LOCUS       AY452667                2219 bp    mRNA    linear   PLN 27-JUL-2004
DEFINITION  Chlamydomonas reinhardtii flagellar radial spoke nucleoside
            diphosphate kinase mRNA, complete cds.
ACCESSION   AY452667
VERSION     AY452667.1
KEYWORDS    .
SOURCE      Chlamydomonas reinhardtii
  ORGANISM  Chlamydomonas reinhardtii
            Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae;
            Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
REFERENCE   1  (bases 1 to 2219)
  AUTHORS   Patel-King,R.S., Gorbatyuk,O., Takebe,S. and King,S.M.
  TITLE     Flagellar radial spokes contain a Ca2+-stimulated nucleoside
            diphosphate kinase
  JOURNAL   Mol. Biol. Cell 15 (8), 3891-3902 (2004)
   PUBMED   15194815
REFERENCE   2  (bases 1 to 2219)
  AUTHORS   Patel-King,R.S. and King,S.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-2003) Molecular, Microbial and Structural
            Biology, University of Connecticut Health Center, 263 Farmington
            Avenue, Farmington, CT 06030-3305, USA
FEATURES             Location/Qualifiers
     source          1..2219
                     /organism="Chlamydomonas reinhardtii"
                     /mol_type="mRNA"
                     /db_xref="taxon:3055"
                     /note="derived from dbEST AV645300"
     CDS             122..1882
                     /note="p61; contains three IQ motifs"
                     /codon_start=1
                     /product="flagellar radial spoke nucleoside diphosphate
                     kinase"
                     /protein_id="AAS15573.1"
                     /translation="MAELEKTFALIKPDAVRAGKAQEIMQLIELNGFTIIAKQKLQLT
                     RARAEEFYGEHKGKEFFPKLVNFMTSGPIWALVLAKPGAILAWRALMGPTNVFKARAE
                     QPKCLRALYGTDGTQNATHGSDSPISAAREIKFFFPTLSGDPTIYAEPTAAAEYITKR
                     IQPALAKALAALAREKPSADKFEAITFVAGYLLQNNPNKPKVLMPDEWDPALMGDDED
                     DEADFINARLAAPTGNDGATKAEFDAMVEAAKADTGGAAPAQEFVYPDSKPTTPVVPA
                     PPAPGSKPPSASGARPQSARPTSARPPSASAAPPAPLAPVPPPASSSRPASGSGRPPS
                     ATARPPSATPPPPPPAVELEEADDPAQLDEAATKVQAAFRGYQARKEVAVMRSEAQPG
                     EAAAEPEQEAELQPEAEPEPQPEGEQEPQPQASASSSFLPDGVTEEMAAEAATRVQAH
                     MRGHLARKQVAAIKAQQAAPAVAESSEALAEPEPQPEAEAEPQPQASVSSSFLPDGVT
                     EEMAAEAATLVQAHMRGHLARKQVAAIKAQQAAPAVAESSEAQAEAEQTEAEAEPQPD
                     AEAEAGAAEGEAEPEPEAAE"
BASE COUNT          416 a          688 c          799 g          316 t
ORIGIN      
        1 gcaagcttca cgtcatcaat taacacatta cttaataaca attataagtc ttctatctga
       61 gttcggtccc gctgagtttc ggtccttgct ttcaagcctc cttagctgct gagacgtcac
      121 catggcagag ctagaaaaga ctttcgcgtt aatcaagcca gatgccgtgc gggccggcaa
      181 ggcgcaggaa atcatgcagc ttatcgagct gaatggcttc acgattatcg ccaagcagaa
      241 gctacagttg acacgggccc gcgcggagga gttctatggc gagcacaagg gaaaggagtt
      301 cttccctaag ctggtgaact ttatgaccag cgggcctatc tgggcgcttg tgctggccaa
      361 gcctggtgcc attctggctt ggcgtgcgct gatgggccca accaacgtgt ttaaagcccg
      421 cgcggagcag cctaagtgcc tgcgcgcgct gtacggaacg gacggcaccc agaatgccac
      481 ccacggcagc gactcgccta tcagcgccgc gcgcgagatt aagttcttct tccccacgct
      541 gtctggcgac ccgaccatct acgcggagcc cactgcggcc gcagagtaca ttacaaagcg
      601 catccagccc gctctggcca aggcgctggc tgcgctggcg cgcgagaagc cgtccgccga
      661 caagttcgag gccatcacct tcgtggcggg ctacctgctg cagaacaacc ccaacaagcc
      721 caaggtgctc atgccggacg agtgggaccc agcgctgatg ggcgatgacg aggacgacga
      781 ggcagacttc atcaacgcgc ggctggcggc acccaccggc aacgacggcg caaccaaggc
      841 cgagttcgac gccatggtgg aggccgccaa ggcggacacc ggcggcgccg cgcccgcgca
      901 ggagttcgtg tatcccgaca gcaagcccac cacaccggtg gtgccggcgc cgccggcacc
      961 gggcagcaag ccgccgtccg ccagcggcgc ccgcccgcag tcggcgcggc ccacctccgc
     1021 gcggccaccg tcggcgtcag ccgcgcctcc ggcgcccctg gcgccggtgc cgccgccggc
     1081 gtcctcatcc cggccggcgt cgggctcagg gcggccgccc tcagcaacgg cgcggccgcc
     1141 gtcggccacg ccgcccccgc cgccgccggc tgtggagctg gaggaggccg acgacccggc
     1201 gcagctggat gaggcggcga ccaaggtgca ggcggcgttc cgtgggtacc aggcgcggaa
     1261 ggaggtggcg gtgatgcgca gcgaggccca gcccggtgag gccgcggcgg agcccgagca
     1321 ggaggcggag ctgcagccgg aggcggagcc ggagccgcaa cccgaggggg agcaggagcc
     1381 gcagccgcag gcgagcgcct ctagcagctt cctaccggac ggcgtgacag aggagatggc
     1441 tgcagaggcg gcgacgcgtg tgcaggcgca catgcgtggg cacctcgcgc gcaagcaggt
     1501 ggcggcgatt aaggcgcagc aagcggcgcc cgcggtggct gagagctcgg aggctctggc
     1561 ggagccggag ccgcaacccg aagcggaggc ggagccgcag ccacaggcga gcgtctctag
     1621 cagcttccta ccggacggcg tgacggagga gatggcggca gaggcggcga cacttgtgca
     1681 ggcgcacatg cgcgggcacc tcgcgcgcaa gcaggtcgcg gccattaagg cgcagcaagc
     1741 ggcgcccgcg gtggctgaga gctcggaggc gcaggcggag gcggagcaaa ccgaggcgga
     1801 ggcggagccc caaccggatg cggaggcgga ggctggggca gccgagggtg aggccgagcc
     1861 ggagccggag gccgctgagt aagggcacag agcatggggt tgcaggagca taggccttgt
     1921 atacgtgtct gtctgatttg ctgctagcgt aaggttattg gtcgacctgg tgggtgggcg
     1981 atggtttgca aggcacggtg gcattgtcaa ctaaatatgg tcgcacgctg cgggccagcc
     2041 gtacaaagtg aagtcccgca gtgagcaagc gccgtgcggt gagagtgtgt cctacattgg
     2101 aaagccctgg atggagcgtg gcgcatagca ggagagctgg cgtgctgtga ggtgcctcct
     2161 gtgtcggttg cgaagagcgc cgcgttgcag cttgtgacgt gaatgtaagg tcaaatggc
//