transl_table=11
                     /product="gp37"
                     /protein_id="AAT69513.1"
                     /translation="MTRVGDILYRLTWDMGFGPWHRLWDEDCTEEDDAFKAEVQMETW
                     IVRQVRRRALPEAMRARGFSSLGTPQHVYLRRYDPGHGMKFKMDRATREQVPVFEPFC
                     PECWKTSWKIGEKPKGFRPSKKGAAIAAMAQLKLSTEFQHHPGHGRALLKRMERYKK"
     gene            24908..24997
                     /locus_tag="JL001p38"
     CDS             24908..24997
                     /locus_tag="JL001p38"
                     /codon_start=1
                     /transl_table=11
                     /product="gp38"
                     /protein_id="AAT69514.1"
                     /translation="MTFWRAAAIGVVIAAGYMVGQVIVMLGSC"
     gene            25072..25272
                     /locus_tag="JL001p39"
     CDS             25072..25272
                     /locus_tag="JL001p39"
                     /codon_start=1
                     /transl_table=11
                     /product="gp39"
                     /protein_id="AAT69515.1"
                     /translation="MFYAIKDDHGNWVKSGGETFQQLGRVPTLYSNKPLAEMVVRDYK
                     FISKNSGKNPRRLTIVPFGELS"
     gene            25269..25643
                     /locus_tag="JL001p40"
     CDS             25269..25643
                     /locus_tag="JL001p40"
                     /codon_start=1
                     /transl_table=11
                     /product="gp40"
                     /protein_id="AAT69516.1"
                     /translation="MITYDDPSIGGTNLLPAGNNYHETFRDARTVDWSEPGLRVTRFR
                     IVSDPGFGAWDVSYCHGYIGDEPVHVELPFDQLAKHSFKYRDRDGNIRKGGWKAHLIA
                     WGKKEGVNVSRLGFFAAVSTLN"
     gene            25654..26037
                     /locus_tag="JL001p41"
     CDS             25654..26037
                     /locus_tag="JL001p41"
                     /codon_start=1
                     /transl_table=11
                     /product="gp41"
                     /protein_id="AAT69517.1"
                     /translation="MTDTPTLPDPFQAWVTPSETRDFMPQLNDGARPFWVYVREENYV
                     MCSVVVWATSPSEARTIVANGCQHVRECSREYEEHAGKKSYNRTEKAKRLQYMLSYDH
                     AGVHVQEVLPGTSLNVSWAHNDTVF"
     gene            26037..26282
                     /locus_tag="JL001p42"
     CDS             26037..26282
                     /locus_tag="JL001p42"
                     /codon_start=1
                     /transl_table=11
                     /product="gp42"
                     /protein_id="AAT69518.1"
                     /translation="MFNAAMKTALPRPGWIPYRLRGSWSRGGVPGKQPTDLMVHVAGH
                     GPRRVYHNVYRGGYFIIHRGRRQYVDINEVLRKARGE"
     gene            26285..26467
                     /locus_tag="JL001p43"
     CDS             26285..26467
                     /locus_tag="JL001p43"
                     /codon_start=1
                     /transl_table=11
                     /product="gp43"
                     /protein_id="AAT69519.1"
                     /translation="MVKLFKYIEMAIQPDKETKGCHRYAHVGGDTGVTTLYVQKNSLQ
                     GERPPEIIHVRIEVKE"
     gene            26552..26797
                     /locus_tag="JL001p44"
     CDS             26552..26797
                     /locus_tag="JL001p44"
                     /codon_start=1
                     /transl_table=11
                     /product="gp44"
                     /protein_id="AAT69520.1"
                     /translation="MSHVITLENSKSYATEANLDKALVKLGLAEYTGGEKFACRYIKC
                     QNGEGRWTAIFLISEYFNRNETGGYVGIASQHGFMSV"
     gene            26809..27453
                     /locus_tag="JL001p45"
     CDS             26809..27453
                     /locus_tag="JL001p45"
                     /codon_start=1
                     /transl_table=11
                     /product="gp45"
                     /protein_id="AAT69521.1"
                     /translation="MEKIESFNNNCTLVAVKAVMNGTKTDDEILAAFRGRGYEDNQGM
                     THSKWTGAARDLGLSLRSVALPRRGYKWVSYTSWHGEEWERRVRVKYTLKEFCEAHPR
                     GVFLVSVPGHAFVVVHGQVWDPNCVHQTMARHVEAVKEVLNPPLNEICHDGKIRSLRT
                     GRVGSKSFQRRWSAVAYIQEHGPQTGETLVRETEYTQADFEFDKKRGNLRYETA"
     gene            27658..27921
                     /locus_tag="JL001p46"
     CDS             27658..27921
                     /locus_tag="JL001p46"
                     /codon_start=1
                     /transl_table=11
                     /product="gp46"
                     /protein_id="AAT69522.1"
                     /translation="MSDWEWEQWWRTRGFPELGDYIQVAFTWKVGGEKGVQEGFVTSI
                     NGDYIGLNGESGDPDKNAYAWRKRIVPSKEKEREEIVSPLTLA"
     gene            27965..28141
                     /locus_tag="JL001p47"
     CDS             27965..28141
                     /locus_tag="JL001p47"
                     /codon_start=1
                     /transl_table=11
                     /product="gp47"
                     /protein_id="AAT69523.1"
                     /translation="MQVVQTSTGKVFEGTLVKTNKKGHQKVMFGEWCMELWFDAKGDS
                     KPLAQERSGKFKLV"
     gene            28155..28322
                     /locus_tag="JL001p48"
     CDS             28155..28322
                     /locus_tag="JL001p48"
                     /codon_start=1
                     /transl_table=11
                     /product="gp48"
                     /protein_id="AAT69524.1"
                     /translation="MTSQQMIKRAFGRRLPPLPYTQHSRPTDDESAARIWMGHTYEGS
                     EVQREIEERKH"
     gene            28331..28582
                     /locus_tag="JL001p49"
     CDS             28331..28582
                     /locus_tag="JL001p49"
                     /codon_start=1
                     /transl_table=11
                     /product="gp49"
                     /protein_id="AAT69525.1"
                     /translation="MKHKDGVCYIEATSKSGAKVMAGQLSLRPPYTVNPAPEWRGHVI
                     KAYFNTTDGDSKILEIDPAKKEELLRGKRRSAKTRDEDS"
     gene            28579..28941
                     /locus_tag="JL001p50"
     CDS             28579..28941
                     /locus_tag="JL001p50"
                     /codon_start=1
                     /transl_table=11
                     /product="gp50"
                     /protein_id="AAT69526.1"
                     /translation="MKTLDMKAMNDKFFALYQQAIDLRLKEARWVLDHDTWLELRRGW
                     EWGSFLEFNPDTREFNIMGLECTFVHPEVPELVPDLDPETVMLETTRMPFCLYLRGVK
                     PNCRVVQIDDPDCAEDWK"
     gene            29059..29277
                     /locus_tag="JL001p51"
     CDS             29059..29277
                     /locus_tag="JL001p51"
                     /codon_start=1
                     /transl_table=11
                     /product="gp51"
                     /protein_id="AAT69527.1"
                     /translation="MSAVRLERSIELEIAETLHREMSPFTKRWLKETRFEDIDLHKRG
                     LGRVICHRWPVTETQAHHATLTLWRLLQ"
     gene            29274..29558
                     /locus_tag="JL001p52"
     CDS             29274..29558
                     /locus_tag="JL001p52"
                     /codon_start=1
                     /transl_table=11
                     /product="gp52"
                     /protein_id="AAT69528.1"
                     /translation="MNLHEAIGRAVCGQRILYLVRRHRDGDDIMRRVVRDTHGLAMCN
                     LANLRLHFPGEGLIKFMTDEDIRQGRHRGMLFDETNSLLPGAQAVVRRNL"
     gene            29555..29785
                     /locus_tag="JL001p53"
     CDS             29555..29785
                     /locus_tag="JL001p53"
                     /codon_start=1
                     /transl_table=11
                     /product="gp53"
                     /protein_id="AAT69529.1"
                     /translation="MNLTLREAVDAGVREGLCQSIWQMCSDLDCPACTRARWHQKPWW
                     RRIWLDEPPLPPYNQLMDRFIGEIVKERANVE"
     gene            29808..29990
                     /locus_tag="JL001p54"
     CDS             29808..29990
                     /locus_tag="JL001p54"
                     /codon_start=1
                     /transl_table=11
                     /product="gp54"
                     /protein_id="AAT69530.1"
                     /translation="MAAIRLGRGASPDQIHRIACLHGQVPKERLDAAVMAERSQIQHP
                     PPPADRQRYRRRDDRD"
     gene            30058..30264
                     /locus_tag="JL001p55"
     CDS             30058..30264
                     /locus_tag="JL001p55"
                     /codon_start=1
                     /transl_table=11
                     /product="gp55"
                     /protein_id="AAT69531.1"
                     /translation="MSQASPYNARPNKRWGWGPVGGMGRFGGGWEFCLGVRAGSWTSW
                     YLELGLGMVRLSTHPPHSFKELRR"
     gene            30261..30464
                     /locus_tag="JL001p56"
     CDS             30261..30464
                     /locus_tag="JL001p56"
                     /codon_start=1
                     /transl_table=11
                     /product="gp56"
                     /protein_id="AAT69532.1"
                     /translation="MMGLSLLHWYLIGAICSGEMMIWGMKNPVRTKPGQPVFPSLLLM
                     YLFWPLFWLGAVLGILLSTGKKR"
     gene            30461..31132
                     /locus_tag="JL001p57"
     CDS             30461..31132
                     /locus_tag="JL001p57"
                     /codon_start=1
                     /transl_table=11
                     /product="gp57"
                     /protein_id="AAT69533.1"
                     /translation="MTHLIGIVSYPPHPQSPYFKVHVPQCDGVPLSLKAMRNGKTANM
                     GDVVIVNKTKGGYKGWETEEVVGSTNAPEPSTLAQVAEFHTAFKCSDVDFQTPEEAHL
                     LGEWEGVLQAQADAIKEQARRVGSVRLLRLQLLLEEVAEVSGALAADDPEHILKELSD
                     VQYVLDGAYISLRLAAKKDAAFALVHQSNMTKLQDGEPRKHGSGRVEKGDGYVPADLS
                     GLFKD"
     gene            31498..32127
                     /locus_tag="JL001p58"
     CDS             31498..32127
                     /locus_tag="JL001p58"
                     /codon_start=1
                     /transl_table=11
                     /product="gp58"
                     /protein_id="AAT69534.1"
                     /translation="MWRLRTMAKTPKTRSKNQPRAETTTDNLPATTGSVAHVELEVTD
                     QDLPDKRTKKFMDKPVVEQRRFDDRAAAKFLAYYAQTGRKGASARAAGVSYNVVRHWE
                     VHDDDFGTLVQEAHNDWLELLERELFRRAVEGVLEPVVAGKDPEIVTYVRKYSDKLLE
                     LALKKADPSGYGNREAVNVNVNTGVLVAPESPAKVEDIDLPLEDVTEVK"
     gene            32124..33653
                     /locus_tag="JL001p59"
     CDS             32124..33653
                     /locus_tag="JL001p59"
                     /note="gp59; similar to Methanobacterium phage psiM2 large
                     terminase subunit encoded by GenBank Accession Number
                     AF065411"
                     /codon_start=1
                     /transl_table=11
                     /product="terminase"
                     /protein_id="AAT69535.1"
                     /translation="MSDVSHLAIGGRKVGWAPLPGSQTMVLKCTSIFELLYHGTRGPG
                     KSDTLLMDFAQFVGRGWGLQYKGIIFRQTYPQLEDLITKSKRWFPKIFPGARYNGSAN
                     KWVFPDGEELLFRQFNKPIDYWKYHGQEFQFIGWDELTNWPTLEGYTSMMSCLRTTHP
                     DIPLRCRATTNPYGPGHNVVKFHFELPAKDGIIRRKTYEFEDPETGEPIRKQLCRVAI
                     KGTIWENTILLKAQPNYIAQLKEQADNPAKLAAWLEGSWDIVAGGMFDDVWDPKINVV
                     QRFIIPRSWKLDRSFDWGSSAPFSVGWWAESDGSDFQDSEGRWRSSVRGDLYRVAEWY
                     GWRNRPNEGLKMLAVDIAKGIREREMILFPTRTVQPGPADSSIYDVENGVSIGADMEK
                     KIRMEDGSMKKGIVWTRADKRAGSRKTGWEMMRKMMRDAGPNRDDKGTILGTPREKPG
                     LFVMDNCDQFIRTVPVLPRCEKDPDDVDSDAEDHVGDETRYRVRFVGNRAATGSTTGM
                     Y"
     gene            33653..35212
                     /locus_tag="JL001p60"
     CDS             33653..35212
                     /locus_tag="JL001p60"
                     /note="gp60; similar to Bacteriophage MB78 62 kDa
                     structural protein encoded by GenBank Accession Number
                     AJ245537"
                     /codon_start=1
                     /transl_table=11
                     /product="62 kDa structural protein"
                     /protein_id="AAT69536.1"
                     /translation="MGVDSKHPLYTDNLDQWTQVRDTHEGQHQVKEKGGVYLPPTSGM
                     QQDGMNSANDPGWKQYDAYRLRAVVPDIVRDAVEAMIGVMHHKPPVIELPATMEPLRE
                     KATLRNESLEMLLRRINEEQLITGRLGLLTDMPKAPSQSDQRVQASGPSTTINDLPYI
                     ALYTAEAIINWDKGRSDGIQIQNLNLVVLDESEYERDKDFEWVWQEKYRVLILGEAEV
                     NEPQGQGVYSVGVFRDNQFTFSQGEMVTPSHRGTTLQMIPFTFINSCDIVPEPDQPPL
                     LGLSNLVLTIYRGEADYRQSLFNQGQDTLVTIGANLQDEQARVGANARLDLPTDADAK
                     YIGVDSSGLSEQREALTNDYNRAAQKGGQLLDSVSRERESGEALTVRVAARTATLNQI
                     AITGAFGLQQTLRHIATWIGANPEEVVVTPNLDFVDNTFAPADLVQIMAAKNVGAPIS
                     YETIHMWLQNMDVTELDFEEEIRKIQEEDASLDLGMSNPDDLEEDDDDDGDEDDGSED
                     DGGSDQTGDDE"
     gene            35202..35438
                     /locus_tag="JL001p61"
     CDS             35202..35438
                     /locus_tag="JL001p61"
                     /codon_start=1
                     /transl_table=11
                     /product="gp61"
                     /protein_id="AAT69537.1"
                     /translation="MTNDPTKEEVIAMLHEVISDIKHDRRSFNKALVIFLDDTDCQYN
                     PGFANAGMSMTECIGLCEVMKTIFIGEMGFHDAD"
     gene            35428..36639
                     /locus_tag="JL001p62"
     CDS             35428..36639
                     /locus_tag="JL001p62"
                     /note="gp62; similar to Bacteriophage EJ-1 minor head
                     protein encoded by GenBank Accession Number AJ609634"
                     /codon_start=1
                     /transl_table=11
                     /product="minor head protein-like"
                     /protein_id="AAT69538.1"
                     /translation="MPTDDQIPGMPDNVNEEWLDAMIRHQIGLLRVSGRVRQRIFEIL
                     DATERDIADQIKRRLAKGATTARLEALIKAVRALRSEAWKKSAEVWREEMLSVAREEP
                     KFLSQALRTVSPVQLDLTLPAADLLQSIVTTRPFEGQTMRQWASNIRNSDLRRIERAI
                     RIGVTQGEPTNAIARRVIGTVRQRGRDGVTQITRRNAEAITRTAINGIANQAKREFYK
                     ANATLFEEEIYVATLDSRTTPICRSLDGQRFAIGEGPIPPLHFNCRSLRVAAIDGDAI
                     GSRPQRQFTQRQLLREYARSRGIKAPTRRADLPRGHKGEFDSFARTRIRQLTGTVDAK
                     VSYQDWLTRQSTEFQDDVLGKTRARLFRKGGLRLDRFVNRQGDEIPLADLARRETSAF
                     RAAGLDPEDFT"
     gene            36636..36863
                     /locus_tag="JL001p63"
     CDS             36636..36863
                     /locus_tag="JL001p63"
                     /codon_start=1
                     /transl_table=11
                     /product="gp63"
                     /protein_id="AAT69539.1"
                     /translation="MTPFAFFIMLCAVEGDPTSCRPVMSGFGAWRDRAHCEESIRPLV
                     DDIGNRLARQLGPGVVMAYKCEGQQPKGEDT"
     gene            36860..36976
                     /locus_tag="JL001p64"
     CDS             36860..36976
                     /locus_tag="JL001p64"
                     /codon_start=1
                     /transl_table=11
                     /product="gp64"
                     /protein_id="AAT69540.1"
                     /translation="MTLLQKLQAIATAMSDIISLSGQVQTELTALNTFLDTV"
     gene            37041..37214
                     /locus_tag="JL001p65"
     CDS             37041..37214
                     /locus_tag="JL001p65"
                     /codon_start=1
                     /transl_table=11
                     /product="gp65"
                     /protein_id="AAT69541.1"
                     /translation="MLSEVRDSRTGARDMTRPLSPWDQRPRQRETLREFMKRCTAGNS
                     VGECQRLWNESRH"
     gene            37281..38150
                     /locus_tag="JL001p66"
     CDS             37281..38150
                     /locus_tag="JL001p66"
                     /codon_start=1
                     /transl_table=11
                     /product="gp66"
                     /protein_id="AAT69542.1"
                     /translation="MAEIKEKEMPLTAVMDTLEGVDESIAALYTQKGEKFELTGIAGV
                     KTQADVDRLTTSLNKEREEHKTTKASLGVWGELNHEEVMAKLDKIPELEAAAAGKLDE
                     AAIEEIVNKRVQGTIATQTAPLERQVAALTKERDEFAAQNEGFRSKDRTRNIHDAVRK
                     ELVDKKVIPEAHDDALMLADRIFEVREDDGAIVTRDNVGVTPGITPDLWLQEIQEKRP
                     HWWPASQGGGAGGGQGGGGVGSGASNPFTAEGWNVTEQGNILRLKGREHAERMAKAAG
                     TTVGGKKPAPRKS"
     gene            38296..39420
                     /locus_tag="JL001p67"
     CDS             38296..39420
                     /locus_tag="JL001p67"
                     /note="gp67; similar to Bacteriophage SPP1 coat protein
                     encoded by GenBank Accession Number X97918"
                     /codon_start=1
                     /transl_table=11
                     /product="coat protein"
                     /protein_id="AAT69543.1"
                     /translation="MAGANDQTTQVDDVIVPEVFTPYVQQLTEEKARLIQSGALARNA
                     LMDGLLSGGGLTFNVPSWRDLDNDEENVSTDSIADRIALTAGVSYADIAALNAAIGND
                     STPNDTSSDQEIAVRLSRNNSWNTTDLAAALAGEDPADSIATRVAFYWTRRLQAAFIA
                     TMQGVTKDNAVNDSADYANDITGASFVDGVTNFSAEAYLDTKLTMGDSMEDLSLVMVH
                     SVVYNRMQKNNLIDFIPDARGEVQIPTFLGAEVIVDDGMPNGTAAVQDDGTAGVAGMY
                     ETWLFGPGAMQLGIGSAKVPTEVERQASAGNGGGSETLHSRVEWSLHPVGHAYVAASP
                     ANGGPSNAATTNNLNIATSWNRVYPERKQIKFARLITREA"
     gene            39514..40329
                     /locus_tag="JL001p68"
     CDS             39514..40329
                     /locus_tag="JL001p68"
                     /codon_start=1
                     /transl_table=11
                     /product="gp68"
                     /protein_id="AAT69544.1"
                     /translation="MKPVKTNRRRKLGAWLDAQVAKFGGTATARTVSAVDFSDDVAAT
                     GTLTITAEPTAGETVTIGLVTYHFVDSLNEFSLVPQVLRTGDVGVATQSLLDAINLTE
                     GGDGANYINAPTNQEVTATGRTDTTLTVTAKAAGTSANSIATTETLAFGSWGGATLSG
                     GANGNFLTSVAHGFTSGDGPYEVFSTIALPSGLTSGVGYYVGVLDANTFELFLDADSA
                     GQPGVAAEVDMTDAGSGTITVGAQVTDQSIVEHMRDGETPNALANSTDIDDFA"
     gene            40346..41026
                     /locus_tag="JL001p69"
     CDS             40346..41026
                     /locus_tag="JL001p69"
                     /codon_start=1
                     /transl_table=11
                     /product="gp69"
                     /protein_id="AAT69545.1"
                     /translation="MEIVEALAKLDHKNDDHWTQDGLPRIEVVANISGIKDLKRGQIT
                     DAAPDFVRVGDDTPPTDDQGQPNPASSDPDDEDVGEIESIDDLTDEEILEASVEDLMR
                     SPELADRWQVVVGNILAQWAKDKNAIENKISTLARRADFIYKVRKQQRKAQPNRDLDG
                     VKAVLQRSKEARAKKHARAKAFLESGTTSEDVVTALSLKAPIDAALNQRKPKLGSTRP
                     AMGMPVRK"
     gene            41030..42331
                     /locus_tag="JL001p70"
     CDS             41030..42331
                     /locus_tag="JL001p70"
                     /codon_start=1
                     /transl_table=11
                     /product="gp70"
                     /protein_id="AAT69546.1"
                     /translation="MGTLDSDARNPNAQLQASLFASRERTRLLRGRVLDIPRTHQIVG
                     ASAIATTIPAGSFAARDRVTTFKTRLRFSSALPSGNVFSFGNATGAISMWVSNSAINF
                     RAGGATVNTDASSVSVTINPVAGLDLTVIGMVRLDGLVGLWVVELGLIAWDSTGSFSS
                     FANDVVGDFAQAAAQPLPADVASSGAPANFSVVEPLSVFLGNLPRINVGTARGAPLFN
                     PLQVSGLSLRLDASQADTITLNGANVSQWDDISGNGNNATQITASQQPPYNAQDSRAN
                     GQASVGPTVNTGSVGLELPSLTVTHFFMVIGYEDGTDATFDERGTLVSGPGSFGTERI
                     MGDVGTANLDSTGGGFNFTTQVSINDGAFGAAILPLPLSCCIFVGNVTQAFSLGYNNS
                     AVDRSWKGPICEVLAYNNALMTTEEQSTVAKFLCTKWGIPT"
     gene            42328..42693
                     /locus_tag="JL001p71"
     CDS             42328..42693
                     /locus_tag="JL001p71"
                     /codon_start=1
                     /transl_table=11
                     /product="gp71"
                     /protein_id="AAT69547.1"
                     /translation="MSGARRGPNQGIDFFQSAIVAVTETLTIDGISPVKPHCFLGVEF
                     FADAAGATPATPSAGTLAVDVRTFNNPQHYEAVPSNSIDATAPTTVSWAANTTSARVT
                     PSGIVGAAYYRATVSCNES"
     gene            42696..43718
                     /locus_tag="JL001p72"
     CDS             42696..43718
                     /locus_tag="JL001p72"
                     /codon_start=1
                     /transl_table=11
                     /product="gp72"
                     /protein_id="AAT69468.1"
                     /translation="MSLGTAYGGSTTSSGGGVDTTVETANSSGYMYLQGDATTEGSVR
                     FNASSDIGAGVFEKLENGIWTANTLEMGVDSLFLGPRTGLASIGEYLSVENSNIPDAR
                     RLFPYTVFNGTTIDDLATIPYVTAHLTNVVSVPFDSDETTGTSYSWTFTGTVNAMLKN
                     IYIKIGSVAPTDTVRFFVRDNDENGQIIFDESYPASAFAANSTVALQTTGFFHNKVGD
                     TYYSTFESSQPFSILGSAALQLPYFEVDASFIRDDRLWQASPWEAGTYAVGDYVIEGR
                     VPYICVVAGAQATDFATNSTSWKPINGYDFDDWVTNYGTRAILDENYDLIIDEATLEP
                     VVLEGT"
     gene            43718..45445
                     /locus_tag="JL001p73"
     CDS             43718..45445
                     /locus_tag="JL001p73"
                     /codon_start=1
                     /transl_table=11
                     /product="gp73"
                     /protein_id="AAT69475.1"
                     /translation="MALHKSLTGSAIHVPYAFTYADATARTTATGFETGDIGKLALQS
                     DENSLWMLTAVTPTWVEISGHTAVADAVSLYNSNATLSNAPRNVDWVGTAGGVLFDFF
                     YQDVDTYTLRSAMFIGLASAGMEVATGTGAGFDSGVAGIGLDTTNGIRVTDSINGQGI
                     RNVADYSANADARTLMDKGYIDGAIAAAFTGSVSQALFKGGGGGLLYLQTSSISLLGG
                     ENIGRIFFQAPDEFDEGISRSVGAAIVGKAGGAFSAAANPTDLAFETTNNGTLVERLR
                     IDNQGRIIYGAPSALSNASGMWMMEGPTNDGTVAGPHMSFLVAGDGSPTMHIFPYAHD
                     NMGILFDMYYDGSVFTSADAGTNFCLYKYQDSLWFGSFAGITKDTATGNPQAGGNHSM
                     RIADSGTVHLGTAPATGTVTSFRTGKDGSSYWTGSTSGLPYAQMYSDNDATTTVTIST
                     IDVSVQYTGFAFNGQSNVCVPDHTNDHITPTVAGVYFVTLDMLVTLTSATDIVEAQIR
                     IDNGATLLTEVDMQLRSGSDLSAHGSVSGFISVSGTSTIEVWIRNRSNTNNVFVRDAS
                     LTIFQVGGN"
     gene            45445..45633
                     /locus_tag="JL001p74"
     CDS             45445..45633
                     /locus_tag="JL001p74"
                     /codon_start=1
                     /transl_table=11
                     /product="gp74"
                     /protein_id="AAT69474.1"
                     /translation="MKIDIDDREAQFICDAIDAFVKQHGLAVAGAGLTVVNRIQLAAK
                     AKPPAPEQKEEDTDDAGS"
     gene            45617..46516
                     /locus_tag="JL001p75"
     CDS             45617..46516
                     /locus_tag="JL001p75"
                     /codon_start=1
                     /transl_table=11
                     /product="gp75"
                     /protein_id="AAT69473.1"
                     /translation="MTLVLETGFGVQDANSYVTAAFVTTYLTDRGREAENGWSGLSQE
                     QQEEKCIAATDYIDNRWGNRFKSVRKTRFAGNKAEARATFSAQPADGETVVLGSYTYT
                     FRTALSSLTADFEVLIGASAAETAQNLVYAITENTTDGASTFSTNVLLNQAAWAEIDS
                     TTDTQVNLVAQADGTAGNDIPLSTTAVNITLIMFVNGRDFGSQPLEFPRAGLTNRSGI
                     LVTGIPLDLKQATAEYAVRAVANELFQDPTIDPSGRAVTSEKLGPIQTDYADGGAIDY
                     LIRPYPAADQLLRDYITSAGVTR"
     gene            46513..46905
                     /locus_tag="JL001p76"
     CDS             46513..46905
                     /locus_tag="JL001p76"
                     /codon_start=1
                     /transl_table=11
                     /product="gp76"
                     /protein_id="AAT69472.1"
                     /translation="MTAAQADKAKIQVDAKGRSVTFVQLDTTASDSTKPWRGDTAPRS
                     PAADEEVLSAVFVPATGGGLGLKWVSDQLLKRAEQVALVAPGSAFTKQLENFDEILES
                     DGSRWRIEMVEILQPADVRILYAIGVKR"
     gene            46902..47312
                     /locus_tag="JL001p77"
     CDS             46902..47312
                     /locus_tag="JL001p77"
                     /codon_start=1
                     /transl_table=11
                     /product="gp77"
                     /protein_id="AAT69471.1"
                     /translation="MSLTFTAARDELLTLFQTAWDANSGGVKLYYWDLTDTPPTADEW
                     ARVTVRHTGGNDAALGGRIFERTGFATVQIFTIHGRGLSRADELAKVAVDAFQGQSTP
                     GGIWFRNVRLVEVGQDGKWFQNNVVADFEYTERT"
     gene            47309..48967
                     /locus_tag="JL001p78"
     CDS             47309..48967
                     /locus_tag="JL001p78"
                     /codon_start=1
                     /transl_table=11
                     /product="gp78"
                     /protein_id="AAT69470.1"
                     /translation="MMAVEVAKIDSNVTGLSIAEEETLGTLPSSPTWYTLEPNSYNDF
                     GGSLTLVARNPINTSRQRKKGVITDLDASGGFNQDLTFSNLSFLWEGLFLANKRTKPK
                     NTAGSTTTSLDITGVTATGYTLGTGGGAAYQGGLIILAQGFTNAANNGLKVLSAVATD
                     EIQTSGLVLEASPPAGANVQVVGFEYGSGDADIAYTGGSLPVLQSTTADPTTFNLIPG
                     EFIFIGGDDTGLTGDAFNAAQNNGFARVNSLAASGITLDKTSGGADGITEMLTEAGGT
                     KLIRIFFADVTRNEDSLSTDFNRRSYAVERTLGKPNPTGDNTQVQSEVLRGAIVNEFA
                     LNIAQADKITTDWTLIATNNEQRDGLNPGSGGGDERVLSETVGTVSTIEAATAYNTSS
                     DFTRIKMAEVRPTQSGVANLAAPSPLFAFVTEITLNANNNASPNKAVGVLGAFDVTAG
                     TFEVSGSITAYFADVEATKAVRNNADVTLDIAIVKDFGDGTLARKAGIVMDIPLIALG
                     DGRLNVEQDEAITLPLTTDAAEDENFGHTLLVHEFFWLPDAADT"
     gene            48977..49108
                     /locus_tag="JL001p79"
     CDS             48977..49108
                     /locus_tag="JL001p79"
                     /codon_start=1
                     /transl_table=11
                     /product="gp79"
                     /protein_id="AAT69469.1"
                     /translation="MNLDENDLEAIRERVKTRWMSLDRAVQIAILAGLGVLIFAILF"
     gene            49171..49584
                     /locus_tag="JL001p80"
     CDS             49171..49584
                     /locus_tag="JL001p80"
                     /codon_start=1
                     /transl_table=11
                     /product="gp80"
                     /protein_id="AAT69478.1"
                     /translation="MALKLTNALSGYDLAEYVNLDCGAFDLKIQQAAIHNEKFRAAIA
                     KKALIAKKKSLIPDQGSMTGSFEQDVELFIDNVILGWGTRPLIDDDGEPVAFNRENLV
                     EIFTGSREGRILFGKIQSAAVDDTVFAIKEEDLGN"
     gene            49909..50349
                     /locus_tag="JL001p81"
     CDS             49909..50349
                     /locus_tag="JL001p81"
                     /codon_start=1
                     /transl_table=11
                     /product="gp81"
                     /protein_id="AAT69477.1"
                     /translation="MASLREFARRMRVLGRRVEVNGPEIARKAALAVDQAVVTSTPVD
                     SGRARSNWIARVGGPASGTREAFVPGAGGSTGPANAQAAIVAAEGVIRTFDGEGEIHL
                     TNNLPYIARLNTGYSAQAPAGFVDTAIQAGVRRVRRSKILRENP"
     gene            50351..52609
                     /locus_tag="JL001p82"
     CDS             50351..52609
                     /locus_tag="JL001p82"
                     /note="gp82; similar to Bacteriophage phiE125 tail length
                     tape measure protein to encoded by GenBank Accession
                     Number AF447491"
                     /codon_start=1
                     /transl_table=11
                     /product="tail length tape measure protein"
                     /protein_id="AAT69476.1"
                     /translation="MTERIDIVISERGARTVNRSIRDIGTGAEATARRINLLRSALGL
                     IGGAAVIQTFGRLADSFTLIQNRLRLVTTGTENLAEVTDRLFGISNRTRVGFEETGEL
                     YARLAQATKDLGTSQEDLLQFTESLNQAVILSGASAQEAQAGILQLSQGLASGALRGD
                     ELRSVLEQLPAVADVIARSLGVTRGELRQLGTDGEITAEVVLNAFREAAEGLDRDFAT
                     TVPTIGQAFTVLRNNVLQAVGAFDAATGASAAFASAILTIANNIPTVINVIQTIVQLI
                     GVQLARIAIPAAIVAFRALTAAIAANPLGLLLTVIATAISALIAFSDQLNQAGGAFRQ
                     LATTVQAVVQLISSGFQQIFAALQAVFPPLQQFESVWPAIAAAANNAILLIVEGFDIL
                     VAAGAGAVEAIVAAWNNLPGAFIEIATAAIEGAVRVVQAGVNQIIGLINSIPFVDGAV
                     GEVNFSGITDALSGLRESTGSPLATGFSEGFDAQRGQITERLEGIRQTIEATNRLRDT
                     EQELQTTLRGTIDEVENLNTANQNSVAASGAAADALGSGGGGLGGAARSAAKDVEDLA
                     ETVDESSNFMQSALETTFNAASSALSNFVRTGEFDFEQFTRSLLADLTQLAANQLLQQ
                     LLGGGGGGGGGGIFGGLFGGGGGLFGGGGGLFGGLGGLFGFNNGGSILIGGQGGIDNN
                     LLSINNRPVARVSRGETIDVNPRGQGGGNNRPVTVNFAVTTPTGEIPLQTQNQLAAKA
                     VLALNTADRRNN"
     gene            52609..53229
                     /locus_tag="JL001p83"
     CDS             52609..53229
                     /locus_tag="JL001p83"
                     /codon_start=1
                     /transl_table=11
                     /product="gp83"
                     /protein_id="AAT69467.1"
                     /translation="MAFDETRLPDDVERGAQGGPRFKTTVITLSSGFERRNSDWAQTR
                     GEWDVGYGIQDATDLEDVIAFFYARNGRARGFRFKDWTDYVLSRQAIGTTDGSNATFQ
                     LFKRYTSGSTSFDRILSKIVTATTQVWVNNVEAPEGGASTSFAIDTTTGIITLGSSLA
                     AQSGTTVEAACQFDVPVRFGSDALDITAEWADAVGAPNIPIVEIRV"
     gene            53231..55000
                     /locus_tag="JL001p84"
     CDS             53231..55000
                     /locus_tag="JL001p84"
                     /codon_start=1
                     /transl_table=11
                     /product="gp84"
                     /protein_id="AAT69466.1"
                     /translation="MKTITGSLQTHLEGEVTTLATIWRVTRTDGVEFFFTDHDVDITF
                     ESNVYTSSVGYNRSAVDSKTGLSVDNLDVLGFLDSSALTETDLRGGKFDFAEIRIGIV
                     NYADLSQGQLRMRRGTLGEVTYSDVTGTFMAELRGLTQLYSQGAVELYQAECRADLGD
                     SRCKVAISPTVMAANTAYALETNLRGSTLLNLAAPYALLLNFDADANDRSSVGATGTL
                     GTEAALQTTQAQFGAGAIEFSPTATVDPSEAFVSYPDNAAYTIETSPFTIECWVRFKD
                     LTSTDQVFMSHYESGTNNRGWYFSRSGSNLEFGYSPDGSFANLSSVDGAFTWAIDTWY
                     HVAVTRDASNNLRLFVDGTQVGTDIVVTTSIFDAASVVYIGKRRSNGGDDIPLNGFVD
                     DARILVGEALYTENFTPPVAAGVEATTVLAALTTPDFNDRFFEVTTPGTTGFQFPVFN
                     TTIGGTTTWGTAVLTTREAFNKAVTVASVTDNRTFTVTFPNGDDTREIDDWFKYGAVV
                     WESGDNNGLAMEVKSYTAATNTVELFLPMSFTVQVGDTGYMYAGCDRQKDTCVSKFDN
                     IFNFRGEPYVPGQDEFLTYPNAR"
     gene            55006..55434
                     /locus_tag="JL001p85"
     CDS             55006..55434
                     /locus_tag="JL001p85"
                     /note="pg85; similar to putative cell wall-associated
                     hydrolases conserved domain (COG0791)"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall-associated hydrolase"
                     /protein_id="AAT69484.1"
                     /translation="MVTRDDIVAEALSWEGVPWRHQGRTRKGIDCAGLAVLVGSSLGL
                     TTANPTAYPRRPDGSFLRHFQDALEQIPVRDILPGDVVIFSGTDHSHVCHCGIVAVKY
                     NRQSVIHAHATRRKVIHERMWEAESVVGRPVHAFRYPGVV"
     gene            55435..58893
                     /locus_tag="JL001p86"
     CDS             55435..58893
                     /locus_tag="JL001p86"
                     /codon_start=1
                     /transl_table=11
                     /product="gp86"
                     /protein_id="AAT69483.1"
                     /translation="MASLAIAAVGALAAGGLGFSPQIGFLIGSVVGTLLFPPPGQETT
                     TEGPRLGDLSVSASTYGTAIPISYGTVRVSGNMIWSSGIREVKHTETSGGGKGGLGGG
                     PKQTQITYTYFVDMALSFGAGPADAVSRIFADGKIIYDATKAPPSRLSGLRFRFYDGG
                     EDQLPDSIIEASEGSGQVPGHRGLCYIVFDDLPLENFGNRVPNITAEISFNATKTTVA
                     VKGTNIDDSASFQVDILTTDFVRRRAYLDSDGGLRVFDMDTMNEIRQSGSLSDGLGIT
                     TIAGKFTGNIYTGNSTFKLINKYDPESFVRTAFFGTGGFGTSNNTTSFAAPTLLLEGS
                     CYNATGGVRNFLMQKAQFDDLGLLDADSMEYIWHLNQTVGVTGFQTAWDRREGECVFW
                     ISFSESNIITLAKLTVSSNAAYNATFATTVGVSYEPSVATFDLNALSTNGTPSTITGP
                     FLDRDDDGLFWFVAQSGGGSMMIKWIEGQGTIYINQLDNVEPNVQRTQAPMNSDVRNG
                     RLSWLGSNGSACLIVDTSNGTELSTPVDITNAGTFSIGGQQGAFVYDGDAEGFICMDG
                     SAGNSDVVKVFLEQISTQGIALSSIVEDLSTRAGYDTAVDLDTTELTDNVKGYLVSRQ
                     MTYRQALEPLAQAFFFEAVESDDQIKFVKRGASSILTIPQSELIEVGDESEVIPEQRT
                     QEVELPERISVLYMDVDQDYQQGTESSKRVRQPIPAMRSRVETSLALPIVFTATEAKQ
                     ISEKLLFSAWNERTAYRFKLPQEYLTLDPTDIVTVTLDNGTTFLVHVSSITVGADLTL
                     EVEGISESSVTFSSTATSGGGLGFPQKPPASPAATKLFLVNVPLLRDIDDTAGLASRV
                     YYGMSGFQDGWDGGSLLQSLDSGSTFDEISRALAGTDWGVTINALPATTTPFQTDETT
                     SLEVFMQVGELSSVSQEQFLADANVALVGSPTTNVWEVIAYRDVTQNTNGTYTLNGLI
                     RAKRGTDPFVNSHAVSEFFLPLNSSNFFAFLLPLAQRNNSLPYKGVGFSQIQEDVNAE
                     TFVGLARDLMPYAPAQQTAVLNASDIDISWVRRTRIGGALVDGLGTVPLGETTEAYEL
                     DIYNAAGDTIVQAVTGLTSPTYTYPAADITADFGTTPSELTLEVFQISEAVGRGFTNR
                     VTIPVE"
     gene            58897..60360
                     /locus_tag="JL001p87"
     CDS             58897..60360
                     /locus_tag="JL001p87"
                     /codon_start=1
                     /transl_table=11
                     /product="gp87"
                     /protein_id="AAT69482.1"
                     /translation="MTNNLSVTQLTTNQDNKETTINDANGELDAAITATITKTIDNTN
                     AGTVTQAELQRAASILVADDGASPPTAGITLTFASFERGNFVVVNTSAQAVTVTISGQ
                     TETAPVLAAGETFTLNMTGGNIRSAGGGSGGGGSSTLLGLTDTPGSFTGQSGRVLKVN
                     VGEDAMEFADDDNTGGGSGTTIVGPTVSTLLPPFRVAPPDPADFATVLNSPTVTQPDT
                     ITTNLSGAADASLVRARLTTVPVGDFTIDARLRSDAASTFNGGGIVLRDTLGAITMFG
                     FVFATPLSVEVGEWTDQTTFSAGQGTISDEDGDYEYFRITVVGSTITYLASKDGLVYD
                     TIHTDSFLGTLQDYGFGVGNRNAVTATEIDVTLWIDGNNDGNEIAVFAAPTSVSLNTQ
                     TASYTLALEDAGANVRMNVAGANNLTVPPNSTVAFPTGTVISARQVGAGQTTIVAGAG
                     VTINTPETLLCRKQGSTVSLVKVGTDEWDLTGDLQLA"
     gene            60365..62989
                     /locus_tag="JL001p88"
     CDS             60365..62989
                     /locus_tag="JL001p88"
                     /codon_start=1
                     /transl_table=11
                     /product="gp88"
                     /protein_id="AAT69481.1"
                     /translation="MLQNLFLGTVSAAALSASAGNQFVSVASWTGTNESGSWTGFTGR
                     IVIQPGALGFQSASQIKLTFTSHSTQGMIVTSCYIAHGSLTGNAYDFVETPTQVRFDG
                     GNANFAIGAASSIVSDVIDFEYNGTSPLVVSFWCDTGNGAQDSFTSLEVANWECYFLA
                     GDNAATVAPAGVWSTTTLSGVGITNVEMVQTGDPLFGEVVFLSNFEDADLSTPEFLDE
                     SEQRNANTWPSIDTAVASISTTQSRFDNAAYKNLSSGISGNTHATQIDEAVPTLFPES
                     GEDFTWEGWAYIDGSTVRSGQGDFFGSFGTSGNRGYILAFNEDELRVLYATSGSAFST
                     LTYATTFQGNIWYHIAFVKEGLDMEVFLDGVSLGTQTMSAWHRPSTRSIEFGSHESGN
                     GNGLGGYLDDWRFTKGIARYTAGFTPPTTLYPRAQAADPIFSEVALLMGFDFGLVDES
                     DFARDVERFGGAARTSVTTLNGTGSLLLDGDGDYLEFDHATELSAANAVDKTYECFIR
                     VDSLAQINTIFCKRNTTVSGTDGEFLLLLETDGTLGFFTFDTMSTADVAIEPTDVLAV
                     DTVYHIAVTREGTTWRMFLDGVQIGTDTETATPGANSGPLWIGRERTHPGREFTGRID
                     EVRITHGTARYTANFAPPIGKFPRNATKDANITSVALLLGFDAQVDTDTAVTDESPNR
                     ATVTFNGASAQVDDAQSRFGGKSLVLGSDAYISVPDSSKFGVDNSNDKTYECWIRTTS
                     LAATQSIFNKRDASAAEEFRLIVPTSGLLRLDTYDGSTEDVSITGTTVMAVDTWYHVA
                     ATRQGGVWRIFVDGNLEASGTEAATPAGNTGDLRIGSSAFNSSRFFVGNIDEIRITDG
                     VARYTANFTAPTQKFPRT"
     gene            63040..63306
                     /locus_tag="JL001p89"
     CDS             63040..63306
                     /locus_tag="JL001p89"
                     /codon_start=1
                     /transl_table=11
                     /product="gp89"
                     /protein_id="AAT69480.1"
                     /translation="MLTLNTGLGFPAMVTMAILGLGTDVLGILAGAYASLLATWAVAA
                     GIRQWGKSNGSEKETWVSYSASEVEVDSKGSTRTSFELSSEQSK"
     gene            63312..63632
                     /locus_tag="JL001p91"
     CDS             63312..63632
                     /locus_tag="JL001p91"
                     /note="gp90; similar to Bacteriophage P27 putative
                     endolysin encoded by GenBank Accession Number AJ298298"
                     /codon_start=1
                     /transl_table=11
                     /product="endolysin"
                     /protein_id="AAT69479.1"
                     /translation="MDFTVLEGVRSLARQKQLVARGASKTMNSRHLPKVPKGGGEPVA
                     HAVDLGAYVDGEVRWDWPLYHKIAKAVKQAARELNVPIEWGGDWRTFKDGPHWQLPWK
                     THPA"
BASE COUNT        13399 a        19867 c        19673 g        10710 t
ORIGIN      
        1 atggttgaaa tcacagtgac tggcggtggc tcgaccaccg tcgacgcgga gagtgccact
       61 gtcaacgtga acggcgacgg agacaccatt gtcaatgaag tgcagatggt tggaggcatt
      121 ccagtgtaca ctgatcttgc tgaactgcca gtcgacggat ctgtattgat agctattttc
      181 caaccagaat ttggaatcta taacggagga gatgacacca tctacaacgg tcttctgttc
      241 tatcagggtt tcaccactgg taatttcggt gattcgacag ccagctttga tgtttgggat
      301 caagctgcca aaacgagcgt ttcaaccgtg atctctccta atggttggag agctgttggg
      361 ctggcacaat cgtgatctgg cttctaaaga actggcgaaa ggtggcgatt ggcttggcag
      421 ccgtcgccat cttgggtatc atcagtgcag gttacatcca ctacacagga ctggtgaacg
      481 aaaatgcccg gatcaagcaa gaaaaagtca tcctcgaaaa agacctcgag tcgcagagga
      541 tcacgatcgc ggcgcaagta gacgcgatcg acatgtggga ggccggtgcc gagaggctcc
      601 gcctggaact ggagagacag agagaggtcg aggcagatgc tcgcgcagag gctgacaggt
      661 tgcggaggct ttttggagag cacgatcttg acgctctcgc aggagcccgt ccggagtcta
      721 ttgagaggct tgtcaatcgt ggctctgctc gtcttgggcg cttgctcgag tgtgcctccg
      781 gagcggtcgg tcatccagag tgtccaggtg aagacgccca agacacagac gcttcccaag
      841 ccaacgccaa ttgacctcgt cgacgtcaag tggatcatag ttcgaaccga gggcggggtc
      901 gtgatggccc tgacacctcg gcagtatcaa aatctgtcaa acaacctggc cgaggtcctc
      961 cgctacgtca agcaggcgga ctctcagctc gactactatc ggcgggaact tggacaatga
     1021 gtgacgatcg ggtcatacac ctcacagagg cgcagttgaa agagataatg gaagaggccg
     1081 tcaacgaggc cctcatcaag attggcgtgg acccctccga tccgatcgag gtccagaagg
     1141 acatgcagca cctgcgtgac tggcgccagt ctgtcgaaag tgtgcagaag cgtggcctca
     1201 tggtcatagt gtccactctc acggccggac ttctggccgc cctgtggatc ggcttcaagg
     1261 aactcacgaa gcagtagccc aggagacaat gtcatgtcac agctgaagga acaggttctg
     1321 gaggcgtggc atcgccttgg cagcaaggcc gccgtcgcca gagagctcgg gatcaacccc
     1381 aagacagtct acaagcacct gaagaacgcg gggatcggag acacgccggt cgccacgggc
     1441 cgggtgcact acctgccacc gcaggagaag gagctgcctc ccgagggcga ggtggcccgg
     1501 tacattctca catgcgctca gaacaacacc aaactgcaca agcggttctg ggactcgctc
     1561 gtcacgtacg ccaaccacct cggcgcggag ctgatggtgt cccgattcac gtacaacaag
     1621 gcatcctact cctccgccaa gtcggtgaag cctggcaagg ggccgacctc cgacgacaag
     1681 gacaaggcct ggtgggaccg ggagctcgac ccgtacatct gcgacgacgc catggacagc
     1741 tccggccggt ggcaactggc cccaggcctg ctctggtgcg cggagatgaa catcctgccg
     1801 accgccgcgc gacccctgtc cgggcttcag acctacaccg gctctgactc gggcatcttc
     1861 ccccactcca agattgcgat ggagtcagtc gccacggcgc gctatgagcc ggcaaagttc
     1921 aactacacca ccggctgcgt gacccagcgc aactacatag ccaagaagac gggcctgaag
     1981 gcagagttcc accacaccta tggcgcgctg atcgtggagg tcctctcaga cggacgctgg
     2041 tgggtcaggc agctcaacgc tgacgcgagg ggccggttct acgactgcgc cgagcaggtg
     2101 gtctttgtgg agccggacag ggtcactcct gtcacgcagg tggcagccgt caactggggc
     2161 gacgtgcacg cctccgagat cgacgaagac gtgaagatcg ccaactgggg cgagggcggc
     2221 atcatagacg tgctccggcc aaagaagcag atcatgcacg acctgctgtc gttccggtcg
     2281 cgcggccacc acgacatgaa gagcttcggc gtgatgtatc agaagttcct cggcggggag
     2341 gactccgtcg aggacgaggt caaccagacc aaggccgtcg ccgacatggc ccaccgagag
     2401 ttctgcgaga tggtggtcgt caactcgaac cacgacaggc acggggaacg ctggctggac
     2461 gaggccgact atcgcaagga cctgctcaac gcggagtact tcctggaggc gcagctcgct
     2521 cggatccgag cgtacaagat gggagctccc tgggacttcc acaagtggtc cctgcagcac
     2581 gccggggtct ccaggcaggt ccggttcctg gagcgcaacg agtcgtacca gatcctcggg
     2641 atcgagtgcg gcctccacgg cgacgagggt ccgaacggaa gccggggaac caccgccaac
     2701 ctgtcccgcc tgggcgctcg tgtaaacaag ggtcacgacc actccgccgc catcctggac
     2761 ggggtctact cggcgggatc ctgcgcggtc gacctgccat acatgaacgg tccaagcagc
     2821 cactcggcgt cccacattgt gacatatccg aacggcaagc ggaccatcat aacgctccga
     2881 ggtcgcgact ggcgggccgc cggacctgac tcgaagtccg agcggacctg acgggacctg
     2941 ataaagtacc ttttaggaaa ctcgtccaag ccactgacat tgcgtgagaa gcccaggagc
     3001 ggacctgatg gacctgacgg accggtcagt ttcgggtccg ctggactttc gcagttttta
     3061 tattctatac tattttatca ggtccatcag gtctatcagg tactgtattg ttattgcttg
     3121 acaatctcgg acctgacgga ggacacccat caggtccgtc aggtccgcca cgctgaactt
     3181 ggcccgctcc ctcccttggg ctatgctggg ctctagaaac ggagaagcag aatggaacac
     3241 tatccccaca caatgccgcc cttcaatcac caggaggagg agctcgacca gcactgggac
     3301 aagccctggc gagccatctt ctgggagcag ggcaccggca agatgaaggc gggctacgac
     3361 ttcgccctca cgcagtggca ggcgggcatc attgacactc tgatcgtcct cgcgcccaac
     3421 ggtgtccacc gggactgggt cgaggagggc ttcaagaagg gcgacccgaa caatccgttc
     3481 aaccagccgc tcgtccctcc cgagtggcac gaccagatcg acgcggcctg gtaccacggc
     3541 ggcaaggccg ggaacaagtc gcaccagaag aagatgcgtg acctcttcta ctcgaagaag
     3601 ttcgtcgtgc tgacgatgtc ctacgactcc gccaagacca agaagaacaa ggcgtccggg
     3661 tggatcggtg gcaagctgtt cctggagaag atgctccgtg agcgacggtg cgcgttcatc
     3721 ctggacgagg cctcctgcat ccagtcgccc acctcgcaga tcaccaagac gctcgtcggg
     3781 cgcggtggca agggtggcat cgcccggcac gcggtctcgc gtcgcatcat ggagggaact
     3841 ccggtcgacg aggggccgtt caacgtctat ccccagatgc agttcctcga ccaggagttc
     3901 tggaaggacc ggggcttcgc gtcgtgggcc tcgttcaaga cctacttcgg cgtgtggcgg
     3961 gagggcttca acggtgtgac caacaagtcg tttcagcagt gcgtcggata ccagaacctg
     4021 gacgagttga aacgcatcct caagccacac agctcaaggg tcctgaagaa ggacgcgctc
     4081 gacctccccg acaagctcta ccagcacgtt cgcttcgaga tgtctccgga gcagtggaag
     4141 atgtacgagc agatccgaga ggagctcatg gccatggtcc gggcggacgg ctccgacatc
     4201 gagaccctgc tgaccgccga gctccccatc gtcaacgtgc tccgcctcta ccagatcacg
     4261 gccggatacc tgccgttcca ggaggacgtg aacggagagc cggtggagcg cgtccacacc
     4321 ttcaaggaga acccgcgcct ggagaccgcg ctcgccgagc tgcgaaggca gacggacaag
     4381 acggtcgtct ggtgtcgatt cacgcgcgac atcgacctgc tcaccgctgc cctgggcaag
     4441 tttgccgtgc gctttgacgg gtccatcagc gaggacgaga gggcccagaa caagcaggag
     4501 tggctcaagg gagacgccca gtacctggtc ccgcagatcc aggcgatggc gaggggacac
     4561 actctcaaca ttgctccata cgtcctgtac tatacaaatg acgccagact cagactgcgc
     4621 aggcagtcgg aggaccgcac ccaccgtggc aagatgaact tctccgttct atacggggac
     4681 atgctcgcct ctgacacggt ggacgagaag cgagtcaagt ccctccggaa gaagctggca
     4741 gtcgcagaga cgataatggg agacaacgaa tgacggtgta cgcggttcag tcgccgagac
     4801 acaggcagca cgggcagatg gtgcccaagt atgacctggc accggccgag gagttcggcg
     4861 aggtggtcga gctcctgtct ccgacggcga agcccttcaa tccgaagccc ctcattgacg
     4921 agctctacgt gaagctggag aagttctccg acgacgacca catcatctgc attggcaacc
     4981 ccatcctgct ctccatggca gtcacgatag cgtccgatgt caacaacggc agggtcaagc
     5041 tcttgcagtg gcacggtcac cagggaaagt acatctctgt gcaggttgac atggggttta
     5101 cttctgcgtc ggacgaggct atgtagttct gaccggccca ggaccctgtc tcttcggaga
     5161 cgggagactg accggaacgc cagacccctc gtctcctgtt cagtccagga cgaggggcgc
     5221 ggcccacagg ggagtctaga gcgtgttgta cagagattgg aagtacgagg cctgtccagt
     5281 ggccgagggg cgagttgacc acaccgccta caatcttgtg acaaagagcc acgtcgcggt
     5341 ccatcaccag ccgacagagg ccatgacaga gtcctccttc aagtttcacg tacagaatga
     5401 cttccgcatg aagcagaacg gcatcaacta ttccaactgg tgccacgcgg acatagaaaa
     5461 ggagagaagc tgtgactgat agcgcatggg ccgagtacgc cgaggaccac caggacgcgc
     5521 cacccgccgc tggcagcaat gccaaggccg tcctcgagac acaggtcaac gagatgtggg
     5581 aggccgagaa ggaggtcgcc gctctcgagg ccaagctcaa ggaggccaag gaacgcctcc
     5641 ggaagtactc cgaggagacc attcccaaca ccctcgagga catgggactg gaggaggtca
     5701 cagtcactgg cggcctcaag gtcaagatcc ggacgtctgt gcacgcgtcc cccaagaagg
     5761 agaaccgcga ggcggtctac gactggctgg agaagcacgg gcacggtggt ttgatcaagc
     5821 gccacgccat cttcacggtc ggtcgtgaca acgagcggca ggcgaagtcc tggatcaaac
     5881 gaatcaaagc cttccccgga ctgttcgagc gcaaggtgga gtcagcgacg ctgcgctcct
     5941 ttgtgaacca gtccatagag gagggcaccg aaattccgat ggagctgttc ggagcctaca
     6001 cgaggcgtgt agccgaagtg aagtcgggat gaggggcgat ctagccccac ccagcaacca
     6061 agcgaaagga aagagcaatg gctacaaagg cagttgcaaa gaaggaagag acggccctgg
     6121 ccgaggcatg gggcgactat gccggagcca cgggctacga ggacgcggac cgctctgaac
     6181 ttgcgatccc gttcatcaac ctgctccagt ccaactcgga gctggtcgag gagaacaagg
     6241 cgaaggccgg acagttcttc aacaacgtca tggagaccat ccacgactcg ttgacgatca
     6301 ttccgtgtgc tcgccagcgt gtcttcgtcg agtgggtccc gatcgatgac ggtggcggtc
     6361 tcgtcgctgt ccacgagccg gactccgcgt tcgtccagaa ggcgatcagt ctgaacgacg
     6421 gaagcacacg ggacatcaag gtggccgatg gcaagcacga gctcatcgag accatctacc
     6481 tgtttgtcct ggtgctcgac gaagacggca atgccgagcg cgctgtgatc tccttcagct
     6541 cctcgaagct gaagaagtat cgtcagttct tcacaaaggc cacctcccag accgtcgctg
     6601 tcaacggacg caagatcaag ctgcccctct gggcgcatcg ctggactgtt gtgtccgagg
     6661 acgacgtctc caagaccaat ggcaggaagt tcaagaacat ctcactccag tgggatgggg
     6721 acaccgcgaa agagtgccgt ctcacccctc gggacgagct ctttgcgatg ggccagggct
     6781 tccatgacat ggtcgctggc ggcgaggcca aggccgacct gtccacggtc gacaaggccg
     6841 agggctcttc ggaggacgga gaggagattc cgttctaggg cgctgcccct gacctaggac
     6901 ggatcagagc ggccccggcc ttgcctcccc agccggggcc gttccccaag ttcaatagaa
     6961 atggagaaca cccatgccga tagtcaccac ccacgagaag tcaccgacgg agttctcgtc
     7021 gttcgtcgtc cacatggcac agctcaatcc gagtggcttc cgccagcctg ggcgtcgccc
     7081 cggctccacc tccctccccg aactcgccat gctgggagcc ggagaggtca agctccacga
     7141 gctccgtccg gagcggtccg agcgctcccg ctggagacgg cgaatggccg agctcacaag
     7201 agagcgcgtc cgcgttgacc aggcgcaggg cctggagctc cggcgcaaca caatgcacgg
     7261 ccgcaatcgc cgccgtcaca tgagatacat cggcctgatg actgggtaca gacagctggt
     7321 cggacagacc gccattgtct ggcttcatcc cggacgagag accgtcctgg ctcagttcga
     7381 cgaaagggag ctggtccacc cgaagacgtt caagaagctc ggctatgaca agcacgagtt
     7441 ccacatctca gacttcgagg acgccgcatg aagtggggag cccaacagaa cacggccctg
     7501 agccgggtcg acgagtggct ggcatccggc cactccccca tattccggct cttcggctac
     7561 gcggggacgg gcaagaccac gctggccaag cacctggccg agggcgtctc gggccgagtg
     7621 aagttcgccg cgtacactgg caaggcggcc caggtcctca gcgagaaggg ctgcccggcc
     7681 accacaatac acaagctgat ctacgtgccc aagagcaagt ccaagacccg gctgaacggg
     7741 ctgcagcagc agcttgttga catggttcgc gacctaagcc agacgctgac ccaggcgcag
     7801 atagaccagc ggtcggacgt gctgaagtgc agggcgcaga tcaaggagga ggaagagaac
     7861 ctccgaggca tgatgttcca gaagaacctg gagtcagagc tctacggctg ctcgctcctg
     7921 gtcgttgacg agtgttcgat ggtcgacatg caggtcggtc aagacctcct ctccttcgac
     7981 gtccccatcc tcgtgctcgg cgacccggcc cagctcccgc ccgtcatggg aggtggcttc
     8041 ttcacggagg ccaagccgga catgatgctg acggacatcc accgccaggc caaggacaac
     8101 cccatcatcg agatggcgac ccgcgtccgc gaggacagag gtctgcccct gggctcctat
     8161 ggagactcgg ccgtgcaccg atttgggacg ccaatggagg acatcgcacg tcgagccgac
     8221 cagcttatat gcggccgcaa caagacgcgt cgagcggcga ataagaggat ccgccagttc
     8281 aagggcttcg agggagacct cccggtggtc ggcgaccggc tcgtctgcct gtccaatgac
     8341 cacgaggagg gcctgctcaa cggccagatc tggatcgcgg cggcggacgc gcaggacgcc
     8401 ggggagacgt acctcctcac agcgtatccc gaggacaacg aagccaacgt caaggagatg
     8461 acggtgtggg cgacggagcc ggactggcac gagcgccgag aggcccagtc gtttgacttc
     8521 ggctactgtc tgacgtgtca caagtcccag ggcagccagt gggaccacgt catggtcatg
     8581 gacgagagcc gctcgttcaa gaaggatgcg aacaggtggc tctacacggc catcacgagg
     8641 gccgccgaaa gagttgacgt ggtgggaatg tgaccttttc ccgcgcgatc ccaccgacta
     8701 ctctggtggc tttcgaccac ctgtcaagga agaacaaaat gcacggacca acactggcca
     8761 tttcggaaga gattcacgcg gagaagtaca gaggagaggg ggagagcttc agagagggga
     8821 tgggccgtgt cgccaacgcc ctcaaggacg gcgaagagca ctacaaggag ctgcgagaga
     8881 tcctcctcga catgcgcttc atgccagcgg gccgcgtcca ggccgccatg ggatccacta
     8941 agaacgtcac cgcgtacaac tgctatgtgt caggcaccat cgaggactcg ttcatagacg
     9001 gccacggctc catcatggag cgcgccaagc aggccgccgc caccatgcgg atgggaggtg
     9061 gcatcggcta cgacttctcc accctccgtc ccaacggagc cctcatcaag aagctccagt
     9121 cgcggtcctc cgggccgctc tccttcatgc agatctacga ctccgtgtgc aagtgcgtcg
     9181 ccagctctgg ccaccgccgt ggcgcgcaga tgggcgtcct ccgagtggac cacccggaca
     9241 tcgaggagtt cattcgcgcc aagcacaacg aggacaacct caccgggttc aacacctcca
     9301 tcgccatcac cgaccgcttc atggagtgcg tcatatctgg cgagcccttc cctctcacgt
     9361 tcggcggcga gacctatcgg tccatcaacg ccgagaacct ctgggagatg atcatgcggt
     9421 ccacgtggga ctgggccgag cccggcaccc tgttcatcga ccagatcaac cgcatgaaca
     9481 atctcaagta ctgcgagacc atcgccgcca ccaatccctg cggcgagcag cccctcccac
     9541 cgtacggtgc ctgcctcttg ggctccttca acctcgtcaa gtatgtcaag ccattcacgg
     9601 gccgggtgtt cgtcgtcggg gctgactccc gctggacctt cgactgggac ctgtttgcca
     9661 cggatgtgta cgcggtcgtc cgcgccatgg acaacgttgt cgaccgggcc atctacccgc
     9721 tgttcgagca ggagaaggag gccaagtcca agcgccgcat gggactgggt gtcacagccc
     9781 tcgccaacgc ggccgaggcg ctcggaatgc cgtacggctc catcgagttt ctcaagttcg
     9841 agggacaggt cctggagacg ctggcgtgca actcctatca ggcctccgtc gagctggccc
     9901 aggagaaggg cgcgttcccg ctgtacgacg agcgctacct ggactctgaa tacgtccgcc
     9961 aggtccttcc agaggagctc caggaggaca tcggccgcta cgggatacgc aactcccacc
    10021 tcacgtccat cgctcccaca gggacgatct cgctgacggc ggacaacgtg tcctctggca
    10081 tcgagccggt cttcagctac ggctatgatc gcacggtgca catgccggac ggtgttcgca
    10141 cggagcgggt ggacgactac ggtgtccgcg tgttcggcgt cgagggaaag acctcggacc
    10201 aggtcacggc cgaggagcac gtggacgttc tcacagtcgc ccagggcttc gtggacagcg
    10261 cggtcagcaa gacctgcaac gtcgcgcctg acatgccctg ggaggacttc aagcagatct
    10321 acttccgcgc ctgggagggc ggtgccaagg gctgcaccac cttcaactcc ggcgggaaga
    10381 gattcggtgt gctacgctcc gatgacgacg accagtcgaa catcgagggc gaggcgtgct
    10441 acatcgacat ggagacgggc cgccgagagt gcggctagaa caggagaaga gaaatggaaa
    10501 tgtttgtcga gagtcaagtc gtgactccga gctacagcat gctcaccctc acggacgagt
    10561 acatgccgct gctgacggac ggtcccagca acaccatccg gaagctctcg gagaagtacg
    10621 agaacatgat gccgggccag atggtcgaga tgacctacgt ccccgccgag tatgtgacgg
    10681 aggacggcaa ggtggtcgag ggcgcaatcc tcgccaccga gcgcctgacg gtgtcgggcg
    10741 tggtcatcgc cccgtaccag cagatcatcg cgcaccacct attcatgaac cacggcgcgc
    10801 ttgctgacca ggccacggac cacttcgaga agatcggcaa gacgcgcgag ttcttcgaga
    10861 agtgctacgg cgaggtgaac gacctcgaca tgtacatggc gatctacttc gcataggaga
    10921 cctcagaaat ggagaagaac ccaaaggaca tcgccgcgac gagccgcgtt cccctgcact
    10981 tgctgccaca catcggccgg gtctggggag ccatggcctg tcgcgacggt gccatcaaat
    11041 acgcgccgta caactggcgc gacaagccga tctccatgat ggagtacctc ggcgcgctgg
    11101 agcggcacat cgccgccttg gcaggaggcg agtggttctc gcccgacacc gacccgcccg
    11161 tcccccacct tgggcacatc atcgccaccg ccgccatcct cctcgacgcc gaggcctgtg
    11221 gcactctgat tgacgaccga ccggagaaga acggggcggt gcctcagctg ctggtcgacc
    11281 tccgtgagat cttggagaac atgaacaatg caaaagacac ttctggtggg aatggcaccg
    11341 ggacagaaga cgagcccgag ggctccactg ttcccgaagc cgaagagctc ggcgggatac
    11401 aagctctcag cgctaacggg gttgacggcg gccgagtact tgaagtcgtt cgaccgagtg
    11461 aactgcctga cgacctttcc ggggaaggat cccaatcaaa agggtgactt ctttccgatt
    11521 cgcgaggcgc gcaaggcggc cgacatccac aagcagtact tccgtgggcg tcgcgtcgtg
    11581 ttcgtcgggc ggcaggtggc ggaggccttt ggcttccgtc gggagaagct ggactggttc
    11641 cagtggacgg tctgcgactt ctggaagtat cggtgctctg tcatcccgca cacctctgga
    11701 tgcaatcact tctggaacag cccggagaac cgcgagcagg cacaaaagtt cttccaggag
    11761 ataatttctt caaaataggg gtttacttct gaacagtctc gaggtatggt cactccatca
    11821 tcaacgcaga aatggagact acaatgtaca ctatcgacac aatgggtgag aagcacgaga
    11881 tcgagaagaa ggaagatctc gaggccgtct ccaccaaggt actcgtcaac gagtacaacc
    11941 tcctcgcagg caagtccatc aagaagttct ctgaccgtgc caccgccatc agccgcgtgt
    12001 gggagctgat ccagggcgtc gacgtcgctc cgaaggacat ccccaccaag tcgcagagca
    12061 ccggccggaa gtccgccctg aacaagctgg cagtgatccg cgtcaccgcc gacgagaacc
    12121 cgaagcgtcc tggctcgcag gcccacgcca acttcgagaa gtacgaggac ggcgacacca
    12181 tcgagtctgt ccagaagaag ggtgtcaccc tggctgacat ccgctggaac ctgagcaagg
    12241 gcttcattga actcgaggag ccgaccaaag atgaagaggc tgagtgaatt cttcgccttc
    12301 gcaagggagc gccaccagat ctatcgcagg cgctccgagg ggatcgaggg tccatggaca
    12361 acggacccca tcctgcagga ctacaggttc acgaacgtct tccgagagct ggacaagacc
    12421 accgtctggt tccgggagaa cgttcgcgag ccacttcgtg acgaccgccg cgtgctgatc
    12481 gccacgatcg ccttccgctg gttcaatcgg atagagaccg gagagatcct ggcgggacag
    12541 ccccggcccg aggttccggc aggcctgaac aacctcttcc tcgagtggaa cagcgagtat
    12601 gctcgcaacc gactggcgca gtcccgtgac ccgtgggtca ctggcgcgta catcatcaag
    12661 acaccgaacg gcatgaacaa gctcgacgga gtcctgtggt gcgtggatca gtgcgcggca
    12721 gacatagacc gcctctaccg ggagatgtcg gcgacgtcac tccagtcagc ctggaagtcc
    12781 ttgaaggaga tgccatacat gggtccgttc atggcgtacg aggtcgtcac ggacctgcga
    12841 cacacccaca tgctcgagaa cgccgacgac atcgacctgt gggccaatcc tggaccaggc
    12901 gctcgccggg gcctctcccg cctccttggg ctcgacaagg acaccttcaa gagcgaggac
    12961 ccggacaggt gcaacatcct catgcggaag atcctcgggc ggtctcgtga ccccaagaac
    13021 tggccaccct tctggggccg gtggtccatg agagaggtcg agcacactct ctgcgagtgg
    13081 gacaagtacg accgcgtcaa gcagggcgag ggaaagccca agcagaggtt cccgtgagcc
    13141 agctctggga gatcctggtc ccgtgcaact ggaacgatgg caggccggtt cgcacccggc
    13201 accaccggga gtgggacagg cgcgtccggt ccgagacggg cgggctgaca gtcctggctc
    13261 ccggaaaggg acagtgggag cacgaaggtg tcctctaccg agaccgggtc ataccggtca
    13321 ggatcatggc caccgaggag cagatgcgcc gcgtggcaga catcaccatt caacactacg
    13381 agcagctcgc agtcatgttc tacctggtct ccgagcgcgc gttcatacag gacgccaccg
    13441 aggagcagca gtcgaagttt attagagggt ttacttctga gccagcctga cgtagtatgc
    13501 gactagaaag ggagtccatc atgctcgaaa tacttgtcaa gtctgtgata ttctgcgggt
    13561 gtgtgctcgc gatgttcttg gtcggcacag tagtcgtcat gattggactc ccactcgtct
    13621 agaaatggag taaagcatga aagttttcat tccgtcactc ggccgcgctg acatgctcat
    13681 ggagcgcggc actgtggcaa acctccccca gcgcgagcgg attcaacaca cctacctcgt
    13741 ctgtcagcac cacgagcgca aggcgtacga aaaggtctgc gacaagtggg gcaccaacct
    13801 gatggtgctc gacaagaaga tcaagcgcat cgtccccact cggcacatga tcggtcaggt
    13861 ctgtgagaag gagggcttcg acaagttcat gatgctcgac gacgacctcg agttctacat
    13921 tcgccagcgc cagtgggagc agacggacga ctggtggaag ctcaccgttc cgagcggggc
    13981 cgagctcagc aagctgttcc atctcatgag cgacgacctt gacacggtcg agcacgtcgg
    14041 catatcgggc cgcgagggga acaatcgcgt ccgagaggcc tgggtctaca acacccggta
    14101 catgcgtgcc ctgggctacc agacggacgc ctacctggcc tgcgaacaca accgggtcca
    14161 ggtgatggag gactttgaca tcgcacttca gatgctcaag cagggctggc agtgcaaggt
    14221 ctggtacgag tatgcccagg gacagacaaa gacacaggcg gccggagggt gctccgtctg
    14281 gcgcactcac aaggtccaca acgccggggc agagcgcctc gccaagctgc atcccggctt
    14341 tgttcgggtc cgtgagaagc agaacaagac ggaccgcgag ggctttggca ctcggaagga
    14401 ggtcactgtc ctgtggaaga aggcgtacga gagttcgcaa gaaaaggaga agtgaattgc
    14461 ccgcgatacg aatgaacaac agccagcgcg acaagctggt cagattgatc ctgtcggaga
    14521 ccttctccga ggaggagtgc gtcctctggg acgagtgtgc cgccattggc tcggcggtct
    14581 atgacgacct ctacaccgtc cgcgagcggg acctgatggc agacctgcca gatggctggc
    14641 tgccgacggt cgggaacctc gaggtccggt tcgccacgga ccacacgagg attgacttca
    14701 atggagacat gtatggctat ggtgacgaga ggaccaagtt cttcactcgt gactccgtct
    14761 tcagggcagt ctcatccagg cacaagggat cctgcgtcaa agtctatgac gcgaatcacg
    14821 agctctgtgt ccgatggcga gagttcgaaa gcgccaagaa ggcgtacctg gggagagtgg
    14881 ctgagctgcg gacagagacc aaggctgtga tctactcctg cacgaccaca aactccctcg
    14941 tttcgaagtg gccggaggtg gcgccatttg tcaaggcgct caacatcccg gctcccgttg
    15001 acaaactgcc ggccacgagg attgacaacc tcagtgtgcg ccttggcctg aaagaggaga
    15061 gagccgcgtg aaagtgatac gcgctcgaaa cgtgaacgac gccctgcccc gaggtctcgc
    15121 gtacctccgg gagtcagggc tgactcgcga gacccggaac ggaggggcgg tcgtcgctcc
    15181 ggagccggtg accacggtgt acgagcagcc acgggagagg gtcctcttct ccaagctgcg
    15241 cgacgccaat cccttcttcc acctgttcga ggcgctctgg atgctggccg gtcgacacga
    15301 cctcgccttc gtcgagaagt tcgccaagaa catgcggtcc ttctccgacg acggagagac
    15361 catgtgggga gcctacggct ggcgctggcg gacgttcttc gacttcgacc agctctcctg
    15421 ggcagtccac cgtctccgtc gcctgccgaa cgaccgtcgc gtcgtcgtgc agatgtgggc
    15481 cgctggcctc gaccaggagc gggctgacgc gggcggcaag gacgtcccct gcaacatcgc
    15541 catccacttc cggatcaacg accgtggcca gctggacatg accgtctgga accggtccaa
    15601 cgacatcatc tggggagcgt acggtgccaa cgtcgtgcac atgtccatcc tccaggagta
    15661 cgtggccagc gcggtcggcg tcgaggtcgg tcggtactgg caggtgtcgg acgactatca
    15721 cgcgtatagc gacctcttca acaagatgct gccgctgatg tccgcgtccg gggtcgcgcc
    15781 agacgacatg tacctggccg gtgtgtcaga gcccactccg ctcatggagc agccagagag
    15841 ctggcagacc tgggaccagg acctggtcat gttcctggac gagccgggtg ccgtgggctt
    15901 ccgcaacgcc ttcttccgga aggtctgcgt gccgatgatg atggcgcaca aggcatactc
    15961 acagggcagg ggcgaggccc gatacgccga cgcggtcgag atcctctccc agatgcctcc
    16021 ctacaacgac tggcgcatcg cgtgcatgaa ctggattcag acgcgctggg acaaatacaa
    16081 gaaggcgaga gacgatggcc ccaaccacga cgaggtctga gcgtctcaag gcgctgaggg
    16141 agggcggctg ggtcgaccgc tgccacaccc tcctcaagac gcggcgctac gacgtcgcac
    16201 agcactcctg gaacatgctc aacctcgcgc tggtcctgtt tccgcagcac tgccacccgg
    16261 acctgatcaa ggccatccag tggcacgacg tgccggagcg ctgggtcggc gacagcccct
    16321 ggcccgcgaa gcacccgctc tccggctcgg agctcgccat tctcttgggc tccatggagc
    16381 atcggataga ggccgcgctg tacatctcgc cgaacctcga gccgatcgag ctcgacgtgc
    16441 tgaagatctg cgacatgctg gagttcgcgc tctggtgcca ggaagagtgg ctcctgggca
    16501 acacgcacat cgagcaccac ttccgcaccg ccatggacgt ctgtcgcacg atgaagctgt
    16561 ggccggagat atccgatgtc atcgaggagc tgctcaaaga gccgatctcg gaggctcgtc
    16621 cctggaccca gaaggaatgc attggtccag gtggccgtgt tgatgaagaa gaggagttcc
    16681 cgttttgagc gaggcgaaca agaagcaggt ggcgggaagc cactacagga agggaggtca
    16741 gttccagcac tgggacctga tcacccacaa gtacggcagg ggatacctga ttggatgcgc
    16801 caccaagtat ctcacccggt ggcgcgagaa gaacgtgtac acgggtttcc agcgcttctg
    16861 gtgcttcctc gttggagtgc gcctcccaac tcccgaggac gacctccgca aggcccagca
    16921 ctacgcggag aagctggcag agttcagcaa gaacccaccc gccgtctttg actaccagac
    16981 ttggctccgt gccaacggca tcaacgcgga cgacgagttc gccattcgca agctgctcga
    17041 ggcggagtcc tcgatccagt acaagcgagc ggccgaggtc atcgagcagc tggcattcca
    17101 ggtgaagaaa tgaacatgat cgacaagcag cgacgcattc aggacctgtc caaggaggtc
    17161 accaaggtcc tcgccggaca ggacctggag atcgccatga cggtgatggt cggcatggtg
    17221 ggccagctgg tctgccacct ccgcgagggc aacctggcgg agatcgagaa ggagtcgcag
    17281 gcggtcgcca tcaacgtccg ccgcgcggcc attgccaagg ccatccacga cgccgaccag
    17341 aagcgaggga acaagccctg atgcagctgc caatgttcgc accggagtcc agctggcagc
    17401 cgccagacat gtccaccctc ccctcctgga agggagcgcg gagggtggcc ttcgatctcg
    17461 agacctacga tccccacttg aaggacacag gtccctccgt gcggacgggc ggtcacatcg
    17521 ctggctatgg ctttgccatc gacggcgggc cgaagcacta cctcccggtg cgacatgaga
    17581 acggcgacaa cctggacgcg gcccaggtgc tccgctacat caaggaccag ttcaagacgt
    17641 tcgacgggga gctggtcgga gccaacctcg gctacgacct ggactgggcc tgggccgagg
    17701 gcatcgacat gccgcttgtc aaggcgtatc gcgacgtgct catcgcggag ccctgcatca
    17761 acgagaacaa gttcttctac tcgctcgact ccgtcgccgg ggactggctc ggagagcaga
    17821 agtccaagac cctcatgatc gaggcggccc gcgcctatgg catgcggaag gacagcgagc
    17881 tcggctcgta catccacctc cttcccgccc gctatgtggg cgtctacggc gaggacgact
    17941 gcgccctgcc cctgaggatc ctggagctcc aggagaagga gatcgagcaa cagggcatcc
    18001 aggccgtgtg ggacctggag tcaaaggtgc ttccggtgct ggtgaggatg cgacagcgcg
    18061 gcgtcaaggt cgacgaggac cggctcatgg aggtcgagat ccgagcgacg aaggagcgtc
    18121 gggacgcgtc cgacctgata actcgcgtga ccggtgtggc ggtgggaccc gaggacgcca
    18181 tgaagaaggg catcctggtg gacgccctcc gcgcggccgg acaccagctg aacgccgatg
    18241 acgctgtgga caagcacttc atcgcgaggc acgagggcca ctgcgaggtg accgccgccc
    18301 tgggccgcct ccgcaagtgg gacaccctcc gcaagctggc gatcgacccg gtcaagaacc
    18361 acatggtcaa cggtcggatc cactgctcct tcaaccagat ggcggcggac aaggacaacg
    18421 gcaagggcac caagggagcc cgctacggga ggctgtcgtg cgagcacgtg aacatgcagc
    18481 agcagccgtc ccgcgacgag gacatcgccc cgatctggcg gcgcatctac cggccggacg
    18541 acggtggcct ctgggcggcc ctcgactact cccagcagga gccgaggatg ctcgtgcact
    18601 tcgccgagat atgcggcatg cccggcgcgt ccgaggcggc gcagaagtac cgagacgacc
    18661 cggacacgga caaccaccag atgatggcgg acatggccgg gatctccagg aaggaggcca
    18721 agatcatctt ccttgggctc tgctacggga tgggacagga gaagctctgc cacgacctcc
    18781 agctgcccac caagatcatc gagctcaaga agggcccaag aaagggacag aagatggtgg
    18841 tcgcgggcga cgagggcgcg cggctgtttg agacattcca tgccaaggtc ccgttcgtca
    18901 agcagatgga gaacctctgc aaggaccggg ccaccgagcg cgggttcatc accacgctgc
    18961 tcggccgtcg ctgccgcttc aagatgggag acgacggact gaactactgg ggcacccaca
    19021 aggcactgaa ccggctcatc caggggtcct ctgctgacca gacaaaggcg gccatggtcg
    19081 cggcggacga ggcgggctac gagcttcagc tgcaggtgca cgacgagatc gacctcacag
    19141 tcgagtcaag agagcaggcc gagaagatcg ccgagatcat gcggacctgc gtggagatca
    19201 atgtcccctc caaagtggac gtggaggtgg gtgtctcatg gggagaagca gcatgagtgt
    19261 agacagattc aaagactggc tccgagaggc ggagcccggt gaccagataa tgtacatgca
    19321 ggcggactac gcagggcgga ggccggaggt ggcacggttc ttcatggacg cggcggagga
    19381 gggcaaggtg ttcctcttcc agaagaaggt tcgcgagggc gtgtacaact actttgccag
    19441 gcgggtgaag ccgagtactg gcaaggctct caagccatgg agagaggact gaagaaaagg
    19501 agaagcagat ggctacagtg actcacacag gcgacgacct cgccacgtgc aacggataca
    19561 ggatcgggga ctgcgtgtgc ctcgcggacg gggagatggt ggagatcacc ggcttctgga
    19621 tgtccgacgt gacccacgag tggaagttcc tctaccagga cggcctccag cagaaggcca
    19681 aggacttcgg cgagatcgac accgacacgg tctgtcctcc gagggttctg caggacccgc
    19741 cggacccgga ccagccaccg ctgcccgacg cggtgcggaa ggcgctggac aaccgggcca
    19801 acgtgcacat tcgcgctgct aagtgggacc gtgactacct caagctcgcc gagttctggg
    19861 cgaacctgaa gtccaaggac cccagcacga aggtgggagc cgtcgtcgtc tccgaggaca
    19921 accgcgtggt tggcatggga tacaacggct tccccgtcgg cgtggaggac tccagggagc
    19981 gcctggagga ccgtcccacg aagtacatgt acgtggtcca cgcggagccg aacgccatcc
    20041 tcacagcagg actgcaggcg aagggtggca cgctctactg cacactgttc ccctgcaacg
    20101 agtgcgccaa gctgatcatc cagtctggca tccgccgcgt ggtctcctgg gcctccgaca
    20161 accagcgctg ggacgaggcg caccaggtct cccggatcat gttcgacgag gccggtgtcg
    20221 cgaacgagtt gatcgtgccg tgagcgaggc aggcttctgg agcagctccg tcaagccagc
    20281 cctgttcggc tgggacccga tccggataga gacgccggat cgggacggca ctccggacgt
    20341 caaccacatc catggctggc tggagctgaa gcaggtggac agctggccgg tccgcgagga
    20401 cacgccgctc cgagtggagc actacacgcc ccagcagagg gtttggcaca agaggaggtg
    20461 cctggcgggc ggacgctgcc aggtgctgat caaggtgaag aacgacatcc tgctgctgaa
    20521 cgggcgagtt gccagcgatg tccttgggca cctgtcgcga ggggatctaa tcaaacatgc
    20581 cgtgggtcac tggaccacgc ggcagaagtg gaagaaagaa ctgaagaatg cgatactctc
    20641 ggatcgacct gacaggcaac tcggactttt tgacagccgg tgagaccctg ctgttgtggc
    20701 gccgccgccg tggtgagaac cagggacagg ccgcgcgaca gatggggctc gaccggaggc
    20761 aggtgtcgct gatggaggcg gacaaggtga acttcgcgcc caagaggctg cgaggcatcc
    20821 aggtgcacga gaagtgcctg atctaccgcc gccgcgcggg caagacacag cgcgaggtgg
    20881 cccgagacct cggcgtctcc aggctctggg tgaacaagat ggagaacggt ctggagtcct
    20941 gcgaccagct cctttggtac tgggagcagt gaccctatac tggtcgctcg cagaaacgga
    21001 ggcgcgtctt gaaacccaac atccaggaat cgattgactt tctcaagtgg ttccgcccag
    21061 gcggcccgtg ggtgctcatg tcaatcgtcc cgaacggccg gatcacgacg accaccttcc
    21121 ggccccagca cgagcggatg ctgtccgact ggctggagtc ccgcgcgggc cacgagaaca
    21181 tatacttcca ggtcaacgac accggcgaga agtcgatcac gaagaagcct accaaggctg
    21241 acatcgtggc ggcggactgg gtgcacgtcg acgtcgatcc ctccgccgac ccgtcgctgt
    21301 tcgacgcgga gcggaagcgg atcctcaaga agctgaaggg ccactccccg gctcccactc
    21361 tcatcatcga ctccggcaac gggtaccagg ccttctggaa gctggccgag ccggtccggg
    21421 tgacaagccc ctcggaggag gcgtgggccg acttcgagcg gtacaacaga cagctggaga
    21481 cggacctcgg cggggaccac tgcttcaacg tcgaccggat catgcggctg ccgggaacca
    21541 tcaacgtccc gaacaagaag aagcggacac agggtcggac ggagcggctc gccaagctgg
    21601 ttcacaaggc cgaccagtcc gtggagctct cgctcttccc acaggctccg ctgctggacg
    21661 gcggtgacca gggcgacgtg ggccgcgcgc gggtccagct gtcgggcaac ctgccccggc
    21721 tctctgagat agacgacctg gaccagcacg gggaggtgcc tcagtacgtg aagatgctct
    21781 gcgtgcaggg cctggacccg gacaacccgg accggtatcc ctcccgctcg gagtgcttct
    21841 ggttcgtcct gtgcgagctg gttcgctgcg agatcccaga cgacgtgatc gcgtcgatca
    21901 tgatggaccc ggacttcctc atatccggcc acgtgcttga ccagcggaac tccaacggct
    21961 acatggtgcg gcagttgcag cgcgctcacg agtgcgccat caacccggcg ctgccatcgc
    22021 tgaacgacaa ccacttcgtc accatggtcg gcggcaagat caaggtcggc tacgaggccg
    22081 aggacggcga gatatcattc atggaccccg gctccttcga gaagttctac tcgaaccagc
    22141 gggtcgagat cggtcagacc aaggagggga tgccgatcac acagaagctc gggaagtggt
    22201 ggatggagca caaggaccgg cgatcgtaca aggacgggat agtcttcagc ccctccggcg
    22261 aggcaccgcc acaggcgtac aacctgtgga agggcttcgc ctgccaggcc gtcgccggga
    22321 gcgctcacga gcgctggctg gagcacgtct tcgagaacgt gtgcaacggc aacgacgagc
    22381 actacaagta caccatcgga tgggccgcgc gactggtgca gaaccccgcg acccagagcg
    22441 agacggccct ggtcatgcgc ggcaaggagg gcaccggcaa gaacacgttc gtcggcaccc
    22501 tgggctcttt cttcccacgc cactacttcg agagctcctc ttccggccag ttcctgggca
    22561 acttcaacgc ccacctccgc gacaaggtgc tggtccacgc caacgaggca ttcttcgccg
    22621 gggacaagaa gcacgaggcc acgctgaaga tgatcgtcac cgaggagatg atgccaatcg
    22681 aggccaaggg tgtcgacatc acccggtgcc cgaactacct ccacgtggtc atgtcctcca
    22741 acagcgattg ggtggtcccg gccggtcccg actcccggcg cttcatggtg ctggacgtgt
    22801 cggacaagcg actccaggac agctcctact tcgccaagat caagaacgag ctgaacaacg
    22861 gcgggcggga gaacctgctc cggttcctga tggactacga cctgtccgac tacaacgtgc
    22921 gccgggtgcc aatcacagag gcactgctgg accagcggat gcggacgatg cccaagctgg
    22981 ggcagtggtg gatggcacgg ctggacaggg gctacgtcat aaacccggag gacggctggt
    23041 cgcgggagct ggaggtggag cacgtctggc actcctacgt caaggacatg caggaccaga
    23101 gcgagcacta ccgggccacg cggatagagc tcggcaagtt tctcagccgc gcctgtccag
    23161 ggatccagag gaagagggtg cagactggtg gcggaggaaa gcgacccgtc taccacctgc
    23221 cgaccctgga ggagtgcagg gaccagttcg acgacgtcat gggcggaccc ttcgagtggt
    23281 cggcgaccga ggcggacgtc caggacgaca tcccatttta aggggtttac ttctgagcgg
    23341 ttcagaagta tacatatggc actcacaaga gtgtgagcgt ctgtaacaga aagtgagaat
    23401 agaaccatgg attcaaacga cacaaccgtc aagctcgccc cgaaggccct ctccggagag
    23461 ctcctcgacc tggcccgtca gatccgcgac atcgaccagt cggtctcgga ccgggcagag
    23521 gagctgcaga aggcggccca ggaggcatac gagatctttg ccaatgaaca gaaggcattc
    23581 cgcaccgagg tctacgacaa gctggtcctc gcggctggct tcgagctcgg cgacgacaag
    23641 cagtactccc tcgacttcac gtatgaagac gcggacggtg gcgcggtcta cctcgtgccg
    23701 aagcagcgcg acgtcggcca gggcggcatg gccgagatgc tcgagcgcgc cctgagtggt
    23761 gccgcgaaca actgacccgt cccggagggt cagacggagg gccggtgtca cgctcagcgc
    23821 accggccctc tccactccca cacagaaacg gagaacgaca atggcgaacg tgatgttcaa
    23881 acacgagaac ggcgacgagg cacagtgcaa catcactggc ttcaagggcg tgatcgacgc
    23941 gcgggcggac cacctgtacg ggtgcaaccg ctaccacctc cagccgaaag cgaccaagga
    24001 gggcaccatc ccggacggtg cctggttcga cgaggacggc atcaccataa cgaagaaggc
    24061 caaggtcaag ggccacgagc cggagaaggg caaggagcgc ggcggattca tcgggaggga
    24121 caagtgaggg acctccgctc ggacgagatc ctctacgacc gcaccgggcg agagatcaag
    24181 atcggcgacg tggtccgtgt gaccatgcga gtgcccgtcc tcaacaccga gtacgacgcc
    24241 tatcgccagg ccgtggcaat cgtgaagctc ggcacccgga ccgaccgcca catggacttc
    24301 gacccgctgc tcatggacgg caacaagcgc ctccacgagg tgctcgacgg ccgcatcctg
    24361 gaggacgtgg agatcgtcca gtccctggac ggggagcacc ctcagcgcgt gtccatcctg
    24421 gagcaggcgt catgaccagg gtcggcgaca tcctctaccg tctcacgtgg gacatgggct
    24481 tcggcccgtg gcaccgcctc tgggacgaag actgcacgga ggaggacgac gccttcaagg
    24541 cggaggtgca gatggagacg tggatcgtga gacaggtccg ccgccgcgcg ctgccagagg
    24601 ccatgcgcgc tcgcggcttc tcctccctgg gcactccgca gcacgtctac ctccggcgct
    24661 acgaccccgg ccacggcatg aagttcaaga tggaccgggc cacgcgggag caggtgccgg
    24721 tgttcgagcc gttctgtccc gagtgctgga agacgtcttg gaagatcggc gagaagccca
    24781 agggcttccg gcccagcaag aagggcgcgg cgatcgccgc catggcgcag ctcaagctgt
    24841 caaccgagtt ccagcatcac cccggccacg gtcgcgcgct gctgaagaga atggagaggt
    24901 acaagaaatg accttctgga gagcggctgc catcggtgtc gtgatcgcgg ctggctacat
    24961 ggtcggccag gtcatcgtga tgttaggctc ctgttaacca acgcgtgcga agtcgcttta
    25021 cttctgaacg cacgagggct atgatgttct catcagaaaa ggagcaccac catgttttac
    25081 gcgatcaaag acgaccacgg caactgggtc aagtcaggcg gcgagacgtt tcagcagctc
    25141 ggccgcgttc cgaccctgta cagcaacaag ccgctggctg agatggtcgt tcgcgactac
    25201 aagttcatca gcaagaactc cggcaagaac ccgcgccggt tgacgatcgt tccctttgga
    25261 gagctgtcat gatcacgtac gacgatccgt ccatcggagg gaccaacctc cttccggctg
    25321 gcaacaacta ccacgagacc ttccgggatg cccgaacggt cgactggtcc gagccgggtc
    25381 tgcgcgtgac gcgcttccgc atcgtgagcg accctggctt cggagcctgg gacgtgtcct
    25441 actgccacgg ctacatcggc gacgagccgg tgcacgtgga gctgccgttc gaccagctgg
    25501 cgaagcacag cttcaagtac cgcgaccgcg acggcaacat ccgcaagggt ggctggaagg
    25561 cacacctcat cgcctggggc aagaaggagg gcgtgaacgt gtctcgcctg ggcttcttcg
    25621 ccgccgtgtc aacactcaac tgaggaggac aacatgaccg acacaccgac actgcccgac
    25681 ccgttccagg cgtgggtcac gccgagcgag acacgggact tcatgccaca gctcaacgac
    25741 ggagcgcggc ccttctgggt gtacgtgcgc gaggagaact acgtcatgtg ctccgtggtg
    25801 gtctgggcca cctccccgag cgaggcccga acgatcgtgg ccaacggctg ccagcacgtc
    25861 cgcgagtgct ccagggagta cgaggagcac gcgggcaaga agagctacaa ccggaccgag
    25921 aaggccaagc ggctccagta catgctgtca tatgaccacg cgggagtcca cgtgcaggag
    25981 gttctccccg gaacctcgct caacgtgtcc tgggcccaca acgacacggt gttctgatgt
    26041 tcaacgcggc gatgaagaca gcactgccca ggccagggtg gatcccgtac cggctgcgtg
    26101 gcagctggtc gcgcggagga gtccccggca agcagccgac agacctgatg gtgcatgtgg
    26161 caggccacgg gccgcgccgg gtctaccaca acgtctaccg aggtggatac ttcatcatcc
    26221 accgaggccg tcgtcaatac gtcgacatca acgaagtcct gagaaaggcg agaggagagt
    26281 agagatggtg aagttgttca agtacatcga gatggcgatc cagcccgaca aggagacgaa
    26341 gggttgccat cgctacgccc atgtgggcgg cgacacaggc gtgaccaccc tgtacgtgca
    26401 gaagaacagt ctccagggcg agaggccgcc cgagatcatc cacgtgcgca tcgaggtgaa
    26461 ggagtagcga tctgttaacc accgtgccag aagtcgcttt acttctgaac ggaactcggg
    26521 catgatggtg tcatagaaaa ggagcaccac catgtcacat gtaatcacac tcgaaaactc
    26581 caagtcctac gccaccgagg cgaacctgga caaggccctc gtcaagctgg gactggcaga
    26641 gtacacgggc ggcgagaagt tcgcctgccg ctacatcaag tgccagaacg gcgagggccg
    26701 ctggaccgcg atcttcctga tcagcgagta cttcaaccgg aacgagaccg gtggctacgt
    26761 cggcatcgcc agccagcacg gcttcatgag cgtctgaggg aggcagagat ggagaagatc
    26821 gagtcattca ataacaactg cactctcgtg gccgtcaagg cggtcatgaa cggcacgaag
    26881 acagacgacg agatcctggc cgcgtttcgc ggtcggggct acgaggacaa ccagggcatg
    26941 acccactcca agtggaccgg cgcggcccgt gacctgggcc tgtccctccg gagtgtggca
    27001 ctgccccggc gcggttacaa gtgggtgtcg tacacgagct ggcacggcga ggagtgggag
    27061 cgccgcgtcc gcgtcaagta cacgctcaaa gagttctgcg aggcgcaccc acgcggtgtg
    27121 ttcctcgtgt cggtcccagg ccacgccttc gtggtggtgc acgggcaggt ctgggacccc
    27181 aactgcgtcc atcagacgat ggcgcgccac gtcgaggcgg tcaaggaggt gctcaaccct
    27241 ccgctgaacg agatctgtca cgacggcaag atccgctcgc tgcgcactgg gcgcgtggga
    27301 tccaagtcct tccagcggcg ctggtcagcg gtggcataca tccaggagca cggtccccag
    27361 acgggcgaga cgctggtccg cgagaccgag tacacccagg cagacttcga gttcgacaag
    27421 aagaggggga acctgcgcta tgagaccgcg tgaggcggac ctgaagccat gtcccttctg
    27481 cggcggagcg gccgaggagc acgaggagat ggagagcgga tacccggtct ccgtcaccgt
    27541 tcgatgccag gactgcgggg ccacgcaccc gcccgttcgc ggtggctcga tgcaggggat
    27601 ggtgagacga gtggacaccc acagcgccac gcggcgctgg aacaacagga gcgggtcatg
    27661 agtgactggg agtgggagca gtggtggcgg acccgtgggt ttcccgagct cggcgactac
    27721 atacaggtcg ccttcacctg gaaggtcggt ggcgagaagg gtgtccaaga ggggttcgtc
    27781 acctccatca atggcgacta catcggtctc aacggagaga gcggcgaccc cgacaagaac
    27841 gcgtacgcgt ggcggaagag gatcgtgcca agcaaagaga aggagaggga agaaatcgtg
    27901 agtccattaa ccctcgctta acacattcag ggtatgatga attcatagaa gaggagtcag
    27961 gcaaatgcaa gtcgttcaaa catccacagg caaggtcttc gagggcactc tcgtgaagac
    28021 aaacaagaag ggtcaccaga aggtgatgtt tggcgagtgg tgcatggagc tctggttcga
    28081 tgccaagggc gacagcaagc cgctggccca ggagcgttct ggcaagttca aactggtctg
    28141 aagaggagaa cacaatgacc agccaacaga tgatcaaacg ggcattcggg aggcggttgc
    28201 cgcccctgcc ctacacacag cactcccgtc ccacagacga cgagagcgcg gcgcggatct
    28261 ggatggggca cacctacgag ggctccgagg tccagcgcga aatagaggag cggaagcatt
    28321 gatctggcag gtgaagcaca aggacggggt ctgctacata gaggcgacca gcaagtccgg
    28381 ggccaaggtg atggctggac agctgtccct ccggccgccc tacacggtca acccggcacc
    28441 ggagtggcgg ggccatgtca tcaaggcata cttcaacacg accgacggcg acagcaagat
    28501 cctcgagatc gacccggcca agaaggagga gctcctccgt ggcaagcgcc gctcggccaa
    28561 gaccagggac gaggactcgt gaagacgctc gacatgaaag cgatgaacga caagttcttc
    28621 gcgctctatc agcaggcgat cgacctccgt ctgaaggagg cccgctgggt gctcgaccac
    28681 gacacgtggc tggagctccg tcgcggctgg gagtggggct cgttcctcga gttcaacccg
    28741 gacactcgcg agttcaacat catggggctc gagtgcacct ttgtccatcc cgaggtgccc
    28801 gagctcgtgc cggacctcga cccagagacc gtgatgctcg agaccacacg gatgccgttc
    28861 tgcctctatc tgcgaggcgt caaacccaac tgccgagtcg tgcagatcga cgacccggac
    28921 tgcgcggagg actggaagtg aacaacttgc acgagcgccg gaaggcggag ttcaacaaga
    28981 ggctcgaggc cgctggcctg ggcgggacag agccggtccg gatggacacg gcccgacaga
    29041 tacaggagat ctggagagat gtccgcagtg agattagaga ggagcatcga gcttgagata
    29101 gccgagactc tccaccgcga gatgagcccg ttcacgaaga ggtggctcaa agagacgcgg
    29161 ttcgaggaca tcgatctgca caagaggggc ctcggccgag tcatatgcca ccgctggcct
    29221 gtgaccgaga cgcaggcgca ccacgccaca ctgacactat ggagactgct gcaatgaacc
    29281 tgcacgaggc aatcggccgc gccgtttgcg gccagcggat cctctacctg gtgcgacgcc
    29341 accgggacgg agacgacatc atgcgccggg tggtgcgcga cacccacgga ctggcgatgt
    29401 gcaacctggc caacctgcgc ctgcacttcc ccggcgaggg actgatcaag ttcatgaccg
    29461 acgaggacat tcgccaaggg cgtcacagag gcatgctgtt cgacgagacc aactctctgc
    29521 tgccaggcgc gcaggccgtc gtgaggagga acctgtgaac ctgacgctga gagaggccgt
    29581 cgacgcgggt gtccgcgagg gcctgtgcca gtcgatatgg cagatgtgct ccgacctgga
    29641 ctgtccggcc tgcacccgcg cccgctggca ccagaagcca tggtggagga ggatctggct
    29701 cgacgagccg cccctgccgc cgtacaacca gctgatggac agattcatcg gcgagatcgt
    29761 gaaggagaga gcgaatgtgg aatagaccgc cgaggagcag ctacgacatg gcagccatcc
    29821 ggctcggccg aggggccagc ccggaccaga tccacaggat cgcgtgtctg cacggccagg
    29881 tgccaaagga gagactggac gcggctgtga tggccgagcg gagccagatc cagcaccctc
    29941 cgcctcccgc tgacagacag cggtatcgcc ggagggacga ccgtgattga gagacgcgga
    30001 aactcccttc ggatcggccg tgtcttcatc acagcagaca ggtggccgtg gcagctcatg
    30061 agccaggcct cgccatacaa cgccaggccg aacaagaggt ggggatgggg acccgtcggc
    30121 ggcatgggtc ggttcggcgg aggctgggag ttctgcctgg gcgttcgcgc gggcagttgg
    30181 accagctggt acctcgagct gggactcggc atggtccggc tctcgaccca cccgccacac
    30241 tcgttcaagg agctccggcg atgatgggac tgtccctcct ccactggtac ctcatcgggg
    30301 cgatctgctc cggagagatg atgatatggg gaatgaagaa ccccgtccgc acgaagccgg
    30361 gtcagcccgt cttcccctcc ctcttgctca tgtatctgtt ctggccactc ttctggctcg
    30421 gagcagtcct gggcatatta ctatcgacag gaaagaagag atgacacacc tcattggaat
    30481 agtcagctac ccaccgcatc cccagtcacc atacttcaag gtccacgtgc cacagtgcga
    30541 cggtgtcccg ctctcgctga aggccatgcg caacggcaag acggcgaaca tgggcgatgt
    30601 cgtcatcgtc aacaagacga agggcggcta caagggctgg gagaccgagg aggtcgtcgg
    30661 gagcacgaac gcgcccgagc cgtcgaccct ggctcaggtg gcagagttcc acaccgcgtt
    30721 caaatgcagc gacgtggact tccagacacc ggaggaggca cacctgctgg gcgagtggga
    30781 gggcgtcctg caggctcagg cagacgcgat caaggagcag gcccgacgcg tgggctccgt
    30841 ccgcctcctg cgtctccagc tcctcctgga ggaggtcgcc gaggtctctg gggcactggc
    30901 cgccgacgac cccgagcaca ttctgaagga gctctcagac gtgcaatacg tgctcgacgg
    30961 ggcgtacatc tcactccgtc tggcggccaa gaaggacgcc gccttcgccc tcgtccatca
    31021 gtccaacatg acgaagttgc aggatggaga gccgagaaag catggttctg gccgcgtgga
    31081 gaagggcgac ggctatgtcc cggcggacct ttctgggctc ttcaaggact gatgcatcag
    31141 gtccaggacc tgatgggcgt gagaaatggc gtttcatcag gtccgtcgca agtcattgtt
    31201 ctcgctgagt gatcggagcc caagagagga cgggacctga tggacctgac ggaccggtca
    31261 gttttgtgtt tgctggactt tcatatattt ttatttccat cttattttat caggtctatc
    31321 aggtctatca ggtactgtat tgttttcact tgtgaatctc ggacctgacg gaggtgaggc
    31381 atcaggtccc gtcaggtccg tctagaatct acagcaaaaa ctgtagagtt gtgcacccac
    31441 tcccttgggc actatgatct ccgcagaacg tgaatcccga atcgcacgtg cgcatttatg
    31501 tggagactca gaacgatggc gaagacgccg aagaccagat ccaagaacca gccccgagca
    31561 gagacgacca cggacaacct gccagccacc actggctccg tggcacacgt cgagctggag
    31621 gtgacagacc aggacctccc tgacaagcgg accaagaagt tcatggacaa gccggtcgtg
    31681 gagcagaggc gctttgacga cagggcggcg gccaagttcc tggcgtacta cgcgcagacc
    31741 ggccgcaagg gcgcgtcagc cagggcagcc ggtgtctctt acaacgtggt ccgccactgg
    31801 gaggtccacg acgacgactt cggcacgctg gtgcaggagg cgcacaacga ctggctcgag
    31861 ctgctggagc gggagctgtt ccgtcgcgcg gtcgagggtg tcctggagcc ggtcgtggca
    31921 gggaaggacc ccgagattgt gacatacgtc cgcaagtact ctgacaagct gctcgagctg
    31981 gcgctcaaga aggcggaccc ctctggctat ggcaaccggg aggcggtcaa cgtcaacgtc
    32041 aacacaggcg tcctcgtggc accagagtca ccggccaagg tcgaggacat cgacctgcca
    32101 ctcgaagatg tgacggaggt caagtgagcg acgtctccca cctcgccatc ggaggcagga
    32161 aggtgggctg ggctcccctg cccggctcgc agaccatggt cctcaagtgc acctccatct
    32221 tcgagctgct ctaccacggc acccgtggcc cagggaagtc cgacaccctg ctcatggact
    32281 tcgcgcagtt cgtcggcagg ggatggggcc tgcagtacaa gggcatcatc ttccgtcaga
    32341 cctatcccca gctggaggat ctgatcacca agagcaagcg ctggttcccc aagatctttc
    32401 ccggcgctcg ctacaacggc tcggccaaca agtgggtgtt cccggacggc gaggagctgc
    32461 tcttccgcca gttcaacaag cccattgact actggaagta ccacggtcag gagttccagt
    32521 tcatcgggtg ggacgagctg accaactggc ccactctgga ggggtacacc tccatgatgt
    32581 cctgcctgcg gacgacgcac ccggacatcc cgttgcgctg tcgtgccacg accaacccgt
    32641 acgggccggg gcacaacgtg gtcaagttcc acttcgagct gccagccaag gacggcatca
    32701 tccggaggaa gacgtacgag ttcgaggacc ccgagaccgg cgagccgatc cgcaagcagc
    32761 tctgccgcgt ggccatcaag ggcacgatct gggagaacac catcctcctc aaggcacagc
    32821 cgaactacat cgcccagctc aaggagcagg ccgacaaccc cgccaagctg gccgcgtggc
    32881 tcgagggcag ctgggacatc gtggccggtg gcatgtttga cgacgtgtgg gacccgaaga
    32941 tcaacgtggt ccagcgcttc atcatcccga ggtcgtggaa gctcgaccgc tcgttcgact
    33001 ggggctcgtc cgccccgttc tccgtgggat ggtgggccga gagcgacggc tctgacttcc
    33061 aggacagcga gggcaggtgg aggagctccg tccgtggcga cctgtacagg gtggccgagt
    33121 ggtatggctg gcgcaaccgg ccgaacgagg gcctcaagat gctggcggtc gacatcgcca
    33181 agggcatacg cgagcgggag atgatccttt tcccgacccg cacggtgcag cccggaccgg
    33241 ctgactcctc catctacgac gtggagaacg gagtgagcat cggtgctgac atggagaaga
    33301 agatccgcat ggaggacggc tccatgaaga agggcatcgt gtggacacgc gccgacaagc
    33361 gcgccgggtc gaggaagacc gggtgggaga tgatgcggaa gatgatgcgc gacgccggtc
    33421 ccaacaggga cgacaagggc accatccttg gcacaccgag ggagaagccc ggtctgttcg
    33481 tcatggacaa ctgcgatcag ttcattcgca cagtcccagt acttcctcgt tgtgaaaagg
    33541 accccgatga cgtagactcg gacgctgaag accacgtcgg cgacgagacc agataccgcg
    33601 tccggttcgt cggcaaccgt gccgccaccg gctcaacaac aggaatgtac tgatgggagt
    33661 tgactccaag cacccgctct acacagacaa cctcgaccag tggacccagg tgcgcgacac
    33721 ccacgagggc cagcaccagg tcaaggagaa gggcggcgtc tacctgccac cgacgtccgg
    33781 catgcagcag gacggcatga actccgccaa cgaccccggc tggaagcagt acgacgccta
    33841 tcggctgcga gccgtggtcc cggacatcgt gagggacgct gtcgaggcga tgatcggtgt
    33901 gatgcaccac aagcctccgg tcatcgagct ccctgccacc atggagcccc tccgcgagaa
    33961 ggccacgctg cgcaacgagt cactggagat gctgctccgc cggatcaacg aggagcagct
    34021 catcacaggc aggctcgggc tgctgacgga catgccgaag gcaccgagcc agagcgacca
    34081 gcgggtccag gcctccgggc cgagcaccac gatcaacgac cttccgtaca tcgcgctcta
    34141 cacggccgag gccatcatca actgggacaa gggccgatcc gacggcatcc agatccagaa
    34201 cctcaacctc gtggtgctcg acgagagcga gtacgagagg gacaaggact tcgagtgggt
    34261 gtggcaggag aagtaccgcg tgctcatcct cggcgaggcg gaggtcaacg agccgcaggg
    34321 ccagggcgtc tactccgtgg gagtgttccg ggacaaccag ttcacgttct cccagggaga
    34381 gatggtcacg ccgagccacc gaggcaccac gctgcagatg atcccgttca cgttcatcaa
    34441 ctcgtgcgac atcgtgccgg agccagacca gccgcccctc cttgggctct ccaacctcgt
    34501 cctgacgatc taccgtgggg aggcggacta tcgccagtcc ctcttcaacc agggccagga
    34561 cacactggtg acgatcggcg ccaacctgca ggacgagcag gccagggtcg gagcgaatgc
    34621 ccggctcgac ctgccgacgg acgccgacgc caagtacatc ggagtggaca gctctgggct
    34681 ctccgagcag cgagaggctc tgaccaacga ctacaaccga gcggcccaga agggcggaca
    34741 gctgctggac tccgtgtcca gggagcggga gtcaggcgag gcactgaccg tgcgcgtcgc
    34801 ggcccggact gccaccctca accagattgc catcacaggg gccttcgggc tgcagcagac
    34861 actgaggcac atcgccacgt ggatcggggc caaccccgag gaggtggtgg tcacgcccaa
    34921 cctggacttc gtcgacaaca cgttcgcccc ggccgacctg gtccagatca tggccgcgaa
    34981 gaacgtcggc gctccgatct cctacgagac catccacatg tggctccaga acatggacgt
    35041 cacggagctg gacttcgagg aggagatccg caagatccag gaggaggacg cctccctgga
    35101 cctcggcatg tccaaccctg acgatctaga ggaagatgac gatgacgacg gagacgaaga
    35161 cgacggatca gaagacgacg gcggaagtga tcagactggg gatgacgaat gaccccacga
    35221 aggaggaggt catcgccatg ctgcacgagg tcatctcgga catcaagcac gaccgtcgct
    35281 cgttcaacaa ggccctcgta atattcctcg acgacaccga ctgccagtac aatcctggct
    35341 tcgccaacgc tggcatgtcc atgacggagt gtatcggcct gtgcgaggtc atgaagacga
    35401 tcttcatcgg ggagatggga ttccacgatg ccgactgacg accagatccc agggatgccc
    35461 gacaatgtga acgaggagtg gctcgacgcc atgatccgcc accagatcgg gctcctccgt
    35521 gtgtcgggcc gggtgcgcca gcgcatcttc gagatcctcg acgccacgga gagggacatc
    35581 gctgaccaga tcaagcgccg ccttgccaag ggcgcgacga ccgcgcgact ggaggcactg
    35641 atcaaggccg tcagggcact gcgctcggag gcctggaaga agtccgccga ggtgtggcgc
    35701 gaggagatgc tgtccgtcgc cagggaggag cccaagttcc tgtcccaggc actgcgcacc
    35761 gtgtcgcccg tccagctgga cctgaccctt ccggccgccg acctgctgca gtcgatcgtg
    35821 accacccgtc ccttcgaggg gcagaccatg cgccagtggg cgtccaacat tcgcaactct
    35881 gacctccgcc ggatcgagag agccattcgc atcggggtca cacagggaga gccgaccaat
    35941 gccatcgcca ggcgcgtcat cggcaccgtt cgccagcgcg gccgagacgg agtcactcag
    36001 atcactcgtc ggaacgccga ggccatcact cgcaccgcca tcaacggcat cgccaaccag
    36061 gccaagcgag agttctacaa ggccaacgcc accctcttcg aggaggagat ctacgtcgcc
    36121 actctcgact cccgaaccac accgatttgt cgctccctgg atggtcagcg ctttgcgatc
    36181 ggggagggac cgatcccgcc tcttcacttc aactgccgta gtctccgtgt cgctgccatc
    36241 gacggggacg ccatcgggtc acgaccccag cgtcagttca ctcagaggca gctccttcgc
    36301 gagtatgctc gatcccgtgg catcaaggca ccgactcgtc gggccgacct gccacgtggc
    36361 cacaagggag agtttgacag ctttgcaagg actcgcattc gacagctgac tggcacggtc
    36421 gacgccaagg tgtcctacca ggactggctg acgaggcaga gcacagagtt ccaggacgac
    36481 gtccttggaa agaccagggc gcggctgttt cgcaagggcg gcctgcgact tgatcgcttc
    36541 gtcaaccggc agggggatga gatccctctc gccgacctgg cccgtcgcga gacgtcggcg
    36601 ttccgcgcgg caggcctcga tccggaggac ttcacatgac accgttcgca ttcttcataa
    36661 tgctgtgcgc cgtggaggga gatcccacca gttgccgccc tgtgatgagc ggcttcggag
    36721 cctggagaga cagagcccac tgcgaggaga gcatccgtcc gctcgtcgac gacatcggca
    36781 accggctggc tcgacagctt ggtccaggcg tcgtgatggc gtacaagtgc gagggccagc
    36841 aaccaaaggg agaagacaca tgacgctgct gcagaagctg caggcaatcg ccacggcgat
    36901 gtctgacatc atcagcctgt caggtcaggt gcagacagag ctcaccgctc tgaacacctt
    36961 tctcgacacg gtctagagcg agagcgatat ggcgagagcg aggatcaggg ctgttcggag
    37021 cgcggacggc tctgatcctc atgctgtccg aggtcaggga cagccggacc ggcgcgcggg
    37081 acatgacccg gcccctgtca ccgtgggacc agaggccccg gcagcgtgag accctccgag
    37141 agttcatgaa gaggtgcacc gctggcaact cggtcggcga gtgccagaga ttgtggaacg
    37201 agtcgcgcca ctagcgccgc cgctcccatg ggcatatgct ccacggaccg gtccccagtg
    37261 gtggacggcc ggaaccctgc atggcagaga tcaaggagaa agaaatgcct ctcacagcag
    37321 tcatggacac cctggaaggt gtcgacgaga gcatcgcagc cctctacaca cagaagggcg
    37381 agaagtttga actcaccgga atcgctggag tcaagacaca ggcagacgtc gatcgcctga
    37441 cgacctccct caacaaagaa cgtgaagagc acaagactac caaggcatcc ctcggcgtct
    37501 ggggcgagct caatcacgag gaggtcatgg ccaagttgga caagatcccc gagctcgagg
    37561 ccgccgccgc tggcaagctg gacgaggccg ccatcgagga gatcgtcaac aagcgtgtcc
    37621 agggcaccat cgccacccag acggccccgc tggagcgaca ggtggcagcc ctcaccaagg
    37681 agcgtgacga gtttgccgcc cagaacgagg gcttccgctc caaggaccga acgagaaaca
    37741 tacatgacgc ggtccgcaag gagctcgtgg acaagaaggt catccccgag gcccacgacg
    37801 atgccctgat gctggccgat cgcatcttcg aggtccgcga ggacgacggt gccattgtga
    37861 cacgagacaa cgtcggtgtc actcccggca tcacccctga cctctggctc caggagatcc
    37921 aggagaagcg cccacactgg tggcccgcgt ctcagggcgg cggagcgggc ggtggccagg
    37981 gcggtggagg cgtcggctct ggcgcgagca acccgttcac ggccgagggt tggaacgtca
    38041 cggagcaggg caacatcctg cgcctcaagg gacgcgagca cgccgagcgg atggccaagg
    38101 ccgctggcac cactgtcggt ggcaagaagc ccgcgcctcg gaaatcgtga agtcaagaca
    38161 ggtttactga ctggcgaggg ccagtataga ttgtcgggag ccggtggcat ggtccacttg
    38221 gctccccttg tcatttcgag cccaagccat ggcgcggagg ctcctctcag agccatgaaa
    38281 caggagattt agaccatggc tggtgcaaac gaccaaacta ctcaggtcga tgacgtcatt
    38341 gttccggagg tgttcactcc gtacgtccag cagctcactg aagagaaggc ccgtctgatc
    38401 cagtcgggtg ccctcgctcg gaacgctctg atggatggac tcctctccgg tggcggcctg
    38461 accttcaacg tcccgtcgtg gcgcgacctc gacaacgacg aagagaacgt gtccaccgac
    38521 tcgatcgctg accgcatcgc cctgacggcc ggagtgtcct acgcggacat cgccgccctg
    38581 aacgccgcga tcggcaacga ctcgacgccg aatgacacct cctcggacca ggagatcgca
    38641 gttcgtctga gccgcaacaa ctcctggaac accactgacc tggccgccgc tctggcaggt
    38701 gaggatcccg ctgactccat cgcgacacgg gtcgcgttct actggactcg gcgtctccag
    38761 gccgccttca tcgcgaccat gcagggtgtg accaaggaca acgctgtcaa cgacagtgct
    38821 gactacgcca acgacatcac tggcgcgtcc ttcgtggacg gtgtgaccaa cttctctgca
    38881 gaggcatatc tcgacacgaa gctcaccatg ggtgactcga tggaagatct gtccctggtg
    38941 atggtccact ctgtcgtcta caaccgcatg cagaagaaca acctgatcga cttcatcccg
    39001 gatgcccgtg gcgaggtcca gatcccgacg ttcctcggtg cggaggtgat tgtcgacgat
    39061 ggcatgccga atggcactgc cgctgtgcag gacgacggca ccgctggtgt cgctggcatg
    39121 tacgagacct ggctcttcgg ccccggtgcc atgcagcttg gcatcggctc cgccaaggtc
    39181 ccgaccgagg tggaacgcca ggcgtccgca ggcaacggcg gtggttctga gaccctgcac
    39241 tcccgcgtgg agtggtctct gcaccctgtc ggtcacgcct acgtcgccgc ctcgccggca
    39301 aacggtggtc cgtccaacgc cgcgacgacc aacaacctca acatcgcgac ttcctggaac
    39361 cgggtctacc cggagcggaa gcagatcaag ttcgcacgcc tgatcactcg cgaagcctaa
    39421 gcggatcggg gagctctcgg gctccccgct ctcttctcaa cggaggacaa catggtcgct
    39481 cggacaccac acatcaagca tcttcgcagg tcgatgaagc ctgtcaagac aaatcgtcgt
    39541 cggaagctcg gtgcgtggct ggacgcccag gttgccaagt tcggtggcac ggccaccgct
    39601 cgcacggtct cggccgtcga cttctcggac gacgtcgccg ccactggcac gctgaccatc
    39661 acagccgagc ccacggcagg cgagacggtc acgatcggtc tcgtcacgta tcactttgtg
    39721 gactctctga atgagttcag tctcgttccc caggttctac ggaccggaga cgtcggtgtt
    39781 gccactcagt ctctgttgga tgccatcaat ctcacggagg gtggtgacgg cgccaactac
    39841 atcaatgctc cgaccaatca ggaagtcaca gccaccggcc ggacggacac aaccctgacc
    39901 gtcacagcca aggccgctgg caccagtgcc aactccatcg ccaccacgga gacgctcgcg
    39961 ttcggctcgt ggggcggggc cacgctcagt ggcggagcga acggcaactt cctcacctcc
    40021 gtcgcccacg gcttcacgtc tggcgatgga ccgtacgaag ttttcagcac gatcgcattg
    40081 ccaagtggcc tgacgtccgg tgtcggctac tatgtcggcg tgctcgatgc caacacgttc
    40141 gagctcttcc tcgacgcgga cagcgccggt cagccgggtg tcgcggccga ggtggacatg
    40201 acagacgctg gctctggcac aatcacagtc ggtgcacagg tcacggacca gagcatcgtg
    40261 gagcacatgc gtgacgggga gaccccgaac gccctggcaa actcgacgga catcgacgac
    40321 ttcgcataag aatcaggaga ctgaaatgga aattgtagag gcactcgcca agctggacca
    40381 caagaacgac gaccactgga cccaggacgg gctccctcgg atcgaagtcg tggccaacat
    40441 ctccggcatc aaggatctca agcgaggcca gatcaccgac gccgcgccgg actttgtccg
    40501 tgtcggggac gacactcctc cgacggacga ccagggccag ccgaaccccg cttcctccga
    40561 tccggacgac gaggacgtcg gcgagatcga gtccattgac gatctgacgg acgaggagat
    40621 cctggaggcc tcggtcgagg acctcatgcg ctccccggag ctggcggacc ggtggcaggt
    40681 ggtcgttgga aacatcctgg ctcagtgggc caaggacaag aatgccatcg agaacaagat
    40741 cagcacgctg gcccgccgcg cggacttcat ctacaaggtt cgcaagcagc agcgcaaggc
    40801 gcagcccaac cgggacctcg acggtgtcaa ggccgtcctc cagcggtcca aggaggcccg
    40861 tgccaagaag cacgcccgag ccaaggcgtt cctggagtca ggcacgacct cggaggacgt
    40921 tgtcacggcc ctgtctctca aggctccgat cgacgcggcg ctcaatcagc gcaagcccaa
    40981 gctcggctcg acccgccccg cgatgggaat gccagtcagg aagtaacaca tgggcactct
    41041 agacagcgac gccaggaacc cgaacgcgca gctccaggcg tcgctgttcg cgtctcggga
    41101 gcgcactcgc ctcctccgtg gccgggtcct cgacatcccc cgaactcacc agatcgtcgg
    41161 ggcctctgcc atcgcaacga ccatccccgc tggctccttc gccgcgcggg accgagtcac
    41221 aacgttcaag acccgcctcc ggttttcttc tgccctgccc tctgggaacg tgttttcctt
    41281 tggcaacgcc acgggagcca tctccatgtg ggtcagcaac tccgccatca acttccgggc
    41341 cggtggcgcc acggtcaaca cagacgccag ctccgtctct gtcaccatca atcctgtggc
    41401 gggactggac ctgactgtga tcggcatggt tcgcctcgac gggctcgtcg gcctgtgggt
    41461 cgtggagctc ggactgatcg cctgggactc cacgggctcc ttcagctcgt ttgccaatga
    41521 cgtcgtcggg gactttgccc aggccgccgc gcagccgctc cctgctgacg tggcgtcctc
    41581 tggagccccg gccaacttct cggtggtgga gccgctctct gtgttcttgg gcaacctgcc
    41641 ccggatcaac gtcggcacgg ccaggggagc gccgctcttc aacccgctgc aggtctctgg
    41701 tctcagtctt cgcctggacg cgtctcaggc agacacgatc actctcaacg gggcgaacgt
    41761 ctcgcagtgg gacgacatat cgggcaatgg gaacaacgcc acgcaaatca ccgcgtcgca
    41821 gcagcctccc tacaatgccc aggacagcag ggccaacgga caggcctctg tcgggccgac
    41881 ggtcaacacc ggctctgtcg ggctggagtt gccgtcgctc acagtcacgc acttcttcat
    41941 ggtcatcggt tacgaggatg gcactgatgc cacgttcgac gagcggggca ccctggtctc
    42001 tggacccggc tcgttcggca cggagcgcat catgggcgac gtcggcacgg cgaaccttga
    42061 ctccacagga ggtggtttta acttcaccac gcaggtctcg atcaacgacg gtgccttcgg
    42121 cgctgccatc ctgcccctgc cactctcctg ctgcatcttc gtcggcaacg tgacccaggc
    42181 gttctcgctc ggctacaaca actcggccgt tgaccggtcc tggaagggtc cgatctgcga
    42241 ggtccttgcc tacaacaacg ccctgatgac gaccgaggag cagtccaccg tggccaagtt
    42301 cctctgtacc aagtggggca tcccgacatg agtggggctc gacgcggacc gaaccagggc
    42361 attgacttct ttcagagtgc gatcgtggct gtcaccgaga cactcacgat cgacggcatc
    42421 tcgcctgtca agccgcactg cttcctcggc gtcgagttct tcgccgacgc ggccggagcg
    42481 acgcctgcca ctccctcggc cggaaccctt gccgttgacg tccgcacctt caacaatcct
    42541 cagcactacg aggcggttcc ctcgaactcc atcgacgcca ccgccccgac cactgtgtct
    42601 tgggctgcca acacgacctc cgcaagagtc acgcctagcg gcattgttgg agccgcgtat
    42661 tatagagcca ctgtgagttg caatgagagc tgaggatgtc cctgggaaca gcctatggcg
    42721 gctccaccac ctcctcaggt ggaggggtcg acaccactgt cgagaccgcg aatagcagcg
    42781 gatacatgta tctgcagggc gatgccacca ccgagggcag cgtccgtttc aacgcgtcct
    42841 ccgacattgg cgcgggcgtc ttcgagaagc ttgaaaacgg catctggaca gccaacaccc
    42901 tcgagatggg tgtggactcc ctctttctag ggcccaggac aggccttgcc tccatcggcg
    42961 agtacctctc ggtcgagaac tccaacatcc ctgacgcgcg tcgtctcttt ccctacactg
    43021 tgttcaatgg cacgacgatc gacgacctgg cgacgatccc ctatgtgacc gcccacttga
    43081 cgaacgtggt ctcagtcccg tttgactccg acgagacgac cgggacgagc tacagctgga
    43141 cgttcactgg caccgtcaat gccatgctca agaacatcta catcaagatc ggctccgtgg
    43201 ctccgacaga cacggtgcgg ttcttcgtca gggacaacga cgagaacggt cagatcatct
    43261 tcgacgagtc ctacccggcc agtgccttcg cggcgaacag cacggtggcc ctgcagacga
    43321 ctggcttctt tcacaacaag gtcggagata cctactactc cacgttcgag tcttcacagc
    43381 cgttctccat actcggcagc gcggccttgc aactgcccta cttcgaggtg gatgccagct
    43441 tcattcgcga tgatcgtctc tggcaggcct ccccgtggga ggcggggaca tacgcggtcg
    43501 gcgactatgt gatcgagggc cgtgtgccat acatctgtgt ggtggcgggt gcccaggcga
    43561 cggactttgc aaccaactcc accagttgga agcccatcaa tggatatgac tttgatgact
    43621 gggtgaccaa ctatggaacc agagcgatat tggacgagaa ctatgacttg ataattgacg
    43681 aggccacact ggagcccgtc gtcttggagg gaacctgatg gcactgcaca agtcactgac
    43741 aggatctgcg atccacgtcc catacgcctt cacctatgcc gatgccacag ctcgcaccac
    43801 agccaccggc ttcgagaccg gagacatagg aaagcttgcc ctgcagtctg acgagaactc
    43861 cctgtggatg ctcacggccg tcacacccac ctgggttgag atctctggtc acacggctgt
    43921 cgctgatgct gtcagcctct acaactcgaa cgcgacactc tccaacgcgc ctcggaatgt
    43981 agactgggtt ggcacagcgg gtggtgtgct cttcgacttc ttctatcagg acgttgacac
    44041 gtacactctc cgctccgcga tgttcatcgg tctggcctcg gcgggaatgg aggtggcaac
    44101 cgggactggc gcgggatttg acagcggtgt ggccggcata ggtcttgaca ccaccaacgg
    44161 catcagggtg acggacagca tcaatggcca gggcatcagg aatgtggctg actatagtgc
    44221 gaatgcagac gctcgcaccc tgatggacaa gggatatatc gacggtgcca ttgctgctgc
    44281 cttcactggc agtgtgagcc aggccctctt caagggaggt ggcggtgggc tcctctacct
    44341 tcagacctcc tccatctctc tacttggcgg agaaaacatc ggcagaatct tcttccaggc
    44401 accagatgaa tttgacgaag ggatctctcg cagcgttgga gcagcgattg ttggaaaggc
    44461 cggtggggca ttcagcgcgg cagctaaccc aacggacctg gccttcgaga caaccaacaa
    44521 cggaacgctc gtcgagcgcc tccgcataga caatcagggt cgcatcattt acggcgcgcc
    44581 ctctgccctg tccaatgcat ccgggatgtg gatgatggag ggacccacga atgacgggac
    44641 tgtcgctggg cctcacatga gcttccttgt cgcaggcgac ggcagtccca cgatgcacat
    44701 cttcccctat gcccacgaca acatgggcat attgtttgac atgtattacg atggctcagt
    44761 cttcacaagt gcagacgcag gcactaactt ctgtctgtac aaatatcagg acagcttgtg
    44821 gttcggcagc tttgcaggca tcaccaaaga tacggcaacg ggtaaccctc aggctggcgg
    44881 caatcactca atgcgcatcg cagacagtgg aacagtccac cttggcacgg ctcccgcgac
    44941 cgggacagtc acgtccttcc gcacaggcaa agacggatcg agctattgga ccgggagcac
    45001 ttccggtctg ccctacgcgc agatgtactc ggacaacgac gccacgacaa ctgtcacgat
    45061 cagcacgata gatgtctcgg tccagtacac aggctttgcc ttcaatggcc agtccaacgt
    45121 gtgtgtgccg gatcacacca atgaccacat aacaccaact gtggcgggtg tctacttcgt
    45181 taccctggac atgttggtca ctctgacttc tgcgaccgac attgtcgagg cacagatccg
    45241 catagacaat ggcgcgaccc tcttgacgga ggttgacatg cagcttcgca gtgggagtga
    45301 cctctccgcg cacggttcag tgtctgggtt catatcggtt agtggaacga gcacaatcga
    45361 ggtatggata cgaaacagga gcaacacgaa caacgtcttc gtgcgtgatg ccagcctcac
    45421 aatattccaa gtcggaggaa actgatgaag attgacatag acgacagaga ggcgcagttc
    45481 atctgcgatg ccatagacgc cttcgtgaag cagcacgggt tggcagtcgc gggtgccgga
    45541 cttacagtcg tgaaccgaat ccaactggca gcgaaggcga agcctccagc tcccgagcag
    45601 aaagaggaag acacggatga cgctggttct tgagaccggc tttggtgtcc aggacgccaa
    45661 cagctatgtg accgccgcct ttgtcacgac ctacctgacc gatcgaggcc gggaggccga
    45721 gaacggctgg agcggactga gccaggagca gcaggaggag aagtgcatcg ctgccactga
    45781 ctacattgac aaccgctggg gcaaccggtt caagtccgtg cgcaagacac gattcgccgg
    45841 caacaaggcc gaggcccgtg ccacgttctc cgcgcagccc gccgatggag agacggttgt
    45901 cttgggctcc tacacctaca cgtttcggac ggccctgtcc tcgctgacgg cggacttcga
    45961 ggtcctgatc ggagcctcgg cggcggagac ggcccagaac ctggtctatg ccatcacgga
    46021 aaacaccacg gacggtgcca gcacattcag caccaacgtg ctgctgaatc aggccgcgtg
    46081 ggccgagatt gacagcacga cggacaccca ggtgaatctg gtggcccagg cagacggcac
    46141 ggccggaaac gacatccccc tctcgaccac ggcggtcaac atcacgctga tcatgtttgt
    46201 caacggacgg gacttcggct cgcagcccct ggagtttccg cgcgcgggcc tgaccaaccg
    46261 atccggcatt ctcgtcacag gcatccctct ggacctcaag caggccacgg cggagtacgc
    46321 ggtgcgcgcg gtggcgaacg agctcttcca ggaccccacg atcgatccaa gtggcagggc
    46381 ggtcacgtcc gagaagctcg ggccgatcca gacggactac gcggacggcg gtgcgatcga
    46441 ctacctcatc cggccctatc ccgccgccga tcagctcctc cgagactaca tcaccagcgc
    46501 gggagtcact cgatgacagc ggcccaggca gacaaggcaa agatccaggt cgacgccaag
    46561 ggccggagtg tgacgttcgt tcagctggac acgaccgcga gtgactccac gaagccctgg
    46621 agaggcgaca cggccccgcg ctccccagct gccgacgagg aggtcctgtc agctgtgttc
    46681 gtccctgcca caggtggtgg cctgggactg aagtgggtct cggaccagct gctcaagcga
    46741 gcggagcagg tcgcgctcgt cgcacccggc tcggcgttca ccaagcagtt ggaaaatttc
    46801 gacgagatcc tcgagtcaga cggctcccgc tggcgcatcg agatggtcga gatcctgcag
    46861 cccgccgacg tccggatcct ctatgcgatt ggagtgaagc gatgagcctg acattcaccg
    46921 ccgctcggga cgagctcctc acactgttcc agaccgcctg ggatgccaac tcgggcggtg
    46981 tgaagctcta ctactgggac ctgacggaca ctccgccgac cgccgacgag tgggcgcgcg
    47041 tcaccgtgcg ccacacgggt ggcaacgacg ctgccctggg cggccgaatc ttcgagagga
    47101 ccggatttgc gacggttcag atcttcacga tccatggtcg aggcttgtca agagctgacg
    47161 agctggctaa agtggccgtt gatgcttttc agggccagtc cacaccgggt ggcatatggt
    47221 tccgaaacgt tcgcctcgtc gaagttggac aggatggcaa gtggttccag aacaacgtcg
    47281 tggcggactt tgagtacact gagaggacat gatggctgtc gaagtagcaa aaattgactc
    47341 aaatgtgacg ggtctgtcga tcgccgagga agagactctc ggcaccctcc cgtcttcccc
    47401 cacctggtac acgctggagc cgaactcgta caatgacttc ggtggaagcc tcacactcgt
    47461 cgcgcggaac ccgatcaaca cgtcccgcca gcgcaagaag ggcgtcatca ccgacctcga
    47521 cgcctccggt gggttcaacc aggacctcac attcagcaac ctgtcattcc tctgggaggg
    47581 cctattcctt gcgaacaagc gaaccaagcc caagaacacg gcgggaagta cgaccacgtc
    47641 actggacatc accggcgtca cggcgaccgg atacacgctc ggcaccggag gtggtgcagc
    47701 gtaccagggt ggactgatca ttcttgcaca gggattcacc aacgcggcca acaacggact
    47761 gaaggtcctc agcgcggttg ccacggacga gatccagacc tctggcctcg tgctggaggc
    47821 ctctcctccg gccggagcca atgttcaagt cgtcggcttc gagtacggct cgggtgacgc
    47881 ggacatcgcc tacacaggcg gctcgctccc cgtcctgcag tcgaccacgg ccgacccgac
    47941 cacgttcaac ctcatccccg gcgagttcat cttcataggc ggtgatgaca cgggcctgac
    48001 cggtgacgcg ttcaacgcgg cacagaacaa cggatttgcc cgtgtcaact ccctcgccgc
    48061 ctccggcatc acgctcgaca agacctcggg cggcgcggac ggcatcactg agatgctcac
    48121 cgaggccggt ggcaccaagc tcatccggat cttctttgcc gacgtcactc ggaacgagga
    48181 ctcgctgtcc actgacttca atcgacggtc ctacgctgtg gagcggacgc tcggcaagcc
    48241 caatcccacg ggcgacaaca cgcaggtcca gtcagaggtg ctgcgtggcg ccatcgtcaa
    48301 cgagttcgca ctcaacatcg ctcaggccga caagatcacg acggactgga cgctcatcgc
    48361 gaccaacaac gagcagcgtg acggcctgaa ccccggctcg ggcggcggtg acgagcgcgt
    48421 cctgtcggag accgtcggca ctgtctccac gatcgaggcg gccacggcct acaacacctc
    48481 ctcggacttc acccgcatca agatggcgga ggtccggccc acgcagtctg gcgtggcaaa
    48541 cctggcggcc ccatcgccac tcttcgcgtt tgtgacggag atcacgctga acgccaacaa
    48601 caacgcctcg ccgaacaagg cagtgggcgt gctcggtgca ttcgatgtaa cggccggaac
    48661 gttcgaggtc tcaggctcca tcactgccta cttcgcagat gtggaggcga ccaaggccgt
    48721 ccggaacaac gctgacgtca cactcgacat tgcgatcgtc aaggactttg gcgatggcac
    48781 gctggctcgc aaggctggca tcgtgatgga catcccgctc atcgccctgg gcgatggtcg
    48841 actcaacgtg gagcaggacg aggcaatcac tctcccgctg accactgacg cggcggaaga
    48901 cgaaaacttt gggcacaccc tgctcgtcca cgagttcttc tggctcccgg acgctgcaga
    48961 cacctaggag aaccgcatga atctcgacga aaacgatctc gaggcaatcc gcgagcgggt
    49021 gaagacccgc tggatgtctc tggaccgcgc tgtacagatc gccatcctcg ctggactcgg
    49081 tgttctgatc ttcgcgatcc tcttttgaaa acggcgggga ggggcgactc tccccgctct
    49141 agaatttgag accaaacacg aggatagaca atggctctta agctcaccaa cgccctgtcg
    49201 ggctacgatc tcgccgagta tgtaaacctg gactgcggag cctttgacct gaagatccag
    49261 caggccgcca tccacaacga gaagttccgc gccgcgattg ccaagaaggc gctcatcgcc
    49321 aagaagaagt ctctcatccc ggaccagggc agcatgaccg gctcgttcga gcaggacgtg
    49381 gagctgttca tcgacaatgt catcctcggc tggggcacgc gccctctgat cgacgatgac
    49441 ggcgagccgg tggcattcaa ccgagagaac ctggtcgaga tcttcaccgg ctctcgcgag
    49501 ggtcgcatcc tcttcggcaa gatccagtcg gccgccgtcg acgacaccgt cttcgcgatc
    49561 aaggaagaag acctgggaaa ctaaacgagg tcctcgactt ctggctcaag aacggtggca
    49621 gcatacaggc catcctgaac gctgctacag ccgctcgccg agggatgcct ccaaggttcg
    49681 ccgagatcac cgagaagacc gagccgtgga tgccgttctt catccacgcg tttctggagc
    49741 tcagcacgga gcgcgctccc ggtctgtcag tcacaccgat cccctggtcc tccatccaac
    49801 actatgcgga atgccacggc ttcgacggta gtgagcggga ggacttccgg actataatcc
    49861 gctcgatgga catgcactat ctgaagacac gggacaaagg caacaaagat ggcctctctg
    49921 cgggagttcg cgagaagaat gagggtgctg ggtcgaaggg tcgaggtgaa cggacccgag
    49981 atcgctcgaa aggccgccct cgcagttgac caggcagtag tgacctccac tcctgtcgac
    50041 tccggccgcg ctcggtccaa ctggatcgcc cgtgtgggtg gccccgcctc tggaacgcga
    50101 gaggcctttg tgcccggcgc gggtggctcc acaggtcccg ccaacgctca ggccgcgatc
    50161 gtcgccgccg agggtgtcat tcgcaccttc gatggagagg gcgagatcca cctcacgaac
    50221 aatcttccgt acatcgctcg actgaacacc ggctactccg cccaggcacc ggctggcttt
    50281 gtcgacaccg ccatccaggc cggggtccgg cgggtccggc gcagcaagat attgagggag
    50341 aacccgtgag atgacagaac gcattgacat tgtcatctcc gagcgtggcg cgcgcacggt
    50401 caaccgctcc atccgagaca tcggcacggg agcggaggcc accgctcgtc gcatcaacct
    50461 gctccgctct gcccttgggc ttatcggagg cgcggctgtc atccagacat tcgggaggct
    50521 tgcagattcc ttcacgctca ttcagaacag gctccggctc gtcactacgg ggacggagaa
    50581 cctggcagag gtcactgatc gcctctttgg catctctaat cgcactcggg tcggtttcga
    50641 agagacgggc gagctatatg cgcggctggc gcaggcgaca aaggatcttg gaacgtcgca
    50701 ggaggacctc ctccagttca cggagagcct gaaccaggcc gtcatcctgt ccggtgcgag
    50761 cgcccaagag gcacaggctg gcatcctcca gctctcgcag ggcctggcgt ccggggcact
    50821 gcgcggcgac gagctccgct ccgtcctgga gcagctccca gcggtcgcag acgtcattgc
    50881 tcgcagcctg ggtgtgacgc ggggcgagct ccgccagctc ggcaccgacg gagagatcac
    50941 ggccgaggtc gtgctcaacg ccttccgcga ggcggccgag ggcctggacc gagacttcgc
    51001 cacgaccgtc ccgacgatcg gccaggcgtt caccgtgctg cggaacaacg tcctgcaggc
    51061 agtcggcgcg ttcgacgctg ccaccggggc ctccgccgcg tttgccagcg ccatcctgac
    51121 catcgccaac aacatcccga ctgtcatcaa cgtgatccag acgatcgtgc agctcatcgg
    51181 tgtccagctg gcgcggattg ccattccggc cgcgatcgtc gcgttccgcg cgctgacggc
    51241 tgccatcgcc gccaaccctc ttgggctact cctgactgtc attgcgacgg ccatctcggc
    51301 gctcatcgcc ttcagcgacc agctcaacca ggccggtggc gcgttccgcc agctcgccac
    51361 gaccgtgcag gccgtggtcc agctcatcag ctctggcttc cagcagatat tcgccgcgct
    51421 gcaggcggtc ttcccgccgc tccagcagtt cgagagcgtg tggccggcca tcgccgccgc
    51481 tgccaacaat gccatcctgc tcatcgtgga gggcttcgac atcctcgtcg cggccggagc
    51541 cggggcagtc gaggcgatcg tcgccgcgtg gaacaacctg cccggcgcgt tcatcgagat
    51601 cgcaaccgcc gccatcgagg gcgcggtccg ggttgtccag gcaggtgtca accagatcat
    51661 tggtctgatc aactccatcc cgtttgtgga cggggcggtc ggcgaggtca acttctcggg
    51721 gatcactgac gccctctctg ggctccgcga gtcaaccggc tccccactgg ccacaggctt
    51781 ctccgagggc ttcgatgccc agaggggaca gatcaccgag aggctcgagg gcatccgtca
    51841 gaccatcgag gcgaccaacc ggctgcgcga cacagagcag gagctgcaga ccactctccg
    51901 tggcaccatc gacgaggtgg agaacctcaa cacggccaac cagaactctg tcgccgccag
    51961 tggcgctgca gcagacgctc tggggtcagg cggcggtggg ctcggcggtg ccgcccgatc
    52021 tgccgcgaag gacgtggagg acctcgcaga gaccgtggac gagtcatcca acttcatgca
    52081 gtcagctctg gagacaacgt tcaacgccgc gtcgtccgcg ctgtccaact tcgtgcggac
    52141 cggcgagttc gacttcgagc agttcacacg ctccctgctg gccgacctga cccagctggc
    52201 agccaaccag ctcctgcagc agctcctcgg tggaggaggc ggtggaggcg gtggtggcat
    52261 cttcggcggc ctgtttggtg gaggcggagg gctctttggt ggaggaggtg gcctgttcgg
    52321 agggctcggc ggtctgttcg gcttcaacaa cggcggctcg atcctcatcg gcggccaggg
    52381 cggcatcgac aacaacttgc tctcgatcaa caaccggccc gtggcacggg tcagccgagg
    52441 cgagacgatc gacgtcaacc cacggggcca gggcggtggc aacaaccggc ccgtgacagt
    52501 gaacttcgcg gtgacgacgc cgaccggcga gatcccgctc cagacacaga accagctggc
    52561 agcgaaggcg gtgctcgccc tgaacacagc tgacaggaga aacaactgat ggcgttcgac
    52621 gagacaaggc tgccagacga cgtggagcgt ggagcccagg gtggcccgcg cttcaagacg
    52681 accgtcatca ccctctcgtc gggtttcgag cggcgcaaca gcgactgggc ccagacccgt
    52741 ggggagtggg acgtcggcta tggcatccag gacgccacgg acctggagga cgtcatcgca
    52801 ttcttctatg cccggaacgg cagggcgcgt ggcttccggt tcaaggactg gacggactac
    52861 gtcctctctc ggcaggccat tggcaccacg gacggcagca acgccacgtt ccagctcttc
    52921 aagcggtaca cctcgggctc gacctcgttc gaccggatcc tcagcaagat cgtcacggcc
    52981 acaacgcagg tctgggtgaa caacgtcgag gctcccgagg gtggtgcatc gaccagcttt
    53041 gcaatcgaca cgacgaccgg catcataacg cttggcagct cgctcgccgc gcagtctggc
    53101 accacggtgg aggcagcctg ccagttcgac gtcccggtcc gctttggatc ggacgccctt
    53161 gacatcacgg cggagtgggc ggacgcagtt ggcgcgccga acatccccat cgtggagatc
    53221 cgagtataga atgaagacaa taactggcag cctgcagacc cacctggagg gagaggtcac
    53281 aaccctcgcc acaatctggc gcgtcacccg aaccgacgga gtcgagttct tcttcacgga
    53341 ccacgacgtg gacatcacgt tcgagagcaa cgtgtacacc tcgtcagttg gctacaaccg
    53401 ctcggccgtc gacagcaaga ccggcctctc cgttgacaac ctggacgtcc tgggcttcct
    53461 ggacagcagt gccctcaccg agaccgacct gcgcggtggc aagttcgact tcgccgagat
    53521 ccgcattggc atcgtcaact acgcggacct gtcgcaggga caactacgca tgcgccgggg
    53581 cacactcggc gaggtcacat actccgatgt cactggcacg ttcatggcgg agctgagagg
    53641 actcacccag ctgtactccc agggcgcggt cgagctctat caagcggagt gtcgggccga
    53701 cctgggtgac tcccgctgca aggttgcgat ctctccaacc gtcatggcgg ccaacaccgc
    53761 gtacgccctg gagacgaacc tccgtggatc gacactgctg aacctcgccg cgccatacgc
    53821 gctgctcttg aacttcgacg cggatgccaa cgaccgaagc tccgttggag ccactggcac
    53881 cctgggcacc gaggccgcgc tccagaccac acaggctcag ttcggagccg gggcaatcga
    53941 gttctcgcca accgccaccg tcgacccctc cgaggcgttc gtgtcctatc cagacaatgc
    54001 cgcgtacacg atcgagacga gtccgttcac catcgagtgc tgggtcaggt tcaaggacct
    54061 cacctcgacg gaccaggtct tcatgtcaca ctacgagagc ggcacgaaca atcgtggctg
    54121 gtacttctcg cgaagcggca gcaacctgga gttcggatac agcccagacg gcagctttgc
    54181 caacctgtcc tctgtggacg gcgcgttcac gtgggccatt gacacctggt accacgtggc
    54241 agtcactcgc gacgccagca acaacctccg cctcttcgtc gacgggacgc aggttggaac
    54301 tgacatcgtc gtgaccacct ccatctttga cgcggcgtct gtggtctaca tcggcaagcg
    54361 ccgttccaac ggtggagacg acatcccgct caacgggttt gtggatgacg ccaggatact
    54421 ggtcggcgag gccctctaca cagagaactt cacgccacct gtcgcggccg gagtcgaggc
    54481 caccactgtc ctcgcggccc tgacgacccc ggacttcaac gacaggttct tcgaggtgac
    54541 gacacctggg acgaccggtt ttcagttccc agtcttcaac accacgatag gtggcaccac
    54601 cacgtggggc actgccgtct tgaccactcg agaggcgttc aacaaggccg tcaccgtggc
    54661 gagcgtgacg gacaaccgga ccttcacagt caccttcccc aacggggatg acacacgaga
    54721 gatcgacgac tggttcaagt atggagccgt ggtctgggag tcaggcgaca acaatggatt
    54781 ggccatggag gtcaagagct acacggcggc caccaacaca gtcgagctct tcctccccat
    54841 gagctttact gtccaggtcg gcgacacagg ctacatgtac gcgggctgtg atcgacagaa
    54901 ggacacctgc gtgagcaagt tcgacaacat tttcaacttc cgtggagagc cgtatgttcc
    54961 aggtcaggac gagttcctga cgtatccaaa cgctcggtga gaacgatggt gacaagagac
    55021 gacatagttg cagaagccct ctcctgggag ggcgttccct ggaggcacca gggtcggacc
    55081 cggaagggga tcgactgcgc tggtctcgca gtcctcgttg gatcctcact gggactgacc
    55141 acggcaaacc ccaccgcgta tccgcgccga cctgatggat ccttcctgcg tcacttccag
    55201 gacgccctgg agcagattcc agtccgggac atactgcctg gtgatgttgt catcttctct
    55261 gggacagatc acagccacgt ctgtcactgt ggcatcgtcg ctgtgaagta caatcggcag
    55321 tctgtcattc acgcccacgc cacccggcgc aaggtcattc acgaacgcat gtgggaggcc
    55381 gagtcagtcg tcggtcgccc ggtccacgcg ttccgctatc cgggagtcgt gtagatggca
    55441 tcactcgcaa ttgcagcagt cggcgcgctc gccgcaggcg gcctgggctt ctcgccccag
    55501 atcggcttcc tcatcgggtc cgtcgtcggc acactgctct tcccgccacc cggccaagag
    55561 acgaccacgg aggggccacg cctcggcgac ctctccgtct cggcgtcgac gtatggcact
    55621 gccatcccga tcagctatgg cacggtccgt gtgtctggca acatgatttg gtcgtctggc
    55681 attcgcgagg tcaagcacac agagaccagc ggaggcggca agggcggcct gggaggaggg
    55741 cccaagcaga cgcagatcac gtacacctac tttgtggaca tggccctgtc cttcggggct
    55801 ggaccggccg acgctgtctc acggatcttc gcggatggca agatcatcta cgacgccacc
    55861 aaggccccac cctctcgcct gtctgggctt cgcttccggt tctacgacgg cggggaggac
    55921 cagctgccgg actccatcat cgaggcgagc gagggctccg gccaggtgcc cggacaccgt
    55981 ggcctctgct acatcgtgtt cgacgacctg ccgctggaga acttcggcaa ccgtgtcccg
    56041 aacatcacgg cggagatctc cttcaacgcc accaagacca ccgtcgctgt caagggcacc
    56101 aacattgacg acagcgcctc cttccaggtc gacattctca caacggactt cgtgcgtcgc
    56161 cgcgcctatc tggactctga tggcggcctg cgtgtctttg acatggacac gatgaacgag
    56221 atccgtcagt ctggctctct gtctgacgga cttggaatca ccaccatagc aggcaagttc
    56281 actgggaaca tctacactgg caacagcacg ttcaagctca tcaacaaata cgatccggag
    56341 agcttcgtgc ggacggcgtt cttcggcacg ggcggctttg gcacgtcgaa caacaccacc
    56401 agcttcgcgg ctccgaccct cctgctggag ggaagctgct acaacgcgac gggtggcgtc
    56461 cgcaactttc tcatgcagaa ggcgcagttc gacgaccttg ggctcctcga cgcggacagc
    56521 atggagtaca tctggcacct caaccagacg gtcggggtca ctggatttca aactgcctgg
    56581 gacaggcgag agggagagtg tgtcttttgg atcagcttct cggagagcaa catcatcacg
    56641 ctcgccaagc tgactgtctc gtccaacgcg gcctacaacg cgacgtttgc cacgactgtc
    56701 ggtgtgtcct acgaaccctc tgtcgccacc ttcgacctca acgctctcag tacgaatggc
    56761 actccgagca ccataacagg tccattcttg gatcgagacg atgatggcct gttctggttc
    56821 gtcgcccagt caggcggtgg cagcatgatg atcaagtgga tcgagggcca gggaaccatc
    56881 tacatcaatc aactcgacaa tgtcgagccc aatgtgcagc gcactcaggc cccgatgaac
    56941 agtgacgtgc ggaatggacg actcagctgg ctcggcagca acggctccgc gtgtctcatc
    57001 gttgacacga gcaatggcac agagctgagc acgcccgttg acataacgaa cgctgggacg
    57061 ttcagcatcg gcggtcagca gggcgcgttt gtctatgacg gtgacgcgga gggttttatt
    57121 tgcatggacg gctctgctgg aaactctgac gttgtgaagg tgtttctgga gcagatcagc
    57181 acgcagggca tcgctctcag ctccatcgtg gaggacttgt ccacgagagc cggttatgac
    57241 acggcagttg acctcgacac cacggagctc actgacaacg tcaagggcta tctcgtgtct
    57301 cgccagatga cctatcgaca ggccctcgag ccgctcgcgc aggcattctt cttcgaggcc
    57361 gtggagtcag acgaccagat caagttcgtg aagcgcgggg cttcttccat tctcacgatt
    57421 ccgcagtccg agctgataga ggtcggtgac gagagcgagg tcattccgga gcagcgcacc
    57481 caggaggtgg agcttccaga gcggatctcc gtcctgtaca tggacgtcga ccaggactat
    57541 cagcagggaa cggagtctag caagcgagtt cgccaaccga tacctgccat gcggagccga
    57601 gtggagacct cgctggcact ccccattgtc ttcacggcca cagaggccaa gcagatctcg
    57661 gagaaattgc tcttctccgc ctggaacgag cggaccgcgt acaggttcaa gctgccccag
    57721 gagtacctca ccctggaccc gacagacatt gtgacagtca cgcttgacaa cggcacgacc
    57781 ttcctggtgc atgtgagctc catcacggtc ggggcggacc tgaccctgga ggtggagggg
    57841 atctccgaga gctccgtcac gttctcgtcg acggccacgt ctggtggtgg cctgggcttt
    57901 ccccagaagc caccggcctc tcccgccgcc acaaagctgt ttcttgtcaa cgtccctctc
    57961 ctacgcgaca tcgacgatac ggctggcctg gcgtcccgtg tctactacgg catgtctggc
    58021 ttccaggacg ggtgggacgg cggctccctg ctccagtcgc tggactccgg ctccacgttc
    58081 gatgagataa gccgcgccct cgccggcaca gactggggcg tgacgatcaa cgccctccct
    58141 gccacgacga cgcccttcca aacggacgag accaccagcc tggaggtctt catgcaggtc
    58201 ggcgagctgt cttctgtgag ccaggagcag ttcctcgcgg acgccaacgt ggcgctcgtc
    58261 gggtctccca cgaccaacgt ctgggaggtg atcgcctatc gagatgtgac ccaaaacacc
    58321 aatggcacct acactctcaa cggactcatc cgtgccaagc gtggcaccga tccgttcgtc
    58381 aacagccacg cggtctccga gttcttcctc cctctgaaca gctccaactt cttcgcgttc
    58441 ctgctgccgc tggcccagcg gaacaactcg ctcccgtaca agggagtcgg cttctctcag
    58501 atccaggagg acgtcaacgc ggagaccttt gtcggcctgg ccagggacct gatgccatac
    58561 gcaccagccc agcagaccgc cgtgctcaac gcgtcggaca ttgacatctc ttgggtccgt
    58621 cggacgcgca tcggtggggc gctcgtggat ggcctgggca ctgtccccct gggcgagacg
    58681 acagaggcct acgagcttga catctacaac gcggccggag acacaattgt ccaggcggtg
    58741 actggtctca cctctcccac gtacacctac ccggctgccg acataaccgc tgatttcggc
    58801 accacgcctt ccgagctaac gttggaggtg ttccagatca gcgaggcggt tggccgagga
    58861 ttcaccaatc gcgtcacgat accggtggag taagagatga ccaacaacct aagcgtcact
    58921 cagttgacaa caaaccaaga taataaagag acgacgatca acgacgccaa cggtgagctt
    58981 gacgcggcca tcactgcgac gatcacgaag accatcgaca acacgaacgc gggaaccgtc
    59041 acacaggccg agctccagcg cgctgcctca atcctcgtgg ccgacgacgg tgcctcccct
    59101 ccgacggctg gaatcaccct gacctttgcc agcttcgagc gtggcaactt cgtggttgtc
    59161 aacacgagcg cccaggcagt tactgtgacc atctcgggac agaccgagac cgcgcctgtc
    59221 ctggcagccg gagagacctt cactctgaac atgactggag ggaacatacg ttctgctgga
    59281 ggcggttctg gcggcggtgg gtccagtacg ctcctggggc tgacagacac tcctggatcc
    59341 ttcacaggac agagcggccg agtgctcaag gtgaacgtcg gcgaggacgc gatggagttc
    59401 gcggatgacg acaacaccgg aggtggctct ggcacgacca tcgtcggtcc gacggtcagc
    59461 actctcttgc ctccgtttcg agtggcgccg ccggacccgg ccgacttcgc cacggttctc
    59521 aactcaccga cagtgacaca gcccgacacc ataacgacga acctgtctgg cgcggcggat
    59581 gccagcctcg tccgggccag gctcacaact gttcctgtgg gagacttcac aattgacgcg
    59641 cggctcagaa gcgacgcggc aagcaccttc aacggcggtg gcatcgtgct ccgagacact
    59701 ctcggagcca taacaatgtt cggatttgtg tttgcaactc cgcttagtgt cgaagtcggt
    59761 gagtggacag accagaccac gttctcagca ggtcagggga ccatcagtga cgaagatgga
    59821 gactacgaat acttcagaat cactgtcgtc ggttcaacaa tcacctatct tgcttccaaa
    59881 gacggcctgg tgtacgacac catccacact gacagcttct tgggcaccct acaagactat
    59941 ggctttggcg ttggcaatcg gaacgctgtc acggccacgg aaatcgatgt cacactttgg
    60001 attgacggca acaacgacgg caatgagatc gctgtgttcg cggctccaac ctccgtcagc
    60061 ctcaatacac agacggccag ctacactctg gcactggaag acgccggagc caatgttcgg
    60121 atgaacgtgg ccggggccaa caacctcacc gttccgccaa acagcaccgt cgcatttccc
    60181 acaggaactg tgatctccgc tagacaggtg ggcgcggggc agacgaccat tgtcgccgga
    60241 gccggtgtca caatcaacac tcccgagacc ctgctgtgtc gcaagcaggg ttccacagtt
    60301 tccctcgtca aggtgggaac ggacgagtgg gacctcacag gcgacctgca actggcgtag
    60361 agagatgctt cagaacctat tccttggaac tgtcagcgcg gcggccctca gcgcctctgc
    60421 aggcaaccag ttcgtctcag tggccagctg gaccggcacc aacgagagtg gatcttggac
    60481 agggttcact ggtcggattg tgatccagcc cggtgccctg ggctttcaga gtgcgagcca
    60541 gataaagctc acgttcacat cgcactcgac gcagggaatg atcgtcacga gctgctacat
    60601 cgcgcatggc tcgctcaccg ggaacgccta cgactttgta gagaccccga cgcaggtccg
    60661 cttcgacggt ggcaacgcca acttcgccat cggggcggcg agctccatcg tctctgatgt
    60721 catcgacttc gagtacaacg ggacctcgcc actggtcgtc tccttctggt gtgacactgg
    60781 caacggtgcc caggacagct tcacgtctct ggaagtggcc aactgggagt gctactttct
    60841 ggcaggagac aacgcggcca ctgtcgcacc ggctggtgtc tggtcgacca cgaccctgtc
    60901 tggcgtcgga atcacaaacg tcgagatggt tcagaccggt gacccgctct tcggcgaggt
    60961 cgtgttcctc tccaacttcg aggacgcgga cctcagcact ccagagttcc tggatgagag
    61021 cgagcagagg aacgccaaca cctggcccag catcgacaca gcggtggcct cgatatcgac
    61081 aacccagtcg agatttgaca acgccgcgta caagaacctg tcctctggca tcagcggcaa
    61141 cacccacgcc acgcagatcg acgaggctgt ccccacgctc ttccccgaga gcggcgagga
    61201 cttcacctgg gagggctggg cgtacatcga cggcagcacc gtcaggtccg gccagggaga
    61261 cttctttggc tcctttggca cgagcggcaa tcgaggctac atcctcgcgt tcaacgaaga
    61321 cgagctgcga gttctgtatg cgacctctgg cagtgcattc agcacgctga cctacgcgac
    61381 caccttccag ggcaacatct ggtaccacat agcgttcgtc aaggagggcc tcgacatgga
    61441 ggtcttcctc gacggggtca gcctaggaac gcagaccatg tcggcgtggc accggccctc
    61501 gacacggagc atcgagttcg ggtctcacga gagcggcaac ggcaacggtc tcggcggata
    61561 tctcgacgac tggagattca ccaagggaat cgcgcgctac accgctggct tcacaccgcc
    61621 gaccactctg tatcctcgcg ctcaggcggc ggatccaata ttctcggagg tcgccctcct
    61681 catggggttt gacttcggtc ttgtggacga gagtgacttt gcccgagatg ttgaacgctt
    61741 cggcggcgcg gcccggacct ctgtgacgac gctgaatgga accggctccc tcctcctgga
    61801 cggggacggc gactacctgg agttcgatca cgccaccgag ctcagcgctg ccaacgcggt
    61861 ggacaagaca tacgagtgct tcattcgagt cgacagcctg gctcagatca acaccatctt
    61921 ctgcaagcgc aacaccacag tcagcgggac cgacggcgag ttcctccttc tcttggagac
    61981 cgacggcacc ctgggcttct ttacgtttga caccatgtcg actgcagacg tggccataga
    62041 gccaacagat gtcttggcag tggacactgt ctatcacatt gctgtgacaa gagaggggac
    62101 cacctggaga atgtttctgg acggcgtcca gattggcacc gacactgaga ctgcgacacc
    62161 aggcgccaac tctggtccgc tttggattgg acgcgagcgc actcatcccg gcagggagtt
    62221 cactggccgc atcgacgagg ttcgaatcac acacggcacg gcgcgctaca cagcgaactt
    62281 cgccccgccc attggcaagt tcccacggaa cgcgaccaag gacgcgaaca tcaccagcgt
    62341 tgccctgctc ctgggcttcg acgcgcaggt ggacacggac acagctgtca ctgacgagag
    62401 cccaaacagg gcgacggtca ccttcaacgg ggcctcggct caggtggacg acgcgcagtc
    62461 tcggttcgga ggcaagtctc ttgtcctcgg gtccgacgct tacatatctg tcccggactc
    62521 ctccaagttc ggcgtggaca actccaacga caaaacgtac gagtgctgga tccggacgac
    62581 ctcgctcgcc gcgacacaga gcatcttcaa caagcgcgac gcgtcggcgg ccgaggagtt
    62641 ccgtctcatc gtcccgacca gtggcctgct ccggctggac acctatgacg ggtcgacgga
    62701 ggacgtcagc attaccggga ccacggtcat ggcagtggac acctggtacc acgtcgctgc
    62761 cactcggcag ggcggcgtct ggcgcatctt cgtggacggc aacttggagg cctcgggcac
    62821 ggaggcggcc acaccggctg gcaacactgg agacctccgc atcggcagct ccgcgttcaa
    62881 cagcagtcgg ttcttcgttg gcaacatcga cgagatacgt ataacagacg gtgtggcgag
    62941 gtacacagcg aacttcaccg ccccgacaca gaagtttccg aggacgtgat ggaaaacaga
    63001 gacctggcat ctcgttggtg gcgtccagca ggattctgga tgcttacact gaacactggc
    63061 cttgggttcc cagcgatggt gaccatggcc atactcggcc tcggcacaga cgtgctggga
    63121 atactggcag gagcgtacgc ctccctgctg gcaacgtggg ctgtcgccgc tggaatacgg
    63181 cagtggggca agagcaacgg atcggagaaa gagacatggg tttcgtactc ggcaagcgaa
    63241 gtagaagtag actccaaggg gtccacccgg acctcgttcg agttgtcgag cgagcaatcg
    63301 aaataactga cgtggacttc acagtcctcg agggtgttcg gtcgctggca cgacagaagc
    63361 agctggtggc acgcggtgcc tccaagacga tgaactcgcg gcacctgccg aaggttccga
    63421 agggcggcgg cgagccggtc gcccacgcgg tggacctggg tgcatacgtg gacggcgagg
    63481 tccgctggga ctggccgctc taccacaaga tcgccaaggc ggtgaagcag gccgctcgcg
    63541 agctgaacgt ccccatcgag tggggcggtg actggcgcac gttcaaggac ggaccgcact
    63601 ggcagctgcc ctggaagaca cacccggctt gacttaaaag gaagacgta
//