LOCUS       AY505112               39853 bp    DNA     linear   PHG 21-JAN-2004
DEFINITION  Vibriophage VP2, complete genome.
ACCESSION   AY505112
VERSION     AY505112.1
KEYWORDS    .
SOURCE      Vibrio phage VP2
  ORGANISM  Vibrio phage VP2
            Viruses; Caudovirales; Podoviridae; Enhodamvirus.
REFERENCE   1  (bases 1 to 39853)
  AUTHORS   Wang,D., Kan,B., Li,Y., Liu,Z., Gao,S., Liu,Y., Liang,W., Zhang,L.,
            Yan,M., Li,W., Liu,G., Liu,Y., Li,J., Diao,B., Zhu,Z. and Qiu,H.
  TITLE     Vibrio cholerae phage VP2 complete genome
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 39853)
  AUTHORS   Wang,D., Kan,B., Li,Y., Liu,Z., Gao,S., Liu,Y., Liang,W., Zhang,L.,
            Yan,M., Li,W., Liu,G., Wang,R., Li,J., Pang,B., Diao,B., Zhu,Z.,
            Qiu,H. and Liu,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-DEC-2003) Department of Diarrhea Disease, National
            Institute for Communicable Disease Control and Prevention, Chinese
            Center for Disease Control and Prevention, P.O. Box 5 Changping,
            Beijing 102206, P.R. China
FEATURES             Location/Qualifiers
     source          1..39853
                     /organism="Vibrio phage VP2"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:260372"
     CDS             1134..2840
                     /note="similar to bacteriophage Mx8 terminase deposited
                     under GenBank Accession Number AAK94379"
                     /codon_start=1
                     /transl_table=11
                     /product="terminase"
                     /protein_id="AAR97628.1"
                     /translation="MDDIRPWSGRNAYADDLDVDVPVLGPKWDENTVHKKLPNNFIPR
                     GYQEEAYDHILSEHLDFARRKNEALNKGEEFNEPEPSWRKKAIQVLHRRAGKDIGALH
                     LIAIASQLRVGNYKHILPYKTQARDAIWDGIDALGNRFIRNAFPDEIVESINESRMLV
                     RFTNGSTYQLQGGDSDKLVGAGPVGIVYSESALMSPNVRTFLRPMLDETGGWELHITT
                     PRGKNWFYKLAMHAEKSEEWYYKYLTINDTWRWAYSSEALDTDTLQQAGTATLNDGHV
                     IPVYESIPTELKYRNVADAEKAIERGVVKGMYAVRIMTERMVQSLIDEGQDPFIVRQE
                     YYCDWDVALQGSYYGDLMITMYNTGRIGKFPHNPNRPVYVHMDIGFNDSTSITFTQEG
                     PMGQGVIIDHLWGSNKSLLQWVYDIEEHANKRDYALGLIILPHDADNTEVSHGKTRKE
                     WVLEEGRFEERGMQFDVLERADKQAGIDATRGFLATCCIDETNCEYLIEALKSFRREY
                     DEKNQTYRNNAVHDWASHPADNVRYLASSWDSVLSYVHVAAKRSRGNKMKANIKVKRA
                     LH"
     CDS             2851..4494
                     /note="similar to Enterobacteria phage epsilon15p04
                     deposited under GenBank Accession Number AAO06067"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAR97629.1"
                     /translation="MENSKIVKRLDFLKTDRKNVEQIWDCIRKYIMPMRSDFFSDLRS
                     EGSINWNQNREVFDSTAGDGLETLSSSLHGSLTSPATKWFELAFRDKELNSDDECRKW
                     LENATHDVYSALQDSNFNLEANETYIDLCGYGNAIMVEEEDEDEEGSVVFQSSPIQDS
                     YFEEDSRGQVVNFYRVFRWTPAQIYDRFGDEGTPEAIIKKAKEASNQAALKQEVVMCV
                     FTRYDKKQNRNAGTVLAPTERPFGKKWILKEGAVQLGEEGGYYEMPAYAIRWRKSAGS
                     QWGFGPSHLALPDVLTANRYVELVLRSSEKVIDPAIMVTERGLISDIDLGASGLTVVR
                     DMESMKPFESRARFDVSSIQLTDLRSAVRRIYYVDQLQMKDSPAMTATEVQVRYELMQ
                     RLLGPTLGRLENDFLSPMIQRTFNIRFRAGKLGELPSKLLESGKAAMDIVYTGPLSRA
                     QKIDQAASIERWAGSTAQLAEINPEVLDIPDWDEMVRMLGSLLGAPQTLMRPKAKVTS
                     IRKNRSQTQQKAEQAAIAEAEGNAMEAQGKGQAALKENQ"
     CDS             8537..9010
                     /note="similar to bacteriophage KVP40.0291 hypothetical
                     protein deposited under GenBank Accession Number AAQ64361"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAR97630.1"
                     /translation="MQKRGHFDIREFVSEADFKKYGLKAWRFVCPALLHTLNTLRDDL
                     DCTITVNNWMYGGNFRWRGVRSSKSADYSETSMHSWGRAADFDVKGMTAPEVVVHIIK
                     NRDKYPLITFIEIDINWVHIDVGQREYNPAEGLKLWSPKRKYVDIDTYLKEQGHG"
     CDS             9329..11554
                     /note="similar to bacteriophage RB30 outer capsid protein
                     deposited under GenBank Accession Number AAM52483"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAR97631.1"
                     /translation="MPSLVSIYNKALAHVGAKPVLSETDANTRAEMCNAMYEFALRSA
                     LEAREWSFAAMRVRLLPDPLITPAWGYNYGYRLPNDCIRVCEVRDGNSYNIDWAIESG
                     FLYATRPTVDVKYNRLVEDPNAFTPTFVEALSLKLASDICIPLTENRGLGNDLISRYL
                     MAVSEGAALDGLQASRERLRADTLINARRGCGRMDRPYPQTGSGKFYDIAPPTIPDSP
                     PLGNISGPSSVQLGQPFSFIAQVTGTQPISYQWYKNGIAIPSATSVSFGVESATNNDE
                     GEYHCLFSNSAGIVVSNKISLEIGCFPPVHNITGPTTVGEGKSFSMVCTVTAGNLPVT
                     YQWQRDGQNIAGATTATLSVAAAIVADSGQYDCLVSNQCASGVSSTNKVTLDVIPLVV
                     PTVSISPTSASPLEPAPVTFTASVVDDGGAPPVTLKWYLNGSLVQNGGTTYTTPPTAV
                     NQNRTVSVVGTNSVGDSAPAVATVTPVSNFISQSTFTTNAAFTLHPDCTFVQVQGCGG
                     GGGGGSGRTAGGNDSIGGGGGGGAALVSVLSSNAIGGQTATIVVGGGGGGAANRAIAA
                     GNGGNSSVSGAGIVGLSWTGGRAGANGVQGYYASGGNGGNNSSNVGAGAGASSGNAAS
                     GVSGGGGGGTGPGNGGWRSGNGGGSNAGVGTSNGNNAQAAGGGGGGNSAVWWDNAAAG
                     KGGDGTASSGASGGNATGNGNGGGGGSGGTSILGNGTDGSAGGNGSGGKVIIRQYRRP
                     I"
     CDS             11563..13347
                     /note="similar to Enterobacteria phage epsilon15 deposited
                     under GenBank Accession Number AAO06075"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAR97632.1"
                     /translation="MADFSQTSFKGGVIAPRLQFNEYESAYHHSIEDAVNFVVTEQGS
                     LITRCGSEEVGLCQDGEVRLFRLPAVDAPSNDVIVEVGNTNIAVWVNDVRQVVANTPS
                     EWRNTIDRIQTAYDTIGDDAGAANTGRLIMVHPALQPKRLYRDNNNAWQFVNMHTGAV
                     PAEWSPSNYPQTVGIFQNRVWYVGSPVHRTYFWATRAGKLEDIAPSTANNPNDPISFV
                     GIMEGTPCWIIASSDVLTIGTTINDYQLAASTGVSVTAATAILRRSSVQGTAAVQGIP
                     AEEQVIFCSRNKSKVYAMNYVREQDNWIPDEMSSQAQHLFTPISSAKGASVRRVAYIS
                     DAAKSLWVVLENGQINYCCFDRTTDTKAWTQLELSGGKVIDIAAAFNPDSDYAYVAVV
                     RSKAINGVQKNYTVLEKISSPRTDWKRADGWVVAQVNQNGDVLNLDRYIGRTAVIFSK
                     YGLEAEVEVNNIGLTHRINGYDPNTVYYVGYKMDSYFRTLTPSNGDMKKSMFGSKIRI
                     SKVQLALFDSIEPTVNGEPADDRSTDDIMDARLLDFSSNSGSSNGTRLVDYNPLGWEN
                     DGKMVIAVEQPFLCEVVGVFSVVQSNKV"
     CDS             17012..19360
                     /note="similar to bacteriophage epsilon15p17 deposited
                     under GenBank Accession Number AAO06080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAR97633.1"
                     /translation="MPRKCFEGWKEEDIAKMFGKTDTDLITAEDIADAIKGKKQEKIA
                     VYKQAEAIKKGNEVLTQSKDPASALLGMLSRDPNEEVKFLSADQRINAIRAVSKAKIS
                     DFMADLAPTTRQIFAGIATGERRLTKSQQRLLDDFVHELYGRQTGNADALKAAKGWKK
                     ATEDLNARFGQAGGHMAELDDWRLPQKHNRMAISKAGADVWVEKVWDLIDRDKMVKKL
                     RKGKDEDNLREALYSVYNNIVTDGMSSSKTLSKKFTDMMRSERFITFKDSDSWLKYQR
                     EFGDTNVYASMLGHIDNMSRAIGMMETFGPDPDIGFNTLERAVKTKKGLTSRQPTGAR
                     PTFDMLMGYNMVEEQTVWGNRVAGLRNLWTASKLGAAVVSALTDSVYASMAASYNAMS
                     PARVLRRMLSEVMKPSKSEASRKLWAQDFGFGAEFALDRMAMTSDYTQSFGGHRSRNL
                     AEAVMVVSGMNQWTQSARASFQFEFATALTRAADSRWSDLPEKMRNSMGRYGITESDW
                     AAIAAAPRTNYKGNKMIDPRNMDAELQTKLVGMVDGETMMAVPTPDARTRAFMAGGTK
                     SGNFGGELHRSLFMFHSFPITTIMNQWRRVFTGKGYSGAFDRMSAAAIMVGATSVLGV
                     GIIQAKDILNGKKPRSMSDPKLWIEGMAQGGSFNYIGDLMRNAASGYSHDMTSYVGGP
                     VLAYGDWVAMTAADMAKGDAESAMARTANFATQQIPFNNLWYTKIATDRLLMDRIRRL
                     SDPEYDKKQLNKMRKMQRTSQQEYWWSPPIGGQSNIESPFEE"
     CDS             19364..20437
                     /note="similar to bacteriophage epsilon15 tail fiber
                     deposited under GenBank Accession Number AAO06083"
                     /codon_start=1
                     /transl_table=11
                     /product="tail fiber"
                     /protein_id="AAR97634.1"
                     /translation="MTIQNKEPFVYATGNGVTATIPFTFPANSASDVYGAINGIDQSV
                     TVVLSPDQINSPGGTLTFNGGAAPLGSSVLVYRNTKMEQTLSYPTKGSFPSKSHESAM
                     DKLVMIAQDLNFLLASRCLRAPNGEKFIKELPPIQERAGKFLGFDPAGNPYAAAPIRG
                     EDGTNGLPPYISDGTDGFNAGNWVAFSIQDNSYKDTGVRALGVDGLPPYISNGTDGFT
                     SGNWIVDDGSTNYVDTGVRAKGDKGDKGDDALSPYVSDGTDGFTAGNWVADNGSGAYA
                     DTGIGAKGDKGDTGDDGLPPYISDGSDTFVAGNWIADNGSGVYVDTGIPARPNLQYAT
                     ETTIGGMRWSLVGTTLNLYFTDV"
     CDS             20439..21821
                     /note="similar to bacteriophage RB30 outer capsid protein
                     Hoc deposited under GenBank Accession Number AAM52483"
                     /codon_start=1
                     /transl_table=11
                     /product="outer capsid protein"
                     /protein_id="AAR97635.1"
                     /translation="MAVYIQGQEVLNIVVHVPNSAPTDLGEFRMAEQLAAKQPQITAQ
                     PVGGSIYDSQTLGLSIAANVFGSTAAYQWLVDGAPIQGANSTSFTFVPSGLGTFDVTC
                     EIKAFGPMVTSEVASVTVEQTPVDLTWQVLPAGYGLPSNVSGLVGLNAIGSDGSLVVG
                     AMGMEGMRSTDKGLTWSYIGNGFGTGQTSGTISAICVVGNVVVVGGIAGSNIGVAGRS
                     TNGGVSWTKLPDFLNSGATASAINKILHVGGNKLIALLGSGYAAVSNDLGATWSALPR
                     WLNSGGSDNNTSFFDGAVTATGAIIAVGQNGFASISRNGGVTWSALPRYLGMPTNTSI
                     VAIGVSDTAIVVGGNNGNCAISRNDGVTWSALPLNFGVPIGSGIRDRSIAGASNGTFL
                     VGLSGSPISGNNGYLALSYDDGVTWQQPPRYLGIPNAGYGALVNTIRNIDILTFLVGF
                     TDKRGVRAVR"
     CDS             complement(21846..22163)
                     /note="similar to Burkholderia cepacia phage Bcep781 ORF57
                     deposited under GenBank Accession Number AAN38061"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAR97636.1"
                     /translation="MPDMSEMNGGDFKETLEDKLTETLNERGSRYGDFQEISSISEQI
                     QTLVFASDSLKEPKLRLNRAQRECIRQLSTKLARIACGDAQYPDNWHDIRGYGQLGEK
                     HCK"
     CDS             complement(23019..23402)
                     /note="similar to Clostridium thermocellum ATCC27405
                     predicted hydrolases of HD superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="AAR97637.1"
                     /translation="MSITSFWRECIKRLPNIAGENEMMQIQNILRAGHVPRWQLCDTT
                     RTQSIAEHMFNVAMIARHMCAHIGITGDEMNEIVMQALTHDMDEVILGDMPTVTKQRL
                     REAGIEPNGLIDCTETIIEDPLAKH"
     CDS             complement(24673..26961)
                     /note="similar to Vibrio parahaemolyticus phage VP16T
                     putative integrase deposited under GenBank Accession
                     Number AAQ96530"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="AAR97638.1"
                     /translation="MYISAQEIHEIGQIKDFADRVHAAARFYIKNGLYVIPVMPNGKS
                     LPSKMYNIGYQHASKNKNTIDSWFGVGGRFRGFNLGIACGKRGGVFAVDIDVEDSKGN
                     RGFDNLAILEEKYGKLVAPIQETPTGGRHYLFQWDKYAKSSSGKIAKAIDTRGGDEDS
                     CKSHIVAWPSVRDEGEYTWSMPTLGDVPEIPKWISDALGVPWTGNMNRGSEEIDEDDL
                     ETRYTPRQIWRMLEYIDPDELEYDEWLAVLQAVHSQYPDDQGYELADRWSQRGARYKP
                     DEVSIRWQSFDEHGTIRVGTLIYFAQKNGFKPNTEPKGAEEPSEDTDSVVAEYNKKFG
                     VVMVGNKLRILMEQFNPDPFQDNFKLMSVQDFKALMANDIVWYGDSKGKSKPVQKSDI
                     WFVNEKRREFVNGLTFMPDKPREVDGCFNVWEGWRYKEVAGDWSLFKKHVKAVVGSQE
                     HYEWLMDWFADALQDPMNPKGCAVVMKGIEGTGKGTIANVFGELFGQHYKHIIQEEQL
                     IGKFNGHLEEALLVFADEVTYGGNKKVAGTLKGLVTEKKLMIERKGLDATPYRNCLRL
                     MIASNEDWFIPAGPHSRRWFVIDVPDSFASDKSYFDAIWKQMENGGYEAMMYELRNRE
                     IKSDLRKAPETKLLMEQRARYTTTDSVVEWWADKVEAGVIGVTGYEEFGDEVDWPQFV
                     DKASLYVDYQEWCQANGAKRLTKPAFYAKVERDFKFVDCRPANPHGGPRKRMFEIMNH
                     SACRALLFKMTGIDVGTSDTEE"
     CDS             complement(26951..28852)
                     /note="similar to Bordetella bronchiseptica DNA polymerase
                     I deposited under GenBank Accession Number CAE33731"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="AAR97639.1"
                     /translation="MRLDWERTGRRMGFIDLTKYEAWAYDTECTGLKYKVDKVFGFSV
                     ATPDGQSGYFDIREQPDAVQWLVEQADSYKGTIVCHNASFDYRMSLHSGIKLPLSQID
                     DTGIRACCINEHESTIFPWTRGKAGDYSLDYLAKKYVGAQKYAEIYDELAAMFGGKAT
                     RKTQMPNLYRAPSGLVRKYACPDAELTLELWLEQQELIAKRGLEKIVAFERKVMPTLI
                     RAEARGVRVDLNYAEQAILKMDGVVRENQAKMFQLAGREFNPNSPKQVREVFGAKEER
                     GVWTSRDGTILERTATGNPCLDADALRAMKDPLAAAVLELRSNIKTKDTFLAKHVVEH
                     SVGGRVYPNINQMKGEDGGTGTGRLSYTGPALQQIPSRNKRIAAIIKPAFLPEEGQLW
                     LDSDMASFEVRIFAHLVAAYNPAIARAYAENPELDLHQWVGDLMGIPRNASYSGQANA
                     KQMNLGMIFNRGDGAVADSLGMPWEWCEFTDKKGDLIRYKKAGPEAKAVIAAYHTQIQ
                     GVKTLATRAQKIAEERGWIQTAHGRRLRFPNGYKSYKASGILIQATAADENKENWLRI
                     EDALGSDGSMILNTHDSYSMSVDENWKPIWERVKKAVERQTLRVPLLLEFDGVGKNWA
                     EAKGLIDVH"
     CDS             complement(28861..29337)
                     /note="similar to Vibrio cholerae single strand
                     DNA-binding protein SSB deposited under GenBank Accession
                     Number AAC72352"
                     /codon_start=1
                     /transl_table=11
                     /product="single strand DNA-binding protein SSB"
                     /protein_id="AAR97640.1"
                     /translation="MAQYDNTNRGTLGKNRQPKNDKSPHFTGKVDIRGTVYWLAGWRQ
                     EDFMSDDHYISLSLTGKDDASLTGSGRLENNRDKIGNRPDMVGRVIVEGAEYEISAWT
                     KTHDNGKFLSIQVRAAGVRRPQDDKQFGTAYGDSHEDGTRPKYNEPPMDFDDDIPF"
     CDS             complement(30863..32281)
                     /note="similar to Clostridium thermocellum ATCC27405
                     superfamily II DNA/RNA helicases"
                     /codon_start=1
                     /transl_table=11
                     /product="superfamily II DNA/RNA helicase"
                     /protein_id="AAR97641.1"
                     /translation="MEHQTQAMRKAWNKTEFALFMEMGTGKTFTTIALAGHRFNQRQI
                     DGVLVIVPTPIKPVWEWEVRDMSPVPSIAHVHDSGGDKETMRFIESEHEDKLKYLVIG
                     VEALSQGKAHELALAFVRKHNALVVVDESSRIKNADAARTKKAIRCGDSAAYRMILTG
                     TPITQGIIDLFGQFRFLGEHIIGLKSFFVFRNMYCIMGGFQGKKVLGYQREEELMDKI
                     APYVYQVKKTECLDLPEKVYRSITVSPTKEQLSAMKELKDFFETEQDGDVLTVSTVLD
                     RMTRFQQILGGNFPFLDKDGAYDVKPISGPNPKMDAMLEDIADLDRNAKVIIWARFRA
                     EIEQISKRLREVYGDDSVIEYHGGISESDRKASIPRFQDSSDPSRFFVANQQTAGMGI
                     TLTIATFAYYYSNSFSLEQRLQSEDRNHRKGQRNVCTYIDIWCKADADLMVGRALKSK
                     KDLAVLVDEELQRRIATTRRAT"
BASE COUNT         9620 a         9951 c        10198 g        10084 t
ORIGIN      
        1 atgtatttta attatagcat gcaatagggc ggttgtcaat agtcttgtgt gttaaaggtg
       61 tgagttttgt cacgcttttt gcattctggt gaccgagtcg ggcggcggaa gggtggaacg
      121 gtgttggggg tcttcgcact ggctgattgc gcaccaacgt actagtggaa tagtacacat
      181 ccgcgaagaa gcaaatggga cccgaagggt cgcggagtcg cacgttccgc tccccgtatt
      241 cggaactatg ggaattatat tgctcgattt atgtctatgg tcgtgtgtct gtgattgcat
      301 gtcctcgtac gtgtgtgtgc gcatgcgttc cttggttacg cgtacgtgcg cgcgtgagat
      361 gtaacggtag ttgacacaga gccagaggtg tgctataatg gaggtaagat ggcagcaaca
      421 tatgaggtga acatgaccaa accatgggaa ccaacagccc ttgatattct actagacccc
      481 caactcacag aactagaagc aatcaaacga aaccaacggc tggcagagaa acgcaatgag
      541 cgaatcaaac gaatcatcaa cagagaagaa ccaactggct cagcaatcca gtgggcaatt
      601 aacgaacgct tgggacaatc tagagcctaa gcgccagttg tttgctatga aatacgttga
      661 gcttggcagt tggaacgctg tgcgcaaggc actgagcatg agctatgaaa gatgcaaaga
      721 attgcgtcaa gaccctcgtg ttcaggctct tatcgcgcac cagatggaac aactccgtat
      781 tcagtcgttg gtaagaccta tcatgatgga acgcgtcttg cttgatgtga ttgaaatagg
      841 gctaggcgaa gacgatactt ttggtgtgga caaggatggt atgcaatata atgcaaaagt
      901 gaccaacctg cctgcagtca accaagctgt tgctactctg caccgcatgc aaaccgaccg
      961 tgagaaaatc aagatcgaga gtgagaagtc gaaagcaggc ggaacagtgg tcatcaacat
     1021 cgagaatgcg aacttcaatt cgaatcgtca cttcgagatg ttggcggcta agaaagctcc
     1081 aataatcgaa acctgtgtcg acgtcgacac tattcccgat gcagaggtga taaatggacg
     1141 acattagacc ttggtcgggg cggaatgcgt atgcagatga cttagacgtt gatgtgccag
     1201 tccttggccc gaaatgggac gagaacactg tccacaagaa actgcctaat aatttcatcc
     1261 cccgtggcta tcaagaggaa gcatacgacc acatcctgtc cgagcatttg gattttgcgc
     1321 gccgcaagaa cgaagcacta aacaagggcg aagagttcaa cgagcctgag ccgtcttggc
     1381 gtaagaaagc cattcaggtc ttgcatcgac gggcaggtaa ggatattggg gcgttgcact
     1441 tgattgcaat cgcatcgcag cttcgcgtag gtaactataa gcacatactg ccgtataaga
     1501 ctcaagcacg tgatgcgatt tgggatggta tcgatgccct agggaacaga ttcattcgaa
     1561 acgcgttccc tgatgaaata gtcgaatcca tcaacgaatc tcgtatgttg gtgagattca
     1621 cgaacggctc gacataccaa ctccaaggag gcgactccga taagcttgtt ggtgcgggtc
     1681 cagtaggaat cgtgtattct gaatcagccc tgatgtcgcc caacgtacgt acgttcttac
     1741 gtcctatgtt ggatgaaacg ggcggatggg aactacatat tactacgcct cgtggtaaga
     1801 attggttcta taagcttgct atgcatgcgg agaagtcgga ggagtggtac tacaaatacc
     1861 tcaccatcaa cgacacttgg agatgggcat actcatccga agcgttggat accgacacat
     1921 tgcaacaagc aggtacggct acgctcaatg acggccatgt tattcctgtt tacgagtcca
     1981 tcccgactga gcttaagtac cggaatgtgg ccgacgcaga gaaggctatt gagcgcggcg
     2041 tagtcaaagg catgtatgcg gtcagaatca tgaccgaacg catggtgcaa tctcttatcg
     2101 acgagggtca agacccgttc atcgttcgac aagagtatta ttgtgactgg gacgttgctc
     2161 tgcaaggttc gtactatggc gacctgatga ttaccatgta caacacgggc agaatcggca
     2221 agtttccgca caacccgaat aggcctgttt acgtacatat ggatatcggc tttaacgact
     2281 ccacgtcaat cacgtttaca caggaaggcc caatgggtca aggcgtcata attgaccacc
     2341 tgtgggggag caacaaatcc ttgctccaat gggtgtatga catagaggaa cacgccaaca
     2401 aacgagacta tgccttggga ttgattattc tcccccacga tgccgacaac actgaggtat
     2461 cgcatggcaa aactcgaaaa gagtgggtgt tagaagaagg ccgattcgaa gaacggggca
     2521 tgcaatttga cgttctcgaa cgggcggaca aacaagcagg catcgatgct actcgcggat
     2581 tcctagcgac atgttgtatc gatgaaacga actgcgaata tttaattgaa gcgctaaaat
     2641 cgttccgcag agagtatgat gaaaagaacc aaacgtatcg gaataatgcc gttcacgatt
     2701 gggcgtcgca ccctgcagat aacgtacgat atttagcgtc gtcttgggac agtgtgttgt
     2761 cgtacgtcca tgtagcagcc aaacgttccc gtgggaacaa aatgaaggca aacatcaagg
     2821 ttaagcgcgc actacactaa ggaacgctag atggaaaaca gtaaaattgt taaacggctc
     2881 gacttcttga agacagaccg caagaatgtc gagcagattt gggattgtat ccgcaagtac
     2941 atcatgccga tgcgttccga ctttttctcg gacttaagaa gcgagggttc cattaactgg
     3001 aaccaaaatc gcgaagtctt cgattcaacg gcaggggatg gcctagaaac attatcgtcg
     3061 tcgctccacg gtagtctgac ttcccctgcc accaaatggt ttgagctagc tttccgcgac
     3121 aaagagctga actcagatga tgaatgccgc aagtggcttg aaaatgcgac ccacgatgtg
     3181 tattcggcgt tgcaggattc gaacttcaac ctagaagcca acgagacata catcgacttg
     3241 tgtggctatg gcaacgccat catggttgaa gaggaggacg aggatgaaga agggagcgta
     3301 gttttccaat cttctcctat ccaagactcc tacttcgaag aagatagtcg cggtcaggtg
     3361 gtcaacttct accgcgtctt ccgttggacg ccagctcaaa tatacgaccg atttggggac
     3421 gaaggcactc cagaagccat cattaagaag gccaaagaag ccagtaacca agcggcgtta
     3481 aagcaagaag tcgtgatgtg cgtgtttact cgttacgaca aaaagcaaaa ccggaacgcg
     3541 ggcacagtct tagcgcccac tgagcgcccg ttcgggaaaa agtggattct aaaagaaggc
     3601 gcagtccagt tgggcgagga aggcggttac tacgaaatgc ctgcctacgc cattcgttgg
     3661 cgaaaaagcg caggctcgca gtggggcttt ggcccaagcc atttggcttt gcccgatgtg
     3721 cttaccgcca accgctatgt tgagctggtg ctacgttcgt ctgagaaggt aatcgaccct
     3781 gcgattatgg tcacagagcg aggtctaatt tcggacatcg acttgggtgc gtcaggtctt
     3841 acagtagtaa gggatatgga atcgatgaaa ccgtttgaat cacgagcgag attcgatgtt
     3901 tcgtcaatcc aactaacgga tttgcgctca gcagtgcgcc gtatctacta cgtagaccaa
     3961 ctacagatga aagattcccc cgcgatgacg gcgactgaag ttcaagtgcg atacgaactg
     4021 atgcagcgtc tgttggggcc aacattaggg cgattagaga acgacttctt gtcgcctatg
     4081 attcagcgaa cgtttaatat ccgattccga gcgggtaaat tgggagaact gcctagcaaa
     4141 ttgttggagt cagggaaagc agcgatggat atcgtttata ctggcccact gtcgcgagcg
     4201 cagaaaatcg accaagccgc cagcatcgaa cgttgggcgg gttctactgc tcagttggct
     4261 gaaatcaatc cggaagtgct tgacatcccc gattgggatg aaatggtacg tatgttgggg
     4321 tcactgttag gtgctccaca aactttaatg cgacccaaag ctaaggtgac gtccattcgc
     4381 aaaaaccgaa gccagacgca gcagaaagcc gaacaggcag ctattgcgga agctgaagga
     4441 aatgcgatgg aagcccaagg caagggtcag gctgctctca aggagaacca ataatgggta
     4501 agcgtaatta ctttcttgtt ccacaagata tcactgatgc ggacgtaacg gccatcaaag
     4561 ccgctatggc caccaccact gcgggtcaac cagtgcgccg tgtttacacg gaatcaggtc
     4621 gcctcgcaag tcaaccaatc gcatcggttc cgatgtcaga agcgcaatgg acagcggctg
     4681 tgaaagcaat cgctactgct gtatacgaca ccgccaacta ataggtaact actatggcta
     4741 gccgcgaaga ggttgaagcc tctgtaaaga aaaaggccgc agcattcgcg gctgttttcc
     4801 gctcttctga tggggagcgg gttttggaag caatccgcca agaatttgac aaggacgaat
     4861 tgcggggcaa tacggttgag ggtacttact tcaacctagg acgacgcgat gtgctgaagt
     4921 acatcgaaca aatgttaaga tactcggagc gagacaacga tgaaaagttt gaagaaaaat
     4981 tcagtaatta gcgccatgtg cgcagtgtgg ccgttgattg caggtgacga accgcaaggc
     5041 gacccaaccc ccaacttccg tgaatcgttg ccggaagacc tgcgcggcaa ttcagttttc
     5101 gataatgtca aagacctgac ggacttagcg acccaattcg cgaacgcaca gtcctttttg
     5161 ggttcgagca tccgcatccc aagcgaaaac gcaagcgaag aagaccgcaa aaagttttac
     5221 gagaaggtga tgaaacacgc accgtctcta atgcccaagc cagaccctgc cgatgaaacg
     5281 gcggtgcaaa ctgtactggc ggcattgggc cgacctgctg acccatctag ctacaacatc
     5341 gaaggcgctc aactgtccga tgatttgaaa aaggcagcgc acgaggcagg tcttacccaa
     5401 aaccagtttg ccaagatgta ccaaacacta atcaagccga gtttggattc tagcgccgct
     5461 cgtgctgctg aagtcgagaa aggccgagca gaattggcca aggagtgggg atatgcattc
     5521 caagttaaag aacagacggc acaagcgttg cttcaaaaaa cgggcgctcc tgcggaattg
     5581 gtcgatgctg cggctaaagg acagcttaac gcaaacacgc tccgttggtt agaccaactg
     5641 gccacctcca tcggtcgtga aggtttggat ttggtgaacc atggccaagg cggaaaccgt
     5701 atgactcctg cggaagctca ggcacaaatc aacgaaatca tgaacaaccg cagtcatgcg
     5761 tactggaaca catcagaccc tgcacacaaa caggcggtca aagatgttgt tgacctacac
     5821 cgtgtcatgg gtcgatagat gtaacacccc ttgactctgt gttctcccta tgatataatg
     5881 gtagtacata gggagaacac ccccaaccga gggtagcgga agcctccgtc ctcaaacaaa
     5941 acacttcttt agagtccgga aacgggtagc tcaaatcgat aataactctt tttaggaaaa
     6001 tagccatgaa attaaacgct atcatgtcga tgctgcctct cattgcgggt gatatcgacc
     6061 aagctttcgt acaaacttac gaaaccactt tgcgtatctt gtcgcaacag aagtcagcta
     6121 aactcaagca atactgtcag cacaagaacg aatcatccga atcccataac tgggaaactt
     6181 tagcatcaat ggatcctgat gcggttaagc gcaaacgttc acgccaacaa tcggctgacg
     6241 gcacttaccc aactccggtc aacaacaagc cttttgctaa gcgccgtacc aacgtagata
     6301 cctacgatac tggtcacgtc gttgagcaag aagacatctc acagatgctg cttgacccta
     6361 actctgcgct tattactagc caagcatacg caatggctcg taagaccgac gatttgatta
     6421 tcgcgggtgc gtggaagcca gcgtccatca aaggcactgg tcagcctgtt gaattcttgg
     6481 ctacccaaga aatcggcgac ggtactaagc caatctcgtt cgattatgtg actgaaatca
     6541 ctgagcgttt cctagagaac gaaatcgaac ctgaagtaag caaggttatc gtaatcggtc
     6601 caacccaagc gcgtaagctg ctgcaaatca ctgaagcgac ttcagctgat tacaccagcg
     6661 caatggatct gcaatctaag ggcatcatca ctaactggat gggctatact tggattgttt
     6721 caactcgttt ggacaagttc gacccgactc aatggggcat ggcagcagaa gacggaccgc
     6781 aaggcgacga aatttggtgt atcgctatga ccgatatggc acttggctac cactcttgta
     6841 aagacatctg gacaaaagtg gcagaagacc caagcgcgtc tttcgcatgg cgtatctact
     6901 ctgcattcac tgcagactgc gtacgtgttg aagatgaaca catcttcaaa ctccgcctca
     6961 aaaactcttt ataatcacgg ctgccgttgg tgattagggt gtgtcgacat cgacacacct
     7021 atttttattg gagaatacat atgactaagt tcattgtaac gtgtccatcc ttggataacg
     7081 taaaaccaaa catcacggct gtcgcagcaa cagggactga aacggtagat tctttggtgg
     7141 gcgataatca aatcgcaatc atcatcggcg gtccgattgc aggccgcgct tccttggatt
     7201 ctaaccgaat tcaagtggcg gcacgagcat tggccgacta cttttgttcc gaagcgcgat
     7261 tgggcgaggg cgtgaacatt ccagctccac ctgagccgga agacccgtaa taaggcggtg
     7321 agcaatggcc acattgattg atgccagatt taatgcacta agggggatgg gctttcaggg
     7381 cacatcctcc gaaatgctat ttgagtactg gaaaagccta atcccgtctg actcggactt
     7441 gccgcctgaa ttggcgagcg ggagcggtcg atggtattat gactttggtg cagcccaata
     7501 cgcccgaatt ccgtctgaag taacaatgaa cgtggggacg gcggtagaag gaaacatgtt
     7561 ccaagaatcc aacgcatact ctcatgtgtt aggtaatttt tcgaactctg ctgtctactt
     7621 ccaagctttc cctaacgttc aagtcgttga gcttcggctg tcgacccacg atggttatgt
     7681 gggtttatgg aacgacccag agtatagcgg atatctaggc gttaaagtca agtggatttt
     7741 gtctcgtctg gccgagggct acaacctgaa agtcgacacg ggcacaggtt tgcgtgactt
     7801 gggtactctg cctagtaata gcgcttttcg cttcaatacc gtagccagaa gtgcttatga
     7861 aggctatatt tgggacgtca aggtgaatga cggttctgtt tggcatttcc cattcgatga
     7921 tggcacaggt tctaccgtca agaacaaagg gagcggaggc gacgcgtcca ttgttggttt
     7981 ctctgaaaac aattggattc aagacgcgag caactctgcg ggttctttaa atgacgcgtg
     8041 gtttcaggcg ttaggccatt tgggtagaac ggaagcaacc ctgacggaca gatggtttaa
     8101 ctacttaaga agcttgaacc acacgggttc tgtgaatgac atggaactcc aatattgggt
     8161 gagcaagcta tgattcaact attcgctaac atcatcgaat tggctacaaa acggatggga
     8221 cttgcggttc tgatgctgat tgtgattgta gggtacaaca cgtaccaaat caacgcagtg
     8281 gccgaatcag tcaagtacca acaagacgaa ctcaccaaaa tggtggcaac gcagtacgcg
     8341 tacgatgttc tggctttcgg gcttaaacac accactagtg acggtgagat agtcgaaacc
     8401 gtaaaaaagt ggaaggccga tgggtggtct gctcaaatgg gggcaatcag gacggtgtgt
     8461 tcaaaccacc ccgcccgttt gctagtttta atgagcgagg acgcaaagcg tctgatatgt
     8521 cgtctggcag ggtgatatgc aaaaacgtgg acattttgac attcgagaat ttgtttccga
     8581 agcagacttc aaaaagtacg ggttgaaggc atggcgattc gtgtgtcctg cactactgca
     8641 cacgctgaac actctgcgcg acgacctaga ctgcactatt acggtcaaca actggatgta
     8701 cggcggcaat tttcgttggc gcggcgttcg tagcagcaag agcgccgact acagcgaaac
     8761 gtccatgcat tcttggggta gagcggctga ctttgatgtg aagggcatga ccgcaccaga
     8821 agttgtggtt cacatcatca aaaaccgcga taagtacccc ctaatcacgt tcatcgagat
     8881 tgacatcaat tgggtgcata ttgatgttgg tcaacgtgaa tacaatcctg ctgagggact
     8941 gaagttatgg tcgccaaagc ggaagtatgt cgacatcgac acatatctaa aggagcaagg
     9001 ccatggctaa tccgattttg attcaactag gggcgcagct gttgggcggc gtaatcaaca
     9061 aactggttga gtccgacaaa aatgacctga ccgacgaaca agcggacaaa attcgctgcg
     9121 ctgttggtca ggaatgtggt gtaccaagcg acgcaattcg tgcggtagaa gcagtgaagg
     9181 acatcgttgg tggtgtatcc actatcgctt ctcttgtgcg cgatttggtt tcttccccga
     9241 acaacgattt ggacgaagaa actgcggctc ctgttctgaa agcgttagag caggaagaaa
     9301 agtaatccat atgggctaag gtgttcagat gccaagttta gtcagcattt ataacaaggc
     9361 tttagcccat gtgggggcta agccagtgct aagcgagaca gacgccaata ctcgtgccga
     9421 gatgtgcaac gctatgtatg agtttgcgtt gcgctcagca ttggaagcac gggagtggtc
     9481 gtttgccgct atgcgagtac ggctgttgcc agaccctctt ataactcctg cttggggcta
     9541 taactacgga tatcgactgc ctaacgattg tattcgtgtg tgcgaggtca gagacggcaa
     9601 ctcatacaac atcgattggg cgattgagtc tggattcctg tacgcaacca gaccgactgt
     9661 cgatgttaaa tacaaccgtt tggttgaaga cccgaacgca ttcaccccca catttgttga
     9721 agctttgagt ctgaaattgg cgtctgacat ctgcatcccc ctgaccgaaa acagaggact
     9781 cggaaatgac ttgatttccc gttatctgat ggcggtcagt gaaggcgcgg cactggacgg
     9841 gctacaagcg tctagagaaa gactgcgcgc agatacgcta atcaacgctc gcagaggttg
     9901 cggtcgaatg gacagaccct acccgcaaac gggaagtggc aagttctacg atatcgctcc
     9961 tcctacaatc ccagattcac ctccattagg caacatttct gggccgagtt cagttcagtt
    10021 gggtcaaccg ttcagtttta tcgctcaagt gacgggaacc caaccgattt cgtaccaatg
    10081 gtacaagaac ggaattgcga taccaagcgc cacatcagtc tcttttggtg ttgagtccgc
    10141 gacaaataat gacgaggggg aataccactg cctgttctca aactctgcgg gcattgtagt
    10201 ttccaacaag atttcacttg agattggttg tttccctcct gtccacaata ttactggccc
    10261 gaccactgtt ggggaaggta agtccttcag catggtctgt acagtgacgg caggtaactt
    10321 gcctgtgaca tatcagtggc aacgggatgg ccaaaacata gcaggagcca caacagccac
    10381 attatctgtg gcagcagcta tcgtggctga ctcaggccag tacgattgtt tggtttcaaa
    10441 ccagtgtgcg tcgggtgttt catccaccaa caaggttacg ctggacgtga ttccgttggt
    10501 agttcccacg gtttcaatca gccctacgtc ggcgtctcct ttggagcctg ctcctgttac
    10561 gttcactgcg tcggttgtgg atgacggcgg cgctcctccg gtgacgttga agtggtactt
    10621 gaacggaagt ctggtgcaga acggcggaac tacttatact acgcctccaa ctgccgttaa
    10681 ccaaaaccgg acagtaagcg tggtagggac taactcagtc ggggacagcg ctcctgctgt
    10741 ggccactgtg acgccagtat ccaactttat ttcgcagtcc acgttcacca ctaacgctgc
    10801 gtttactcta catcccgatt gtacgtttgt tcaagttcaa ggatgtggcg gcggcggcgg
    10861 cggcggttca ggccgcactg ccggaggcaa tgacagcata ggcggcggcg gcggcggtgg
    10921 tgcagcattg gtttcagttc tttcgtccaa cgcgattggt ggtcaaactg cgactattgt
    10981 tgtgggcggc ggtggcggcg gcgcggctaa cagagccatt gcggcaggca acggcggaaa
    11041 ttcctctgta tcaggagccg gtattgttgg gttgagctgg acgggaggaa gagcaggagc
    11101 caacggagtc caagggtact atgcctcagg aggcaacggc ggcaacaact cttccaacgt
    11161 tggtgcgggg gctggagcca gttccggcaa tgctgctagt ggcgttagtg gcggcggcgg
    11221 cggtggaaca gggccaggta atggtggctg gagaagcggc aacggcggcg gttctaacgc
    11281 tggtgttggg acatccaacg ggaacaacgc tcaggcagca ggcggcggcg gcggcggtaa
    11341 tagcgccgtt tggtgggaca acgcagctgc aggcaagggc ggcgatggaa ccgctagttc
    11401 aggtgcttcg ggcggaaatg ccacgggcaa cggtaatggc ggcggcggcg gctctggcgg
    11461 aacctcgatt ctgggcaacg gcacagacgg aagcgcaggc ggcaacggtt ccggaggcaa
    11521 ggtgattatc cgtcaataca gacgaccaat ctaaggaaaa atatggcaga cttcagtcag
    11581 accagcttca aggggggcgt aattgctccc cgacttcaat tcaacgaata tgagtcggcg
    11641 taccatcact ctattgagga tgctgtcaac tttgtcgtta ctgaacaagg aagcttaata
    11701 acacgatgcg gctcggagga agttggattg tgccaagatg gcgaagtccg ccttttccga
    11761 ttaccagctg ttgacgcacc ctctaatgac gttatcgtag aggtgggtaa tactaacata
    11821 gctgtttggg ttaatgacgt acgtcaggtg gtggccaata ctcccagcga atggcgcaac
    11881 acgattgacc gaatccaaac agcatacgac accatagggg acgatgcagg tgcagccaac
    11941 acaggacgcc tgattatggt tcatcctgca ttgcagccca aacgactgta ccgcgacaac
    12001 aataatgcat ggcaattcgt gaacatgcac acaggcgcgg ttcctgctga gtggtctcct
    12061 agtaattatc ctcagacagt gggcattttc caaaacagag tttggtatgt gggttctccc
    12121 gttcaccgga cttatttttg ggctacgcga gcaggtaagt tggaagatat cgcgcctagc
    12181 acggccaaca atcctaatga ccctattagt ttcgtgggta ttatggaggg gacgccttgc
    12241 tggattatcg catcttctga cgtgttgacc atcggaacaa caataaacga ctaccagtta
    12301 gctgcctcta ctggtgtgtc ggtcacagcg gcgacggcca tattgcgtcg ttcgtctgtt
    12361 caggggacgg cggcagtcca agggattcct gcggaggagc aagttatttt ctgctcccgc
    12421 aacaagtcca aagtatatgc catgaactat gtcagggagc aggataactg gattcctgac
    12481 gaaatgtcga gccaagcaca gcacttattt acgccgattt cgtctgcgaa gggtgctagc
    12541 gtccgtaggg tcgcctatat ctcagatgcg gcgaagtctc tttgggttgt gttagagaat
    12601 ggtcaaatca attattgttg ttttgaccgc acgacggaca ccaaagcatg gactcaattg
    12661 gagctttcag gcggaaaggt gattgacatc gccgccgcat tcaacccaga ctccgattac
    12721 gcttacgttg ccgtggtcag aagcaaggcg ataaacggag ttcaaaagaa ctacaccgtg
    12781 ttggagaaaa tctcgtcgcc tcgcactgat tggaagagag cagatggatg ggtagtggca
    12841 caagtcaacc aaaacggcga cgtgctgaac ttagacagat acatcggcag aacggcagta
    12901 atcttcagca aatacgggct agaagccgag gttgaagtaa acaatatcgg tttgacgcac
    12961 agaatcaacg gctatgaccc gaacaccgtg tactatgtag ggtacaagat ggatagctac
    13021 ttccgcacat taaccccatc aaatggagac atgaaaaagt cgatgtttgg gagcaaaata
    13081 cggattagca aggtgcagtt agcccttttt gatagcatag agccaactgt aaatggcgaa
    13141 cctgccgacg accgcagcac ggacgacatt atggatgcga gattattaga cttttcttct
    13201 aattcaggca gtagcaacgg cacaagacta gtcgactaca atcctttggg ttgggaaaat
    13261 gacggcaaaa tggtgatagc cgttgagcaa cctttcttat gcgaggtggt cggtgtcttc
    13321 tcagtagttc aatccaacaa ggtatgagca cgatgaaaat ttcaacagca acagcagcag
    13381 gagccggatt gggggcagct ttcggcgcta ttggtgggct aaaggccaaa ggtttgatgg
    13441 acagagaagc cgaattgcgt tggttggcta cccaagaaga agtgcgcaag atggaaaaga
    13501 ctcacaacca aatcctaggc caagccgaag cggatttggg ttcgtcaggc tttgcctcga
    13561 attcagcctc ccaacgctct ttgattgaag acactcgaat ggagatggat aagcaaagag
    13621 cgttgatgtt ggctttcggc aaaacccaaa acaaaataga caaagccgcc tctaacgaag
    13681 ccttgaaggg ttcgattctg tccggcattt cttccggcat cagctttggc agcaccgtgg
    13741 gagattggtt taaatgatta acttaccaac agcagcgcaa ctgcaaacac ctgccactcc
    13801 gtcggcgcag ggtttggcgt cgtccatcat cagcaacaac caaaaagtga tgggcattgc
    13861 caatcaggcc gctagtgagg tgaacaaagt catccaagag cgtaatgacg agcaacagaa
    13921 tgcggcgttc tccaaggtca acaatgtcat gcacgacttt gatgccgcaa acgcgggcaa
    13981 agagtattac acgggtgacg agattcccga cgatttggat tttaagaaaa ccgaaatcca
    14041 aattgacgcc gacggcaacg aagtcgaagt tgttcgcgag cgtattcctg catatgaaat
    14101 ccaagcagca atgcgcgata agtaccatcg caaagcaatt gcggcagcgg cagctgacat
    14161 tgaaagccca tctcgtcgca ctttgttcat gcaacagatg gaagagcggg caaatagcca
    14221 gaatattcgt tacttagagc ggtcggctgc ggaacaaacg gagtcaatac gcagacagca
    14281 aaacgaagac ttcactcagt ctttgctgaa tcgtgattac gaaactgcgg cgtacattgc
    14341 gcacaatttc aatggctccg acaccgagcg ccaagaaaaa gcgcgaaacg tgcggtatat
    14401 gatggaagcg gattcgtacg ccgatgcaat gtccgaggac gatgttggcc gaatgcagtc
    14461 tgccctcaaa tttttgagca aagatggcta tgcaggtgaa ttaaacgaac ctcagcgatt
    14521 ggccacaatc gaccaactga aggcgagaat caacctagtc aacaagcgca acgaggcatc
    14581 ataccaaggt cgtctgaccc ttcttggtgt tgaggtcgac cgtaccattg acgccctaga
    14641 aagcggagaa atggtgtcgc cacagcatca ggctcggttg tttgctcaaa tccaagcggc
    14701 taaagacgca gggttgattt cgagcgaaga ttcttcttgg gttaagcgca cggcgttttt
    14761 ctcagaggcg gctacttact cccctgattt ggtgcagttt aaaagcaaac cgttgcagga
    14821 gcaagaagcc gtaatccgcg aaatgcgtaa ttctgccgtg tccggttccg actatcataa
    14881 gttggatatc tacaccaaga accacgaaaa cgcgaaatca atgctgaaca gcgaccctct
    14941 gatgtacggg gcacaaacag gcatcatcga cttgcagccg tttgacttcg ccgaccctgc
    15001 tgcgtctttg gttaaaagac agaatgacgt tgcttctatg aaatcgcagt atggtgattc
    15061 catggttccc gcctttttca ccaagcagga agctatggaa ttcagccgtg tggttcaaga
    15121 cgcgcccgtt aaagaccaaa tgcgcatgct gtccatcatc aacggtcagt tgagtaagga
    15181 taatgcaaac gctgttcggt cgcagctgat gggcaacggc ggcggtgttt tggccgtggc
    15241 gagcgacgcc ttggatagca accaaccgta cgtggccgaa aagattttga tggggcggaa
    15301 cgcactgaaa gaagtgcctg aggcgtttaa gtcttgggac acggacgcct ctcccttggt
    15361 tttgagcgaa ataggcaatg cgtactccgc tagccctgca accatggggc aggtgatgga
    15421 gtccatcaaa gctgcgtatg ctgcccagac tgtgaatgag ggtgactttt cgggaaccat
    15481 caacagcaag cgcttgaaat cagttatcaa agaagtcacg ggcggtctga ttaaaatcgg
    15541 ttcatccaca atcgtgtcgc cagacagaaa catggatgaa aacaagttcg attcatggct
    15601 aagagacgtc cagcccaaat acctcgatac gttgggtggc gtcaaagggt acaacggaag
    15661 agcgggtgtc atggcgctgc acacacaagt gtcaaacggc gacgtgacaa tggtgaatgt
    15721 cggcaaggac aaatacctac tccgaggcga aaacggattt ttggtcaaaa gagacgaccc
    15781 atctagcgtt ttcattcttc aatacaaccc tgatgctgtg tacgggagta aatggtaatg
    15841 tgggacaaag acacggtaga tttcaccaat cacgctaaca acaacttggc tagaaaagac
    15901 ggtgttgctg agtctgggtt cggttccgga ttcagcgcgt ccgtcgacaa tgaaatggcg
    15961 tcagggcttt ccgtgtctcg ttacataatg agcgcaccaa tcagagagcg aaacgctaag
    16021 attcgcgacc tgatgaacga agaccccgat atcgccagat tccgcagcgt atccatcaac
    16081 cctaacacag gataccctga atctagttat gattatgatg ctgctgcgga ttatttaata
    16141 gagcgagggg atgaaggatt ccagtctact gcagagttga ccgcccaaat ccaagaatct
    16201 gtcaaacaga cagacgaaat gaaccgcatt atcggaacag aggccaatgc tctgggtgtg
    16261 gcaggcagtt ttgcaggcgc gttcgcttcc caaaccatgg agccgctgaa ctatgtggct
    16321 gtaataccag gccttggcca agcagccagt atgtcagtca aagcaaaggc cgcagttggg
    16381 gcagtcgagg gcgcgttagc atctgcgttg gctcaacccg ctatcaaagg ctggaaaaac
    16441 gaaaacgaca tcgaatacac aacaaaagac gtagttctcg atgtcggaat gagtgctgct
    16501 tttggtgggg ctttatccgc tctatcgcat tgggtttcgg gggcgatagg tggaatcaag
    16561 agcaaaaagg ccgaggccgt cagcactgac agtgtagagg cactcaacgc agccgagtct
    16621 cgtctgaatg agttcaagtc tgaagttgag cacctagatg cgctccccga cgagttgaaa
    16681 cctgagacag ccaaggctgc gctagatgcg ttggacgaca cagccaagtt aattgctaag
    16741 ggagaagacc aatggtcgga acctgcaaac ccttatgcca agatggccga cgaggaaata
    16801 gagcctgtgt tggagcaatc tcttggcgtt gagcgcaaga agcctgaggg ggagggtgtc
    16861 gacgtcgaca cccccgaaca ggtcgtgcta aaagacgaga ccctcttcga ttttgaagtg
    16921 gacgggcaaa aggcagcgga tgtggtcaaa ggctacgatg acgacatcaa aaaattggaa
    16981 gacacgttcg cgtgtatgat gggaggctaa catgccaaga aaatgttttg aaggttggaa
    17041 ggaagaagac atcgcaaaga tgttcgggaa aaccgacact gacctaatca cagcagaaga
    17101 tattgccgac gcaatcaaag gcaagaagca agaaaaaatc gctgtgtata aacaggccga
    17161 agctatcaaa aaaggaaacg aagtgttgac gcaatcgaaa gaccctgcgt ccgcgctcct
    17221 tggtatgttg agccgcgacc ctaacgaaga agtaaaattc ctgtctgctg accaacggat
    17281 taacgcaatc cgcgcagtat ctaaggcaaa aatcagcgac ttcatggcgg atttagctcc
    17341 caccactcgt cagatttttg caggtatcgc tacaggcgag cggagactaa cgaagtcaca
    17401 acaacgcctg ttggatgatt ttgtgcacga actgtacgga agacaaacag gaaacgccga
    17461 tgcgctgaaa gcagccaagg ggtggaaaaa ggcaactgaa gacttgaatg cgcgattcgg
    17521 tcaggcaggt ggccacatgg ccgagttaga tgactggcgc ttgcctcaaa aacacaaccg
    17581 catggcgatt agcaaggcag gtgctgacgt ttgggttgaa aaggtgtggg acttgattga
    17641 ccgagataaa atggtcaaaa agctccgcaa aggcaaagac gaagacaatc ttcgtgaagc
    17701 tttgtattcg gtgtataaca acatcgttac cgacgggatg tcgtcaagca agacgctatc
    17761 caaaaagttt actgacatga tgcgcagcga acgtttcatc acattcaaag attcggattc
    17821 ttggcttaag taccaacgcg agttcggcga taccaacgtg tatgcgtcga tgttaggtca
    17881 tatcgacaac atgagccgag caatcgggat gatggagact ttcggcccag accctgacat
    17941 cggattcaac acactggaac gcgcagtcaa aaccaaaaag ggattgacat cgcgacagcc
    18001 aacgggtgct cgtcctacct tcgatatgtt gatgggatac aacatggtcg aagagcagac
    18061 tgtttggggc aaccgtgttg caggtcttcg caacttgtgg acagcgtcta agttgggagc
    18121 agctgttgtg tcggcgttga ccgactcggt ttatgcatca atggccgcaa gttataatgc
    18181 gatgtctccg gccagagtat tgcgccggat gttgtctgaa gtgatgaaac catctaaatc
    18241 agaagcgtcg cgcaaattgt gggcgcaaga ttttggcttt ggtgctgaat ttgcactaga
    18301 ccgtatggcc atgacttccg attatactca aagcttcgga ggtcatcgta gccgaaacct
    18361 agcggaagcc gtgatggtgg tatcaggcat gaaccaatgg acacagtctg ctcgcgcatc
    18421 gttccagttt gagttcgcta ccgccttgac ccgcgccgcc gattctaggt ggagcgattt
    18481 gcctgaaaag atgcgcaatt cgatgggtcg gtatggaatc actgagtccg attgggccgc
    18541 tattgctgct gctccccgca cgaattacaa gggcaataaa atgattgacc ctcgtaacat
    18601 ggacgcagag ctacagacca aacttgttgg tatggtggat ggcgagacaa tgatggctgt
    18661 ccctacaccg gacgctagaa ctcgcgcatt tatggctggt ggcactaaat caggcaactt
    18721 tggcggtgaa ttgcatcgtt cgttgttcat gttccattcg ttcccaatca ctacgattat
    18781 gaaccaatgg agacgagtgt tcacaggcaa gggatacagt ggagcgtttg accgtatgtc
    18841 ggctgcggcc atcatggtgg gagcaacgtc ggtattgggt gtgggcataa tccaagccaa
    18901 agatatacta aacggcaaga aaccgcgcag catgtccgac cctaagcttt ggattgaagg
    18961 catggcacaa ggcggttcat tcaactacat cggcgacctg atgcgcaacg ctgcctctgg
    19021 ttacagccac gatatgactt catatgttgg tggtcccgtt ctagcttacg gcgattgggt
    19081 ggcgatgaca gcggctgaca tggctaaggg agatgcggaa tctgctatgg ctcgtaccgc
    19141 caactttgcc actcagcaaa ttccattcaa caacttgtgg tacactaaaa tcgccacgga
    19201 cagattgttg atggacagaa ttcgccgatt gtccgaccct gagtacgaca agaagcaatt
    19261 gaacaagatg cgcaaaatgc agcgcacgtc gcaacaagaa tactggtggt cgcctcctat
    19321 tggcggtcaa tctaacatcg agtcaccttt tgaggaataa agtatgacta tccagaacaa
    19381 agaacccttt gtatatgcca ctggtaacgg agtgacggcc actattccct tcacgtttcc
    19441 ggccaactcg gcctcggatg tgtatggtgc aatcaacgga atagaccaat cagtaactgt
    19501 ggtgctgagt cccgaccaga taaatagtcc aggcggaaca ttgacattta atggcggcgc
    19561 ggctcccttg ggttcaagtg tcttggtcta tcgcaacaca aagatggagc agactttgtc
    19621 atacccgact aagggcagct ttccatccaa atcacatgag tctgccatgg acaaactggt
    19681 gatgattgcg caggacttga acttcctttt agcatctcgt tgcttgagag cgccgaacgg
    19741 agaaaaattc atcaaggaat tgccaccaat ccaagaacgc gccggaaaat tccttggctt
    19801 tgaccctgca ggtaacccct atgcggcagc tccgattcgc ggcgaggacg gcacaaatgg
    19861 tcttcctcct tacatctcgg acggtactga tgggttcaac gccggaaact gggtagcatt
    19921 ctccattcaa gacaactcgt ataaggatac aggcgtccgt gcccttggtg ttgatggctt
    19981 acctccttac atctcgaacg gcactgacgg gtttacgtca ggaaactgga ttgtcgacga
    20041 tggaagcact aactatgttg acacgggagt gagggcgaag ggagacaaag gcgacaaagg
    20101 cgacgacgct ctatcacctt atgtgtccga tgggactgac ggattcaccg caggaaactg
    20161 ggtcgcggac aatggctccg gtgcctatgc ggacacagga atcggggcaa aaggtgataa
    20221 gggtgataca ggcgatgacg gtctaccgcc ttacatctcg gatggtagtg atacctttgt
    20281 tgcgggcaac tggattgcag acaatggctc tggtgtgtat gttgatacgg gtattcctgc
    20341 tcgaccgaat ttgcaatacg ccacagaaac cacaatcggc ggtatgcgtt ggtcattggt
    20401 tgggactact ttaaacttgt attttacgga cgtttaatat ggcggtatat attcaaggtc
    20461 aagaagtgct gaacattgtt gtccacgtgc ctaattctgc tccgaccgat ttgggtgagt
    20521 ttcgcatggc ggaacaacta gcagcgaagc aaccccaaat cacagcgcag cctgtgggcg
    20581 gttctattta cgattcgcag actttgggtt tgtccatagc ggccaatgtg tttggctcaa
    20641 cggctgcata ccagtggttg gtcgacggcg ctccaatcca aggggctaac tctacgtcct
    20701 ttaccttcgt tccgtcaggg ttgggtactt ttgatgtgac gtgtgagata aaagctttcg
    20761 gcccaatggt cacgagcgaa gtagcctcgg ttacagtcga gcaaactcct gttgatttga
    20821 cttggcaagt cttgcctgca gggtatggtc taccaagcaa tgtcagcgga ctcgttgggc
    20881 tgaacgccat tggttctgat ggctctttag tagtaggagc catgggcatg gaaggcatgc
    20941 gcagcacgga caaaggattg acgtggtcgt atattggcaa cgggttcggc actggacaaa
    21001 catcaggcac tatctcggcc atttgcgtgg tagggaatgt tgtggtggtg ggcggaattg
    21061 caggcagcaa tattggggta gcaggtcggt caaccaacgg aggtgttagt tggaccaaac
    21121 ttcccgattt cctgaacagc ggagccacgg ctagtgccat caacaagatt ttgcacgtgg
    21181 gtggcaacaa gttgatagcg ctattgggga gtggatacgc agccgtgagc aacgatttgg
    21241 gagccacttg gtctgcgctg cctcgttggc tgaatagcgg cggctcggac aacaacacgt
    21301 ccttttttga cggagcggtt acggcaacag gagctataat tgcagtaggc caaaatggct
    21361 ttgcgtcaat aagccggaac ggaggcgtta cttggtccgc acttcctcga tacttaggca
    21421 tgccgaccaa cacttccatt gtcgctattg gtgtgagcga cactgccatc gtagtaggag
    21481 gcaacaacgg taactgcgct atcagcagga atgacggtgt tacttggtct gctctgcctc
    21541 tgaattttgg tgtgccgata gggtcaggta tccgcgaccg ttcaattgcg ggagctagca
    21601 acggcacatt cttagtgggg ctgagtggaa gcccgatatc cggcaacaac ggctatttgg
    21661 cgttgagcta tgatgatggc gtcacttggc aacaaccacc gaggtatttg ggtatcccaa
    21721 atgcagggta tggcgcgttg gtcaacacca tcagaaatat tgatatctta actttcttgg
    21781 tgggctttac tgacaagaga ggagtgagag cggtgagata gggtgtcgac gtcgacaccc
    21841 gcccattatt tgcagtgttt ttcccccaac tggccatatc ctcggatatc gtgccagttg
    21901 tcggggtatt gtgcgtcgcc acaagcaatt cgcgctagct tagttgaaag ctgacgtata
    21961 cactcgcgct gcgcgcggtt taatcgtaat ttaggctcct taaggctgtc cgaagcgaaa
    22021 acgagggttt ggatttgttc gctgatggaa gaaatttctt gaaaatcacc atagcgactg
    22081 ccgcgctcgt tcaacgtctc ggtcagtttg tcttcgagag tttctttgaa atccccacca
    22141 ttcatttcgc tcatatctgg catttctttt tctcctgctt ctttgcaccc ttcgcggtgc
    22201 ggcaaaaaat ctaaagtcaa acagcacttt cttaggttat tagacaactt gcatctccga
    22261 aatcaagcgc tctatggatt cattatccaa aaagccgtgg tggtcatacc aagcatgttt
    22321 catccagttg gaaacgcttt tgtcttcaat caactgacga gagcttgagc catgtatcag
    22381 cagccatcgg ggttgtacgc ttatgctgcg gtcatcgatt gccgccaaaa tccaaagtct
    22441 acggtcgccc aacttgatgc ggtcttgcat gaaccgatgc tgcgcaggtc gcaaggtgaa
    22501 cccattattc acgtctttgc aaatcttgag ttctatcttc agcggaccgt aatcttccaa
    22561 gaaggcgtcc acgtcaggaa cccccgacgc agtgccgccc gtttcgattc gagtgaacat
    22621 accgtgagga gccaattttg gtcttaggta tttccacatt ccgtgttcat ctttcattct
    22681 ccgcctccag ttcgtctggg cttacgccca ccaaaccaaa ttcatcagaa tcaataacca
    22741 acaaagggtg acaaggatgc catccgacga tgatggctcc gtttcctttg tacgtgcatt
    22801 tggttccact ctcccactcc tctttcatat caaaagttct ccgtgtttga tgcgttccca
    22861 tgcgtcgaaa cccgcactag tcaggatttt atctattttg gcgttgttca gcatcgaaaa
    22921 caagcggtgg cgcgtgattt ctgcgactcg ctcagcgtgg cgaccaatgc cgtgttcatc
    22981 aatccaccac gccgcctcaa ccaaatccgc gattttaatc aatgtttggc aagtgggtct
    23041 tctatgattg tttcggtgca gtcaatcagc ccgttaggtt cgatgcctgc ttcgcgcagt
    23101 cgttgtttgg tgacggtcgg catgtcacct aaaatcacct cgtccatgtc gtgagtcagt
    23161 gcttgcatca cgatttcgtt catttcgtcg cccgtaatgc caatatgagc acacatgtgg
    23221 cgagcaatca ttgcgacgtt gaacatgtgt tcagctatgc tttgggttcg ggttgtgtca
    23281 cacagttgcc aacgcgggac gtggccagcc cgtagaatgt tttgtatttg catcatttca
    23341 ttttctcccg cgatattcgg taatcgcttt atgcactcgc gccagaacga agttatagac
    23401 atctgctgcc tcctcaatca cgtgaatcag ctctttagct tcttctagct catttacttc
    23461 accgcgcaac atcgagatga tttcgtctgt gctgcagtct tcgatgcttc ctttgtggga
    23521 gttcatggcc agttttactc tggccatgtt ttcaatcact tggtgggcat cggaatattt
    23581 atccaagtcc cgcgccatat tacatcattt cttcgcgcag ttcaacatca aggaacgtcg
    23641 gaccaaaacc aaggtatttg accttagcat cgcagtagcg agattgcgcc gccacttcga
    23701 tttggtgcac gatgtcttgc caacccatgg gcgacaggta gttacagaag ttcaagaaca
    23761 cttcgtctgg ctggcaagtc cacatggcct tttgcatctg gatgaaactg aagctaaaca
    23821 cgcgacggat tttcttggtc actgtggtca gctcaggcac ttggcctagt tgttcccatg
    23881 tcagctcttc ttggtcaggg tagtgaccgc ctgacgttcc gcccacgcga atcggatgac
    23941 agcgagcagt gccgattact ttatttagca taggcagagg gatacccatg tctgctagga
    24001 atcgagcagg tgtgcagtca cggctagtgc agtacgggta gaattcttgg tttagagaca
    24061 ggctgaaacc ttgggcgcct tccgccagaa ttcgttcact ggccatcagt gccatgtccc
    24121 attcttcaac agtacacacg tattgagcga tgcgaccgtc atattgcgcc acgtcgcggg
    24181 ctacgattgt gttattggtt gggtcgcgct gtagcttttc aaccatagct gccattgatc
    24241 cttggcctgt gctgccgatt gatgtggcga ttccgacttc agcttttttg tgtgcttctt
    24301 cgtctagaac tgttgccatc gggtgaatca aaatagcgac cttgtcgtgc aacaggtctt
    24361 tggacatttc gatttcttcc atcagacggt tgatgctgaa gacgctacct gcaccaagca
    24421 tgacgcgttt taagttcgga ctcacgatac cgttgggcag aaccttgtgc atccacttac
    24481 ggccttcggc gttgatgtag gtgtggcctg catttggcat gttggcattg attacggtgt
    24541 catagccgtt cttctccgcc agataacccg cgattaaacc ttttcctgtg ctgccgaatt
    24601 gtaggtcaat aactaagtct acgtttttca ttgtgtttcc tcttgtgtgt tgtgggtgtc
    24661 gacgtcgaca ccctattctt ccgtgtcgga ggttccgaca tcaataccgg tcatcttgaa
    24721 taacagtgct ctacacgcgc tatggttcat gatttcaaac atccgctttc ttggcccacc
    24781 gtgtggattg gcaggacgac agtcaacaaa cttgaagtcc cgttccacct tggcatagaa
    24841 tgctggcttg gttagtcgtt ttgctccgtt cgcctgacac cattcttggt aatcgacgta
    24901 gagcgaagct ttgtccacga actgtggcca atcgacttcg tcgccgaact cttcatagcc
    24961 agtgacccca atgactccgg cctcaacctt atcagcccac cattcaacaa ctgaatcagt
    25021 tgttgtgtag cgagcgcgct gttccatcaa tagcttggtt tcaggtgctt tacgcaggtc
    25081 tgacttgatt tcgcggttac gaagctcgta catcatcgct tcatacccgc cattttccat
    25141 ctgtttccaa atagcgtcga agtatgattt atcgctagcg aacgaatccg gaacgtcgat
    25201 aacaaaccaa cgtctggaat gcggtccggc aggaataaac cagtcttcgt ttgacgcaat
    25261 catcaagcgc agacagttgc ggtaaggagt agcatccaag cctttgcgct caatcatcag
    25321 tttcttctct gtgaccaagc ctttgagcgt acccgctacc tttttattgc cgccgtacgt
    25381 gacctcgtca gcaaaaacca agagtgcttc ctctaagtgg ccgttgaatt tgccaatcag
    25441 ctgttcctct tggatgatgt gcttgtagtg ttggccaaac aactcgccga acacgttagc
    25501 aatcgtgccc ttacctgtac cttcgatgcc tttcatcaca acagcacagc cttttgggtt
    25561 catagggtct tggagtgcgt cagcaaacca gtccatcaac cactcgtagt gctcctgtga
    25621 gccaaccacc gctttaacgt gtttcttgaa cagcgaccag tcacctgcta cttccttgta
    25681 tcgccacccc tcccacacgt taaaacaccc gtccacttca cgcggcttat ctggcatgaa
    25741 cgtcagaccg tttacgaact cgcggcgctt ttcgttcaca aaccaaatgt ccgacttttg
    25801 gacaggtttg gatttccctt tcgagtcacc gtaccacacg atgtcattgg ccatcaaggc
    25861 cttgaaatcc tgaaccgaca tcagcttgaa gttgtcttgg aacgggtcgg ggttgaactg
    25921 ctccatcaaa atccgcagtt tgttccccac catgaccacg ccaaacttct tgttgtattc
    25981 ggctaccacc gagtcagtgt cctcggacgg ctcctcggct cccttgggtt cggtgtttgg
    26041 cttaaagccg ttcttctgag caaaataaat caaagtcccg acacgaatag tgccgtgttc
    26101 atcgaaactc tgccaacgga tggacacttc gtcgggctta tatcttgctc cgcgctgcga
    26161 ccatctgtct gccagttcat agccttggtc atcagggtac tgactatgca cagcctgcag
    26221 caccgccaac cattcatcgt actcaagctc gtcggggtcg atgtattcca acatccgcca
    26281 gatttggcga ggagtgtatc tcgtctccaa gtcgtcttca tcgatttctt ccgagccgcg
    26341 attcatgttg cccgtccacg gaaccccaag cgcgtctgaa atccacttag gtatctcagg
    26401 cacgtcgcct agtgtgggca tcgaccatgt gtattcgccc tcgtcgcgaa ccgatggcca
    26461 cgctacgatg tgcgatttac atgaatcttc atcgccgccg cgcgtgtcaa ttgccttggc
    26521 gattttccct gacgaggatt tggcgtactt atcccattgg aataagtaat gacgtccacc
    26581 agtcggagtc tcttggattg gagccaccaa cttgccgtac ttctcttcca gtatggctag
    26641 gttatcaaat cctcggtttc ccttcgaatc ttcaacatca atatcaacgg caaaaacacc
    26701 gcctcgcttt ccgcaagcga tacccaagtt gaacccacgg aaccgaccgc cgacaccaaa
    26761 ccaagaatca attgtgttct tgttttttga tgcgtgttgg tatccaatgt tgtacatctt
    26821 tgatggcagc gatttgccat taggcatgac tgggattaca tatagaccgt ttttgatgta
    26881 gaatcttgcc gcagcgtgta ctctgtcggc gaagtcctta atctgaccaa tctcatgtat
    26941 ctcttgtgca ctaatgtaca tcgattaatc cttttgcttc ggcccaattc ttgccaacgc
    27001 catcgaattc caacagtaag ggaacgcgta aggtctgtcg ctctacggct tttttgaccc
    27061 gttcccatat tggtttccaa ttctcgtcaa cagacattga gtaggaatcg tgagtgttga
    27121 gaatcatcga cccgtcgctg cccaacgcgt cttcaattct cagccagttt tctttgtttt
    27181 catcagcagc cgttgcttga atcaaaattc ccgacgcttt gtacgacttg tacccgttag
    27241 ggaatcggag tcttctgcca tgggctgttt gtatccagcc tctttcttcg gctatcttct
    27301 gtgctctcgt cgccagagtt ttcacccctt ggatttgagt gtggtaggcg gcaatgacgg
    27361 cttttgcctc tggacccgcc tttttatagc gaattaaatc acccttcttg tcggtgaact
    27421 cgcaccactc ccatggcatg cctaagctat cggccaccgc accatcgcca cggttaaaaa
    27481 tcatgccaag gttcatttgc ttggcgtttg cttggcctga ataggaggcg ttgcgcggta
    27541 ttcccatcaa atcacccacc cattggtgca ggtcgagttc agggttttct gcgtacgctc
    27601 tcgcaatcgc agggttgtac gccgccacca gatgggcgaa aatacgaacc tcaaacgagg
    27661 ccatgtcgga atcgagccac agttggcctt cttccggcag gaatgctggc ttgataatgg
    27721 ccgcaattcg cttgttgcga gacggaatct gctgcagtgc gggtccagtg taagacaatc
    27781 tgcctgtccc cgtccctccg tcttctccct tcatctgatt gatgttagga taaactcgac
    27841 cgccgacgct gtgctcaaca acgtgtttgg ccaagaaagt gtccttggtt ttgatgttgc
    27901 ttctcaattc caagactgca gcggctagtg ggtctttcat tgcgcgaagt gcgtcggcgt
    27961 ccaaacacgg gttgcctgtc gccgttcgct ccaaaatagt gccatcgcgc gaagtccaca
    28021 cgccgcgctc ttctttcgcg ccgaacacct cgcgcacttg tttcggcgag ttcgggttga
    28081 actctcttcc agccaattgg aacatcttgg cttggttctc cctcaccacg ccatccattt
    28141 taaggattgc ctgttcggcg tagtttaagt caaccctaac tccacgcgct tcggctcgaa
    28201 tcagagtcgg cattaccttc cgctcaaaag ctactatttt ctcaagaccg cgcttggcta
    28261 tgagttcctg ctgctccagc cacaattcca aagtcaactc ggcgtccgga caggcgtatt
    28321 ttcttaccag tccacttggc gctcgataga gattcggcat ttgtgtcttg cgggtggcct
    28381 tgcctccgaa catagcagcc agttcatcat aaatctcagc gtatttctgt gctcccacgt
    28441 acttcttcgc gaggtagtca aggctatagt cacctgcttt gccacgagtc caagggaaaa
    28501 tagttgactc atgctcatta atgcagcagg ctcgtatgcc tgtatcatca atctgcgaaa
    28561 gaggtaactt aattccggaa tgtagcgaca ttctgtagtc aaatgacgcg ttatggcaca
    28621 cgattgttcc cttgtaggag tcagcctgtt caacaagcca ttgtaccgcg tcaggctgct
    28681 ctcgaatatc gaaatatccg ctttgcccgt cgggagttgc gacgctgaat ccaaagacct
    28741 tatccacttt gtacttgagt cccgtacact ctgtgtcata agcccacgcc tcatatttag
    28801 tcaggtcgat gaaacccatt cgtcgacctg ttctttccca atctagccgc atgtttcctc
    28861 ctagaatgga atatcgtcat cgaaatccat tgggggttca ttgtattttg ggcgggttcc
    28921 gtcctcgtgg ctgtcaccgt acgcagtgcc gaattgcttg tcatcctgag ggcgacgaac
    28981 acctgctgct ctcacttgga ttgacaagaa cttgccattg tcgtgggttt tagtccaagc
    29041 agagatttcg tactcggctc cttcgacaat cacgcgccct accatgtctg gtcggttgcc
    29101 gattttgtcg cggttgtttt ccaagcgccc tgagccagtg agactagcgt cgtctttgcc
    29161 tgttaaggag agagaaatgt agtggtcgtc agacatgaaa tcttcttgac gccatcctgc
    29221 aagccaatag actgtgccac ggatgtctac tttccctgtg aaatgagggg atttgtcgtt
    29281 ctttggttgg cggtttttgc caagagtacc acggttggtg ttatcatatt gagccattta
    29341 agtctctcca gtaaaaagag ggtgtcgacg tcgacaccct agggttgtgt taagagggag
    29401 gattacattt cgtctgggaa atcagacatg tcttccattt cttcgttgtg ctcgtaggta
    29461 gcaccgccag ttgatggcgc tgaacctttg gcatcgttca tgtcgattga cttagcacca
    29521 gacttaactg cttcgtacat cgactcaccc aacgcataag cccattctgg agcgtaacca
    29581 actttcttga acgtccagtt gtagtattcg cctttttctg acttatcgtc aaccacgcta
    29641 aaacgaagaa cgtgggcaaa gcggtcacca cctgccatgc gcagttgggt gttgaggcgt
    29701 ttcgacactt tgatttgcga cttagccatc gaaataacgg cttcttgggc tgtcttcttg
    29761 gcagggtcga taatcagcac gaattgttgg tgcgtgtcga cgatttcgag ttctgcgcga
    29821 tttggcagtg ccttcaacgc ttctactgca gcagcttcgg ttggataaga accgtggaag
    29881 ccgtttgtat ctgcgctgcg ctcagctgtc caaattaaga actctttacg gaagtaaacc
    29941 ggaatcacat acagaccgtc ggtgaacagc tcttcggttg cagtgttgaa agccatgcct
    30001 tcttccgcgc cttcaatgta cttggcgtga gtctttttct tttgaggaga aagcgcttgg
    30061 atgatttgga ttcgaggaat cgtcaagtca tcagagctta cgtcttctga accacggcct
    30121 tgctccatct tgccttgcaa gtgggctggc agttgtgcag atgagaacat ttcttcttcg
    30181 ttgattgcta cttcattttt cttagttgac atgattttgt ctccattgac agttatttcg
    30241 ttactagttg cttcgttact tttcgttaaa aggctgttgc tgagattatt taacgcggtc
    30301 atcgtccaca gccaagttct acccgcgaat cactactttt tggtcactgc cgctcggtag
    30361 aacggttcga ccttgattag gtgctcaggc aattcgcagc cttcttcacc ttccgcatcg
    30421 cgtttggcca tgtccttagc ccaagcctta acagtaccag gttgtgcata aggtttgacc
    30481 attccgccgt gaccgttctc ttcgagccat tgatagaact cttcacgatg ttcggccaac
    30541 acggtgacgt aggcatcttg ggttaaaccc agacggccaa cgcctttgac gttcaatgac
    30601 gtcaattctt gttcatccat catttcgggg atgacgtgca gacgcaggta gtcaaactcg
    30661 ttttccatgt tcgatttgat tttggcgatt ttgtcaatct cctctttcat ctcgaccatc
    30721 atgcgagcca gctcagctag cgtcttacct ttgaactttt cgcgccattc gaggtcaagt
    30781 tcacctttat atccactcat gttttcgctc ctgtggtggg tggtatacat ctattataac
    30841 acagtccggt gtctgtgtca agttatgttg cacggcgtgt agtggcaatg cggcgttgaa
    30901 gttcttcatc tactagcacc gctaagtctt tcttggattt gagcgctcgc cctaccatca
    30961 agtccgcatc cgctttacac caaatgtcaa tgtaggtaca cacattccgt tgacctttgc
    31021 ggtggtttct atcctcggac tgtagccgct gctccaaact aaaggagttg gagtaatagt
    31081 aagcaaatgt tgcgatagta agcgtgatgc ccattcccgc tgtctgttgg ttagcgacga
    31141 agaatcggga cgggtcagag ctatcttgaa agcgaggtat agacgccttt ctgtctgact
    31201 ctgaaattcc gccgtggtat tcaataacgc tgtcatcgcc ataaacctca cgaagtcgct
    31261 tggagatttg ttcgatttcg gctcggaatc tagcccaaat gatgaccttg gcgtttctat
    31321 ccaaatcagc gatatcttcg agcatcgcat ccattttcgg gttcgggcca gaaataggtt
    31381 tgacatcgta cgctccgtcc ttatccaaaa acgggaaatt gccgcccaat atctgctgaa
    31441 agcgggtcat tcggtccaga acagtagaca ccgtcaatac gtctccatct tgttccgtct
    31501 cgaagaagtc cttcagctcc ttcatcgcag acagttgttc tttcgtaggc gaaacggtta
    31561 tactgcggta caccttttcc ggcaagtcca aacactctgt cttcttcact tgatacacat
    31621 agggagcaat cttgtccatc agctcctctt ccctttgata accaagtacc tttttccctt
    31681 ggaaaccacc catgatgcag tacatatttc gaaagacgaa gaagctcttc aacccgatta
    31741 tatgttcgcc aagaaatctg aactgaccaa acaggtcgat tatcccttgg gtgattggcg
    31801 tccccgtcaa aatcatccga tacgccgcgc tgtctccgca gcgaatcgcc ttttttgtgc
    31861 gagcagcatc cgcattcttg atacgagaag attcatcgac aacgaccaat gcattgtgtt
    31921 ttcggacaaa agccaaagct aattcgtgcg ccttgccttg ggatagagct tccactccta
    31981 tgaccaaata cttaagcttg tcttcgtgtt cggattcgat gaaacgcatc gtctctttgt
    32041 caccgcccga atcgtggacg tgtgcaatcg aagggactgg cgacatgtct cgtacttccc
    32101 actcccaaac gggtttgatg ggggtcggta caatgaccag tactccgtct atctgacgtt
    32161 ggttgaatcg atgccctgcg agggcgatgg tggtgaacgt tttgccagtg cccatttcca
    32221 taaacagagc gaattctgtt ttattccacg cttttcgcat ggcttgggtc tggtgttcca
    32281 ttggtgagat tccgtcaggg taacggaata cgttgcgagg ttctattttc atatcgttcc
    32341 tgcttgcgtt gggttgaagc gcagcaccaa cccaagaggc tagttggtgc tacgtgttat
    32401 tcttcgtctg ctaccttgcc tttagcaata gcagcttcgg cttggatttg ctttccggtg
    32461 tctgaccaac ggaattgctc gtgtcgccgt acggccacgt tggccaactc acgagccaat
    32521 ttggacttga cgcccagact ggataaaaaa gcggctaaat cgctaacggt cacgttgcca
    32581 gccacgtgac cgtgttgttt gattgagtac tcacgcacag caagattgac gtgttctgct
    32641 atcttgcttt cgagagaagc tatatcatca gcgatttctt tgattgactg aatggacgag
    32701 tcctttcctt catccgtcca ttcagtctct ggcgcttttg cgccgctcat tatgcgttat
    32761 tatccgcgcc tgagccgtct tcatcgccgc cagtagtttc ggcatcggct tttgccttag
    32821 ctttcgcttc agcttttgcc tttgcttcag cttctttagc cgccgctttt tccgcagctt
    32881 ctttagcttt gcgttctttt tctgctttaa tcgcttcttc acgagcgtta acagcagacg
    32941 caaacttgtc gaccacggta ttgaagatct cttcaccttt gccagtcact agctccggta
    33001 cttcagctag ttgaggcttt tcaggtgttt tcagtggagg aattgaagct gggtcttccg
    33061 ctttcgcgat tttggcgttg aattcagcag tcagcttatc cacttctttc atgtgcataa
    33121 ccaacagctt ttcgttcgcc ttagtcacgc gctccacttc cttggcgttg cctttatcca
    33181 gtgcagcgat tgcgccacgg atacggttgc cgaggttcat gcgctgcatg ccttcgttta
    33241 gatgttggta tttcgctacc agtgtgtcga cgtcgacacc catcatttca gcagctacag
    33301 catatacttc gctcaaaacc aagggtgcta gacctactgc cacaacgtcg ccgctgtgaa
    33361 gagaggtgtt gcctttggca gtgcgggttt tttggtactt gtctacgcct gggcgtacta
    33421 cagttttttc tggttgagtc atcgtcgtgc tcctacgatt ggggtttggt tagtagattg
    33481 aaagggcggc aggtgcgtca tcgcatctac ctgccgccac tagactttta ttataccaca
    33541 tgactacagc tacgtcaagc ggtgttgcat ctggttagtg taactcaggt gcgtaacggt
    33601 gtgacgagtg tagcggcggt gtatctaaat ccattaccgc ttccaccgtc cagaatcgga
    33661 ggttatgaac ctcgttgcct atctttctgt aggctaaaat cccatcgccc ttgcctaggt
    33721 tccggtcaag gacaactgga ttttcaccac ggaaatctac caacacccga tgggctgatt
    33781 tctcccaatt caggctgatt gcgttcaaca ggtacacaaa gccacggtgc atgcgatgcg
    33841 gaatttcgtg cggtgcgtac gatgggcggc gagcattgac tcctcgctgc agtaggtact
    33901 gcaccacgga caggctgcat tcagcatagt ggagtctatg aaacacaggg tctatgtgtt
    33961 catcgccaca caacatggcc acgcaagcag ccatgcaggt gtcagaggtc ggttgtttaa
    34021 cgagctttat tggtttcatt ttaataccac gctttccatc aagccacggg agaagggaat
    34081 agaacgaccg aagtagtgcc cgttccattc gcggtctttt gctacgtgaa ccagttcaat
    34141 caagtgaagg tcacggtcat caaagtgcca gctcacttgc ccttggggtg tttcgacata
    34201 caacacccac atctgcattt gttcgtcttt tttacgccac acatcccagc ccgcagcgat
    34261 agccgccgac gtaaaaaacg aaagcgctag tgctcgctca gaataagcac ggtcaacgcg
    34321 ttccgaatca cgactagcgt tattaatgag ggttagctct tctctggcag catcgaccat
    34381 gtcttgctct tcttgagttt caacaatttc ttcaaagaag tcaatcagtt ttttgatttt
    34441 acccatctta tcgctcccgt tggtggattc ttaagcgaat tctcgccatc acttgttctg
    34501 ccctttccat catgtcgtca ccaaagctga tggtttgcca gtctagtgaa ccatcgggac
    34561 cggaatgagg gtctaggctg acgtatttaa ctgcttcgtg tgcgtagggg atttctgaaa
    34621 ggactgacgc ccaaacccaa atagacccgt acacagggtg gaattcaacc gaaatcttgt
    34681 acttgttttc gtacttgagt gtgacgtctg tggcgaaagc cactaagtgg ctcatagttt
    34741 tggccgctag gcggcgaatg tctttgcttg ccattgtctg gctccttaag tagggtgtcg
    34801 acgtcgacac ccatctagtt gttagttgcg gtgttcgcag atttcgtagt ggtcgtcgct
    34861 catgtctttc agctctttca gcttgcgacg gaacgcgttc aaaccactct ttgcgagttg
    34921 ggtcacctag cttcttatcg gctagcacgt gcatctcttc cgtttccttg agaatcttct
    34981 caatcaggaa gtccacttca cctagtcggt ctaggtactg ctcggcaggt gagcgcttga
    35041 ttggagattc gctgctcttt tctgcagcga tgtatttctt gggttggctc ggcttttggc
    35101 gcagcttcag ttgacttgcg tgtgcgctcg cctgtcatgc ctttttcagg ctgaggagcg
    35161 gcggcagcaa gagcaatctt tttcatgtcg cggatgtttt tgacgcttgg gatgttgcct
    35221 gtctcaatca gcttttccac gtctgcttgg actgataggg gtgcgtcttt caattccaaa
    35281 aggtgggact gacctaggtc tgagttcagc atcttttggc tgattgtgcc atctttcact
    35341 gcgcggtgca gcagcatggc tttgttcgcg ttttctttgg attcgaaagg cgtgtttttc
    35401 actcgccact caccgaattt gatgtcgtcg ttaattaagc gacgcgcgtc gtccaataaa
    35461 ccgcccatct ggatgaaagc tttcttagcc gtcatttcta ctttgttgta ttcttcgcga
    35521 atagcaactt cgattgactt gagttcgttc aggtctaccg ttgataggcc gtaggtctgg
    35581 atttctgttg acatttcaat ttcctcttgt gggtgtgtca ccatcgacac acctattata
    35641 acacatgtac gtatgtgcgt caagctctat tgcagcgcac cgttgataaa aactgcaggg
    35701 aacactacca tcaagtcagg ctcgccttcc tgctccttga ttcgggcaat cttttgcatc
    35761 ccgtacttga ttaggtcatc gcacttgtcg tattgcattg accacttagt gccgaatttc
    35821 tcaaacatca gttcgcgaca acgctctgaa tctttggcaa ctatttcaac gtaggtgttt
    35881 ggaaaagctt ggccgcagcc gaatgtgaag tattgggtta catgagtatc tcctatttga
    35941 acactggacg taggccgtgc tgcagcgcaa cggcgcggat tgaaccattc tttttggctg
    36001 tgcgaatcat ttcacacgac catttctcgc cgccgcgaat acgcataata aaggaatcac
    36061 gcataaacgt aggacaaccg cgagtgattt cgcgtttcac tgaatccgga caatccaaat
    36121 cttcgatgcc gtacttggca tacagggctt ggtagtcttc gcggattctg gctttctgcg
    36181 cgttggtggt ttgagccact gtcttgcgca tggtgttgac tgtagccatc atgctcgacg
    36241 gcttgatgct cggcagtgtg tcgacgtcga caccgccttt gcgaaagttt ttggagaacg
    36301 aacacaacac caaggcactt ggtctgaagt ctcggttctt ccacacaatg tttttggttg
    36361 agcgaatcgg gtcactctgt accgcacttg ctatgctgat ttcggcaaaa agtttcatct
    36421 gctgctccta gaatcgatat tcatagtcaa acgtaatcac tgcgccgtcg cttcccactg
    36481 gaggcaacac acccacattg agccatcccc actcggagtt gcctaccgac acgtaagggt
    36541 tgacaaaagg aatcacagac ccgaataaag gcgacataga tacgcccact tcatcgtatc
    36601 cggacgccgc acctaatcgg acgcccacat caatgccgct cacgatttgg gttcgaggcg
    36661 accaaaatgc cgctattgag ttgttatcat acgagttttt aaaccacaac aggccgaagt
    36721 ccttgtattg gacgcctagg ccgtagttat tctcgttgta gtccacgtcg gtgttcaaat
    36781 gcttagaccc gattggagta ataactgacc attctgcgcc gtgtgcgttg gtggctccga
    36841 tgattacggc agcagtcaat gccgttgccg ctcctactat tgtcgcacta acggcggtgg
    36901 ccactatggc cgctttaaaa gtcctttaca catgttagtt ccttactagt tgagatagga
    36961 gggacacgcc ctcccctaaa taaaaaattg caacaaaaac caaaaatagt gctacgcact
    37021 gcagtgtcca tttaatcatg ccactcgtcc tccgtgggct gcgtccaact gcttgtacac
    37081 gctcattggc atagtgcagt tatagccgca catcaggttt tgttcccgtc tctcttcagg
    37141 tgtgtacaac cacgcccaat agtgagactt ctctgtgcct tgttggccac gccgtctagc
    37201 cgtcgccact actaggcgtc tcatttctga gacttgctga caaaggtctt ccattttgtc
    37261 agggattctt ttgaatcgtc cggtgtcgca attacctacc agacgtccgt acaggtgttt
    37321 gtgctctgcg accaatctgt ctctcatagt cgcgtagtaa aacttcgaca actgtttacc
    37381 tgcgagcgat gggtgcattt gaatcattac gcgttcccct ctggatagcc caccacgcgc
    37441 cagaatgttg cttcaataaa agctgtggta gggacacgac cacctcggtc gtagtacatt
    37501 gaattgtagc agcgataacc ataggcttgg gcaatcgcct ctttcacctt ggcttgagtc
    37561 gtcttgtatc cgcgcttgcg taaatctgag gtacgtgcgc gaatcaagtc gattagggtc
    37621 gtgttttcca ttgttgctcc ttgttggaat gcggcagagt gcctgtcagc atgcccacga
    37681 taccacaccg cgagcatggt gtcaatcact attgggttaa gtccttgatt aaagcataga
    37741 cgtgcaccac ttcaatcacg ccttcggtca ctgcgtacac ggctacggtt tcaactcccg
    37801 acagcccttg ggatgttaac cacgggtact cggctctcca cggcgtgttg gtgatttcct
    37861 ctttcttgcc ctgcatcgtc actaggtctt tatcaactgc ccacagcgcg atgcctaggt
    37921 tgttcttatt gcccatgttc gttacctgca ccaacaagtg gttgcgagag ttgaacgtga
    37981 atctaactaa tctgtccatt gcggactcct tacatgttcg gggtgtgtcg accgtcgaca
    38041 ccattgttcc ccgtcgagtg aactctatgg agcgccctaa cccaaggacg ctctaacagc
    38101 ttactctatg ctaccaccgc catgattgcg tcgcgtagcg tcgggaaaag tgggtaactc
    38161 actttgctct ttgagtcggg cgtcaccttg tagaatcgcg tgtagttgcg cgtccctacc
    38221 atgcgactga tgataaaagt gcctccctca taaccgccgt tgctgtcctt gagccgcacc
    38281 acgtagaatc ggcctttgtc acctgcgatg atgctcacct tgtaattagg ttcgtacttt
    38341 ttcatggtga cccccttact tcactagagc gtgtggacgg tgtttagggt ctaggtcttc
    38401 cgccgtccag atggctggca gtgattccat caactctttc acgtcgtctt cagtaagctc
    38461 gccacgtttc accgcgttgt tgatgcggtt gccgcagttc atgcgcatct gaccattgtt
    38521 gagatgggcg tacatgcggt agtagactag cgattcctcg gtctgcgctt cgcccattcc
    38581 taggaggagc gccaacactt gagctacctg cgcgtggtcg tagccttcca tgtaacgagc
    38641 cgtgattgac gccgttgatg attggctctt accacccttt gcagtcagcg acgggcgata
    38701 ggtgcggcgg tacttgttga gtgtgccgct catgcctttt ggcttgtcat cggcttgctc
    38761 gtcgtcagct tgctgcggtt caacccaagg gctgaggtgc ttcgcctgta acttgacggt
    38821 gttccctgcg tccagtagca cggtgtgcca tcctttctta acctcggtca ctgttcccac
    38881 tagctcgtct gcttcgtgtc cctgtttgct caccaccact ctggcgtcca gttcgtagtt
    38941 gctcatgttg tgcctcctaa ggctctggtt gttgcggcag cccccgtggc cacctcttgg
    39001 tttgtgttct tattttaaca cactttcgga tgcctgtcaa gtacccttgc aagtcgggct
    39061 actctggcat gcggaaatgc gctctcagat accgtcctgt ggagtgtccc gtccgcaatt
    39121 ctctggacac gacagatgcc cgaagaaagt ctctggacag ccgaccgata tcgccgacgg
    39181 tgggacacgg tggacacggt ggacagaccc gccatactgc actggacacg gtggacaggc
    39241 cgcaagtagc tggacaggcc gcgaaccccc gtcggacggg cgtctgtcca ccgtgtccac
    39301 cgtgtccatc tctaaaaaaa tcagaatctg gagatatcgt cgactagtcg aaaacgccgg
    39361 aaaaaaacga tatcgtcgga cggtggacat cgggacacgc tggacatttc tcattcgaga
    39421 taaggtcttc gactccagcc ggaggctttg acgaaagatt ctcgtgcgcc cccttggcat
    39481 cggccttcgc ccccacttcg cgcccatcgt ttccggctct cggcgcgtta cctgtgcccc
    39541 ttgcccatca tcctgcaaat gtcgccacga tggtgtgctt aacgtgcacg gcgcattgcc
    39601 aaaccaacgt acgcgacccg tcgtgtgatg tggtgtccga caatagttcg taatcgctgc
    39661 tcaacatctc ggcatccaac tcgccgtgcg ttaccatgcc caataggtca atggcatcag
    39721 ccttgcgcca ttcacccgtc acgccctcaa gcgactgctc gccagtcatt gtgtcgtgtt
    39781 ccatcatgta gccagtctct ttgattaatg ttgtcattgt gttatctcca gtggtgaagg
    39841 gctgattgcc ccg
//