LOCUS       AY446894              235646 bp    DNA     linear   VRL 02-JUL-2013
DEFINITION  Human herpesvirus 5 strain Merlin, complete genome.
ACCESSION   AY446894 AY156043 AY169797 AY325310
VERSION     AY446894.2
KEYWORDS    .
SOURCE      Human betaherpesvirus 5 (HHV-5; HCMV)
  ORGANISM  Human betaherpesvirus 5
            Viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae;
            Cytomegalovirus.
REFERENCE   1  (bases 1 to 235646)
  AUTHORS   Davison,A.J., Akter,P., Cunningham,C., Dolan,A., Addison,C.,
            Dargan,D.J., Hassan-Walker,A.F., Emery,V.C., Griffiths,P.D. and
            Wilkinson,G.W.
  TITLE     Homology between the human cytomegalovirus RL11 gene family and
            human adenovirus E3 genes
  JOURNAL   J. Gen. Virol. 84 (PT 3), 657-663 (2003)
   PUBMED   12604818
REFERENCE   2  (bases 1 to 235646)
  AUTHORS   Akter,P., Cunningham,C., McSharry,B.P., Dolan,A., Addison,C.,
            Dargan,D.J., Hassan-Walker,A.F., Emery,V.C., Griffiths,P.D.,
            Wilkinson,G.W. and Davison,A.J.
  TITLE     Two novel spliced genes in human cytomegalovirus
  JOURNAL   J. Gen. Virol. 84 (PT 5), 1117-1122 (2003)
   PUBMED   12692276
REFERENCE   3  (bases 1 to 235646)
  AUTHORS   McSharry,B.P., Tomasec,P., Neale,M.L. and Wilkinson,G.W.
  TITLE     The most abundantly transcribed human cytomegalovirus gene (beta
            2.7) is non-essential for growth in vitro
  JOURNAL   J. Gen. Virol. 84 (PT 9), 2511-2516 (2003)
   PUBMED   12917473
REFERENCE   4  (bases 1 to 235646)
  AUTHORS   Dolan,A., Cunningham,C., Hector,R.D., Hassan-Walker,A.F., Lee,L.,
            Addison,C., Dargan,D.J., McGeoch,D.J., Gatherer,D., Emery,V.C.,
            Griffiths,P.D., Sinzger,C., McSharry,B.P., Wilkinson,G.W. and
            Davison,A.J.
  TITLE     Genetic content of wild-type human cytomegalovirus
  JOURNAL   J. Gen. Virol. 85 (PT 5), 1301-1312 (2004)
   PUBMED   15105547
REFERENCE   5  (bases 1 to 235646)
  AUTHORS   Gatherer,D., Seirafian,S., Cunningham,C., Holton,M., Dargan,D.J.,
            Baluchova,K., Hector,R.D., Galbraith,J., Herzyk,P., Wilkinson,G.W.
            and Davison,A.J.
  TITLE     High-resolution human cytomegalovirus transcriptome
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (49), 19755-19760 (2011)
   PUBMED   22109557
REFERENCE   6  (bases 1 to 235646)
  AUTHORS   Wilkie,G.S., Davison,A.J., Stanton,R.J. and Wilkinson,G.W.G.
  TITLE     Direct Submission
  JOURNAL   Unpublished
  REMARK    Consensus viral genome sequence in the original urine sample
            confirmed from Illumina data as being identical, except for the
            mutation at 176311
REFERENCE   7  (bases 1 to 235646)
  AUTHORS   Davison,A.J., Akter,P., Cunningham,C., Dolan,A., Addison,C.,
            Dargan,D.J., Hassan-Walker,A.F., Emery,V.C., Griffiths,P.D. and
            Wilkinson,G.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-SEP-2002) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, UK
REFERENCE   8  (bases 1 to 235646)
  AUTHORS   Akter,P., Cunningham,C., McSharry,B.P., Dolan,A., Addison,C.,
            Dargan,D.J., Hassan-Walker,A.F., Emery,V.C., Griffiths,P.D.,
            Wilkinson,G.W. and Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-2002) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, UK
REFERENCE   9  (bases 1 to 235646)
  AUTHORS   McSharry,B.P., Tomasec,P., Neale,M.L. and Wilkinson,G.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JUN-2003) Infection and Immunity, University of Wales
            College of Medicine, Tenovus Building, Heath Park, Cardiff CF14
            4XX, UK
REFERENCE   10  (bases 1 to 235646)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-OCT-2003) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, UK
REFERENCE   11  (bases 1 to 235646)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-AUG-2007) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, UK
  REMARK    Sequence update by submitter
COMMENT     On or before Aug 14, 2009 this sequence version replaced
            AY156043.1, AY169797.2, AY325310.1, AY446894.1.
            The original gene nomenclature has been retained. Genes presumably
            inherited from the common ancestor of alpha-, beta- and
            gammaherpesviruses (core genes), from the common ancestor of beta-
            and gammaherpesviruses (betagamma genes), or from the common
            ancestor of betaherpesviruses (beta genes) are indicated. A
            standard protein nomenclature has been applied so that orthologs
            have the same name in all herpesviruses.
FEATURES             Location/Qualifiers
     source          1..235646
                     /organism="Human betaherpesvirus 5"
                     /mol_type="genomic DNA"
                     /strain="Merlin"
                     /isolation_source="urine from a congenitally infected
                     child"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:VR-1590"
                     /db_xref="taxon:10359"
                     /country="United Kingdom: Cardiff"
                     /collection_date="1999"
                     /collected_by="Gavin W.G. Wilkinson"
                     /note="originally named strain 742; passaged 3 times in
                     human fibroblasts; gene UL128 is mutated; populations of
                     mutants in RL13 predominate, but the consensus sequence of
                     this gene is not mutated;
                     acronym: HHV-5; HCMV"
     repeat_region   1..1324
                     /note="TRL"
                     /rpt_type=inverted
     repeat_region   1..578
                     /note="'a' sequence"
                     /rpt_type=direct
                     /rpt_type=terminal
     gene            1324..2386
                     /gene="RL1"
                     /locus_tag="HHV5wtgp001"
     regulatory      1324..1329
                     /regulatory_class="TATA_box"
                     /gene="RL1"
                     /locus_tag="HHV5wtgp001"
     misc_feature    1325..194343
                     /note="UL"
     mRNA            1356..2386
                     /gene="RL1"
                     /locus_tag="HHV5wtgp001"
                     /product="protein RL1"
                     /experiment="Northern blot"
                     /experiment="RACE"
     CDS             1367..2299
                     /gene="RL1"
                     /locus_tag="HHV5wtgp001"
                     /note="RL1 family"
                     /codon_start=1
                     /product="protein RL1"
                     /protein_id="AAR31561.1"
                     /translation="MPATDTNSTHTTPLHPEDQHTLPLHHSTTQPHVQTSDKHADKQH
                     RTQMELDAADYAACAQARQHLYGQTQPQLHAYPNANPQESAHFRTENQHQLTNLLHNI
                     GEGAALGYPVPRAEIRRGGGDWADSASDFDADCWCMWGRFGTMGRQPVVTLLLARQRD
                     GLADWNVVRCRGTGFRAHDSEDGVSVWRQHLVFLLGGHGRRVQLERPSAGEAQARGLL
                     PRIRITPISTSPRPKPPQPTTSTASHPHATARPDHTLFPVPSTPSATVHNPRNYAVQL
                     HAETTRTWRWARRGERGAWMPAETFTCPKDKRPW"
     regulatory      2367..2372
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RL1"
                     /locus_tag="HHV5wtgp001"
     gene            complement(2489..5852)
                     /gene="RL5A"
                     /locus_tag="HHV5wtgp002"
     mRNA            complement(2489..5819)
                     /gene="RL5A"
                     /locus_tag="HHV5wtgp002"
                     /product="protein RL5A"
                     /experiment="Northern blot"
                     /experiment="RACE"
     gene            complement(2489..5000)
                     /gene="RNA2.7"
                     /locus_tag="HHV5wtgp166"
     ncRNA           complement(2489..4969)
                     /ncRNA_class="other"
                     /gene="RNA2.7"
                     /locus_tag="HHV5wtgp166"
                     /product="RNA2.7"
                     /experiment="Northern blot"
                     /experiment="RACE"
                     /note="involved in apoptosis"
     regulatory      complement(2505..2510)
                     /regulatory_class="polyA_signal_sequence"
                     /note="RNA2.7, RL5A"
     regulatory      complement(4995..5000)
                     /regulatory_class="TATA_box"
                     /gene="RNA2.7"
                     /locus_tag="HHV5wtgp166"
     CDS             complement(5389..5676)
                     /gene="RL5A"
                     /locus_tag="HHV5wtgp002"
                     /note="RL11 family"
                     /codon_start=1
                     /product="protein RL5A"
                     /protein_id="AAR31562.1"
                     /translation="MDMRKLNTSQGRNLTTVDDRRRFSIGWETWDDGGESLYDVTNNG
                     TTVINTTACVSSCSHTSLVLCNMTQQTDSLYGVGHRLNDEEDGELWRVSVS"
     regulatory      complement(5847..5852)
                     /regulatory_class="TATA_box"
                     /gene="RL5A"
                     /locus_tag="HHV5wtgp002"
     gene            complement(5959..6504)
                     /gene="RL6"
                     /locus_tag="HHV5wtgp003"
     mRNA            complement(5959..6473)
                     /gene="RL6"
                     /locus_tag="HHV5wtgp003"
                     /product="protein RL6"
                     /experiment="Northern blot"
                     /experiment="RACE"
     regulatory      complement(5975..5980)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RL6"
                     /locus_tag="HHV5wtgp003"
     CDS             complement(6025..6360)
                     /gene="RL6"
                     /locus_tag="HHV5wtgp003"
                     /note="RL11 family"
                     /codon_start=1
                     /product="protein RL6"
                     /protein_id="AAR31563.1"
                     /translation="MTLIYVDADNTRNELKATTGSNFTITHRKDPLTTKWKTVFGNNG
                     DQWLCNVTGIGNATVNGNATICVSSCGHNTLDLCNLKSGDSGFFDLSRWFGENMDEYS
                     GDVWHLEVS"
     regulatory      complement(6499..6504)
                     /regulatory_class="TATA_box"
                     /gene="RL6"
                     /locus_tag="HHV5wtgp003"
     gene            complement(6759..13155)
                     /gene="RL8A"
                     /locus_tag="HHV5wtgr003"
     mRNA            complement(join(6759..8196,12992..13121))
                     /gene="RL8A"
                     /locus_tag="HHV5wtgr003"
                     /product="protein RL8A"
                     /experiment="RACE"
                     /experiment="RT-PCR"
                     /note="RL8A CDS spliced from one or other of >24 exons"
     gene            complement(6759..8458)
                     /gene="RL9A"
                     /locus_tag="HHV5wtgr002"
     mRNA            complement(6759..8426)
                     /gene="RL9A"
                     /locus_tag="HHV5wtgr002"
                     /product="protein RL9A"
                     /experiment="RACE"
     mRNA            complement(6759..8393)
                     /gene="RL9A"
                     /locus_tag="HHV5wtgr002"
                     /product="protein RL9A"
                     /experiment="RACE"
     gene            complement(6759..7811)
                     /gene="RNA1.2"
                     /locus_tag="HHV5wtgr001"
     ncRNA           complement(6759..7781)
                     /ncRNA_class="other"
                     /gene="RNA1.2"
                     /locus_tag="HHV5wtgr001"
                     /product="RNA1.2"
                     /experiment="Northern blot"
                     /experiment="RACE"
     regulatory      complement(6777..6782)
                     /regulatory_class="polyA_signal_sequence"
                     /note="RNA1.2, RL8A, RL9A"
     regulatory      complement(7806..7811)
                     /regulatory_class="TATA_box"
                     /gene="RNA1.2"
                     /locus_tag="HHV5wtgr001"
     CDS             complement(7912..8184)
                     /gene="RL8A"
                     /locus_tag="HHV5wtgr003"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein RL8A"
                     /protein_id="AEJ33666.1"
                     /translation="MPHGHLRQALSPTSWTCEGLLLLLGLLVLFFHHHNQSAVERRRR
                     VSFVEADRLPHESGWYSSDDDGDRDGDEETGESHNRNSVGLSAVFS"
     CDS             complement(8250..8393)
                     /gene="RL9A"
                     /locus_tag="HHV5wtgr002"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein RL9A"
                     /protein_id="AEJ33667.1"
                     /translation="MSLDAASHQPAARRLLDSALVRRVLACMIIVIMIAISIWILTYV
                     LFL"
     regulatory      complement(8420..8425)
                     /regulatory_class="TATA_box"
                     /gene="RL9A"
                     /locus_tag="HHV5wtgr002"
                     /note="nominal"
     regulatory      complement(8453..8458)
                     /regulatory_class="TATA_box"
                     /gene="RL9A"
                     /locus_tag="HHV5wtgr002"
     gene            8601..9113
                     /gene="RL10"
                     /locus_tag="HHV5wtgp004"
     CDS             8601..9113
                     /gene="RL10"
                     /locus_tag="HHV5wtgp004"
                     /note="type 1 membrane protein; possibly related to RL11
                     family"
                     /codon_start=1
                     /product="envelope glycoprotein RL10"
                     /protein_id="AAR31564.1"
                     /translation="MYPRVMHAVCFLALGLISYVAVCAENTVTTNCLVKAENTHLTCK
                     CNPNTTSNTNNGSKCHAMCKCRVTEPITMLGAYSAWGAGSFVATLIVLLVVFFVIYAR
                     EEEKNNTGTEVDQCLAYRSLTRKKLEQHAAKKQNIYERIPYRPSRQNDNSPLIEPTGT
                     DDEEDEDDDV"
     gene            9142..9846
                     /gene="RL11"
                     /locus_tag="HHV5wtgp005"
     CDS             9142..9846
                     /gene="RL11"
                     /locus_tag="HHV5wtgp005"
                     /note="type 1 membrane protein; binds IgG Fc; involved in
                     immune regulation; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein RL11"
                     /protein_id="AAR31565.1"
                     /translation="MQTYSTPLTLIIVTSLFLFTTQGSSSNAVEPTKKPLKLANYRAT
                     CEDRTRTLVTRLNTSHHSVVWQRYDIYSRYMRRMPPLCIITDAYKETTHQGGATFTCT
                     RQNLTLYNLTVKDTGVYLLQDQYTGDVEAFYLIIHPRSFCRALETRRCFYPGPGRVVV
                     TDSQEADRAIISDLKRQWSGLSLHCAWVSGLMIFVGALVICFLRSQRIGEQDAEQLRT
                     DLDTEPLLLTVDGDLE"
     gene            9850..11094
                     /gene="RL12"
                     /locus_tag="HHV5wtgp006"
     CDS             9850..11094
                     /gene="RL12"
                     /locus_tag="HHV5wtgp006"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein RL12"
                     /protein_id="AAR31566.1"
                     /translation="MRVDRQKRNNFTYRQTVYIILTFYIVYRGKCNSTDTNNSTSTSD
                     STVSDTSVYSTPNLPSTFFTTLDTSTGSQISTTSNTISSTTNTLAASSITTLNTSTNT
                     TSYTASTLTALSSTHTNSPILSNNATLYTTSLDNTTTDITSSESSINASTIHNTTYSP
                     VTSIAVNCTVAANETNNSSSKNCQQDIGTIRVKSTTLTAEEGKNITIQGNSTWNCPNV
                     VWYRHYNWSTHGHHIYPNRRYQTPTYQHKILTSHPICHPDVSSPAAYHDLCRSCNKTE
                     LRIYDLNTTNSGRYSRRCYKEYNHDGPHEDENFGLTVNPRNDTDNHTTPLCPRYVGTQ
                     SEEDEDDDYTLSTITNNNMRKTSHRDISHGTRTTWALTLICIACILLFFVRRALNKRY
                     RPLRDDISESSFVVRYHPEHED"
     gene            11189..12070
                     /gene="RL13"
                     /locus_tag="HHV5wtgp007"
     CDS             11189..12070
                     /gene="RL13"
                     /locus_tag="HHV5wtgp007"
                     /note="type 1 membrane protein; RL11 family; consensus is
                     wild type, consisting of several mutants present in
                     different populations"
                     /codon_start=1
                     /product="membrane protein RL13"
                     /protein_id="AAR31567.1"
                     /translation="MHWHLAITWTVIILTFSECYNQTCPCPCICVNSTTVSISTSETT
                     SKNITPTTTTNSKKTTSSIATTTPSLVTTGKVVSTAASSTIISQTNRSHTSNAITTPK
                     TRFEYNITGYVGQEVTLNFTGSWNYIQWFRYGSPGWLYSSEPICTVTSNYHHTFPRGA
                     LCFDCDMTKLLIYDLTLNDSGKYVVKRTRHDNQYEEACYSLTVIFANTTSIVTNRTCD
                     RKRTENTDTTNHEIGKHIIETIKKANIPLGIHAVWAGIVVSVALIALYMGNRRRPRKP
                     RYTRLPKYDPDESWTKT"
     gene            12174..12830
                     /gene="UL1"
                     /locus_tag="HHV5wtgp008"
     CDS             12174..12830
                     /gene="UL1"
                     /locus_tag="HHV5wtgp008"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein UL1"
                     /protein_id="AAR31568.1"
                     /translation="MGVQCNSKLLLLAVLITIILSSILVQAIPHKQKTSYQQLLLQSE
                     HVQIPITVAEGDTICFNVSDNPCNFSSYWNHNNCELCGWTPFYSEYAGYSENKSCHPR
                     FTCLHDTKGLKLHNVTTNDSGIYTRNVYYCDIPCNISDDHKHNVEDFDNCNTTINRTH
                     YIITVSSSRYSKRTNSHVATHVGWTATVVIIICVLTYVNVTTTLKHRLRTRNNVNHTM
                     "
     gene            complement(13211..13390)
                     /gene="UL2"
                     /locus_tag="HHV5wtgp009"
     CDS             complement(13211..13390)
                     /gene="UL2"
                     /locus_tag="HHV5wtgp009"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL2"
                     /protein_id="AAR31569.1"
                     /translation="MAEDSVTILIVEDDDAYPSFGSLPASHAQYGFRLLRSIFLIMLV
                     IWTAVWLKLLRDALL"
     gene            13821..14270
                     /gene="UL4"
                     /locus_tag="HHV5wtgp010"
     CDS             13821..14270
                     /gene="UL4"
                     /locus_tag="HHV5wtgp010"
                     /note="contains signal peptide; RL11 family"
                     /codon_start=1
                     /product="envelope glycoprotein UL4"
                     /protein_id="AAR31570.1"
                     /translation="MMLRTWISLPMVLLDAYCFCIFVSCSISTTTAPVEWKSPDRQIP
                     MNITCANYSGTVNGNVTFRGLQNKTEDFLHWLLGWGHKSICSFFPKLQGNKEQHYMYG
                     ITNLTYNCTYDRLTLLNLTTENSGKYYFKREDVNSTFYYSCYNLTVT"
     gene            14358..14858
                     /gene="UL5"
                     /locus_tag="HHV5wtgp011"
     CDS             14358..14858
                     /gene="UL5"
                     /locus_tag="HHV5wtgp011"
                     /note="contains potential transmembrane domain; RL11
                     family"
                     /codon_start=1
                     /product="protein UL5"
                     /protein_id="AAR31571.1"
                     /translation="MFLGYSDCVDPGLAVYRVSRSRLKLMLSFVWLVGLRFHDCAAFE
                     SCCYDITEAESNKAISRDEAAFTSSVSTRTPSLAIAPPPDRSMLLSREEELVPWSRLI
                     ITKQFYGGLIFHTTWVTGFVLLGLLTLFASLFRVPQSICRFCIDRLRDIARPLKYRYQ
                     RLVATV"
     gene            14965..15807
                     /gene="UL6"
                     /locus_tag="HHV5wtgp012"
     CDS             14965..15807
                     /gene="UL6"
                     /locus_tag="HHV5wtgp012"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein UL6"
                     /protein_id="AAR31572.1"
                     /translation="MNGWAGVCLITHCLNTRSRTYVALNMLAFARTPRGVPSCLFNKV
                     WVSRYALVLILMVCASESSTSWAVTSNGLPNCSTVTRTAGQDAELHGPAPLSCNVTQW
                     GRYENGSTPVLWCTLRGSRMRVSLGHRVAFGCSWKTFFIYNVSESSGGTYYQKGYNCT
                     DKHITLSCFNLTVVPRAVQSTTTVMTPTLVTNSTFSVSLVALRLTTNSSAFGHAIYQR
                     QQRVENGTLSKNITNLAFTYGSWGVAMLLFAAVMVLVDLGLPQSAWRRWRSHVDDEER
                     GLLM"
     gene            15865..16941
                     /gene="UL8"
                     /locus_tag="HHV5wtgp014"
     CDS             join(15865..16449,16552..16941)
                     /gene="UL8"
                     /locus_tag="HHV5wtgp014"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL8"
                     /protein_id="AAR31574.2"
                     /translation="MASDVGSHPLTVTRFRCRVHYVYNKLLILTLFAPVILESVIYVS
                     GPQGGNVTLVSNFTSNISARWFRWDGNDSHLICFYKRGEGLSTPYVGLSLSCAANQIT
                     IFNLTLNDSGRYGAEGFTRSGENETFLWYNLTVKPKPLETTPASNVTTIVTTTSTVTD
                     AKSNVTGNVSLAPQLRAVAGFSHQTPLENNTHLALGEGFVPTMTSSRLSASENYDGNY
                     EFTETANTTRTNTSDWITLGSSASLLKSTETAVNLSNATTVIPQPVEYPAGGVQYQRA
                     ATHYSWMLIIVIILIIFIIICLRAPRKIYHHWKDSKQYGQVFMTDTEL"
     gene            15865..16533
                     /gene="UL7"
                     /locus_tag="HHV5wtgp013"
     CDS             15865..16533
                     /gene="UL7"
                     /locus_tag="HHV5wtgp013"
                     /note="type 1 membrane protein; modulates cytokine
                     production; involved in immune regulation; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL7"
                     /protein_id="AAR31573.1"
                     /translation="MASDVGSHPLTVTRFRCRVHYVYNKLLILTLFAPVILESVIYVS
                     GPQGGNVTLVSNFTSNISARWFRWDGNDSHLICFYKRGEGLSTPYVGLSLSCAANQIT
                     IFNLTLNDSGRYGAEGFTRSGENETFLWYNLTVKPKPLETTPASNVTTIVTTTSTVTD
                     AKSNVTGNVSLAPQLRAVAGFSHQTPLENNTHLALVGVVVFLVLIVVCIMGWWKLLCS
                     KSEL"
     gene            16947..17648
                     /gene="UL9"
                     /locus_tag="HHV5wtgp015"
     CDS             16947..17648
                     /gene="UL9"
                     /locus_tag="HHV5wtgp015"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL9"
                     /protein_id="AAR31575.1"
                     /translation="MSKRLQVFPWITILFYTSKSQYWNYMTIPCTPTVGYGSHNISLH
                     PLNNSLFQDDVFEWYIDKPMVTNKLCLYQSNERIKSNLDSPNIMWQCTDNRTLILMNL
                     TTTYSRNYYFQSFKYLGQGVPKPNNLCYNVSVHFTHQTHCHTTTSSLYPPTSVHDSLE
                     ISQSFTSTNFTHTAVHYAAGNVEAQHDTATSHTMWIIPLVIVITIIVLICFKFPQKAW
                     NKFTQYRYSGMLAAA"
     gene            17776..18540
                     /gene="UL10"
                     /locus_tag="HHV5wtgp016"
     CDS             17776..18540
                     /gene="UL10"
                     /locus_tag="HHV5wtgp016"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein UL10"
                     /protein_id="AAR31576.1"
                     /translation="MRQLINHIVNHDLFRWSVVTAMIFYRYSETCMEVTVRVGDPVTL
                     GSGHGYHPGQKVHWYNQSCVGIGNGENTHPICTYDPPKPGRQKTMKTTPLPSPLLYEC
                     HNSTLSILHVNVSDPRNYCRRKCPPKGNCEFPTCFTLSLISRTTTRKPEQKTTLLRLK
                     TTPNKHTQHKRSTRRTSPKDYNVTGLPKGFADSFTGNVEAHRTKDAAHSAWILIIIII
                     IIVVILFFFKIPQRLREKWDTKGYLYKGTDGLPTTD"
     gene            18642..19460
                     /gene="UL11"
                     /locus_tag="HHV5wtgp017"
     CDS             18642..19460
                     /gene="UL11"
                     /locus_tag="HHV5wtgp017"
                     /note="type 1 membrane protein; disrupts T cell function
                     via inhibition of CD45; involved in immune regulation;
                     RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL11"
                     /protein_id="AAR31577.1"
                     /translation="MLFRYITFHREKVLYLTAACIFGVYISLHDACIPVVGKIGTNVT
                     LNAVDVLPPRDQVRWSYGPGGQGYMLCIFTGTSTTTFNNTRFNFSCLSNYSLLLINVT
                     TQYSTTYRTMTSLDHWLHQRHNHGSRWTLDTCYNLTVNENGTFPTTTTKKPTTTTRTT
                     TTTTQRTTTTRTTTTAKKTTISTTHHKHPSPKKSTTPNSHVEHHVGFEATAAETPLQP
                     SPQHQHLATHALWVLAVVIVIIIIIIFYFRIPQKLWLLWQHDKHGIVLIPQTDL"
     gene            19658..21079
                     /gene="UL13"
                     /locus_tag="HHV5wtgp018"
     CDS             19658..21079
                     /gene="UL13"
                     /locus_tag="HHV5wtgp018"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein UL13"
                     /protein_id="AAR31578.1"
                     /translation="MLWAHCGRFLRYHLLPLLLCRLPFLLFFQRPQWAHGLDIVEEDE
                     WLREIQGATYQLSIVRQAMQHAGFQVRAASVMTRRNAVDLDRPPLWSGSLPHLPVYDV
                     RSPRPLRPPSSQHHAVSPELPSRNGIRWQYQELQYLVEEQRRRNQSRNAIPRPSFPPP
                     DPPSQPAEDARDADAERAESPHTAESTVSHDASDNAVRRRHERRRYNALTVRSRDSLL
                     LTRIRFSNQRCFGRGRLRHPAGSGPNTGGPRPGGAGLRQLRQQLTVRWQLFRLRCHGW
                     TQQVSSQIRTRWEESNVVSQTATRVRTWFVQRTTLWRRTWVPGQNPAAEAQELAIIPP
                     APTVLRQNEEPRQQLTGEETRNSTHTQREEVEDVSREGAREGNDGSRASGNDERRNNA
                     GRYDDDHEVQEPQVTYPAGQGELNRRSQEENEEGGPCESPPMTTNTLTVACPPREPPH
                     RALFRLCLGLWVSSYLVRRPMTI"
     gene            21229..22212
                     /gene="UL14"
                     /locus_tag="HHV5wtgp019"
     CDS             21229..22212
                     /gene="UL14"
                     /locus_tag="HHV5wtgp019"
                     /note="type 1 membrane protein; possibly involved in
                     immune regulation; UL14 family"
                     /codon_start=1
                     /product="membrane protein UL14"
                     /protein_id="AAR31579.1"
                     /translation="MGGGRLPPLWLPLLIAWSEWGNCCLDAPPVVRSPCLQPVRDRNR
                     ERNPGSPQLLPYGDRLEVACIFPAHDWPEVSIRVHLCYWPEIVRSLVVDARSGQVLHN
                     DASCYIAGGRWRFEDGGAAQRLSLSFRLITETAGTYTCVLGNETHSLATETTALVADV
                     HDLRHSDRSCDLAFGSRSQTRYLWTPDPSRLRSINCGWEGERHRVVHYIPGTSGLLPS
                     CEEDERELCVPFISQSIADNNCSRRHRVDGARRRYHLRRDYWLTDPKIGLLAAGSVAL
                     TSLCHLLCYWCSESYRRLNTEEENEAAEETAAGEASAVAAAAVSEEEQQRE"
     gene            22225..22533
                     /gene="UL15A"
                     /locus_tag="HHV5wtgp020"
     CDS             22225..22533
                     /gene="UL15A"
                     /locus_tag="HHV5wtgp020"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL15A"
                     /protein_id="AAR31580.1"
                     /translation="MKRMIRSHGRKTECQMTGAGERRGSAVGALICGSGTRRGSGANE
                     RRDSDVGPIAHSSGTRRGSANETSACTRTDHQKADIGLWFMFLVFGLCSWLAMRYRAQ
                     "
     gene            22754..23446
                     /gene="UL16"
                     /locus_tag="HHV5wtgp021"
     CDS             22754..23446
                     /gene="UL16"
                     /locus_tag="HHV5wtgp021"
                     /note="type 1 membrane protein; inhibits NK cell
                     cytotoxicity; sequesters MICB, ULBP1 and ULBP2; acts on
                     activating receptor NKG2D; involved in immune regulation"
                     /codon_start=1
                     /product="membrane glycoprotein UL16"
                     /protein_id="AAR31581.1"
                     /translation="MERRRGTVPLGWVFFVLCLSASSPCAVDLGSKSSNSTCRLNVTE
                     LASIHPGETWTLHGMCISICYYENVTEDEIIGVAFTWQHNESVVDLWLYQNDTVIRNF
                     SDITTNILQDGLKMRTVPVTKLYTSRMVTNLTVGRYDCLRCENGTMKIIERLYVRLGS
                     LYPRPPGSGLAKHPSVSADEELSATLARDIVLVSAITLFFFLLALRIPQRLCQRLRIR
                     LPHRYQRLRTED"
     gene            23554..23868
                     /gene="UL17"
                     /locus_tag="HHV5wtgp022"
     CDS             23554..23868
                     /gene="UL17"
                     /locus_tag="HHV5wtgp022"
                     /note="possibly related to UL19"
                     /codon_start=1
                     /product="protein UL17"
                     /protein_id="AAR31582.1"
                     /translation="MDHALFTHFVGRPRHCRLEMLILDEQVSKRSWDTTVYHRRRKHL
                     PRRRAPCGPQRPAEIPKRRKKAAVLLFWHDLCWLFRRLFFPREDSEPLMSDPARSPEE
                     EE"
     gene            23977..25083
                     /gene="UL18"
                     /locus_tag="HHV5wtgp023"
     CDS             23977..25083
                     /gene="UL18"
                     /locus_tag="HHV5wtgp023"
                     /note="type 1 membrane protein; inhibits NK cell
                     cytotoxicity; acts on inhibitory receptor LIR-1 (ILT2);
                     involved in immune regulation; MHC family"
                     /codon_start=1
                     /product="membrane glycoprotein UL18"
                     /protein_id="AAR31583.1"
                     /translation="MMTMWCLTLFVLWMLRVVGMHVLRYGYTGIFDDTSHMTLTVVGI
                     FDGQHFFTYHVNSSDKASSRANGTISWMANVSAAYPTYLDGERAKGDLIFNQTEQNLL
                     ELEIALGYRSQSVLTWTHECNTTENGSFVAGYEGFGWDGETLMELKDNLTLWTGPNYE
                     ISWLKQNKTYIDGKIKNISEGDTTIQRNYLKGNCTQWSVIYSGFQTPVTHPVVKGGVR
                     NQNDNRAEAFCTSYGFFPGEINITFIHYGNKAPDDSEPQCNPLLPTFDGTFHQGCYVA
                     IFCNQNYTCRVTHGNWTVEIPISVTSPDDSSSGEVPDHPTANKRYNTMTISSVLLALL
                     LCALLFAFLHYFTTLKQYLRNLAFAWRYRKVRSS"
     gene            25080..25376
                     /gene="UL19"
                     /locus_tag="HHV5wtgp024"
     CDS             25080..25376
                     /gene="UL19"
                     /locus_tag="HHV5wtgp024"
                     /note="possibly related to UL17"
                     /codon_start=1
                     /product="protein UL19"
                     /protein_id="AAR31584.1"
                     /translation="MTSNALYELFRRRLPRAPVNTVMFLTRRTRDGFCGRLTSIATNS
                     HYTMFVLDHGSVRIERPSQSEVDCASLMETLKRIRLRNSWVASEDELDVSRRDA"
     gene            25640..26656
                     /gene="UL20"
                     /locus_tag="HHV5wtgp025"
     CDS             25640..26656
                     /gene="UL20"
                     /locus_tag="HHV5wtgp025"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL20"
                     /protein_id="AAR31585.1"
                     /translation="MLGIRAMLVMLDYYWIQLITNNGTRSNNTDTIFVSLLTGPNGVT
                     RTAIGGLYSNYTNLTGAFGFTSTNMSATNSSAEDNWSVTNLTESCINRGESYVTTIWL
                     LDCTKNDTYWYYGNAYNHTCEGTISGYLLGMCKLWKSWVNNITSYNTVRVESLGNETR
                     CMLLPRQYTLNATVEWYNKSEGDVPEEFMDYVILTPLAVLTCGLQEAYILDKGRRYMY
                     LFSVSCVGITGTVSIILVSLSLLILICYYRCGRLLICPRGFELLPEFTEEEEEKEKLL
                     THNDIEVQVPIRTRRLLVPWIRESKMWVLPPPLPPRPPHLIEFPPSPPPSPGPMHMVV
                     CMPA"
     gene            complement(26803..27174)
                     /gene="UL21A"
                     /locus_tag="HHV5wtgp026"
     CDS             complement(26803..27174)
                     /gene="UL21A"
                     /locus_tag="HHV5wtgp026"
                     /note="facilitates viral DNA synthesis"
                     /codon_start=1
                     /product="protein UL21A"
                     /protein_id="AAR31586.1"
                     /translation="MGGSPVPQLTTVTQGLMPSVRMDFRARRPLRRLAFYAPRARRRL
                     FQNHIHPEQRRVLVGEGDEEMLPDLPMEIDIVIDRPPQQPLPNPLVLLLDDVPPHVPG
                     FAPYRVPRPHPMIPEEHWDQF"
     gene            27443..27843
                     /gene="UL22A"
                     /locus_tag="HHV5wtgp027"
     CDS             join(27443..27528,27612..27843)
                     /gene="UL22A"
                     /locus_tag="HHV5wtgp027"
                     /note="contains signal peptide; secreted protein; binds CC
                     chemokine RANTES; involved in immune regulation"
                     /codon_start=1
                     /product="glycoprotein UL22A"
                     /protein_id="AAR31587.1"
                     /translation="MARRLWILSLLAVTLTVALAAPSQKSKRSVTVEQPSTSTNSDGN
                     TTPSKNVTLSQGGSTTDGDEDYSGGDYDVLITDTDGGNHQQPQEKTDEHKGEHTKENE
                     KTQ"
     ncRNA           27992..28011
                     /ncRNA_class="miRNA"
                     /product="hcmv-miR-UL22A"
                     /inference="ab initio prediction:miRBase:rel16"
     ncRNA           28029..28050
                     /ncRNA_class="miRNA"
                     /product="hcmv-miR-UL22A*"
                     /inference="ab initio prediction:miRBase:rel16"
     gene            complement(28208..29062)
                     /gene="UL23"
                     /locus_tag="HHV5wtgp028"
                     /note="beta gene"
     CDS             complement(28208..29062)
                     /gene="UL23"
                     /locus_tag="HHV5wtgp028"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL23"
                     /protein_id="AAR31588.1"
                     /translation="MSVIKDCFLNLLDRWRPPKTSRPWKPGQRVALVWPKDRCLVIRR
                     RWRLVRDEGRDAQRLASYLCCPEPLRFVGSICTYNFLKHKGDHNVPSELYLGASGAMY
                     LWTDHIYSDSLTFVAESITEFLNIGLRRCNFITVPEELPHTASLRALAGCMHIHAFAQ
                     WRATYRGRLMVMGDYSVIRVSTIRLYDWSEINDWRVMVGSNHVEPLGWLVSPYDVINL
                     FVDDCMRVFAANNQHVCIVADSLMEFVTRGMTRCHENGIYYGTRSMRKLNKPTCPYGV
                     DHQLFDDA"
     gene            complement(29278..30354)
                     /gene="UL24"
                     /locus_tag="HHV5wtgp029"
                     /note="beta gene"
     CDS             complement(29278..30354)
                     /gene="UL24"
                     /locus_tag="HHV5wtgp029"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL24"
                     /protein_id="AAR31589.2"
                     /translation="MEETRAGRYIVRAGSGGQTEDTASGAESVLATLAAVRTRRRSVV
                     CDGPPGSPTDSARHMSDLASLALTAEFGLGCLEAYVRINAGQVLPVVWPPGWNLVLQE
                     IETDEDFKPEDVKAWSHYLCCQTRLAFVGRFVNEGVLSPDQQKKTAVCLISDEGYVFC
                     YVREDTAVYYLARNLMEFARVGLRAVETLHCMRYLTSSLVKRYFRPLLRAWSLGLDTM
                     ARFIIRHHGQFMPLTYPPGTELRLCNLRCFENSVEGGHLLRNIKTAFGMRVLGLGTVS
                     LKGENAPFPHLRWPVDLIPIVVAYTGAVYACDVRDDRYIRVGDNLNTFMCLGLNLLFE
                     NRRFSGHNGIYDRVPDCPKGRQHR"
     gene            30402..32372
                     /gene="UL25"
                     /locus_tag="HHV5wtgp030"
     CDS             30402..32372
                     /gene="UL25"
                     /locus_tag="HHV5wtgp030"
                     /note="UL25 family"
                     /codon_start=1
                     /product="tegument protein UL25"
                     /protein_id="AAR31590.1"
                     /translation="MSSRRRSSSRRSGEPSTVIYIPSSNEDTPADEEAEDSVFTSTRA
                     RSATEDLDRMEAGLSPYSVSSDAPSSFELVRETGGTGAAKKPSEKKRSSSRRQPQIAA
                     GAPRGSPATPKAGKSPKVSRPPSVPSLPENGAGGGGDDNSSSGGSSSRTTSNSSRSTS
                     PVAPGEPSAAEGDEFSFCDSDIEDFERECYRVSVADNLGFEPSVVAPQHVEYLKFVLQ
                     DFDVQHLRRLNECIPMPAFALTSLVDPVLNNVAPGERDLTRRIITHAVIINYYYVAQK
                     KARHMVEAIRTTVRGDTVRRVAAQVNNQSRSGRAAALALHFLTSRKGVTDGQYATSLR
                     RLDEELRHRGTPESPRLTEVYQTLRDYNVLFYTAHYTSRGALYLYRQNLQRLNENHRG
                     MLRLLSVEEICEEHTLNDLAFLVGVELMITHFQRTIRVLRCYLQHQLQSISELCYLIY
                     VQLPSLREDYAQLSDVIYWAVSQNYDYALYASTPALFDFLRVVRQQDAFICTDYVYCA
                     LRLLACPDRPIIGDTGGSSSSQRLVGEFMVRDPLLRDPRATHLRQKLITRDICVARLQ
                     AQPSSRHIPVEHTGVSSVTLLKIFSQVPPDEREEDTLREMALKAFMEANGNHPEQICR
                     SPPPPLPPRDYPQRDERDRHRRDRRDSGEYCC"
     gene            complement(32560..33126)
                     /gene="UL26"
                     /locus_tag="HHV5wtgp031"
     CDS             complement(32560..33126)
                     /gene="UL26"
                     /locus_tag="HHV5wtgp031"
                     /note="transcriptional activator of major immediate early
                     promoter; involved in gene regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein UL26"
                     /protein_id="AAR31591.1"
                     /translation="MTSRRAPDGGLNLDDFMRRQRGRHLDLPYPRGYTLFVCDVEETI
                     LTPRDVEYWKLLVVTQGQLRVIGTIGLANLFSWDRSVAGVAADGSVLCYEISRENFVV
                     RAADSLPQLLERGLLHSYFEDVERAAQGRLRHGNRSGLRRDADGQVIRESACYVSRAL
                     LRHRVTPGKQEITDAMFEAGNVPSALLP"
     gene            complement(33182..35008)
                     /gene="UL27"
                     /locus_tag="HHV5wtgp032"
                     /note="beta gene"
     CDS             complement(33182..35008)
                     /gene="UL27"
                     /locus_tag="HHV5wtgp032"
                     /note="low-level resistance to maribavir"
                     /codon_start=1
                     /product="protein UL27"
                     /protein_id="AAR31592.1"
                     /translation="MNPVDQPPPPPLTQQPEEQAKEDHDDGDERLFRDPLTTYEYLDD
                     CRDDEEFCHQFLRAYLTPIRNRQEAVRAGLLCRTPEDLAAAGGQKRKTPAPKHPKHAM
                     VYIRRSCLVHSACATAHGKYDIRGLTLESDLAVWAALRGVPLPPDPQHFRWLNAGAFR
                     RLVHEAQYLPEISRAAKRIALAVATGQYVVCTLLDYKTFGTRTHYLRQLCSMTEELYL
                     RLDGTLCLFLEPEERELIGRCLPAALCRGLPVKYRTHRAAVFFHATFMARAEAALKDL
                     YAAFCECGDGRDDGGNHNGNYGGGDHSSLSPSAVASHHSRLEHAELRLERNRHLGAFH
                     LPAIRHLTAGDVARVQDSVSRDLGFADWSQTLVDDYFLLPAGWACANPRRGYAMYLAS
                     NAVLALRIIRLLRASIRHEYTACIRMLSGDVQRLIRLFKGEAALLRKGLAQNPVQRRE
                     LSRFRKHVHDLKRIRFTEDTFVETFCDFLELVQRIPDYRSVSLRIKRELLCLHVFKLR
                     RGCRAPPTPEAVRVQRLLWHSLRHGDAPQDRTRLPQFSSALSDAELSNHANRCRRKAP
                     LELGPAVVAAPGPSVRYRAHIQKFERLHVRRFRPHEVGGHAT"
     gene            complement(35105..37353)
                     /gene="UL29"
                     /locus_tag="HHV5wtgp034"
                     /note="beta gene"
     CDS             complement(join(35105..36131,36278..37353))
                     /gene="UL29"
                     /locus_tag="HHV5wtgp034"
                     /note="interacts with components of the NuRD complex,
                     promoting accumulation of immediate early RNA; US22
                     family"
                     /codon_start=1
                     /product="protein UL29"
                     /protein_id="AAR31593.2"
                     /translation="MSGRRKGCSAATASSSSSSPPSRLPLPGHARRPRRKRCLVPEVF
                     CTRDLADLCVRRDYEGLRRYLRRFEGSCVSLGWPSQCIYVVGGEHSPHSLTEIDLEHC
                     QNDFFGEFRALHLIGTVSHATCRYQVFVDAYGAVFAYDAQEDCLYELASDLAGFFAKG
                     MIRCDPVHESICARLQPNVPLVHPDHRAELCRRSRASARGRYLRSLLAFRELLACEDT
                     AARCAYVEAHREAQLTLIWPEKHSLVLRTARDLGLSASMLRRFQRSLYTREPVMPLGE
                     IEGAEDKTFFHRVRILCGDTGTVYAALVGQDKLVRLSRDLRGFVRVGLALLIDDFRYE
                     SIGPVDRSSLYEANPELRLPFKKRRLVVGYFDSLSSLYLRGQPKFSSIWRGLRDAWTH
                     KRPKPRERASGVHLQRYVRATAGRWLPLCWPPLHGIMLGDTQYFGVVRDHKTYRRFSC
                     LRQAGRLYFIGLVSVYECVPDANTAPEIWVSGHGHAFAYLPGEDKVYVLGLSFGEFFE
                     NGLFAVYSFFERDYVDEIVEGAWFKHTFAGMYELSQILHDRANLLRVCQLHAGSKIRL
                     GGSPACTFTFGSWNVAEADEANNFVIGVLEQAHFVVIGWMEPVNKAVFMDAHGGIHVL
                     LYGTMLVKLAETLRGFIRQGSFWFRCPRRFCFSPLDSSATVAAKPVSSHTSPAYDVSE
                     YVFSGRSVLDSVSGTGAS"
     gene            complement(37483..37848)
                     /gene="UL30"
                     /locus_tag="HHV5wtgp035"
     CDS             complement(37483..37848)
                     /gene="UL30"
                     /locus_tag="HHV5wtgp035"
                     /note="UL30 family"
                     /codon_start=1
                     /product="protein UL30"
                     /protein_id="AAR31595.1"
                     /translation="MTTSAMTAPDTRRQLQHVETLRRFLRGDSCFVHDLRGMMDYHDG
                     LSRRQQRAFCRAGRVLTDPEPIQSETEGENKQFTEHTHKVVSFFIKSVFVFPCLVLPN
                     CCQVSVDRSRVPETGGRWL"
     gene            complement(37605..38174)
                     /gene="UL30A"
                     /locus_tag="HHV5wtgp035a"
     mRNA            complement(37605..38174)
                     /gene="UL30A"
                     /locus_tag="HHV5wtgp035a"
                     /product="protein UL30A"
                     /experiment="Northern blot"
                     /experiment="RACE"
     regulatory      complement(37624..37629)
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL30A"
     CDS             complement(37894..38133)
                     /gene="UL30A"
                     /locus_tag="HHV5wtgp035a"
                     /experiment="EXISTENCE:ribosome profiling[23180859]"
                     /note="UL30 family;
                     alternative start codon"
                     /codon_start=1
                     /transl_except=(pos:complement(38131..38133),aa:Met)
                     /product="protein UL30A"
                     /protein_id="AGL13510.1"
                     /translation="MACRDARWVRFIRLRTLWSVRPRAHVADLEDFAAFYRTLSDSEQ
                     QEFEQEAELASRSQRVRDLREARRQLKMDLMCHGG"
     regulatory      complement(38200..38205)
                     /regulatory_class="TATA_box"
                     /note="UL30A"
     gene            38327..40114
                     /gene="UL31"
                     /locus_tag="HHV5wtgp036"
                     /note="beta gene"
     CDS             38327..40114
                     /gene="UL31"
                     /locus_tag="HHV5wtgp036"
                     /note="DURP family"
                     /codon_start=1
                     /product="protein UL31"
                     /protein_id="AAR31596.1"
                     /translation="MGDKPTLVTLLTVAVSSPPPSSPLPLVSFTELLLPPPSVAAAAV
                     AATATSEVGEKTAEQEVAAAGPETRNERRENREDEGGETRTTGTTAVKRSHDGIPRQL
                     AERLRLCRHMDPEQDYRLPAQDVVTSWIEALRDADRDNYGRCVRHAKIHRSASHLTAY
                     ESYLVSITEQYNTASNVTEKASYVQGCIFLSFPVIYNNTQGCGYKYDWSNVVTPKAAY
                     AELFFLLCSTSESSVVLQPLITKGGLCSSMAVYDEETMRQSQAVQIGFLHTQLVMVPF
                     VPHACPHYAVPFTTPGKPGCGGAPSGVAGLEETAPFGRVSVTRHGATLLCRVDHLTWI
                     SKRVTTYGHKKITRYLAQFRGTMDDDEAALPGEDEAWIASKNVQYEFMGLIFTVNVDS
                     LCVDAEQRQLLGTVATSFCHRVSDKITARNMPRAFSFYLLTSAQRGYDLRFSRNPSLF
                     FSGDALNCPLLNEPNVFSLTVHAPYDIHFGVQPRQTVELDLRYVQITDRCFLVANLPH
                     EDAFYTGLSVWRGGEPLKVTLWTRTRSIVIPQGTPIATLYQITEGDGNVYSYNHHTVF
                     RQMHAAGATTFFLGDMQLPADNFLTSPHP"
     gene            complement(40195..43344)
                     /gene="UL32"
                     /locus_tag="HHV5wtgp037"
                     /note="beta gene"
     CDS             complement(40195..43344)
                     /gene="UL32"
                     /locus_tag="HHV5wtgp037"
                     /note="major tegument protein; binds to capsids"
                     /codon_start=1
                     /product="tegument protein pp150"
                     /protein_id="AAR31597.1"
                     /translation="MSLQFIGLQRRDVVALVNFLRHLTQKPDVDLEAHPKILKKCGEK
                     RLHRRTVLFNELMLWLGYYRELRFHNPDLSSVLEEFEVRCAAVARRGYTYPFGDRGKA
                     RDHLAVLDRTEFDTDVRHDAEIVERALVSAVILAKMSVRETLVTAIGQTEPIAFVHLK
                     DTEVQRIEENLEGVRRNMFCAKPLDLNLDRHANTALVNAVNKLVYTGRLIMNVRRSWE
                     ELERKCLARIQERCKLLVKELRMCLSFDSNYCRNILKHAVENGDSADTLLELLIEDFD
                     IYVDSFPQSAHTFLGARSPSLEFDDDANLLSLGGGSAFSSVPKKHVPTQPLDGWSWIA
                     SPWKGHKPFRFEAHGSLAPAAEAHAARSAAVGYYDEEEKRRERQKRVDDEVVQREKQQ
                     LKAWEERQQNLQQRQQQPPPPTRKPGASRRLFGSSADEDDDDDDDDEKNIFTPIKKPG
                     TSGKGAASGGGVSSIFSGLLSSGSQKPTSGPLNIPQQQQRHAAFSLVSPQVTKASPGR
                     VRRDSAWDVRPLTETRGDLFSGDEDSDSSDGYPPNRQDPRFTDTLVDITDTETSAKPP
                     VTTAYKFEQPTLTFGAGVNVPAGAGAAILTPTPVNPSTAPAPAPTPTFAGTQTPVNGN
                     SPWAPTAPLPGDMNPANWPRERAWALKNPHLAYNPFRMPTTSTASQNTVSTTPRRPST
                     PRAAVTQTASRDAADEVWALRDQTAESPVEDSEEEDDDSSDTGSVVSLGHTTPSSDYN
                     NDVISPPSQTPEQSTPSRIRKAKLSSPMTTTSTSQKPVLGKRVATPHASARAQTVTST
                     PVQGRLEKQVSGTPSTVPATLLQPQPASSKTTSSRNVTSGAGTSSASSARQPSASASV
                     LSPTEDDVVSPATSPLSMLSSASPSPAKSAPPSPVKGRGSRVGVPSLKPTLGGKAVVG
                     RPPSVPVSGSAPGRLSGSSRAASTTPTYPAVTTVYPPSSTAKSSVSNAPPVASPSILK
                     PGASAALQSRRSTGIAAVGSPVKSTTGMKTVAFDLSSPQKSGTGPQPGSAGMGGAKTP
                     SDAVQNILQKIEKIKNTEE"
     gene            43415..44773
                     /gene="UL33"
                     /locus_tag="HHV5wtgp038"
                     /note="beta gene"
     CDS             join(43415..43441,43562..44773)
                     /gene="UL33"
                     /locus_tag="HHV5wtgp038"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     putative chemokine receptor; involved in intracellular
                     signalling; GPCR family"
                     /codon_start=1
                     /product="envelope glycoprotein UL33"
                     /protein_id="AAR31598.1"
                     /translation="MDTIIHNTTNRSTDTPHVNITCNITEPLSAIRTTEAVINTFIIF
                     VGGPLNAIVLITQLLTNRVLGYSTPTIYMTNLYSTNFLTLTVLPFIVLSNQWLLPASV
                     ASCKFLSVIYYSSCTVGFATVALIAADRYRVLHKRTYARQSYRSTYIILLLTWFAGLI
                     FSMPAAVYTTVVIHNGTNGQSSNGHATCVLYFIADEVYTVLLSWKVLLTLVWGAAPVI
                     MMTWFYAFFYSTVQRASQKQRSRTLTFVSVLLISFVALQTPYVSIMIFNSYATAAWPM
                     DCEHLTLRRTIGTLSRLVPHLHCLINPILYALLGHDFLQRMRQCFRGQLLDRRAFLRS
                     QQNQRATAETNLAAGNNSQSVATSLDTSSKNCNQHAKRSVSFNFPSGTWKGGQKTASN
                     DTSTKIPHRLSQSHHNLSGV"
     gene            45141..46364
                     /gene="UL34"
                     /locus_tag="HHV5wtgp039"
     CDS             45141..46364
                     /gene="UL34"
                     /locus_tag="HHV5wtgp039"
                     /note="represses US3 transcription; involved in gene
                     regulation"
                     /codon_start=1
                     /product="protein UL34"
                     /protein_id="AAR31599.1"
                     /translation="MNFIITTRDFSNDDSVLRAAEMRDNVAGSISKAYKGTVRAEGKK
                     KLLLKHLPVPPGGCSRRNSNLFVFCTERDYRKFHQGIAQLKRAPAELDPHEIQQVTAS
                     IRCRLQPSLREPPTPADELQTAVSRVCALFNQLVFTAQLRHYCEHQDKVVSYARDELT
                     KRCGEKSALGVEVHQLVALLPHERHRELCHVLIGLLHQTPHMWARSIRLIGHLRHYLQ
                     NSFLHLLMNSGLDIAQVFDGCYHSEAYRMLFQIGHTDSVSAALELSHSAAAGPPEADE
                     NNDEGEEDDDELRHSDPAPLHDSKKPRNARRPRTRVPPHEQKPEENEEEEEELFPSCK
                     ATAAFLRAEPSVSNDDGNGGERCDTLATALRHRADEEDGPLASQTSVRVAATPSPSVT
                     SALTPVTSPITPLCI"
     gene            46443..48368
                     /gene="UL35"
                     /locus_tag="HHV5wtgp040"
                     /note="beta gene"
     CDS             46443..48368
                     /gene="UL35"
                     /locus_tag="HHV5wtgp040"
                     /note="UL25 family"
                     /codon_start=1
                     /product="tegument protein UL35"
                     /protein_id="AAR31600.1"
                     /translation="MAQGSRAPSGPPLPVLPVDDWLNFRVDLFGDEHRRLLLEMLTQG
                     CSNFVGLLNFGVPSPVYALEALVDFQVRNAFMKVKPVAQEIIRICILANHYRNSRDVL
                     RDLRTQLDVLYSEPLKTRLLRGLIRLCRAAQTGVKPEDISVHLGADDVTFGVLKRALV
                     RLHRVRDALGLRASPEAEARYPRLTTYNLLFHPPPFTTVEAVDLCAENLSDVTQRRNR
                     PLRCLTSIKRPGSRTLEDALNDMYLLLTLRHLQLRHALELQMMQDWVVERCNRLCDAL
                     YFCYTQAPETRQTFVTLVRGLELARQHSSPAFQPMLYNLLQLLTQLHEANVYLCPGYL
                     HFSAYKLLKKIQSVSDARERGEFGDEDEEQENDGEPREAQLDLEADPTAREGELFFFS
                     KNLYGNGEVFRVPEQPSRYLRRRMFVERPETLQIFYNFHEGKITTETYHLQRIYSMMI
                     EGASRQTGLTPKRFMELLDRAPLGQESEPEITEHRDLFADVFRRPVTDAASSSSASSS
                     SSSASPNSVSLPSARSSSTRTTTPASTYTSAGTSSTTGLLLSSSSLSGSHGISSADLE
                     QPPRQRRRMVSVTLFSPYSVAYSHHRRHRRRRSPPPAPRGPAHTRFQGPDSMPSTSYG
                     SDVEDPRDDLAENLRHL"
     gene            complement(48595..50128)
                     /gene="UL36"
                     /locus_tag="HHV5wtgp041"
                     /note="beta gene; immediate early gene"
     CDS             complement(join(48595..49823,49927..50128))
                     /gene="UL36"
                     /locus_tag="HHV5wtgp041"
                     /note="inhibitor of caspase-8-induced apoptosis; involved
                     in apoptosis; US22 family"
                     /codon_start=1
                     /product="tegument protein vICA"
                     /protein_id="AAR31601.1"
                     /translation="MDDLRDTLMAYGCIAIRAGDFNGLNDFLEQECGTRLHVAWPERC
                     FIQLRSRSALGPFVGKMGTVCSQGAYVCCQEYLHPFGFVEGPGFMRYQLIVLIGQRGG
                     IYCYDDLRDCIYELAPTMKDFLRHGFRHCDHFHTMRDYQRPMVQYDDYWNAVMLYRGD
                     VESLSAEVTKRGYASYSIDDPFDECPDTHFAFWTHNTEVMKFKETSFSVVRAGGSIQT
                     MELMIRTVPRITCYHQLLGALGHEVPERKEFLVRQYVLVDTFGVVYGYDPAMDAVYRL
                     AEDVVMFTCVMGKKGHRNHRFSGRREAIVRLEKTPTCQHPKKTPDPMIMFDEDDDDEL
                     SLPRNVMTHEEAESRLYDAITENLMHCVKLVTTDSPLATHLWPQELQALCDSPALSLC
                     TDDVEGVRQKLRARTGSLHHFELSYRFHDEDPETYMGFLWDIPSCDRCVRRRRFKVCD
                     VGRRHIIPGAANGMPPLTPPHAYMNN"
     ncRNA           complement(49849..49870)
                     /ncRNA_class="miRNA"
                     /gene="UL36"
                     /locus_tag="HHV5wtgp041"
                     /product="hcmv-miR-UL36*"
                     /inference="ab initio prediction:miRBase:rel16"
     ncRNA           complement(49893..49914)
                     /ncRNA_class="miRNA"
                     /gene="UL36"
                     /locus_tag="HHV5wtgp041"
                     /product="hcmv-miR-UL36"
                     /inference="ab initio prediction:miRBase:rel16"
     gene            complement(50262..53060)
                     /gene="UL37"
                     /locus_tag="HHV5wtgp042"
                     /note="beta gene; immediate early gene"
     CDS             complement(join(50262..51197,51302..51344,52573..53060))
                     /gene="UL37"
                     /locus_tag="HHV5wtgp042"
                     /note="type 1 membrane protein; involved in apoptosis;
                     involved in gene regulation; major isoform (mitochondrial
                     inhibitor of apoptosis, vMIA) encoded by unspliced mRNA"
                     /codon_start=1
                     /product="envelope glycoprotein UL37"
                     /protein_id="AAR31602.1"
                     /translation="MSPVYVNLLGSVGLLAFWYFSYRWIQRKRLEDPLPPWLRKKKAC
                     ALTRRSRHRLRRQHGVIDGENSETERSVDLVAALLAEAGEESVTEDTEREDTEEERED
                     EEEENEARTPEVNPMDAEGLSGLAREACEALKKALRRHRFLWQRRRRARLLQHNGPQQ
                     SHHAAVFCRVHGLRGFQVSVWLLLTLFWSTGYGVSVRCTYHGTDINVTSNATSMNCRL
                     NCTCNHTQIYNGPCAGAESKLPLNVTFRQSRRQWHSVMLTFGFQYHLEGWFPLRILNE
                     SRDINVTEVYGEVACFTNDTNITMGQLTLNLTGRSYVLRALARTSPFESSVNWEETNV
                     TDNATSSENNTVTVMSVLTVYAESDYIFLQDMCPRFLKRSVKLAKNNRRNTTFTGTNV
                     TSLPEWTLQQCQGWKYWTTLSIMWKNRRSALLRAKSRALGHWALLSICTVAAGSIALL
                     SLFCILLIGLRRDLLEDFRYICRDEGSSSTKNDVHWIV"
     gene            complement(51482..52477)
                     /gene="UL38"
                     /locus_tag="HHV5wtgp043"
                     /note="beta gene"
     CDS             complement(51482..52477)
                     /gene="UL38"
                     /locus_tag="HHV5wtgp043"
                     /note="involved in apoptosis"
                     /codon_start=1
                     /product="protein UL38"
                     /protein_id="AAR31603.1"
                     /translation="MTTTTHSTAAIMSLLDEAEWRQTQMDVGGLIQASALGKVALRYA
                     VRKLMKRGARLRHDSGLYVCICDPSYEFLQMNLSKISWLERHCPPLDQELIMFGVIEA
                     WEEASVRPTRQLVLFMTPKWDVFAYDSGILFFLAPSMAQFWHGAIVLEYWNALFPVEV
                     RSHVRQHAHTMDDLVMVFHQLDYEKQVLEARRDKNTEGPRTFAKSVNSYVRAILESER
                     RIREGKIPMTFVDRDSLRANSLAHIQATGAQPSHAPAQRVLSAPPSLPSPVSEEDPAA
                     AATPPSSAATTPPSSVVPASVESELSSSPPLPPVVVKDVMYTAGEGDVVQMVVVV"
     gene            complement(53498..54838)
                     /gene="UL41A"
                     /locus_tag="HHV5wtgp045"
     mRNA            complement(53498..54808)
                     /gene="UL41A"
                     /locus_tag="HHV5wtgp045"
                     /product="protein UL41A"
                     /experiment="Northern blot"
                     /experiment="RACE"
     gene            complement(53498..54344)
                     /gene="UL40"
                     /locus_tag="HHV5wtgp044"
     mRNA            complement(53498..54314)
                     /gene="UL40"
                     /locus_tag="HHV5wtgp044"
                     /product="membrane glycoprotein UL40"
                     /experiment="Northern blot"
                     /experiment="RACE"
     mRNA            complement(53498..54206)
                     /gene="UL40"
                     /locus_tag="HHV5wtgp044"
                     /product="membrane glycoprotein UL40 short form"
                     /experiment="Northern blot"
                     /experiment="RACE"
     regulatory      complement(53517..53522)
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL40, UL41A"
     CDS             complement(53574..54239)
                     /gene="UL40"
                     /locus_tag="HHV5wtgp044"
                     /note="type 1 membrane protein; sequence in signal peptide
                     inhibits NK cell cytotoxicity; upregulates cell surface
                     expression of HLA-E; acts on inhibitory receptor
                     CD94/NKG2A; involved in immune regulation"
                     /codon_start=1
                     /product="membrane glycoprotein UL40"
                     /protein_id="AAR31604.1"
                     /translation="MNKFSNTRIGFTCAVMAPRTLILTVGLLCMRIRSLLSSPVETTV
                     TTAGVTSAHGPLCPLVFQGWAYAVYHQGDMVLMTLDVYCCRQTSSNTVVAFSHHPADN
                     TLLIEVGNNTRRHVDGISCQDHFRAQHQDCPAQTVHVRGVNESAFGLTHLQSCCLNEH
                     SQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYAL
                     KKA"
     regulatory      complement(54231..54236)
                     /regulatory_class="TATA_box"
                     /gene="UL40"
                     /locus_tag="HHV5wtgp044"
                     /note="nominal"
     regulatory      complement(54339..54344)
                     /regulatory_class="TATA_box"
                     /gene="UL40"
                     /locus_tag="HHV5wtgp044"
                     /note="nominal"
     CDS             complement(54401..54637)
                     /gene="UL41A"
                     /locus_tag="HHV5wtgp045"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL41A"
                     /protein_id="AAR31605.1"
                     /translation="MTLFCRTANSTAGYVDMNVCIGMIGVVCFVFGVFILIFCSTLKA
                     FYVRQKTYHLLGTESDDEETTVWEKRRMESDTDF"
     gene            complement(54742..55119)
                     /gene="UL42"
                     /locus_tag="HHV5wtgp046"
     CDS             complement(54742..55119)
                     /gene="UL42"
                     /locus_tag="HHV5wtgp046"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL42"
                     /protein_id="AAR31606.1"
                     /translation="MEPTPMLRDRDHDDAPPTYEQAMGLCPTTVSTPPPPPPDCSPPP
                     YRPPYCLVSSPSPRHTFDMDMMEMPATMHPTTGAYFDNGWKWTFALLVVAILGIIFLA
                     VVFTVVINRDSANITTGTQASSG"
     regulatory      complement(54833..54838)
                     /regulatory_class="TATA_box"
                     /gene="UL41A"
                     /locus_tag="HHV5wtgp045"
     gene            complement(55183..56454)
                     /gene="UL43"
                     /locus_tag="HHV5wtgp047"
                     /note="beta gene"
     CDS             complement(55183..56454)
                     /gene="UL43"
                     /locus_tag="HHV5wtgp047"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL43"
                     /protein_id="AAR31607.1"
                     /translation="MEKTPAETTAVSAGNVPRDSIPCITNVSADTRGRTRPSRPATVP
                     QRRPARIGHFRRRSASLSFLDWPDDSVTEGVRTTSASVAASAARFDEIRRRRQSINDE
                     MKERTLEDALAVELVNETFRCSVTSDARKDLQKLVRRVSGTVLRLSWPNGWFFTYCDL
                     LRVGYFGHLNIKGLEKTFLCCDKFLLPVGTVSRCEAIGRPPLPVLIGEGGRVYVYSPV
                     VESLYLVSRSGFRGFVQEGLRNYAPLREELGYVRFETGGDVGREFMLARDLLALWRLC
                     MKREGSIFSWRDGNEALTTVVLNGSQTYEDPAHGNWLKETCSLNVLQVFVVRAVPVES
                     QQRLDISILVNESGAVFGVHPDTRQAHFLARGLLGFFRVGFLRFCNNYCFARDCFTHP
                     ESVAPAYRATGCPRELFCRRLRKKKGLFARR"
     gene            complement(56501..57802)
                     /gene="UL44"
                     /locus_tag="HHV5wtgp048"
                     /note="core gene"
     CDS             complement(56501..57802)
                     /gene="UL44"
                     /locus_tag="HHV5wtgp048"
                     /note="dsDNA-binding protein; involved in DNA replication"
                     /codon_start=1
                     /product="DNA polymerase processivity subunit"
                     /protein_id="AAR31608.1"
                     /translation="MDRKTRLSEPPTLALRLKPYKTAIQQLRSVIRALKENTTVTFLP
                     TPSLILQTVRSHCVSKITFNSSCLYITDKSFQPKTINNSTPLLGNFMYLTSSKDLTKF
                     YVQDISDLSAKISMCAPDFNMEFSSACVHGQDIVRESENSAVHVDLDFGVVADLLKWI
                     GPHTRVKRNVKKAPCPTGTVQILVHAGPPAIKFILTNGSELEFTANNRVSFHGVKNMR
                     INVQLKNFYQTLLNCAVTKLPCTLRIVTEHDTLLYVASRNGLFAVENFLTEEPFQRGD
                     PFDKNYVGNSGKSRGGGGGSGSLSSLANAGGLHDDGPGLDNDIMNEPMGLGGLGGGGG
                     GGGKKHDRGGGGGSGTRKMSSGGGGGDHDHGLSSKEKYEQHKITSYLTSKGGSGGGGG
                     GGGGGLDRNSGNYFNDAKEESDSEDSVTFEFVPNTKKQKCG"
     gene            complement(57943..60663)
                     /gene="UL45"
                     /locus_tag="HHV5wtgp049"
                     /note="core gene"
     CDS             complement(57943..60663)
                     /gene="UL45"
                     /locus_tag="HHV5wtgp049"
                     /note="enzymatically inactive; tegument protein"
                     /codon_start=1
                     /product="ribonucleotide reductase subunit 1"
                     /protein_id="AAR31609.1"
                     /translation="MNPADADEEQRVSSVPAHRCRPGRIPSRSAETETEESSAEVAAD
                     TIGGDDSELEEGPLPGGDKEASAGNTNVSSGVACVAGFTSGGGVVSWRPESPSPDGTP
                     SVLSLTRDSGPAVPSRGGRVSSGLSTFNPAGATRMELDSVEEEDDFGASLCKVSPPIQ
                     AMRMLMGKKCHCHGYWGKFRFCGVQEPARELPSDRNALWREMDTVSRHSAGLGSFRLF
                     QLIMRHGPCLIRHSPRCDLLLGRFYFKANWARESRTPLCYASELCDESVRRFVLRHME
                     DLPKLAEETARFVELAGCWGLYAAILCLDKVCRQLHGQDESPGGVFLRIAVALTAAIE
                     NSRHSRIYRFHLDARFEGEVLESVLKRCRDGQLSLSTFTMSTVGFDRVPQYDFLISAD
                     PFSRDASWAAMCKWMSTLSCGVSVSVNVTRLNADVNSVIRCLGGYCDLIREKEVHRPV
                     VRVFVDMWDVAAIRVINFILKESTSELTGVCYAFNVPSVLMKRYRAREQRYSLFGRPV
                     SRRLSDLGQESAFEKEYSRCEQSCPKVVVNTDDFLKKMLLCALKGRASVVFVHHVVKY
                     SIMADSVCLPPCLSPDMASCHFGECDMPVQRLTVNVARCVFARSDEQKLHLPDVVLGN
                     TRRYFDLSVLRELVTEAVVWGNARLDALMSASEWWVESALEKLRPLHIGVAGLHTALM
                     RLGFTYFASWDLIERIFEHMYFAAVRASVDLCKSGLPRCEWFERTIYQEGKFIFELYR
                     LPRLSIASARWEALRADMLEFGLRNCQFLAVGPDDEVAHLWGVTPSVWASRGTVFEEE
                     TVWSLCPPNRECYFPTVVRRPLRVPVVNYAWLEQHQEEGKATQCLFQAAPAIQNDVEM
                     AAVNLSVFVDQCVALVFYYDSGMTPDVLLARMLKWYHWRFKVGVYKYCAS"
     gene            complement(60806..61678)
                     /gene="UL46"
                     /locus_tag="HHV5wtgp050"
                     /note="core gene"
     CDS             complement(60806..61678)
                     /gene="UL46"
                     /locus_tag="HHV5wtgp050"
                     /note="complexed 1:2 with capsid triplex subunit 2 to
                     connect capsid hexons and pentons; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid triplex subunit 1"
                     /protein_id="AAR31610.1"
                     /translation="MDARAVAKRPRDPADEDNELVTALKAKREVNTISVRYLYHADHQ
                     ALTARFFVPEGLVEFEAQPGALLIRMETGCDSPRHLYISLYLLGIRASNVSASTRCLL
                     ESVYTASAARAALQWLDLGPHLLHRRLETLGCVKTVSLGITSLLTCVMRGYLYNTLKT
                     EVFALMIPKDMYLTWEETRGRLQYVYLIIVYDYDGPETRPGIYVLTSSIAHWQTLVDV
                     ARGKFARERCSFVNRRITRPRQIPLCTGVIQKLGWCLADDIHTSFLVHKELKLSVVRL
                     DNFSVELGDFREFV"
     gene            61677..64628
                     /gene="UL47"
                     /locus_tag="HHV5wtgp051"
                     /note="core gene"
     CDS             61677..64628
                     /gene="UL47"
                     /locus_tag="HHV5wtgp051"
                     /note="complexed with large tegument protein; involved in
                     virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL37"
                     /protein_id="AAR31611.1"
                     /translation="MMARRTVDFKKLIEQLRARATDKAEALNTVSQLEIGAVDAQDVT
                     ASAVRAFVGALPSSGYHFGFVRQNVVFYLLSHATVQTARDPLYAAEQLHEQLDRFLRH
                     QHDGGGDEDRLPFYHNGATLTAFQKLLQTLREIQTVIAEQSGGTAAAADLIASNNAST
                     ERRGKKGGSSSGGQQPLVRRVITQLETAATEARPYVNCRAVAELLDLTYQRLIYWACT
                     LMPYVLFRRDTDTELDTVLLMHFFYTHYRSVNGDLAVEFQNYVKNSVRHMSSFVSSDI
                     DGDQKPGAEHMRDVSYKLFVGNLQARDASGLMFPIISTRISTVNLYLSPERMFFHPGL
                     ISRLLSEEVSPRANLDAYARVCDRVLEDHLHTPRRVQRLLDLTQMVMRLVELGFNHDT
                     CAAYAQMALIQPASQKSSLFVSEIREKLIQIIYNFYTFFMCLYVYSPTFLFDHRRRLI
                     LEQHRSTLIGSKEELQHVWSNVTLNVNTHFAVQYTEEDFEAHTKGATEAEREYLYRDL
                     HSKWGVHLFTLRPSRGAAGAASPLPPLDGVTRSDILRECALVNLNEGRVNYASLLAFS
                     HHPEFPSIFAQLVVVTEFSEIFGIPQGLFQAVGSPRLFALIQLCRVLLPEQVTLYQNL
                     VSIYNLTTFVKHIDAAVFKTVRDCVFDIATTLEHLSGVPVTPNVDLLAELMARSVAHN
                     LYTTVNPLIEDVMRSSAGSLRNYLRHTRLCFGLARGRARLSEDGVTVYVEVQGQYGLR
                     VPTTRFVEQLRELVRRDRLLAENLRGLNERLLSVRVRVRQISSDTEEVSRHAKGHRTV
                     AQMSKALKKTASKIKMLETRVTLALEQAQRSNGAVVTAVQRALAVFDVLSRENLERRG
                     AQLCLTEATSLLHRHRALAPMTWPAGTGVAAAAEADGALREFLEAPWESAPQPPRLRM
                     TPDTDHEESTAGATSVPEVLGARYEPAHLAASDLLNWYIVPVSQAQQDILSSIDPPAG
                     STSVSLPPASP"
     gene            64625..71350
                     /gene="UL48"
                     /locus_tag="HHV5wtgp052"
                     /note="core gene"
     CDS             64625..71350
                     /gene="UL48"
                     /locus_tag="HHV5wtgp052"
                     /note="complexed with tegument protein UL37;
                     ubiquitin-specific protease (N-terminal region); involved
                     in capsid transport"
                     /codon_start=1
                     /product="large tegument protein"
                     /protein_id="AAR31613.1"
                     /translation="MKVTQASCHQGDIARFGARAGNQCVCNGIMFLHALHLGGTSAVL
                     QTEALDAIMEEGARLDARLERELQKKLPAGGRLPVYRLGDEVPRRLESRFGRTVHALS
                     RPFNGTTETCDLDGYMCPGIFDFLRYAHAKPRPTYVLVTVNSLARAVVFTEDHMLVFD
                     PHSSAECHNAAVYHCEGLHQVLMVLTGFGVQLSPAFYYEALFLYMLDVATVPEAEIAA
                     RLVSTYRDRDIDLTGVVRESADTAATTTTAAPSLPPLPDPIVDPGCPPGVAPSIPVYD
                     PSSSPKKTPEKRRKDLSGSKHGGKKKPPSTTSKTLATASSSPSAIAAASSSSAVPPSY
                     SCGEGALPALGRYQQLVDEVEQELKALTLPPLPANTSAWTLHAAGTESGANAATATAP
                     SFDEAFLTDRLQQLIIHAVNQRSCLRRPCGPQSAAQQAVRAYLGLSKKLDAFLLNWLH
                     HGLDLQRMHDYLSHKTTKGTYSTLDRALLEKMQVVFDPYGRQHGPALIAWVEEMLRYV
                     ESKPTNELSQRLQRFVTKRPMPVSDSFVCLRPVDFQRLTQVIEQRRRVLQRQREEYHG
                     VYEHLAGLITSIDIHDLDASDLNRREILKALQPLDDNAKQELFRLGNAKMLELQMDLD
                     RLSTQLLTRVHNHILNGFLPVEDLKQMERVVEQVLRLFYDLRDLKLCDGSYEEGFVVI
                     REQLSYLMTGTVRDNVPLLQEILQLRHAYQQATQQNEGRLTQIHDLLHVIETLVRDPG
                     SRGSALTLALVQEQLAQLEALGGLQLPEVQQRLQNAQLALSRLYEEEEETQRFLDGLS
                     YDDPPTEQTIKRHPQLREMLRRDEQTRLRLINAVLSMFHTLVMRLARDESPRPTFFDA
                     VSLLLQQLPPDSHEREDLRAANATYAQMVKKLEQIEKAGTGASEKRFQALRELVYFFR
                     NHEYFFQHMVGRLGVGPQVTELYERYQHEMEEQHLERLEREWQEEAGKLTVTSVEDVQ
                     RVLARAPSHRVMHQMQQTLTTKMQDFLDKEKRKQEEQQRQLLDGYQKKVQQDLQRVVD
                     AVKGEMLSTIPHQPLEATLELLLGLDQRAQPLLDKFNQDLLSALQQLSKKLDGRINEC
                     LHGVLTGDVERRCHPHREAAMQTQASLNHLDQILGPQLLIHETQQALQHAVHQAQFIE
                     KCQQGDPTTAITGSEFESDFARYRSSQQKMEGQLQETRQQMTETSERLDRSLRQDPGS
                     SSVTRVPEKPFKGQELAGRITPPPADFQRPVFKTLLDQQADAARKALSDEADLLNQKV
                     QTQLRQRDEQLSTAQNLWTDLVTRHKMSGGLDVTTPDAKALMEKPLETLRELLGKATQ
                     QLPYLSAERTVRWMLAFLEEALAQITADPTHPHHGSRTHYRNLQQQAVESAVTLAHQI
                     EQNAACENFIAQHQEATANGASTPRVDMVQAVEAVWQRLEPGRVAGGAARHQKVQELL
                     QRLGQTLGDLELQETLATEYFALLHGIQTFSYGLDFRSQLEKIRDLRTRFAELAKRCG
                     TRLSNEGALPNPRKPQATTSLGAFTRGLNALERHVQLGHQYLLNKLNGSSLVYRLEDI
                     PSVLPPTHETDPALIMRDRLRRLCFARHHDTFLEVVDVFGMRQIVTQAGEPIYLVTDY
                     GNVAFKYLALRDDGRPLAWRRRCSGGGLKNVVTTRYKAITVAVAVCQTLRTFWPQISQ
                     YDLRPYLTQHQSHTHPAETHTLHNLKLFCYLVSTAWHQRIDTQQELTAADRVGSGEGG
                     DVGEQRPGRGTVLRLSLQEFCVLIAALYPEYIYTVLKYPVQMSLPSLTAHLHQDVIHA
                     VVNNTHKMPPDHLPEQVKAFCITPTQWPAMQLNKLFWENKLVQQLCQVGPQKSTPSLG
                     KLWLYAMATLVFPQDMLQCLWLELKPQYAETYASVSELVQTLFQIFTQQCEMVTEGYT
                     QPQLPTGEPVLQMIRVRRQDTTTTDTNTTTEPGLLDVFIQTETALDYALGSWLFGIPV
                     CLGVHVADLLKGQRVLVARHLEYTSRDRDFLRIQRSRDLNLSQLLQDTWTETPLEHCW
                     LQAQIRRLRDYLRFPTRLEFIPLVIYNAQDHTVVRVLRPPSTFEQDHSRLVLDEAFPT
                     FPLYDQDDNTSADNVAASGAAPTPPVPFNRVPVNIQFLRENPPPIARVQQPPRRHRHR
                     AAAAADDDGQIDHAQDDTSRTADSALVSTAFGGSVFQENRLGETPLCRDELVAVAPGA
                     ASTSFASPPITVLTQNVLSALEILRLVRLDLRQLAQSVQDTIQHMRFLYLL"
     gene            complement(70422..71796)
                     /gene="UL48A"
                     /locus_tag="HHV5wtgp053"
                     /note="core gene"
     mRNA            complement(70422..71766)
                     /gene="UL48A"
                     /locus_tag="HHV5wtgp053"
                     /product="small capsid protein"
                     /experiment="RACE"
     regulatory      complement(70436..70441)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL48A"
                     /locus_tag="HHV5wtgp053"
     CDS             complement(71469..71696)
                     /gene="UL48A"
                     /locus_tag="HHV5wtgp053"
                     /note="located externally on capsid hexons; involved in
                     capsid morphogenesis; possibly involved in capsid
                     transport"
                     /codon_start=1
                     /product="small capsid protein"
                     /protein_id="AAR31612.1"
                     /translation="MSNTAPGPTVANKRDEKHRHVVNVVLELPTEISEATHPVLATML
                     SKYTRMSSLFNDKCAFKLDLLRMIAVSRTRR"
     gene            complement(71689..73401)
                     /gene="UL49"
                     /locus_tag="HHV5wtgp054"
                     /note="betagamma gene"
     CDS             complement(71689..73401)
                     /gene="UL49"
                     /locus_tag="HHV5wtgp054"
                     /codon_start=1
                     /product="protein UL49"
                     /protein_id="AAR31614.1"
                     /translation="MANRRLRHAPHTATDEFHQALRRLFAPLCVHEDHFHVQLVIGRG
                     ALQPEEAAVETSQPPAQFAAQTSAVLQQQLVHHVPRSCVLHLFVTDKRFLNRELGDRL
                     YQRFLREWLVCRQAEREAVTALFQRMVMTKPYFVFLAYVYSMDCLHTVAVRTMAFLRF
                     ERYDTDYLLRRLRLYPPERLHALLDGVTVSLLGDLHRFLFGVDLRLPVLHPTSSPCLA
                     LLRAKRFDARADLAVYHRNQWCHQRQPRSPQLRGLIAALRRHAGKVPCGNPLYVLARQ
                     AVQTFCDTCPRYLVPLRALGLHDETRGGGSTAAAAAVGHAGAGQQAHHVEPTKIVLFA
                     LSAALRGGLIGSVIDLPLWCLCRLKCERHLDARSLVAVVCRQCGHCLNLGKEKLHCQQ
                     NFPLNSMFYYRDRQEKSVIFNTHAELVHCSLCGSQRVVRQRVYELVSETLFGQRCVRV
                     GWKAVLGLNAACAVYDHRLAFDVILPCAARTCDSTVVVRGVTVPRLLRLTSHGHGLLC
                     ARCQTGEYRDSCLESEDGAPLCRGCALVKQTACHVGGHIVQQARGGLAATSSSSSPHG
                     LPHV"
     regulatory      complement(71791..71796)
                     /regulatory_class="TATA_box"
                     /gene="UL48A"
                     /locus_tag="HHV5wtgp053"
     gene            complement(73358..74554)
                     /gene="UL50"
                     /locus_tag="HHV5wtgp055"
                     /note="core gene"
     CDS             complement(73358..74554)
                     /gene="UL50"
                     /locus_tag="HHV5wtgp055"
                     /note="type 2 membrane protein; interacts with nuclear
                     egress lamina protein; involved in nuclear egress"
                     /codon_start=1
                     /product="nuclear egress membrane protein"
                     /protein_id="AAR31616.1"
                     /translation="MEMNKVLHQDLVQATRRILKLGPSELRVTDAGLICKNPNYSVCD
                     AMLKTDTVYCVEYLLSYWESRTDHVPCFIFKNTGCAVSLCCFVRAPVKLVSPARHVGE
                     FNVLKVNESLIVTLKDIEEIKPSAYGVLTKCVVRKSNSASVFNIELIAFGPENEGEYE
                     NLLRELYAKKAASTSLAVRNHVTVSSHSGSGPSLWRARMSAALTRTAGKRSPRTASPP
                     PPPPRHPSCSPTMVAAGGAAAGPRPPPPPMAAGSWRLCRCEACMGRCGCASEGDADEE
                     EEELLALAGEGKAAAAAAGQDIGGSARRPLEEHVSRRRGVSTHHRHPPSPPCTPSLER
                     TGYRWAPSSWWRARSGPSRPQSGPWLPARFATLGPLVLALLLVLALLWRGHGQSSSPT
                     RSAHRD"
     gene            complement(74576..75049)
                     /gene="UL51"
                     /locus_tag="HHV5wtgp056"
                     /note="core gene"
     CDS             complement(74576..75049)
                     /gene="UL51"
                     /locus_tag="HHV5wtgp056"
                     /note="interacts with DNA packaging terminase subunit 2;
                     involved in DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging protein UL33"
                     /protein_id="AAR31615.1"
                     /translation="MSWAKQRVPFLDDDDGEEENDVQDDVDSPVPTRPLVIDEDAEPA
                     AGTSGGLEGGGGDDEDGEDGHALPDLDDDLLLQFEPMLPRVYDLLLPSLDARLNFVNA
                     GQKYAAFLKYVHGDCATCSHGEILREKTQLLTAIVSKLMDINGILEGKDEPAPGK"
     gene            75087..77093
                     /gene="UL52"
                     /locus_tag="HHV5wtgp057"
                     /note="core gene"
     CDS             75087..77093
                     /gene="UL52"
                     /locus_tag="HHV5wtgp057"
                     /note="involved in DNA encapsidation; possibly involved in
                     capsid transport"
                     /codon_start=1
                     /product="DNA packaging protein UL32"
                     /protein_id="AAR31618.1"
                     /translation="MNPSTHVSSNGPTTPPHGPHTTFLPPTSPAPSTSSVAAATLCSP
                     QRQAVSRYSGWSTEYTQWHSDLTTELLWHAHPRQVPMDEALAAAAAASYQVNPQHPAN
                     RYRHYEFQTLSLGTSEVDELLNCCAEETTCGGTQSTVLTNATNTTSCGGAVAGSSNAG
                     PAGASAACDLDAELAGLETSAADFEQLRRLCAPLAIDTRCNLCAIISICLKQDCDQSW
                     LLEYSLLCFKCSYAPRAALSTLIIMSEFTHLLQQHFSDLRIDDLFRHHVLTVFDFHLH
                     FFINRCFEKQVGDAVDNENVTLNHLAVVRAMVMGEDTVPYNKPRRHPQQKQKNNPYHV
                     EVPQELIDNFLEHSSPSRDRFVQLLFYMWAGTGVMSTTPLTELTHTKFARLDALSTAS
                     EREDARMMMEEEEDEEGGEKGGDDPGRHNGGGTSGGFSESTLKKNVGPIYLCPVPAFF
                     TKNQTSTVCLLCELMACSYYDNVVLRELYRRVVSYCQNNVKMVDRIQLVLADLLRECT
                     SPLGAAHEDVARCGLEAPTSPGGDSDYHGLSGVDGALARPDPVFCHVLRQAGVTGIYK
                     HFFCDPQCAGNIRVTNEAVLFGHLHPHHVQEVKLAICHDNYYISRLPRRVWLCITLFK
                     AFQITKRTYKGKVHLADFMRDFTQLLENCDIKLVDPTYVIDKYV"
     gene            77086..79337
                     /gene="UL53"
                     /locus_tag="HHV5wtgp058"
                     /note="core gene"
     CDS             77086..78216
                     /gene="UL53"
                     /locus_tag="HHV5wtgp058"
                     /note="interacts with nuclear egress membrane protein;
                     involved in nuclear egress"
                     /codon_start=1
                     /product="nuclear egress lamina protein"
                     /protein_id="AAR31617.1"
                     /translation="MSSVSGVRTPRERRSALRSLLRKRRQRELASKVASTVNGATSAN
                     NHGEPPSPADARPRLTLHDLHDIFREHPELELKYLNMMKMAITGKESICLPFNFHSHR
                     QHTCLDISPYGNEQVSRIACTSCEDNRILPTASDAMVAFINQTSNIMKNRNFYYGFCK
                     SSELLKLSTNQPPIFQIYYLLHAANHDIVPFMHAENGRLHMHVIFENSDVHIPCDCIT
                     QMLTAAREDYSVTLNIVRDHVVISVLCHAVSASSVKIDVTILQRKIDEMDIPNDVSES
                     FERYKELIQELCQSSGNNLYEEATSSYAIRSPLTASPLHVVSTNGCGPSSSSQSTPPH
                     LHPPSQATQPHHYSHHQSQSQQHHHRPQSPPPPLFLNSIRAP"
     gene            complement(78194..81922)
                     /gene="UL54"
                     /locus_tag="HHV5wtgp059"
                     /note="core gene"
     CDS             complement(78194..81922)
                     /gene="UL54"
                     /locus_tag="HHV5wtgp059"
                     /EC_number="2.7.7.7"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="DNA polymerase catalytic subunit"
                     /protein_id="AAR31619.1"
                     /translation="MFFNPYLSGGVTGGAVAGGRRQRSQPGSAQGSGKRPPQKQFLQI
                     VPRGVMFDGQTGLIKHKTGRLPLMFYREIKHLLSHDMVWPCPWRETLVGRVVGPIRFH
                     TYDQTDAVLFFDSPENVSPRYRQHLVPSGNVLRFFGATEHGYSICVNVFGQRSYFYCE
                     YSDTDRLREVIASVGELVPEPRTPYAVSVTPATKTSIYGYGTRPVPDLQCVSISNWTM
                     ARKIGEYLLEQGFPVYEVRVDPLTRLVIDRRITTFGWCSVNRYDWRQQGRASTCDIEV
                     DCDVSDLVAVPDDSSWPRYRCLSFDIECMSGEGGFPCAEKSDDIVIQISCVCYETGGN
                     TAVDQGIPNGNDGRGCTSEGVIFGHSGLHLFTIGTCGQVGPDVDVYEFPSEYELLLGF
                     MLFFQRYAPAFVTGYNINSFDLKYILTRLEYLYKVDSQRFCKLPTAQGGRFFLHSPAV
                     GFKRQYAAAFPSASHNNPASTAATKVYIAGSVVIDMYPVCMAKTNSPNYKLNTMAELY
                     LRQRKDDLSYKDIPRCFVANAEGRAQVGRYCLQDAVLVRDLFNTINFHYEAGAIARLA
                     KIPLRRVIFDGQQIRIYTSLLDECACRDFILPNHYSKGTTVPETNSVAVSPNAAIIST
                     AAVPGDAGSVAAMFQMSPPLQSAPSSQDGVSPGSGSNSSSSVGVFSVGSGSSGGVGVS
                     NDNHGAGGTAAVSYQGATVFEPEVGYYNDPVAVFDFASLYPSIIMAHNLCYSTLLVPG
                     GEYPVDPADVYSVTLENGVTHRFVRASVRVSVLSELLNKWVSQRRAVRECMRECQDPV
                     RRMLLDKEQMALKVTCNAFYGFTGVVNGMMPCLPIAASITRIGRDMLERTARFIKDNF
                     SEPCFLHNFFNQEDYVVGTREGDSEESSTLPEGLETSSGGLNERRVEARVIYGDTDSV
                     FVRFRGLTPQALVARGPSLAHYVTACLFVEPVKLEFEKVFVSLMMICKKRYIGKVEGA
                     SGLSMKGVDLVRKTACEFVKGVTRDVLSLLFEDREVSEAAVRLSRLSLDEVKKYGVPR
                     GFWRILRRLVQARDDLYLHRVRVEDLVLSSVLSKDISLYRQSNLPHIAVIKRLAARSE
                     ELPSVGDRVFYVLTAPGVRAAPQGSSDNGDSVTTGVVSRSDAIDGTDDDADGGGVEES
                     NRRGGEPAKKRARKPPSAVCNYEVAEDPSYVREHGVPIHADKYFEQVLKAVTNVLSPV
                     FPGGETARKDKFLHMVLPRRLHLEPAFLPYSVKAHECC"
     regulatory      79322..79327
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL53"
                     /locus_tag="HHV5wtgp058"
     polyA_site      79337
                     /gene="UL53"
                     /locus_tag="HHV5wtgp058"
                     /experiment="RACE"
     gene            complement(82066..84789)
                     /gene="UL55"
                     /locus_tag="HHV5wtgp060"
                     /note="core gene"
     CDS             complement(82066..84789)
                     /gene="UL55"
                     /locus_tag="HHV5wtgp060"
                     /note="type 1 membrane protein; possible membrane fusogen;
                     binds cell surface heparan sulphate; involved in cell
                     entry; involved in cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein B"
                     /protein_id="AAR31620.1"
                     /translation="MESRIWCLVVCVNLCIVCLGAAVSSSSTRGTSATHSHHSSHTTS
                     AAHSRSGSVSQRVTSSQTVSHGVNETIYNTTLKYGDVVGVNTTKYPYRVCSMAQGTDL
                     IRFERNIVCTSMKPINEDLDEGIMVVYKRNIVAHTFKVRVYQKVLTFRRSYAYIHTTY
                     LLGSNTEYVAPPMWEIHHINSHSQCYSSYSRVIAGTVFVAYHRDSYENKTMQLMPDDY
                     SNTHSTRYVTVKDQWHSRGSTWLYRETCNLNCMVTITTARSKYPYHFFATSTGDVVDI
                     SPFYNGTNRNASYFGENADKFFIFPNYTIVSDFGRPNSALETHRLVAFLERADSVISW
                     DIQDEKNVTCQLTFWEASERTIRSEAEDSYHFSSAKMTATFLSKKQEVNMSDSALDCV
                     RDEAINKLQQIFNTSYNQTYEKYGNVSVFETTGGLVVFWQGIKQKSLVELERLANRSS
                     LNLTHNRTKRSTDGNNATHLSNMESVHNLVYAQLQFTYDTLRGYINRALAQIAEAWCV
                     DQRRTLEVFKELSKINPSAILSAIYNKPIAARFMGDVLGLASCVTINQTSVKVLRDMN
                     VKESPGRCYSRPVVIFNFANSSYVQYGQLGEDNEILLGNHRTEECQLPSLKIFIAGNS
                     AYEYVDYLFKRMIDLSSISTVDSMIALDIDPLENTDFRVLELYSQKELRSSNVFDLEE
                     IMREFNSYKQRVKYVEDKVVDPLPPYLKGLDDLMSGLGAAGKAVGVAIGAVGGAVASV
                     VEGVATFLKNPFGAFTIILVAIAVVIITYLIYTRQRRLCTQPLQNLFPYLVSADGTTV
                     TSGSTKDTSLQAPPSYEESVYNSGRKGPGPPSSDASTAAPPYTNEQAYQMLLALARLD
                     AEQRAQQNGTDSLDGRTGTQDKGQKPNLLDRLRHRKNGYRHLKDSDEEENV"
     gene            complement(84752..87304)
                     /gene="UL56"
                     /locus_tag="HHV5wtgp061"
                     /note="core gene"
     CDS             complement(84752..87304)
                     /gene="UL56"
                     /locus_tag="HHV5wtgp061"
                     /note="involved in DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 2"
                     /protein_id="AAR31621.1"
                     /translation="MEMNLLQKLCVVCSKCNEYAMELECLKYCDPNVLLAESTPFKRN
                     AAAIVYLYRKIYPEVVAQNRTQSSLLTLYLEMLLKALHEDTALLDRALMAYSRQPDRA
                     AFYRTVLRLDRCDRHHTVELQFTDNVRFSVSLATLNDIERFLCKMNYVYGILAPEAGL
                     EVCAQLLELLRRLCGISPVARQEVYVEGTTCAQCYEELTIIPNQGRSLNKRLQGLLCN
                     HIAVHRPSSQSDVNIQTVEQDLLDLTTRIPHLAGVLSALKSLFSSSSAYHSYIQEAEE
                     ALREYNLFTDIPERIYSLSDFTYWSRTSEVIVKRVGITIQQLNVYHQLCRALMNGISR
                     HLYGEDVEDIFVLGEKALDGEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKLH
                     ESNEMYTKIKHILEEIRRPLPDGTGGDGPEGEVIHLRGREAMSGTGTTLMTASNSSNS
                     STHSQRNNGGGGRARGGGKKAVGGGANGQDGDGSENGLRVRNCDEHEALDLVDARSRI
                     HNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLM
                     NGFLYRSQYHQDQDVVDVGNQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGP
                     LFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEGTVYPSEWMVVKYMGFFNF
                     SDCQDLNVLQKEMWMHVRELVLSVALYNETFGKQLSIACLRDELHPDRDVILTYNKEW
                     PLLLRHEGSLYKSKDLYLLLYRHLSRPDESGDVPTAPVAKPSTLTAAAAVSGAFREPD
                     RPWLPSPYPSSSTAGVSRRVRATRKRPRRASSLLDLARDEHGIQDLVPGSLR"
     gene            complement(87871..91578)
                     /gene="UL57"
                     /locus_tag="HHV5wtgp062"
                     /note="core gene"
     CDS             complement(87871..91578)
                     /gene="UL57"
                     /locus_tag="HHV5wtgp062"
                     /note="contains zinc-finger; involved in DNA replication;
                     possibly involved in gene regulation"
                     /codon_start=1
                     /product="single-stranded DNA-binding protein"
                     /protein_id="AAR31622.1"
                     /translation="MSHEELTALAPVGPAAFLYFSRLNAETQEILATLSLCDRSSSVV
                     IAPLLAGLTVEADFGVSVRTPVLCYDGGVLTKVTSFCPFALYFHHTQGIVAFTEDHGD
                     VHRLCEDARQKYALEAYTPEADRVPTDLAALCAAVGCQASETTVHVVVGNGLKEFLFA
                     GQLIPCVEEATTVRLHGGEAVRVPLYPPTLFNSLQLDAEADEVSLDARSAFVEARGLY
                     VPAVSETLFYYVYTSWCQSLRFSEPRVLIEAALRQFVHDSQQSVKLAPHKRYLGYMSQ
                     RLSSLEKDHLMLSDAVVCELAFSFASVFFDSAYQPAESMLFSEWPLVTNATDHRDLIR
                     ALTELKLHLSTHVAALVFSANSVLYQHRLVYLQSSARHPSAGGTASQETLLKAIQFTN
                     GLSAACEDVYNDARKVLKFQGAPLKDERYGPQHLALVCGTCPQLVSGFVWYLNRVSVY
                     NTGLSGSSTLTNHLVGCAAGLCEACGGTCCHTCYQTAFVRVRTRLPVVPKQPKKEPCV
                     ITVQSRFLNDVDILGSFGRRYNVDAKDGGLDGKGDDGVPGGGAGGGGGRDVSGGPSDG
                     LGGGRGGGGGGDSGGMMGRGGRMLGASVDRTYRLNRILDYCRKMRLIDPVTGEDTFSA
                     HGKSDFVAVFSALNKFVDDEALGFVSEVRLKSSRDEVAGATQAFNLDLNPYAVAFQPL
                     LAYAYFRSVFYVIQNVALITATSYIVDNPLTTNLVSKWMTQHFQSIHGAFSTTSSRKG
                     FLFTKQIKSSKNSDHDRLLDFRLYAQGTYAVVPMEIKLSRLSVPTLIMVRVKNRPIYR
                     AGKGNAGSVFFRRDHVPRRNPAKGCLGFLLYRHHERLFPECGLPCLQFWQKVCSNALP
                     KNVPIGDMGEFNAFVKFLVAVTADYQEHDLLDVAPDCVLSYVESRFHNKFLCYYGFKD
                     YIGSLHGLTTRLTTQNHAQFPHVLGASPRFSSPAEFALHVKGLKTAGVPAPMAATVAR
                     ESLVRSVFEHRSLVTVPVSVEKYAGINNSKEIYQFGQIGYFSGNGVERSLNVSSMSGQ
                     DYRFMRQRYLLATRLADVLIKRSRRENVLFDADLIKNRVMLALDAENLDCDPEVMAVY
                     EILSVREEIPASDDVLFFVDGCEALAASLMDKFAALQEQGVEDFSLENLRRVLDADAQ
                     RLTDAAGGEVHDLSALFAPSGVGAASGVGGGGLLLGESVAGNSICFGVPGETGGGCFL
                     VNAGEDEAGGVGGSSGGGGGSGLLPAKRSRL"
     rep_origin      93523..94613
                     /note="OriLyt"
     repeat_region   94059..94198
                     /note="OriLyt-associated repeat"
                     /rpt_unit_range=94059..94122
     gene            94297..99218
                     /gene="RNA4.9"
                     /locus_tag="HHV5wtgr004"
     regulatory      94297..94302
                     /regulatory_class="TATA_box"
                     /gene="RNA4.9"
                     /locus_tag="HHV5wtgr004"
     ncRNA           94326..99218
                     /ncRNA_class="other"
                     /gene="RNA4.9"
                     /locus_tag="HHV5wtgr004"
                     /product="RNA4.9"
                     /experiment="Northern blot"
                     /experiment="RACE"
     regulatory      99193..99198
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RNA4.9"
                     /locus_tag="HHV5wtgr004"
     gene            complement(99519..101747)
                     /gene="UL69"
                     /locus_tag="HHV5wtgp063"
                     /note="core gene"
     CDS             complement(99519..101747)
                     /gene="UL69"
                     /locus_tag="HHV5wtgp063"
                     /note="RNA-binding protein; shuttles between nucleus and
                     cytoplasm; inhibits pre-mRNA splicing; exports virus mRNA
                     from nucleus; exerts most effects post-transcriptionally;
                     involved in gene regulation; involved in RNA metabolism
                     and transport"
                     /codon_start=1
                     /product="multifunctional expression regulator"
                     /protein_id="AAR31623.1"
                     /translation="MELHSRGRHDAPSLSSLSERERRARRARRFCLDYEPVPRKFRRE
                     RSPTSPSTRNGAAASEYHLAEDTVGAASHHHRPCVPARRPRYSKDDDTEGDPDHYPPP
                     LPPSSRHALGGTGGHIIMGTAGFRGGHRASSSFKRRVAASASVPLNPHYGKSYDNDDG
                     EPHHHGGDSTHLRRRVPSCPTTFGSSHPSSANNHHGSSAGPQQQQMLALIDDELDAMD
                     EDELQQLSRLIEKKKRARLQRGAASSGTSPSSTSPVYDLQRYTAESLRLAPYPADLKV
                     PTAFPQDHQPRGRILLSHDELMHTDYLLHIRQQFDWLEEPLLRKLVVEKIFAVYNAPN
                     LHTLLAIIDETLSYMKYHHLHGLPVNPHDPYLETVGGMRQLLFNKLNNLDLGCILDHQ
                     DGWGDHCSTLKRLVKKPGQMSAWLRDDVCDLQKRPPETFSQPMHRAMAYVCSFSRVAV
                     SLRRRALQVTGTPQFFDQFDTNNAMGTYRCGAVSDLILGALQCHECQNEMCELRIQRA
                     LAPYRFMIAYCPFDEQSLLDLTVFAGTTTTTASNHATAGGQQRGGDQIHPTDEQCASM
                     ESRTDPATLTAYDKKDREGSHRHPSPMIAAAAPPAQPPSQPQQHYSEGELEEDEDSDD
                     ASSQDLVRATDRHGDTVVYKTTAVPPSPPAPLAGVRSHRGELNLMTPSPSHGGSPPQV
                     PHKQPIIPVQSANGNHSTTATQQQQPPPPPPVPQEDDSVVMRCQTPDYEDMLCYSDDM
                     DD"
     gene            complement(101847..104687)
                     /gene="UL70"
                     /locus_tag="HHV5wtgp064"
                     /note="core gene"
     CDS             complement(101847..104687)
                     /gene="UL70"
                     /locus_tag="HHV5wtgp064"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase primase subunit"
                     /protein_id="AAR31624.1"
                     /translation="MTLVLFATEYDSAHIVANVLSQTPTDHCVFPLLVKHQVSRRVYF
                     CLQTQKCSDSRRVAPVFAVNNETLQLSRYLAARQPIPLSALIASLDEAETRPLYRHLF
                     RTPVLSPEHGGEVREFKHLVYFHHAAVLRHLNQVFLCPTSPSWFISVFGHTEGQVLLT
                     MAYYLFEGQYSTISTVEEYVRSFCTRDLGTIIPTHASMGEFARLLLGSPFRQRVSAFV
                     AYAVARNRRDYTELEQVDTQINAFRERARLPDTVCVHYVYLAYRTALARARLLEYRRV
                     VAYDADAAPEAQCTREPGFLGRRLSTELLDVMQKYFSLDNFLHDYVETHLLRLDESPH
                     SATSPHGLGLAGYGGRIDGTHLAGFFGTSTQLARQLERINTLSESVFSPLERSLSGLL
                     RLCASLRTAQTYTTGTLTRYSQRRYLLPEPALAPLLERPLPVYRVHLPNDQHVFCAVA
                     SETWHRSLFPRDLLRHVPDSRFSDEALTETVWLHDDDVASTSPETQFYYTRHEVFNER
                     LPVFNFVADFDLRLRDGVSGLARHTVFELCRGLRRVWMTVWASLFGYTHPDRHPVYFF
                     KSACPPNSVPVDAAGAPFDDDDYLDYRDERDTEEDEDGKEDKNNVPGNGVFQKTTSSV
                     DTSPPYCRCKGKLGLRIITPFPACTIAVHPSVLRAVAQVLNHAVCLDAELHTLLDPIS
                     HPESSLDTGIYHHGRSVRLPYMYKMDQDDGYFMHRRLLPLFIVPDAYREHPLGFVRAQ
                     LDLRNLLHHHPPHDLPALPLSPPPRVILSVRDKICPSTEANFIETRSLNVTRYRRRGL
                     TEVLAYHLYGGDGATAAAISDTDLQRLVVTRVWPPLLEHLTQHYEPHVSEQFTAPHVL
                     LFQPHGACCVAVKRRDGARTRDFRCLNYTHRNPQETVQVFIDLRTEHSYALWASLWSR
                     CFTKKCHSNAKNVHISIKIRPPDAPMPPATAV"
     ncRNA           104404..104424
                     /ncRNA_class="miRNA"
                     /product="hcmv-miR-UL70-5p"
                     /inference="ab initio prediction:miRBase:rel16"
     ncRNA           104445..104464
                     /ncRNA_class="miRNA"
                     /product="hcmv-miR-UL70-3p"
                     /inference="ab initio prediction:miRBase:rel16"
     gene            104703..105788
                     /gene="UL71"
                     /locus_tag="HHV5wtgp065"
                     /note="core gene"
     CDS             104703..105788
                     /gene="UL71"
                     /locus_tag="HHV5wtgp065"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL51"
                     /protein_id="AAR31724.1"
                     /translation="MQLAQRLCELLMCRRKAAPVADYVLLQPSEDVELRELQAFLDEN
                     FKQLEITPADLRTFSRDTDVVNHLLKLLPLYRQCQSKCAFLKGYLSEGCLPHTRPAAE
                     VECKKSQRILEALDILILKLVVGEFAMSEADSLEMLLDKFSTDQASLVEVQRVMGLVD
                     MDCEKSAYMLEAGAAATVAPPTPPAVVQGESGVREDGETVAAVSAFACSSVSDSLIPE
                     ETGVTRPMMSLAHINTVSCPTVMRFDQRLLEEGDEEDEVTVMSPSPEPVQQQPPVEPV
                     QQQPQGRGSHRRRYKESAPQETLPTNHEREILDLMRHSPDVPREAVMSPTMVTIPPPQ
                     IPFVGSARELRGVKKKKPTAAALLSSA"
     gene            complement(105869..107035)
                     /gene="UL72"
                     /locus_tag="HHV5wtgp066"
                     /note="core gene"
     CDS             complement(105869..107035)
                     /gene="UL72"
                     /locus_tag="HHV5wtgp066"
                     /note="enzymatically inactive; DURP family"
                     /codon_start=1
                     /product="deoxyuridine triphosphatase"
                     /protein_id="AAR31625.1"
                     /translation="MLTMLTDRIDSQLVLSRLPRSRFQRFWETPTLIMKEESAPSSGS
                     IILAEKSVNMRYCVRFASDSDFQTTFTLPQSTEEKYDKEQHPGEDEASSPLPSPLKVP
                     YKWMPSSFIVKQCHTQLAFYNKHIIWLSRERKVPTSLGVSLYIPEGFFGITFYKCLDA
                     QFVCMPELLESGLQVPQLDVVNLNDTFQSIFPGTIEGDIGVFPCFVPEPWQLMNLPPP
                     NEHRFFSLRTRQTLVIGPGHTQTVYFDAAYVHAPGICALIVGVRQFSQSDLIIRPTIW
                     LPGTAAGVTVVNTSHTTVCISPHTTVAKAVFTTHRFTYLPVGSHPLGQMIVPPTPDIG
                     FTHTPEHALLQRTPSPVDDDVDETEEDEKSSDAESPVNTSDVIFDVGPKPPRHP"
     gene            106937..109088
                     /gene="UL73"
                     /locus_tag="HHV5wtgp067"
                     /note="core gene"
     regulatory      106937..106942
                     /regulatory_class="TATA_box"
                     /gene="UL73"
                     /locus_tag="HHV5wtgp067"
     regulatory      106965..106970
                     /regulatory_class="TATA_box"
                     /gene="UL73"
                     /locus_tag="HHV5wtgp067"
     mRNA            join(106972..107496,108854..109088)
                     /gene="UL73"
                     /locus_tag="HHV5wtgp067"
                     /product="envelope glycoprotein N"
                     /experiment="Northern blot"
                     /experiment="RACE"
                     /experiment="RT-PCR"
     mRNA            join(106995..107496,108854..109088)
                     /gene="UL73"
                     /locus_tag="HHV5wtgp067"
                     /product="envelope glycoprotein N"
                     /experiment="Northern blot"
                     /experiment="RACE"
                     /experiment="RT-PCR"
     CDS             107051..107458
                     /gene="UL73"
                     /locus_tag="HHV5wtgp067"
                     /note="type 1 membrane protein; complexed with envelope
                     glycoprotein M; involved in virion morphogenesis; involved
                     in membrane fusion"
                     /codon_start=1
                     /product="envelope glycoprotein N"
                     /protein_id="AAR31725.1"
                     /translation="MEWNTLVLGLLVLSVVASSNNTSTASTPRPSSSTHASTTVKATT
                     VATTSTTTATSTSSTTSAKPGSTTHDPNVMRPHAHNDFYNAHCTSHMYELSLSSFAAW
                     WTMLNALILMGAFCIVLRHCCFQNFTATTTKGY"
     gene            complement(107430..108848)
                     /gene="UL74"
                     /locus_tag="HHV5wtgp068"
                     /note="beta gene"
     CDS             complement(107430..108848)
                     /gene="UL74"
                     /locus_tag="HHV5wtgp068"
                     /note="contains signal peptide; associated with envelope
                     glycoprotein H and envelope glycoprotein L; involved in
                     virion morphogenesis"
                     /codon_start=1
                     /product="envelope glycoprotein O"
                     /protein_id="AAR31626.1"
                     /translation="MGKKEMIMVKGIPKIMLLISITFLLLSLINCNVLVNSRGTRRSW
                     PYTVLSYRGKEILKKQKEDILKRLMSTSSDGYRFLMYPSQQKFHAIVISMDKFPQDYI
                     LAGPIRNDSITHMWFDFYSTQLRKPAKYVYSEYNHTAHKITLRPPPCGTVPSMNCLSE
                     MLNVSKRNDTGEKGCGNFTTFNPMFFNVPRWNTKLYIGSNKVNVDSQTIYFLGLTALL
                     LRYAQRNCTRSFYLVNAMSRNLFRVPKYINGTKLKNTMRKLKRKQALVKEQPQKKNKK
                     SQSTTTPYLSYTTSTAFNVTTNVTYSATAAVTRVATSTTGYRPDSNFMKSIMATQLRD
                     LATWVYTTLRYRNEPFCKPDRNRTAVSEFMKNTHVLIRNETPYTIYGTLDMSSLYYNE
                     TMSVENETASDNNETTPTSPSTRFQRTFIDPLWDYLDSLLFLDKIRNFSLQLPAYGNL
                     TPPEHRRAANLSTLNSLWWWSQ"
     gene            107708..109088
                     /gene="UL74A"
                     /locus_tag="HHV5wtgp167"
                     /note="beta gene"
     regulatory      107708..107713
                     /regulatory_class="TATA_box"
                     /gene="UL74A"
                     /locus_tag="HHV5wtgp167"
     mRNA            join(107740..108155,108854..109088)
                     /gene="UL74A"
                     /locus_tag="HHV5wtgp167"
                     /product="envelope glycoprotein 24"
                     /experiment="Northern blot"
                     /experiment="RACE"
                     /experiment="RT-PCR"
                     /note="main coding exon spliced from one or other of >45
                     upstream exons"
     regulatory      107828..107833
                     /regulatory_class="TATA_box"
                     /gene="UL74A"
                     /locus_tag="HHV5wtgp167"
     mRNA            join(107860..108155,108854..109088)
                     /gene="UL74A"
                     /locus_tag="HHV5wtgp167"
                     /product="envelope glycoprotein 24"
                     /experiment="Northern blot"
                     /experiment="RACE"
                     /experiment="RT-PCR"
                     /note="main coding exon spliced from one or other of >45
                     upstream exons"
     CDS             join(108142..108155,108854..109052)
                     /gene="UL74A"
                     /locus_tag="HHV5wtgp167"
                     /note="type 2 membrane protein"
                     /codon_start=1
                     /product="envelope glycoprotein 24"
                     /protein_id="ACO83398.2"
                     /translation="MALTRGGDPAPSVCLVVWFACVYSLLILVVLLLIYRCCIGFQDD
                     LVSRTLAVYRACIQGPICNQTHNSTS"
     regulatory      109052..109057
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL73, UL74A"
     gene            complement(109224..111452)
                     /gene="UL75"
                     /locus_tag="HHV5wtgp069"
                     /note="core gene"
     CDS             complement(109224..111452)
                     /gene="UL75"
                     /locus_tag="HHV5wtgp069"
                     /note="type 1 membrane protein; possible membrane fusogen;
                     complexed with envelope glycoprotein L; involved in cell
                     entry; involved in cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein H"
                     /protein_id="AAR31627.1"
                     /translation="MRPGLPSYLIILAVCLFSHLLSSRYGAEAVSEPLDKAFHLLLNT
                     YGRPIRFLRENTTQCTYNSSLRNSTVVRENAISFNFFQSYNQYYVFHMPRCLFAGPLA
                     EQFLNQVDLTETLERYQQRLNTYALVSKDLASYRSFSQQLKAQDSLGEQPTTVPPPID
                     LSIPHVWMPPQTTPHGWTESHTTSGLHRPHFNQTCILFDGHDLLFSTVTPCLHQGFYL
                     IDELRYVKITLTEDFFVVTVSIDDDTPMLLIFGHLPRVLFKAPYQRDNFILRQTEKHE
                     LLVLVKKDQLNRHSYLKDPDFLDAALDFNYLDLSALLRNSFHRYAVDVLKSGRCQMLD
                     RRTVEMAFAYALALFAAARQEEAGAQVSVPRALDRQAALLQIQEFMITCLSQTPPRTT
                     LLLYPTAVDLAKRALWTPNQITDITSLVRLVYILSKQNQQHLIPQWALRQIADFALKL
                     HKTHLASFLSAFARQELYLMGSLVHSMLVHTTERREIFIVETGLCSLAELSHFTQLLA
                     HPHHEYLSDLYTPCSSSGRRDHSLERLTRLFPDATVPATVPAALSILSTMQPSTLETF
                     PDLFCLPLGESFSALTVSEHVSYIVTNQYLIKGISYPVSTTVVGQSLIITQTDSQTKC
                     ELTRNMHTTHSITVALNISLENCAFCQSALLEYDDTQGVINIMYMHDSDDVLFALDPY
                     NEVVVSSPRTHYLMLLKNGTVLEVTDVVVDATDSRLLMMSVYALSAIIGIYLLYRMLK
                     TC"
     gene            111647..112624
                     /gene="UL76"
                     /locus_tag="HHV5wtgp070"
                     /note="core gene"
     CDS             111647..112624
                     /gene="UL76"
                     /locus_tag="HHV5wtgp070"
                     /codon_start=1
                     /product="nuclear protein UL24"
                     /protein_id="AAR31628.1"
                     /translation="MPSGCGDDADSTGNALRRLPHVRKRIGKRKHLDIYRRLLRVFPS
                     FVALNRLLGGLFPPELQKYRRRLFIEVRLSRRIPDCVLVFLPPDSGSRGIVYCYVIEF
                     KTTYSDADDQSVRWHATHSLQYAEGLRQLKGALVDFDFLRLPRGGGQVWSVVPSLVFF
                     QQKADRPSFYRAFRSGRFDLCTDSVLDYLGRRQDESVAHLLAATRRRLLRAARGKRAA
                     LPRARASAVAGGRGGGNARRGLARGRAHGPGAQTVSASGAEGSGSQGTDLLRGSRRAR
                     VRGGGAVEPAVRARRRTVAADAATTTVSSAFVVPRDRRGRSFRRPTRSL"
     gene            112227..114137
                     /gene="UL77"
                     /locus_tag="HHV5wtgp071"
                     /note="core gene"
     CDS             112227..114137
                     /gene="UL77"
                     /locus_tag="HHV5wtgp071"
                     /note="located on capsid near vertices; possibly
                     stabilizes the capsid and retains the genome; involved in
                     DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL25"
                     /protein_id="AAR31629.1"
                     /translation="MSLLHTFWRLPVAVFFEPHEENVLRCPERVLRRLLEDAAVAMRG
                     GGWREDVLMDRVRKRYLRQELRDLGHRVQTYCEDLEGRVSEAEALLNQQCELDEGPSP
                     RTLLQPPCRPRSSSPGTGVAGASAVPHGLYSRHDAITGPVAAPSDAVAASAAAGASST
                     WLAQCAEQPLPGNVPNYFGITQNDPFIRFHTDFRGEVVNTMFENASTWTFSFGIWYYR
                     LKRGLYTQPRWKRVYHLAQMDNFSISQELLLGVVNALENVTVYPTYDCVLSDLEAAAC
                     LLVAYGHALWEGRDPPDSVTAVLSELPQLLPRLADDVSREIAAWEGPVAAGNNYYAYR
                     DSPDLRYYMPLSGGRHYHPGTFDRHVLVRLFHKRGVLQHLPGYGTITEELVQERLSGQ
                     VRDDVLSLWSRRLLVGKLGRDVPVFVHEQQYLRSGLTCLAGLLLLWKVTNADSVFAPR
                     TGKFTLADLLGSDAVAGGGLPGGRAGGEEKGYGGRHGRVRNFEFLVQYYIGPWYARDP
                     AVTLSQLFPGLALLAVTESVRSGWDPSRREDSAGGGDGGGAVLMQLSKSNPVADYMFA
                     QSSKQYGDLRRLEVHDALLFHYEHGLGRLLSVTLPRHRVSTLGSSLFNVNDIYELLYF
                     LVLGFLPSVAVL"
     gene            114226..115521
                     /gene="UL78"
                     /locus_tag="HHV5wtgp072"
                     /note="beta gene"
     CDS             114226..115521
                     /gene="UL78"
                     /locus_tag="HHV5wtgp072"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     putative chemokine receptor; possibly involved in
                     intracellular signalling; GPCR family"
                     /codon_start=1
                     /product="envelope protein UL78"
                     /protein_id="AAR31630.1"
                     /translation="MSPSVEETTSVTESIMFAIVSFKHMGPFEGYSMSADRAASDLLI
                     GMFGSVSLVNLLTIIGCLWVLRVTRPPVSVMIFTWNLVLSQFFSILATMLSKGIMLRG
                     ALNLSLCRLVLFVDDVGLYSTALFFLFLILDRLSAISYGRDLWHHETRENAGVALYAV
                     AFAWVLSIVAAVPTAATGSLDYRWLGCQIPIQYAAVDLTIKMWFLLGAPMIAVLANVV
                     ELAYSDRRDHVWSYVGRVCTFYVTCLMLFVPYYCFRVLRGVLQPASAAGTGFGIMDYV
                     ELATRTLLTMRLGILPLFIIAFFSREPTKDLDDSFDYLVERCQQSCHGHFVRRLVQAL
                     KRAMYSVELAVCYFSTSVRDVAEAVKKSSSRCYADATSAAVVVTTTTSEKATLVEHAE
                     GMASEMCPGTTIDVSAESSSVLCTDGENTVASDATVTAL"
     gene            complement(115576..116463)
                     /gene="UL79"
                     /locus_tag="HHV5wtgp073"
                     /note="betagamma gene"
     CDS             complement(115576..116463)
                     /gene="UL79"
                     /locus_tag="HHV5wtgp073"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL79"
                     /protein_id="AAR31631.1"
                     /translation="MMARDEENPAVPRVRTGKFSFTCANHLILQISEKMSRGQPLSSL
                     RLEELKIVRLICVLLFHRGLETLLLRETMNNLGVSDHAVLSRKTPQPYWPHLYRELRQ
                     AFPGLDFEAAVFDETRAARLSQRLCHPRLSGGLLTRFVQRHTGLPVVFPEDLARNGNI
                     LFSLGTLYGHRLFRLAAFFTRHWGAEAYEPLIRIICQKMWYFYLIGTGKMRITPDAFD
                     IQRSRHETGIFTFIMEDYRTFAGTLSRHPHRPHPQQQQHHHPGPPHPPLSHPASSCLS
                     PEAVLAARALHMPTLANDV"
     gene            116500..118626
                     /gene="UL80"
                     /locus_tag="HHV5wtgp074"
                     /note="core gene"
     CDS             116500..118626
                     /gene="UL80"
                     /locus_tag="HHV5wtgp074"
                     /EC_number="3.4.21.97"
                     /note="serine protease (N-terminal region); minor scaffold
                     protein (remainder of protein, clipped near C terminus);
                     involved in capsid morphogenesis"
                     /codon_start=1
                     /product="capsid maturation protease"
                     /protein_id="AAR31632.1"
                     /translation="MTMDEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLH
                     AQGQGQPSLSVALPLNINHDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASE
                     KSELVSRGPVSPLQPDKVVEFLSGSYAGLSLSSRRCDDVEAATSLSGSETTPFKHVAL
                     CSVGRRRGTLAVYGRDPEWVTQRFPDLTAADRDGLRAQWQRCGSTAVDASGDPFRSDS
                     YGLLGNSVDALYIRERLPKLRYDKQLVGVTERESYVKASVSPEAACVIKAASAERSGD
                     SRSQAATPAAGARVPSSSPSPPVEPPSPVQPPALPASPSVLPAESPPSLSPSEPAEAA
                     SMSHPLSAAVPAATAPPGATVAGASPAVSSLAWPHDGVYLPKDAFFSLLGASRSAAPV
                     MYPGAVAAPPSASPAPLPLPSYPASYGAPVVGYDQLAARHFADYVDPHYPGWGRRYEP
                     APSLHPSYPVPPPPSPAYYRRRDSPGGMDEPPSGWERYDGGHRGQSQKQHRHGGSGGH
                     NKRRKETAAASSSSSDEDLSFPGEAEHGRARKRLKSHVNSDGGSGGHAGSNQQQQQRY
                     DELRDAIHELKRDLFAARQSSTLLSAALPSAASSSPTTTTVCTPTSELTSGGGETPTA
                     LLSGGAKVAERAQAGVVNASCRLATASGSEAATAGPSTAGSSSCPASVVLAAAAAQAA
                     AASQSPPKDMVDLNRRIFVAALNKLE"
     gene            117505..118626
                     /gene="UL80.5"
                     /locus_tag="HHV5wtgp075"
                     /note="core gene"
     CDS             117505..118626
                     /gene="UL80.5"
                     /locus_tag="HHV5wtgp075"
                     /note="clipped near C terminus; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid scaffold protein"
                     /protein_id="AAR31633.1"
                     /translation="MSHPLSAAVPAATAPPGATVAGASPAVSSLAWPHDGVYLPKDAF
                     FSLLGASRSAAPVMYPGAVAAPPSASPAPLPLPSYPASYGAPVVGYDQLAARHFADYV
                     DPHYPGWGRRYEPAPSLHPSYPVPPPPSPAYYRRRDSPGGMDEPPSGWERYDGGHRGQ
                     SQKQHRHGGSGGHNKRRKETAAASSSSSDEDLSFPGEAEHGRARKRLKSHVNSDGGSG
                     GHAGSNQQQQQRYDELRDAIHELKRDLFAARQSSTLLSAALPSAASSSPTTTTVCTPT
                     SELTSGGGETPTALLSGGAKVAERAQAGVVNASCRLATASGSEAATAGPSTAGSSSCP
                     ASVVLAAAAAQAAAASQSPPKDMVDLNRRIFVAALNKLE"
     gene            complement(118788..120467)
                     /gene="UL82"
                     /locus_tag="HHV5wtgp076"
                     /note="beta gene"
     CDS             complement(118788..120467)
                     /gene="UL82"
                     /locus_tag="HHV5wtgp076"
                     /note="upper matrix protein; involved in gene regulation;
                     transcriptional activator; targeted to ND10; targets Rb
                     proteins for ubiquitin-independent proteosomal
                     degradation; DURP family"
                     /codon_start=1
                     /product="tegument protein pp71"
                     /protein_id="AAR31634.1"
                     /translation="MSQASSSPGEGPSSEAAAISEAEAASGSFGRLHCQVLRLITNVE
                     GGSLEAGRLRLLDLRTNIEVSRPSVLCCFQENKSPHDTVDLTDLNIKGRCVVGEQDRL
                     LVDLNNFGPRRLTPGSENNTVSVLAFALPLDRVPVSGLHLFQSQRRGGEENRPRMEAR
                     AIIRRTAHHWAVRLTVTPNWRRRTDSSLEAGQIFVSQFAFRAGAIPLTLVDALEQLAC
                     SDPNTYIHKTETDERGQWIMLFLHHDSPHPPTSVFLHFSVYTHRAEVVARHNPYPHLR
                     RLPDNGFQLLIPKSFTLTRIHPEYIVQIQNAFETNQTHDTIFFPENIPGVSIEAGPLP
                     DRVRITLRVTLTGDQAVHLEHRQPLGRIHFFRRGFWTLTPGKPDKIKRPQVQLRAGLF
                     PRSNVMRGAVSEFLPQSPGLPPTEEEEEEEEEDDEDDLSSTPTPTPLSEAMFAGFEEA
                     SGDEDSDTQAGLSRALILTGQRRRSGNNGALTLVIPSWHVFASLDDLVPLTVSVQHAA
                     LRPTSYLRSDMDGDVRTAADISSTLRSVPAPRPSPISTASTSSTPRSRPRI"
     gene            complement(120656..122341)
                     /gene="UL83"
                     /locus_tag="HHV5wtgp077"
                     /note="beta gene"
     CDS             complement(120656..122341)
                     /gene="UL83"
                     /locus_tag="HHV5wtgp077"
                     /note="lower matrix protein; involved in immune
                     regulation; suppresses interferon response; inhibits NK
                     cell cytotoxicity; binds NKp30; DURP family"
                     /codon_start=1
                     /product="tegument protein pp65"
                     /protein_id="AAR31635.1"
                     /translation="MESRGRRCPEMISVLGPISGHVLKAVFSRGDTPVLPHETRLLQT
                     GIHVRVSQPSLILVSQYTPDSTPCHRGDNQLQVQHTYFTGSEVENVSVNVHNPTGRSI
                     CPSQEPMSIYVYALPLKMLNIPSINVHHYPSAAERKHRHLPVADAVIHASGKQMWQAR
                     LTVSGLAWTRQQNQWKEPDVYYTSAFVFPTKDVALRHVVCAHELVCSMENTRATKMQV
                     IGDQYVKVYLESFCEDVPSGKLFMHVTLGSDVEEDLTMTRNPQPFMRPHERNGFTVLC
                     PKNMIIKPGKISHIMLDVAFTSHEHFGLLCPKSIPGLSISGNLLMNGQQIFLEVQAIR
                     ETVELRQYDPVAALFFFDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGA
                     AQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMASASTSAGRKRKSASSATACTAGV
                     MTRGRLKAESTVAPEEDTDEDSDNEIHNPAVFTWPPWQAGILARNLVPMVATVQGQNL
                     KYQEFFWDANDIYRIFAELEGVWQPAAQPKRRRHRQDALPGPCIASTPKKHRG"
     gene            complement(122613..124376)
                     /gene="UL84"
                     /locus_tag="HHV5wtgp078"
                     /note="beta gene"
     CDS             complement(122613..124376)
                     /gene="UL84"
                     /locus_tag="HHV5wtgp078"
                     /note="involved in gene regulation; involved in DNA
                     replication; DURP family"
                     /codon_start=1
                     /product="protein UL84"
                     /protein_id="AAR31636.1"
                     /translation="MPRVDPNLRNRARRPRARRGGGGGVGSNSSRHSGKCRRQRRALS
                     TPPLTFLATTTTTTMMGVASTDDDSLLLKTPDELDKHSGSPQTILTLTDKHDIRQPRV
                     HRGTYHLIQLHLDLRPEELRDPFQILLSTPLQLGEANGESQTAPATSQEEETAASHEP
                     EKKKEKEEKKEEEDEDDRNDDRERGILCVVSNEDSDVRPAFSLFPARPGCHILRSVID
                     QQLTRMAIVRLSLNLFALRIITPLLKRLPLRRKAAHHTALHDCLALHLPELTFEPTLD
                     INNVTENAASVADTAESTDADLTPTLTVRVRHALCWHRVEGGISGPRGLTSRISARLS
                     ETTAKTLGPSVFGRLELDPNESPPDLTLSSLTLYQDGILRFNVTCDRTEAPADPVAFR
                     LRLRRETVRRPFFSDAPLPYFVPPRSGAADEGLEVRVPYELTLKNSHTLRIYRRFYGP
                     YLGVFVPHNRQGLKMPVTVWLPRSWLELTVLVSDENGATFPRDALLGRLYFISSKHTL
                     NRGCLSAMTHQVKSTLHSRSTSHSPSQQQLSVLGASIALEDLLPMRLASPETEPQDCK
                     LTENTTEKTSPVTLAMVCGDL"
     gene            complement(124408..125328)
                     /gene="UL85"
                     /locus_tag="HHV5wtgp079"
                     /note="core gene"
     CDS             complement(124408..125328)
                     /gene="UL85"
                     /locus_tag="HHV5wtgp079"
                     /note="complexed 2:1 with capsid triplex subunit 1 to
                     connect capsid hexons and pentons; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid triplex subunit 2"
                     /protein_id="AAR31637.1"
                     /translation="MAAMEANIFCTFDHKLSIADVGKLTKLVAAVVPIPQRLHLIKHY
                     QLGLHQFVDHTRGYVRLRGLLRNMTLTLMRRVEGNQILLHVPTHGLLYTVLNTGPVTW
                     EKGDALCVLPPLFHGPLARENLLTLGQWELVLPWIVPMPLALEINQRLLIMGLFSLDR
                     SYEEVKAAVQQLQTITFRDATFTIPDPVIDQHLLIDMKTACLSMSMVANLASELTMTY
                     VRKLALEDSSMLLVKCQELLMRLDRERSVGEPRTPARPQHVSPDDEIARLSALFVMLR
                     QLDDLIREQVVFTVCDVSPDNKSATCIFKG"
     gene            complement(125490..129602)
                     /gene="UL86"
                     /locus_tag="HHV5wtgp080"
                     /note="core gene"
     CDS             complement(125490..129602)
                     /gene="UL86"
                     /locus_tag="HHV5wtgp080"
                     /note="6 copies form hexons, 5 copies form pentons;
                     involved in capsid morphogenesis"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="AAR31638.1"
                     /translation="MENWSALELLPKVGIPTDFLTHVKTSAGEEMFEALRIYYGDDPE
                     RYNIHFEAIFGTFCNRLEWVYFLTSGLAAAAHAIKFHDLNKLTTGKMLFHVQVPRVAS
                     GAGLPTSRQTTIMVTKYSEKSPITIPFELSAACLTYLRETFEGTILDKILNVEAMHTV
                     LRALKNTADAMERGLIHSFLQTLLRKAPPYFVVQTLVENATLARQALNRIQRSNILQS
                     FKAKMLATLFLLNRTRDRDYVLKFLTRLAEAATDSILDNPTTYTTSSGAKISGVMVST
                     ANVMQIIMSLLSSHITKETVSAPATYGNFVLSPENAVTAISYHSILADFNSYKAHLTS
                     GQPHLPNDSLSQAGAHSLTPLSMDVIRLGEKTVIMENLRRVYKNTDTKDPLERNVDLT
                     FFFPVGLYLPEDRGYTTVESKVKLNDTVRNALPTTAYLLNRDRAVQKIDFVDALKTLC
                     HPVLHEPAPCLQTFTERGPPSEPAMQRLLECRFQQEPMGGAARRIPHFYRVRREVPRT
                     VNEMKQDFVVTDFYKVGNITLYTELHPFFDFTHCQENSETVALCTPRIVIGNLPDGLA
                     PGPFHELRTWEIMEHMRLRPPPDYEETLRLFKTTVTSPNYPELCYLVDVLVHGNVDAF
                     LLIRTFVARCIVNMFHTRQLLVFAHSYALVTLIAEHLADGALPPQLLFHYRNLVAVLR
                     LVTRISALPGLNNGQLAEEPLSAYVNALHDHRLWPPFVTHLPRNMEGVQVVADRQPLN
                     PANIEARHHGVSDVPRLGAMDADEPLFVDDYRATDDEWTLQKVFYLCLMPAMTNNRAC
                     GLGLNLKTLLVDLFYRPAFLLMPAATAVSTSGTTSKESTSGVTPEDSIAAQRQAVGEM
                     LTELVEDVATDAHTPLLQACRELFLAVQFVGEHVKVLEVRAPLDHAQRQGLPDFISRQ
                     HVLYNGCCVVTAPKTLIEYSLPVPFHRFYSNPTICAALSDDIKRYVTEFPHYHRHDGG
                     FPLPTAFAHEYHNWLRSPFSRYSATCPNVLHSVMTLAAMLYKISPVSLVLQTKAHIHP
                     GFALTAVRTDTFEVDMLLYSGKSCTSVIINNPIVTKEERDISTTYHVTQNINTVDMGL
                     GYTSNTCVAYVNRVRTDMGVRVQDLFRVFPMNVYRHDEVDRWIRHAAGVERPQLLDTE
                     TISMLTFGSMSERNAAATVHGQKAACELILTPVTMDVNYFKIPNNPRGRASCMLAVDP
                     YDTEAATKAIYDHREADAQTFAATHNPWASQAGCLSDVLYNTRHRERLGYNSKFYSPC
                     AQYFNTEEIIAANKTLFKTIDEYLLRAKDCIRGDTDTQYVCVEGTEQLIENPCRLTQE
                     ALPILSTTTLALMETKLKGGAGAFATSETHFGNYVVGEIIPLQQSMLFNS"
     gene            129662..132487
                     /gene="UL87"
                     /locus_tag="HHV5wtgp081"
                     /note="betagamma gene"
     CDS             129662..132487
                     /gene="UL87"
                     /locus_tag="HHV5wtgp081"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL87"
                     /protein_id="AAR31639.1"
                     /translation="MAGAAPRRLGCDALIVVGGSAMPRRVLHVPVHVRACNLTQELST
                     GEDARFCRPRPVNVERVRAVFAALYRACPIHVRTEPERVKLVLGRLLLGPVAVPCFCD
                     GEVEGHGEHLVPTTQFCRGPLLYVHRRCCCGSVTAGRALSYHVLENHVATHVLRGLLS
                     LTEWNRELPSLFCDCPGGGGASGTEERYAMACLPRDLSLHLDDYPYLMVEIGRVLSVS
                     EVDDYVTAVSGYLGEAAAPRIQVHYKLLFGLNVRPQAPCALDATRDFFLLELQKLWLG
                     VEYHHEVTSEFFGRVLAQLHRDRARVMMALRLPEQTVCHLSTFVLSRFKRQVLYFKLQ
                     VSYGKCRTGHADRSGGGGNGGNQGHHNLLCYRRLSVTFADTDTVWRNLFYVYYELARD
                     LGSHGTENRPVNRGYGVSCAPRTSRLSPSESTVVSANGHALSSTALPTTSAGHKLSLP
                     RDPAADRVRRYVCIISRLMYARYGERWRKHRQRRSETGEEEEEETLESGETDATPPFD
                     FTGQQLRRAYQEHRRRKHLAVQRYAPCRRKLIGGMEFAEVTGVSLDRIAVNAFNTNRV
                     INMKAALSSIAASGLGVRAPRLPKNMTHSFVMYKHTFKEPACTVSTFVSNDAVYINSL
                     NVNIRGSYPEFLYSLGVYRLHVNIDHFFLPAVVCNSNSSLDVHGLEDQAVIRSERSKV
                     YWTTNFPCMISHTNNVNVGWFKAATAIVPRVSGADLEAILLKELSCIKNMRDVCIDYG
                     LHRVFTQLELRNSYQIPFLAKQLVLFLRACLLKLHGREKRLQLDRLVFEAAQRGLFDY
                     SKNLTAHTKIKHTCALIGSRLANNVPKILARNKKVKLDHLGRNANVLTVCRHVEAHKI
                     PRTRLKVLVEVLGVLQSISGTPHTREVIHQTLFRLCSAAAATSGLCSSPPPLCVSSSS
                     SVPSVPTSVSVDGSSEPTSPRVRFASR"
     gene            132484..133773
                     /gene="UL88"
                     /locus_tag="HHV5wtgp082"
                     /note="betagamma gene"
     CDS             132484..133773
                     /gene="UL88"
                     /locus_tag="HHV5wtgp082"
                     /codon_start=1
                     /product="tegument protein UL88"
                     /protein_id="AAR31640.1"
                     /translation="MMEAAAAAAAAFRPEERPTPGWHDAALLMDDGTVREHAFRNGPL
                     SQLIRRVLPPPPDAEDDVVFASELCFYCSGRFNRRSSVFSIYWQKHSDLVYALTGITH
                     CAKLVVECGQLGSSRLRWRDGDASGEERRGDDDSRDELYDVPGIYMIRVNDGGSTGPR
                     HVIWPGTSVLWAPDVVITTVQRRISAARALVNTFRQYFFLLERRSHEELVLCPPEMEE
                     RLAPLLQSATRGDSDMFDGVVASAYHRLRMSNIPRSSARLLEHCVGLAGAKKLLLLDV
                     PRLENYFLCQVCLYELDEDEMGEEMLGMLAGKPEDAAVSGASGGFLLHRKTMKLAACL
                     CLLLNSLHLHQEALEALDPPPPRVEENDLVNVVLRRYYRSHGGVQARTLAAARALLAD
                     YAETFSPLGSFTRLGYDRLVSADAGVSRRHLVALLRA"
     gene            complement(133770..139697)
                     /gene="UL89"
                     /locus_tag="HHV5wtgp083"
                     /note="core gene"
     CDS             complement(join(133770..134906,138810..139697))
                     /gene="UL89"
                     /locus_tag="HHV5wtgp083"
                     /note="contains ATPase domain; involved in DNA
                     encapsidation"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 1"
                     /protein_id="AAR31641.1"
                     /translation="MLRGDSAAKIQERYAELQKRKSHPTSCISTAFTNVAALCRKRYQ
                     MMHPELGLAHSCNEAFLPLMAFCGRHRDYNSPEESQRELLFHERLKSALDELTFRPCS
                     EEQRASYQKLDALTELYRDPQFQQINNFMTDFKKWLDGGFSTAVEGDAKAIRLEPFQK
                     NLLIHVIFFIAVTKIPVLANRVLQYLIHAFQIDFLSQTSIDIFKQKATVFLVPRRHGK
                     TWFIIPIISFLLKHMIGISIGYVAHQKHVSQFVLKEVEFRCRHTFARDYVVENKDNVI
                     SIDHRGAKSTALFASCYNTNSIRGQNFHLLLVDEAHFIKKEAFNTILGFLAQNTTKII
                     FISSTNTTSDATCFLTRLNNAPFDMLNVVSYVCEEHLHSFTEKGDATACPCYRLHKPT
                     FISLNSQVRKTANMFMPGAFMDEIIGGTNKISQNTVLITDQSREEFDILRYSTLNTNA
                     YDYFGKTLYVYLDPAFTTNRKASGTGVAAVGAYRHQFLIYGLEHFFLRDLSESSEVAI
                     AECAAHMIISVLSLHPYLDELRIAVEGNTNQAAAVRIACLIRQSVQSSTLIRVLFYHT
                     PDQNHIEQPFYLMGRDKALAVEQFISRFNSGYIKASQELVSYTIKLSHDPIEYLLEQI
                     QNLHRVTLAEGTTARYSAKRQNRISDDLIIAVIMATYLCDDIHAIRFRVS"
     gene            135142..135477
                     /gene="UL91"
                     /locus_tag="HHV5wtgp084"
                     /note="betagamma gene"
     CDS             135142..135477
                     /gene="UL91"
                     /locus_tag="HHV5wtgp084"
                     /codon_start=1
                     /product="protein UL91"
                     /protein_id="AAR31642.1"
                     /translation="MNSLLAELNRLGVAHATTEDVFIFVDRLFQHFSFLFQAEESGPR
                     RLELVASVFEHLTVECVNDILDACSHPDVNVVETSNTCRPCPSPVPSAPKTVSDAQTS
                     CATPRAPVT"
     gene            135447..136052
                     /gene="UL92"
                     /locus_tag="HHV5wtgp085"
                     /note="betagamma gene"
     CDS             135447..136052
                     /gene="UL92"
                     /locus_tag="HHV5wtgp085"
                     /codon_start=1
                     /product="protein UL92"
                     /protein_id="AAR31643.1"
                     /translation="MCDASGACDMRHVQNAFTEEIQLHSLYACTRCFRTHLCDLGSGC
                     ALVSTLEGSVCVKTGLVYEALYPVARSHLLEPIEEAALDDVNIISAVLSGVYSYLMTH
                     AGRYADVIQEVVERDRLKKQVEDSIYFTFNKVFRSMHNVNRISVPVISQLFIQLIIGI
                     YSKQTKYDACVIKVSRKKREDALLKQMRSEYGNAPVFGSGV"
     gene            136018..137802
                     /gene="UL93"
                     /locus_tag="HHV5wtgp086"
                     /note="core gene"
     CDS             136018..137802
                     /gene="UL93"
                     /locus_tag="HHV5wtgp086"
                     /note="capsid-associated; involved in DNA encapsidation;
                     involved in capsid transport"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL17"
                     /protein_id="AAR31644.1"
                     /translation="METHLYSDLAFEARFADDEQLPLHLVLDQEVLSNEEAETLRYVY
                     YRNVDSAGRSAGRVPSGDEDDAPASDDAEDAVGGDRAFDRERRTWQRACFRVLPRPLE
                     LLDYLRQSGLTVTLEKEQRVRMFYAVFTTLGLRCPDNRLSGAQTLHLRLVWPDGSYRD
                     WEFLARDLLREEMEANKRDRQHQLATTTNHRRRGGLRNNLDNGSDRRLPEAAVASLET
                     AVSTPFFEIPNGAGTSSANGGGRFSNLEQRVARLLRGDEEFIYHAGPLEPPSKIRGHE
                     LVQLRLDVNPDLMYATDPHDRDEVARTDEWKGAGVSRLREVWDVQHRVRLRVLWYVNS
                     FWRSRELSYDDHEVELYRALDAYRARIAVEYVLIRAVRDEIYAVLRRDSGALPQRFAC
                     HVPRNMSWRVVWELCRHALALWMDRADVRSCIIKALTPRLSRGAAAAAQRARRQRERS
                     APKPQELLFGPRNESGPPAERTWYADVVRCVRTQVDLGVEVRAARCPRTGLWIVRDRR
                     GRLRRWLSQPEVCVLYVTPDLDFYWVLPGGFAVSSRVTLHGLAQRALRDRFQNFEAVL
                     ARGMHVEAGRQEPETPRVSGRRLPFDDL"
     gene            137660..138697
                     /gene="UL94"
                     /locus_tag="HHV5wtgp087"
                     /note="core gene"
     CDS             137660..138697
                     /gene="UL94"
                     /locus_tag="HHV5wtgp087"
                     /note="possibly involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL16"
                     /protein_id="AAR31645.1"
                     /translation="MAWRSGLCETDSRTLKQFLQEECMWKLVGKSRKHREYRAVACRS
                     TIFSPEDDGSCILCQLLLFYRDGEWILCLCCNGRYQGHYGVGHVHRRRRRICHLPTLY
                     QLSFGGPLGPASIDFLPSFSQVTSSMTCDGITPDVIYEVCMLVPQDEAKRILVKGHGA
                     MDLTCQKAVTLGGAGAWLLPRPEGYTLFFYILCYDLFTSCGNRCDIPSMTRLMAAATA
                     CGQAGCSFCTDHEGHVDPTGNYVGCTPDMGRCLCYVPCGPMTQSLIHNEEPATFFCES
                     DDAKYLCAVGSKTAAQVTLGDGLDYHIGVKDSEGRWLPVKTDVWDLVKVEEPVSRMIV
                     CSCPVLKNLVH"
     gene            139696..141297
                     /gene="UL95"
                     /locus_tag="HHV5wtgp088"
                     /note="betagamma gene"
     CDS             139696..141297
                     /gene="UL95"
                     /locus_tag="HHV5wtgp088"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL95"
                     /protein_id="AAR31646.1"
                     /translation="MMAAAVVRAEVRRQRREERKKMASARTTEDPPENHVVADVACGT
                     GAVTRSSSSSLVVSSSSASGSDESSSASPLSFPVSSPSTAVRSPGSAGVSTSLCSVER
                     MVELSAQSPAADFSVSEAWRFEEAVNMALVACEAVSPYDRFRLIETPDENFLLVTNVI
                     PRESAEVPVLDSSSSGGDSGPEDKKKNVGNKTAGEKNGGGSRAKRRRRRRAPKNDAAT
                     PSFLRRHDVLERFAAAAEPLPSLCVHDYALRNADRVTYDGELIYGSYLLYRKAHVELS
                     LSSNKVQHVEAVLRQVYTPGLLDHHNVCDVEALLWLLYCGPRSFCARDTCFGREKNGC
                     PFPALLPKLFYEPVRDYMTYMNLAELYVFVWYRGYEFPAPTPQATTAGGGGGGGSGGG
                     GGAGACAVETSASAGRVDDAGDEVHLPLKPVSLDRLREVLQAVRGRFSGREVPAWPAS
                     SRTCLLCALYSQNRLCLDLARDEARTVSYSPIVIQDCAAAVTDVTLSHILPGQSTVSL
                     FPVYHVGKLLDALSLNDAGLITLNL"
     gene            141294..141677
                     /gene="UL96"
                     /locus_tag="HHV5wtgp089"
                     /note="core gene"
     CDS             141294..141677
                     /gene="UL96"
                     /locus_tag="HHV5wtgp089"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL14"
                     /protein_id="AAR31647.1"
                     /translation="MTSVNKQLLKDVMRVDLERQQHQFLRRTYGPQHRLTTQQALTVM
                     RVAAREQTRYSQRTTQCVAAHLLEQRAAVQQELQRARQLQSGNVDDALDSLTELKDTV
                     DDVRATLVDSVSATCDLDLEVDDAV"
     gene            141798..143921
                     /gene="UL97"
                     /locus_tag="HHV5wtgp090"
                     /note="core gene"
     CDS             141798..143921
                     /gene="UL97"
                     /locus_tag="HHV5wtgp090"
                     /EC_number="2.7.11.1"
                     /note="involved in protein phosphorylation; resistance to
                     ganciclovir; high-level resistance to maribavir"
                     /codon_start=1
                     /product="tegument serine/threonine protein kinase"
                     /protein_id="AAR31648.1"
                     /translation="MSSALRSRARSASLGTTTQGWDPPPLRRPSRARRRQWMREAAQA
                     AAQAAVQAAQAAAAQVAQAHVDEDEVVDLMTDEAGGGVTTLTTLSSVSTTTVLGHATF
                     SACVRSDVMRDGEKEDAASDKENQRRPVVPSTSSRGSAASGDGYHGLRCRETSAMWSF
                     EYDRDGDVTSVRRALFTGGSDPSDSVSGVRGGRKRPLRPPLVSLARTPLCRRRVGGVD
                     AVLEENDVELRAESQDSAVASGPGRVPQPLSGSSGEESATAVEADSTSHDDVHCTCSN
                     DQIITTSIRGLTCDPRMFLRLTHPELCELSISYLLVYVPKEDDFCHKICYAVDMSDES
                     YRLGQGSFGEVWPLDRYRVVKVARKHSETVLTVWMSGLIRTRAAGEQQQPPSLVGTGV
                     HRGLLTATGCCLLHNVTVHRRFHTDMFHHDQWKLACIDSYRRAFCTLADAIKFLNHQC
                     RVCHFDITPMNVLIDVNPHNPSEIVRAALCDYSLSEPYPDYNERCVAVFQETGTARRI
                     PNCSHRLRECYHPAFRPMPLQKLLICDPHARFPVAGLRRYCMSELSALGNVLGFCLMR
                     LLDRRGLDEVRMGTEALLFKHAGAACRALENGKLTHCSDACLLILAAQMSYGACLLGE
                     HGAALVSHTLRFVEAKMSSCRVRAFRRFYHECSQTMLHEYVRKNVERLLATSDGLYLY
                     NAFRRTTSIICEEDLDGDCRQLFPE"
     gene            144015..145769
                     /gene="UL98"
                     /locus_tag="HHV5wtgp091"
                     /note="core gene"
     CDS             144015..145769
                     /gene="UL98"
                     /locus_tag="HHV5wtgp091"
                     /note="involved in DNA processing"
                     /codon_start=1
                     /product="deoxyribonuclease"
                     /protein_id="AAR31649.1"
                     /translation="MWGVSSLDYDDDEELTRLLAVWDDEPLSLFLMNTFLLHQEGFRN
                     LPFTVLRLSYAYRIFAKMLRAHGTPVAEDFMTRVAALARDEGLRDILGQRHAAEASRA
                     EIAEALERVAERCDDRHGGSDDYVWLSRLLDLAPNYRQVELFQLLEKESRGQSRNSVW
                     HLLRMDTVSATKFYEAFVSGCLPGAAAADGSGGGGSHYTGSRAGVSPGIQFGIKHEGL
                     VKTLVECYVMHGREPVRDGLGLLIDPTSGLLGASMDLCFGVLKQGSGRTLLVEPCARV
                     YEIKCRYKYLRKKEDPFVQNVLRRHDAAAVASLLQSHPVPGVEFRGERETPSAREFLL
                     SHDAALFRATLKRARPLKPPEPLREYLADLLYLNKAECSEVIVFDAKHLNDDNSDGDA
                     TITINASLGLAAGDAAGGGADHHLRGSPGDSPPPIPFEDENTPELLGRLNVYEVARFS
                     LPAFVNPRHQYYFQMLIQQYVLSQYYIKKHPDPERIDFRDLPTVYLVSAIFREREESE
                     LGCELLAGGRVFHCDHIPLLLIVTPVVFDPQFTRHAVSTVLDRWSRDLSRKTNLPIWV
                     PNSANEYVVSSVPRPVSP"
     gene            145706..146278
                     /gene="UL99"
                     /locus_tag="HHV5wtgp092"
                     /note="core gene"
     CDS             145706..146278
                     /gene="UL99"
                     /locus_tag="HHV5wtgp092"
                     /note="envelope-associated; involved in virion
                     morphogenesis"
                     /codon_start=1
                     /product="myristylated tegument protein"
                     /protein_id="AAR31650.1"
                     /translation="MGAELCKRICCEFGTTSGEPLKDALGRQVSLRSYDNIPPTSSSD
                     EGEDDDDGEDDDNEERQQKLRLCGSGCGGNDSSSGSHREATHDGPKKNAVRSTFREDK
                     APKPSKQSKKKKKPSKHHHHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPR
                     PDTPRTPRQKKISQRPPTPGTKKPAASLPF"
     gene            complement(146538..147653)
                     /gene="UL100"
                     /locus_tag="HHV5wtgp093"
                     /note="core gene"
     CDS             complement(146538..147653)
                     /gene="UL100"
                     /locus_tag="HHV5wtgp093"
                     /note="type 3 membrane protein; 8 transmembrane domains;
                     complexed with envelope glycoprotein N; involved in virion
                     morphogenesis; involved in membrane fusion"
                     /codon_start=1
                     /product="envelope glycoprotein M"
                     /protein_id="AAR31651.1"
                     /translation="MAPSHVDKVNTRTWSASIVFMVLTFVNVSVHLVLSNFPHLGYPC
                     VYYHVVDFERLNMSAYNVMHLHTPMLFLDSVQLVCYAVFMQLVFLAVTIYYLVCWIKI
                     SMRKDKGMSLNQSTRDISYMGDSLTAFLFILSMDTFQLFTLTMSFRLPSMIAFMAAVH
                     FFCLTIFNVSMVTQYRSYKRSLFFFSRLHPKLKGTVQFRTLIVNLVEVALGFNTTVVA
                     MALCYGFGNNFFVRTGHMVLAVFVVYAIISIIYFLLIEAVFFQYVKVQFGYHLGAFFG
                     LCGLIYPIVQYDTFLSNEYRTGISWSFGMLFFIWAMFTTCRAVRYFRGRGSGSVKYQA
                     LATASGEEVAALSHHDSLESRRLREEEDDDDEDFEDA"
     gene            147831..150452
                     /gene="UL102"
                     /locus_tag="HHV5wtgp094"
                     /note="core gene"
     CDS             147831..150452
                     /gene="UL102"
                     /locus_tag="HHV5wtgp094"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase subunit"
                     /protein_id="AAR31652.1"
                     /translation="MTAQPPLHHRHHPYTLFGTSCHLSWYGLLEASVPIVQCLFLDLG
                     GGRAEPRLHTFVVRGDRLPPAEVRAVHRASYAALASAVTTDADERRRGLEQRSAVLAR
                     VLLEGSALIRVLARTFTPVQIQTDASGVEILEAAPALGVETTALSNALSLFHVAKLVV
                     IGSYPEVHEPRVVTHAAERVSEEYGTHAHKKLRRGYYAYDLAMSFRVGTHKYVLERDD
                     EAVLARLFEVREVCFLRTCLRLVTPVGFVAVAVTDEQCCLLLQSAWTHLYDVLFRGFA
                     GQPPLRDYLGPDLFETGAARSFFFPGFPPVPVYAVHGLHTLMRETALDAAAEVLSWCG
                     LPDIVGSAGKLEVEPCALSLGVPEDEWQVFGTEAGGGAVRLNATAFRERPAGGDRRWL
                     LPPLPRDDGDGENNVVEVSSSTGGAHPPSDDATFTVHVRDATLHRVLIVDLVERVLAK
                     CVRARDFNPYVRYSHRLHTYAVCEKFIENLRFRSRRAFWQIQSLLGYISEHVTSACAS
                     AGLLWVLSRGHREFYVYDGYSGHGPVSAEVCVRTVVDCYWRKLFGGDDPGPTCRVQES
                     APGVLLVWGDERLVGPFNFFYGNGGAGGSPLHGVVGGFAAGHCGGACCAGCVVTHRHS
                     SGGGGSGVGDADHASGGGLDAAAGSGHNGGSDRVSPSTPPAALGGCCCAAGGDWLSAV
                     GHVLGRLPALLRERVSVSELEAVYREILFRFVARRNDVDFWLLRFQPGENEVRPHAGV
                     IDCAPFHGVWAEQGQIIVQSRDTALAADIGYGVYVDKAFAMLTACVEVWARELLSSST
                     ASTTTCSSSSVLSSALPSVTSSSSGTATVSPPSCSSSSATWLEERDEWVRSLAVDAQH
                     AAKRVASEGLRFFRLNA"
     gene            complement(150615..151364)
                     /gene="UL103"
                     /locus_tag="HHV5wtgp095"
                     /note="core gene"
     CDS             complement(150615..151364)
                     /gene="UL103"
                     /locus_tag="HHV5wtgp095"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL7"
                     /protein_id="AAR31653.1"
                     /translation="MEALMIRGVLEVHTDFTRQNVMIMEPQVLDFTVRGDKLWLHTEH
                     GLLVSMAEYRSELLCTSAFLGYSAVFLLETEDAVTQVRLSDLRLKHRCGIVKADNLLH
                     FALCTVISCVENCNLTRKCLHDLLQYLDAVNVRESFGRLLHHSARRLICSALYLLFEE
                     KEPHIVQYVPATFVLFQQTRHTCLQLVARFFFRLTGQDEAHSFSLKLTERKTVDGWPV
                     GLGLLDVLNANYPNLPSPPKLPPRWERGEEE"
     gene            complement(151312..153405)
                     /gene="UL104"
                     /locus_tag="HHV5wtgp096"
                     /note="core gene"
     CDS             complement(151312..153405)
                     /gene="UL104"
                     /locus_tag="HHV5wtgp096"
                     /note="dodecamer located at one capsid vertex in place of
                     penton; involved in DNA encapsidation"
                     /codon_start=1
                     /product="capsid portal protein"
                     /protein_id="AAR31654.1"
                     /translation="MERNHWNEKSSGAKRSRERDLTLSTIRSILAADERLRIKASSYL
                     GVGRGVDDEAVIDIFPTGQTMSFLRLLHGFLGTCRGQSMHQVLRDPCVLRKQLLYGVC
                     KTLFDTITVRRVAEEWKLHAALFPYRALDEEDLEQYLLVWSASLRQSVQTGVLGALRD
                     ILYQYADNDDYGLYVDWCVTVGLVPLLDVKTKPSEAAERAQFVRAAVQRATETHPLAQ
                     DLLQANLALLLQVAERLGAVRIANAPEVRVFKKVRSERLEAQLRGKHIRLYVAAEPLA
                     YERDKLLFTTPVAHLHEEILRYDGLCRHQKICQLLNTFPVKVVTASRHELNCKKLVEM
                     MEQHDRGSDAKKSIMKFLLNVSDSKSRIGIEDSVESFLQDLTPSLVDQNRLLPARGPG
                     GPGVVGPGGAVVGGPAGHVGLLPPPPGPAAPERDIRDLFKKQVIKCLEEQIQSQVDEI
                     QDLRTLNQTWENRVRELRDLLTRYASRREDSMSLGARDAELYHLPVLEAVRKARDAAP
                     FRPLAVEDNRLVANSFFSQFVPGTESLERFLTQLWENEYFRTFRLRRLVTHQGAEEAI
                     VYSNYTVERVTLPYLCHILALGTLDPVPEAYLQLSFGEIVAAAYDDSKFCRYVELICS
                     REKARRRQMSREAAGGVPERGTASSGGPGTLERSAPRRLITADEERRGPERVGRFRNG
                     GPDDPRRAGGPYGFH"
     gene            153233..156103
                     /gene="UL105"
                     /locus_tag="HHV5wtgp097"
                     /note="core gene"
     CDS             153233..156103
                     /gene="UL105"
                     /locus_tag="HHV5wtgp097"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase helicase subunit"
                     /protein_id="AAR31655.1"
                     /translation="MSMTASSSTPRPTPKYDDALILNLSSAAKIERIVDKVKSLSRER
                     FAPEDFSFQWFRSISRVERTTDNNPSAATTAAATATVHSSVSSSAAAAASSEAGGTRV
                     PCVDRWPFFPFRALLVTGTAGAGKTSSIQVLAANLDCVITGTTVIAAQNLSAILNRTR
                     SAQVKTIYRVFGFVSKHVPLADSAVSHETLERYRVCEPHEETTIQRLQINDLLAYWPV
                     IADIVDKCLNMWERKAASASAAAAAAACEDLSELCESNIIVIDECGLMLRYMLQVVVF
                     FYYFYNALGDTRLYRERRVPCIICVGSPTQTEALESRYDHYTQNKSVRKGVDVLSALI
                     QNEVLINYCDIADNWVMFIHNKRCTDLDFGDLLKYMEFGIPLKEEHVAYVDRFVRPPS
                     SIRNPSYAAEMTRLFLSHVEVQAYFKRLHEQIRLSERHRLFDLPVYCVVNNRAYQELC
                     ELADPLGDSPQPVELWFRQNLARIINYSQFVDHNLSSEITKEALRPAADVVATNNPSV
                     QAHGGGGSVIGSTGGNDETAFFQDDDTTTAPDSRETLLTLRITYIKGSSVGVNSKVRA
                     CVIGYQGTVERFVDILQKDTFIERTPCEQAAYAYSLVSGLLFSAMYYFYVSPYTTEEM
                     LRELARVELPDVSSLCAAAAATAAAPAWSGGENPINNHVDADSSQGGQSVPVSQRMEH
                     GQEETHDIPCLSNHHDDSDAITDAELMDHTSLYADPFFLKYVKPPSLALLSFEETVHM
                     YTTFRDIFLKRYQLMQRLTGGRFATLPLVTYNRRNVVFKANCQISSQTGSFVGMLSHV
                     SPAQTYTLEGYTSDNVLSLPSDRHRIHPEVVQRGLSRLVLRDALGFLFVLDVNVSRFV
                     ESAQGKSLHVCTTVDYGLTSRTAMTIAKSQGLSLEKVAVDFGDHPKNLKMSHIYVAMS
                     RVTDPEHLMMNVNPLRLPYEKNTAITPYICRALKDKRTTLIF"
     gene            complement(156102..161821)
                     /gene="RNA5.0"
                     /locus_tag="HHV5wtgp168"
     ncRNA           complement(join(156102..156413,160957..161789))
                     /ncRNA_class="other"
                     /gene="RNA5.0"
                     /locus_tag="HHV5wtgp168"
                     /product="RNA5.0"
                     /experiment="Northern blot"
                     /experiment="RACE"
                     /experiment="RT-PCR"
     regulatory      complement(156131..156136)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RNA5.0"
                     /locus_tag="HHV5wtgp168"
     intron          complement(156414..160956)
                     /gene="RNA5.0"
                     /locus_tag="HHV5wtgp168"
                     /note="stable"
     gene            161003..161692
                     /gene="UL111A"
                     /locus_tag="HHV5wtgp098"
     CDS             join(161003..161185,161262..161462,161546..161692)
                     /gene="UL111A"
                     /locus_tag="HHV5wtgp098"
                     /note="contains signal peptide; involved in immune
                     regulation"
                     /codon_start=1
                     /product="interleukin-10"
                     /protein_id="AAR31656.1"
                     /translation="MLSVMVSSSLVLIVFFLGASEEAKPATTTTIKNTKPQCRPEDYA
                     TRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDH
                     VYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSE
                     LDTLFSRLEEYLHSRK"
     regulatory      complement(161816..161821)
                     /regulatory_class="TATA_box"
                     /gene="RNA5.0"
                     /locus_tag="HHV5wtgp168"
     gene            161917..164128
                     /gene="UL112"
                     /locus_tag="HHV5wtgp099"
                     /note="beta gene"
     CDS             join(161917..162673,162831..164128)
                     /gene="UL112"
                     /locus_tag="HHV5wtgp099"
                     /note="involved in gene regulation; involved in DNA
                     replication"
                     /codon_start=1
                     /product="protein UL112"
                     /protein_id="AAR31657.1"
                     /translation="MDLPTTVVRKYWTFTNPNRILHQSVNQTFDVRQFVFDNARLVNC
                     VDGDGKVLHLNKGWLCATIMQHGEASAGAKTQQGFMSIDITGDGELQEHLFVRGGIVF
                     NKSVSSVVGSSGPNESALLTMISENGNLQVTYVRHYLKNHGESSGGGGGCGAASTASA
                     VCVSSLGGSGGTRDGPSAEEQQRRRQEQRHEERRKKSSSSAGGGGGGGASGGGGGGGS
                     GGQHSSDSANGLLRDPRLMNRQKERRPPPSSENDGSPPLREAKRQKTTAQHEGHGGGG
                     KNETEQQSGGAGGGGGGGSGRMSLPLDTSEAVAFLNYSSSSSAVSSSSNNHHHHHHHH
                     NAVTDVAAGTDGALLLPIERGAVVSSPSSTSPSSLLSLPRPSSAHSAGETVQESEAAA
                     TAAAAGLMMMRRMRRAPAEAAEAPPQSEEENDSTTPVSNCRVPPNSQESAAPQPPRSP
                     RFDDIIQSLTKMLNDCKEKRLCDLPLVSSRLLPETSGGTVVVNHSSVARTAAAVSTAG
                     VGPPAVACPPLVTTGVVPSGSVAGVAPVAAAVETPAAPPRPVCEIKPYVVNPVVATAA
                     AASNSSSSSSAPLPPPPPPPGGRRGRARNNTRGGGGGGGGGRNSRRQAASSSSSSSRR
                     SRRRNNRHEDEDNDPLLRLSQVAGSGRRRGPSFLEDGLEIIDPSEEAAIAAASIAAFF
                     DD"
     gene            complement(164298..165050)
                     /gene="UL114"
                     /locus_tag="HHV5wtgp100"
                     /note="core gene"
     CDS             complement(164298..165050)
                     /gene="UL114"
                     /locus_tag="HHV5wtgp100"
                     /EC_number="3.2.2.3"
                     /note="involved in DNA repair"
                     /codon_start=1
                     /product="uracil-DNA glycosylase"
                     /protein_id="AAR31658.1"
                     /translation="MALKQWMLANIADNKGSLLTPDEQARVFCLSADWIRFLSLPDHD
                     TVLLRDTVAAVEGARQLEMVYPAPEHVHRWSYLCPPEQVRVVIVGQDPYCDGSASGLA
                     FGTLAGRPPPPSLNNVFRELARTVDGFQRPASGCLDAWARRGVLLLNTVFTVVHGQPG
                     SHRHLGWQTLSNHVIRRLSERREHLVFMLWGADAHTCEYLIDRRRHLVLKSCHPSPRN
                     TTRAFVGNDHFILANAYLDTHYRETMDWRLCG"
     ncRNA           164557..164578
                     /ncRNA_class="miRNA"
                     /product="hcmv-miR-UL112"
                     /inference="ab initio prediction:miRBase:rel16"
     gene            complement(165022..165858)
                     /gene="UL115"
                     /locus_tag="HHV5wtgp101"
                     /note="core gene"
     CDS             complement(165022..165858)
                     /gene="UL115"
                     /locus_tag="HHV5wtgp101"
                     /note="contains signal peptide; complexed with envelope
                     glycoprotein H; involved in cell entry; involved in
                     cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein L"
                     /protein_id="AAR31659.1"
                     /translation="MCRRPDCGFSFSPGPVILLWCCLLLPIVSSAAVSVAPTAAEKVP
                     AECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLD
                     EAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCR
                     GYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEG
                     ITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVD
                     AR"
     gene            complement(165858..166799)
                     /gene="UL116"
                     /locus_tag="HHV5wtgp102"
     CDS             complement(165858..166799)
                     /gene="UL116"
                     /locus_tag="HHV5wtgp102"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein UL116"
                     /protein_id="AAR31660.1"
                     /translation="MKRRRRWRGWLLFLALCFCLLCEAVETNATTVTSTTAAAATTNT
                     TVATTGTTTTSPNVTSTTSNTVTTPTTVSSVSNLTSSATSILISTSTVSGTRNTRNNN
                     TTTIGTNATSPSSSVSILTTVTPAATSTTSNNGDVTSDYTPTFDLENITTTRAPTRPP
                     AQDLCSHNLSIILYEEESQSSVDIAVDEEEPELEDDDEYDELWFPLYFEAECNLNYTL
                     QYVNHSCDYSVRQSSVSFPPWRDIDSVTFVPRNLSNCSAHGLAVIVAGNQTWYVNPFS
                     LAHLLDAIYNVLGIEDLSANFWRQLAPYRHTLIVPQT"
     gene            complement(166796..168073)
                     /gene="UL117"
                     /locus_tag="HHV5wtgp103"
                     /note="beta gene"
     CDS             complement(166796..168073)
                     /gene="UL117"
                     /locus_tag="HHV5wtgp103"
                     /codon_start=1
                     /product="protein UL117"
                     /protein_id="AAR31661.1"
                     /translation="MVMFSQDHVQIVYGSTRICKSLAPANKRKTHRTIVVAPRRGFLR
                     IPPDGQDVNHVKIVPTTTSSSLAPPRDDERRPTPPLRPPLTVYPYGTSLIRRSARDAK
                     LRSKLIVFHITRPALGQHPQNPGISGPAAMDHSEFLTSFRREVDRQTVLTAESAPATV
                     EVCLGDALPGGVMGGGGLPAGVGSASAAVAAAAAAVAGVPVAANPVMPATATVTTPPM
                     IDLTSHHRPLTLFTPASAAAAPAVATNGGNATYILPADCRYAPLFASKYKYVFEEVSR
                     LMRLHDSTAVQLQISASCGNAFQALKSALLKLHNVTVLAGQQLITQTMPHTPQAVATF
                     KFFHQDPNRVLDCIRPVVPRSTSYHETGVYQMWVSGATKKDLFDAVTLCASIVEKQPD
                     VFNINVSLLTYPSIAAPHLPLYNEFTSFRLPTS"
     gene            complement(168186..169311)
                     /gene="UL119"
                     /locus_tag="HHV5wtgp104"
                     /note="beta gene"
     CDS             complement(join(168186..168802,168891..169311))
                     /gene="UL119"
                     /locus_tag="HHV5wtgp104"
                     /note="type 1 membrane protein; IgG Fc-binding; similar to
                     OX-2; involved in immune regulation; possibly related to
                     UL120 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL119"
                     /protein_id="AAR31662.1"
                     /translation="MCSVLAIALVVALLGDMHPGVKSSTTSAVTSPSNTTVTSTTSIS
                     TSNNVSSAVTTTVQTSTSSASTSVIATTQKEGHLYTVNCEASYSYDQVSLNATCKVIL
                     LNNTKNPDILSVTCYARTDCKGPFTQVGYLSAFPSNDKGKLHLSYNATAQELLISGLR
                     PQETTEYTCSFFSWGRHHNATWDLFTYPIYAVYGTRLNATTMRVRVLLQEHEHCLLNG
                     SSLYHPNSTVHLHQGDQLIPPWNISNVTYNGQRLREFVFYLNGTYTVVRLHVQIAGRS
                     FTTTYVFIKSDPLFEDRLLAYGVLAFLVFMVIILLYVTYMLARRRDWSYKRLEEPVEE
                     KKHPVPYFKQW"
     gene            complement(169366..169971)
                     /gene="UL120"
                     /locus_tag="HHV5wtgp105"
     CDS             complement(169366..169971)
                     /gene="UL120"
                     /locus_tag="HHV5wtgp105"
                     /note="type 1 membrane protein; UL120 family"
                     /codon_start=1
                     /product="membrane protein UL120"
                     /protein_id="AAR31663.1"
                     /translation="MYRAGVTLLVVAVVSFGRWDSVTVATTIRVGWWYEPQVKMAYIY
                     EHNDTNLTIFCNTTAYDSPFLASGMMIVLPHRTQFLTRKVNYSEDMENIKQNYTHQLT
                     HMLTGEPGTYVNGSVTCWGSNGTFGAGTFIVRSMVNKTAGNTNTFIHFVEDSELVENP
                     AYFRRSDHRAFMIVILTQVVFVVFIINASFIWSWTFRRHKR"
     gene            complement(170022..170564)
                     /gene="UL121"
                     /locus_tag="HHV5wtgp106"
     CDS             complement(170022..170564)
                     /gene="UL121"
                     /locus_tag="HHV5wtgp106"
                     /note="type 1 membrane protein; UL120 family"
                     /codon_start=1
                     /product="membrane protein UL121"
                     /protein_id="AAR31664.1"
                     /translation="MWGCGWSRILVLLLLMCMALMARGTYGAYICSPNPGRLRISCAL
                     SVLDQRLWWEIQYSSGRLTRVLVFHDEGEEGDDVHLTDTHHCTSCTHPYVISLVTPLT
                     INATLRLLIRDGMYGRGEKELCIAHLPTLRDIRTCRVDADLGLLYAVCLILSFSIVTA
                     ALWKVDYDRSVAVVSKSYKS"
     gene            complement(170689..174090)
                     /gene="UL122"
                     /locus_tag="HHV5wtgp107"
                     /note="beta gene; immediate early gene"
     CDS             complement(join(170689..172175,173719..173903,
                     174020..174090))
                     /gene="UL122"
                     /locus_tag="HHV5wtgp107"
                     /note="interacts with basal transcriptional machinery and
                     cellular transcription factors; specific DNA-binding
                     protein; involved in gene regulation"
                     /codon_start=1
                     /product="regulatory protein IE2"
                     /protein_id="AAR31665.1"
                     /translation="MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEV
                     NSQLSLGDPLFPELAEESLKTFEQVTEDCNENPEKDVLTELGDILAQAVNHAGIDSSS
                     TGPTLTTHSCSVSSAPLNKPTPTSVAVTNTPLPGASATPELSPRKKPRKTTRPFKVII
                     KPPVPPAPIMLPLIKQEDIKPEPDFTIQYRNKIIDTAGCIVISDSEEEQGEEVETRGA
                     TASSPSTGSGTPRVTSPTHPLSQMNHPPLPDPLGRPDEDSSSSSSSSCSSASDSESES
                     EEMKCSSGGGASVTSSHHGRGGFGGAASSSLLSCGHQSSGGASTGPRKKKSKRISELD
                     NEKVRNIMKDKNTPFCTPNVQTRRGRVKIDEVSRMFRHTNRSLEYKNLPFMIPSMHQV
                     LEEAIKVCKTMQVNNKGIQIIYTRNHEVKNEVDQVRCRLGSMCNLALSTPFLMEHTMP
                     VTHPPDVAQRTADACNDGVKAVWNLKELHTHQLCPRSSDYRNMIIHAATPVDLLGALN
                     LCLPLMQKFPKQVMVRIFSTNQGGFMLPIYETAAKAYAVGQFEKPTETPPEDLDTLSL
                     AIEAAIQDLRNKSQ"
     gene            171704..174649
                     /gene="UL124"
                     /locus_tag="HHV5wtgp109"
                     /note="beta gene"
     regulatory      171704..171709
                     /regulatory_class="TATA_box"
                     /gene="UL124"
                     /locus_tag="HHV5wtgp109"
     mRNA            join(171737..171874,174081..174649)
                     /gene="UL124"
                     /locus_tag="HHV5wtgp109"
                     /product="membrane protein UL124"
                     /experiment="Northern blot"
                     /experiment="RACE"
                     /experiment="RT-PCR"
                     /note="main coding exon spliced from one or other of >8
                     upstream exons"
     gene            complement(172329..174090)
                     /gene="UL123"
                     /locus_tag="HHV5wtgp108"
                     /note="beta gene; immediate early gene"
     CDS             complement(join(172329..173548,173719..173903,
                     174020..174090))
                     /gene="UL123"
                     /locus_tag="HHV5wtgp108"
                     /note="enhances activation by IE2; interacts with basal
                     transcriptional machinery and cellular transcription
                     factor; disrupts ND10; involved in gene regulation"
                     /codon_start=1
                     /product="regulatory protein IE1"
                     /protein_id="AAR31666.1"
                     /translation="MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEV
                     NSQLSLGDPLFPELAEESLKTFEQVTEDCNENPEKDVLTELVKQIKVRVDMVRHRIKE
                     HMLKKYTQTEEKFTGAFNMMGGCLQNALDILDKVHEPFEDMKCIGLTMQSMYENYIVP
                     EDKREMWMACIKELHDVSKGAANKLGGALQAKARAKKDELRRKMMYMCYRNIEFFTKN
                     SAFPKTTNGCSQAMAALQNLPQCSPDEIMSYAQKIFKILDEERDKVLTHIDHIFMDIL
                     TTCVETMCNEYKVTSDACMMTMYGGISLLSEFCRVLCCYVLEETSVMLAKRPLITKPE
                     VISVMKRRIEEICMKVFAQYILGADPLRVCSPSVDDLRAIAEESDEEEAIVAYTLATA
                     GASSSDSLVSPPESPVPATIPLSSVIVAENSDQEESEQSDEEQEEGAQEEREDTVSVK
                     SEPVSEIEEVASEEEEDGAEEPTASGGKSTHPMVTRSKADQ"
     CDS             174123..174575
                     /gene="UL124"
                     /locus_tag="HHV5wtgp109"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL124"
                     /protein_id="AAR31667.1"
                     /translation="MERNSLLVCQLLCLVARAAATSTAQTTLPSTVNSTATGVTSDSQ
                     QNTTQLPASSAAALSLPSASAVQAHSPSSFSDTYPTATALCGTLVVVGIVLCLSLAST
                     VRSKELPSDHEPLEAWEQGSDVEAPPLPEKSPCPEHVPEIRVEIPRYV"
     regulatory      174628..174633
                     /regulatory_class="polyA_signal_sequence"
                     /gene="UL124"
                     /locus_tag="HHV5wtgp109"
     misc_feature    complement(176186..176944)
                     /note="UL128; contains 1 nt substitution causing premature
                     termination"
     variation       176311
                     /note="compared to unpassaged virus; in UL128"
                     /replace="g"
     gene            complement(176984..177628)
                     /gene="UL130"
                     /locus_tag="HHV5wtgp111"
     CDS             complement(176984..177628)
                     /gene="UL130"
                     /locus_tag="HHV5wtgp111"
                     /note="contains signal peptide; complexed with envelope
                     glycoproteins H and L; essential in non-fibroblast cells;
                     involved in cell entry"
                     /codon_start=1
                     /product="envelope glycoprotein UL130"
                     /protein_id="AAR31669.1"
                     /translation="MLRLLLRHHFHCLLLCAVWATPCLASPWSTLTANQNPSPPWSKL
                     TYSKPHDAATFYCPFLYPSPPRSPLQFSGFQRVSTGPECRNETLYLLYNREGQTLVER
                     SSTWVKKVIWYLSGRNQTILQRMPRTASKPSDGNVQISVEDAKIFGAHMVPKQTKLLR
                     FVVNDGTRYQMCVMKLESWAHVFRDYSVSFQVRLTFTEANNQTYTFCTHPNLIV"
     gene            complement(177649..178146)
                     /gene="UL131A"
                     /locus_tag="HHV5wtgp112"
     CDS             complement(join(177649..177802,177911..178146))
                     /gene="UL131A"
                     /locus_tag="HHV5wtgp112"
                     /note="contains signal peptide; complexed with envelope
                     glycoproteins H and L; essential in non-fibroblast cells;
                     involved in cell entry"
                     /codon_start=1
                     /product="envelope protein UL131A"
                     /protein_id="AAR31670.1"
                     /translation="MRLCRVWLSVCLCAVVLGQCQRETAEKNDYYRVPHYWDACSRAL
                     PDQTRYKYVEQLVDLTLNYHYDASHGLDNFDVLKRINVTEVSLLISDFRRQNRRGGTN
                     KRTTFNAAGSLAPHARSLEFSVRLFAN"
     gene            complement(178252..179064)
                     /gene="UL132"
                     /locus_tag="HHV5wtgp113"
     CDS             complement(178252..179064)
                     /gene="UL132"
                     /locus_tag="HHV5wtgp113"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="envelope glycoprotein UL132"
                     /protein_id="AAR31671.1"
                     /translation="MPAPRGPLRATFLALVAFGLLLQIDLSDVTNVTSSTKVPTSTSN
                     RNSVDNATSSGPTTGINMTTTHESSVHNVRNNEIMKVLAILFYIVTGTSIFSFIAVLV
                     AVVYSSCCKHPGRFRFADEEAVNLLDDTDDSGGSSPFGSGSRRGSQIPAGFCSSSPYQ
                     RLETRDWDEEEEASAARERMKHDPENVIYFRKDGNLDTSFVNPNYGRGSPLTIESHLS
                     DNEEDPIRYYVSVYDELTASEMEEPSNSTSWQIPKLMKVAMQPVSLRDPEYD"
     gene            complement(179141..180091)
                     /gene="UL148"
                     /locus_tag="HHV5wtgp114"
     CDS             complement(179141..180091)
                     /gene="UL148"
                     /locus_tag="HHV5wtgp114"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL148"
                     /protein_id="AAR31672.1"
                     /translation="MLRLLFTLVLLALYGPSVDASRDYVHVRLLSYRGDPLVFKHTFS
                     GVRRPFTELGWAACRDWDSMHCTPFWSTDLEQMTDSVRRYSTVSPGKEVTLQLHGNQT
                     VQPSFLSFTCRLQLEPVVENVGLYVAYVVNDGERPQQFFTPQVDVVRFALYLETLSRI
                     VEPLESGRLTVEFDTPDLALAPDLVSSLFVAGHGETDFYMNWTLRRSQTHYLEEMALQ
                     VEILKPRGVRHRAIIHHPKLQPGVGLWIDFCVYRYNARLTRGYVRYTLSPKARLPAKA
                     EGWLVSLDRFIVQYLNTLLITMMAAIWARVLITYLVSRRR"
     gene            complement(180160..180387)
                     /gene="UL147A"
                     /locus_tag="HHV5wtgp115"
     CDS             complement(180160..180387)
                     /gene="UL147A"
                     /locus_tag="HHV5wtgp115"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL147A"
                     /protein_id="AAR31673.1"
                     /translation="MSLFYRAVALGTLSALVWYSTSILAEINENSCSSSSVDHEDCEE
                     PDEIVREEQDYRALLAFSLVICGTLLVTCVI"
     gene            complement(180390..180869)
                     /gene="UL147"
                     /locus_tag="HHV5wtgp116"
     CDS             complement(180390..180869)
                     /gene="UL147"
                     /locus_tag="HHV5wtgp116"
                     /note="contains signal peptide; putative secreted
                     glycoprotein; possibly involved in immune regulation; CXCL
                     family"
                     /codon_start=1
                     /product="chemokine vCXCL2"
                     /protein_id="AAR31674.1"
                     /translation="MLLTWLHHPILNSRIKLLSVRYLSLTAYMLLAICPIAVRLLELE
                     DYDKRCRCNNQILLNTLPVGTELLKPIAASESCNRQEVLAILKDKGTKCLNPNAQAVR
                     RHINRLFFRLVLDEEQRIYDVVSTNIEFGAWPVPTAYKAFLWKYAKKLNYHYFRLRW"
     gene            complement(180930..181292)
                     /gene="UL146"
                     /locus_tag="HHV5wtgp117"
     CDS             complement(180930..181292)
                     /gene="UL146"
                     /locus_tag="HHV5wtgp117"
                     /note="contains signal peptide; putative secreted
                     glycoprotein; involved in immune regulation; CXCL family"
                     /codon_start=1
                     /product="chemokine vCXCL1"
                     /protein_id="AAR31675.1"
                     /translation="MRLIFGALIISLTYMYYYEVHGTELRCKCLDGKKLPPKTIMLGN
                     FWFHRESGGPRCNNNEYFLYLGGGKKHGPGVCLSPHHPFSKWLDKRNDNRWYNVNVTR
                     QPERGPGKITVTLVGLKE"
     gene            complement(181573..181965)
                     /gene="UL145"
                     /locus_tag="HHV5wtgp118"
     CDS             complement(181573..181965)
                     /gene="UL145"
                     /locus_tag="HHV5wtgp118"
                     /note="RL1 family"
                     /codon_start=1
                     /product="protein UL145"
                     /protein_id="AAR31676.1"
                     /translation="MYGVLAHYYSFISSPSVMVNFKHHNAVQLLCARTRDGTAGWERL
                     THHASYHANYGAYAVLMATSQRKSLVLHRYSAVTAVALQLMPVEMLRRLDQSDWVRGA
                     WIVSETFPTSDPKGFWSDDDSPMGGSED"
     gene            complement(182206..182736)
                     /gene="UL144"
                     /locus_tag="HHV5wtgp119"
     CDS             complement(182206..182736)
                     /gene="UL144"
                     /locus_tag="HHV5wtgp119"
                     /note="type 1 membrane protein; similar to TNFR; interacts
                     with BTLA and inhibits T cell proliferation; does not bind
                     TNF superfamily ligands; activates NFkappaB via
                     TRAF6-dependent mechanism to upregulate CCL22; involved in
                     immune regulation"
                     /codon_start=1
                     /product="membrane glycoprotein UL144"
                     /protein_id="AAR31677.1"
                     /translation="MKPLVMLICFGVILLQLGVTKVCQHNEVQLGNECCPPCGLGQRV
                     TKVCTERTSVTCTPCPNGTYVSGLYNCTDCTQCNVTQVMIRNCTSTNNTVCAPKNHTY
                     FSTPGVQHHKQRQQNHTAHITVKQGKSGRHTLAWLSLFIFLVGIILLILYLIAAYRSE
                     RCQQCCSIGKIFYRTL"
     gene            182854..194348
                     /gene="UL150A"
                     /locus_tag="HHV5wtgr005"
     regulatory      182854..182859
                     /regulatory_class="TATA_box"
                     /gene="UL150A"
                     /locus_tag="HHV5wtgr005"
     mRNA            join(182888..183244,193169..193542,193654..194348)
                     /gene="UL150A"
                     /locus_tag="HHV5wtgr005"
                     /product="protein UL150A"
                     /experiment="Northern blot"
                     /experiment="RACE"
                     /experiment="RT-PCR"
                     /note="main coding exons spliced from one or other of >10
                     upstream exons"
     gene            complement(183406..184323)
                     /gene="UL142"
                     /locus_tag="HHV5wtgp120"
     CDS             complement(183406..184323)
                     /gene="UL142"
                     /locus_tag="HHV5wtgp120"
                     /note="type 1 membrane protein; similar to MHC-I; inhibits
                     NK cell cytotoxicity; downregulates MICA; acts on
                     activating receptor NKG2D; involved in immune regulation;
                     MHC family"
                     /codon_start=1
                     /product="membrane glycoprotein UL142"
                     /protein_id="AAR31678.1"
                     /translation="MRIEWACWLFGYFVSSVGSERSLSYRYHLESNSSANVVCNGNIS
                     VFVNGTLGVRYNITVGISSSLLIGHLTIQTLESWFTPWVQNKSYSKQPLSTTETLYNI
                     DSENIHRVSQYFHTRWIKSLQENHTCDLTNSTPTYTYQANVNNTNYLTLTSSGWQDRL
                     NYTAINSTHFNLTESNITSIHKYLNTTCIERLRNYTLEPVYTTAVPQNVTPEHAITTL
                     YTTPPNAITIKDTTQSHTVQTPSFNDTHNVTEHTLNISYVLSQKTNNTTSPWVYAIPM
                     GATATIGAGLYIGKHFTPVKFVYEVWRGQ"
     gene            complement(184396..185412)
                     /gene="UL141"
                     /locus_tag="HHV5wtgp121"
     CDS             complement(184396..185412)
                     /gene="UL141"
                     /locus_tag="HHV5wtgp121"
                     /note="type 1 membrane protein; inhibits NK cell
                     cytotoxicity; sequesters CD155; acts on activating
                     receptor DNAM-1, CD96; involved in immune regulation; UL14
                     family"
                     /codon_start=1
                     /product="membrane glycoprotein UL141"
                     /protein_id="AAR31679.1"
                     /translation="MCRRESLRTLPWLFWVLLSCPRLLEYSSSSFPFATADIAEKMWA
                     ENYETTSPAPVLVAEGEQVTIPCTVMTHSWPMVSIRARFCRSHDGSDELILDAVKGHR
                     LMNGLQYRLPYATWNFSQLHLGQIFSLTFNVSTDTAGMYECVLRNYSHGLIMQRFVIL
                     TQLETLSRPDEPCCTPALGRYSLGDQIWSPTPWRLRNHDCGMYRGFQRNYFYIGRADA
                     EDCWKPACPDEEPDRCWTVIQRYRLPGDCYRSQPHPPKFLPVTPAPPADIDTGMSPWA
                     TRGIAAFLGFWSIFTVCFLCYLCYLQCCGRWCPTPGRGRRGGEGYRRLPTYDSYPGVK
                     KMKR"
     gene            complement(185705..186280)
                     /gene="UL140"
                     /locus_tag="HHV5wtgp122"
     CDS             complement(185705..186280)
                     /gene="UL140"
                     /locus_tag="HHV5wtgp122"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL140"
                     /protein_id="AAR31680.1"
                     /translation="MTPAQTNGTTTVHPHGAKNGSGGSALPTLVVFGFIVTLLFFLFM
                     LYFWNNDVFRKLLRCAWIQRCCDRFDAWQDEVIYRRPSRRSQSDDESRTNSVSSYVLL
                     SPASDGGFDNPALTEAVDSVDDWATTSVFYATSDETADTERRDSQQLLIELPPEPLPP
                     DVVAAMQKAVKRAVQNALRHSHDSWQLHQTL"
     gene            complement(186462..186878)
                     /gene="UL139"
                     /locus_tag="HHV5wtgp123"
     CDS             complement(186462..186878)
                     /gene="UL139"
                     /locus_tag="HHV5wtgp123"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane glycoprotein UL139"
                     /protein_id="AAR31681.1"
                     /translation="MLWILVLFALAASASETTTGTSSNSSQSTSAGTTNTTTPSTACI
                     NASNGSDLGAPQLALLAASGWTLSGLLLIFTCCLCCFWLVRKVCSCCGNSSESESKAT
                     HAYTNAAFTSSDATLPMGTTGSYTPPQDGSFPPPPR"
     gene            complement(187441..187950)
                     /gene="UL138"
                     /locus_tag="HHV5wtgp124"
     CDS             complement(187441..187950)
                     /gene="UL138"
                     /locus_tag="HHV5wtgp124"
                     /note="contains potential transmembrane domain; possibly
                     involved in latency"
                     /codon_start=1
                     /product="protein UL138"
                     /protein_id="AAR31682.1"
                     /translation="MDDLPLNVGLPIIGVMLVLIVAILCYLAYHWHDTFKLVRMFLSY
                     RWLIRCCELYGEYERRFADLSSLGLGAVRRESDRRYRFSERPDEILVRWEEVSSQCSY
                     ASSRITDRRAGSSSSSSVHVANQRNSVPPPDMAVTAPLTDVDLLKPVTGSATQFTTVA
                     MVHYHQEYT"
     gene            complement(188033..188755)
                     /gene="UL136"
                     /locus_tag="HHV5wtgp125"
     CDS             complement(188033..188755)
                     /gene="UL136"
                     /locus_tag="HHV5wtgp125"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL136"
                     /protein_id="AAR31683.1"
                     /translation="MSVKGVEMPEMTWDLDVGNKWRRRKVLSRIHRFWECRLRVWWLS
                     DAGVRETDPPRPRRRPTWMTAVFHVICAVLLTLMIMAIGALIAYLRYYHQDSWRDMLH
                     DLFCGCHYPEKCRRHHERQRSRRRAMDVPDPELGDPARRPLNGAMYYGSGCRFDTVEM
                     VDETRPAPPALSSPETGDDSNDDAVAGGGAGGVTSSATRTTSSNALLPEWMDAVHVAV
                     QAAVQATVQVSGPRENAVSPAT"
     gene            complement(188846..189772)
                     /gene="UL135"
                     /locus_tag="HHV5wtgp126"
     CDS             complement(188846..189772)
                     /gene="UL135"
                     /locus_tag="HHV5wtgp126"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL135"
                     /protein_id="AAR31684.1"
                     /translation="MVWLWLGVGLLGGTGLASLVLAISLFTQRRGRKRSDETSSRGRL
                     PGAASDKRGACACCYRIPKEDVVEPLDLELGLMRVATHPPTPQVPRCTSLYIGEDGLP
                     IDKPEFPPARFEIPDVSTPGTPTSIGRSPSHCSSSSSLSSSASVDTVLHQPPPSWKPP
                     PPPGRKKRPPTPPVRAPTTRLSSHRPPTPIPAPRKNLSTPPTKKTPPPTKPKPVGWTP
                     PVTPRPFPKTPTPQKPPRNPRLPRTVGLENLSKVGLSCPCPRPRTPTEPTTLPIVSVS
                     ELAPPPRWSDIEELLEKAVQSVMKDAESMQMT"
     gene            complement(189949..190722)
                     /gene="UL133"
                     /locus_tag="HHV5wtgp127"
     CDS             complement(189949..190722)
                     /gene="UL133"
                     /locus_tag="HHV5wtgp127"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL133"
                     /protein_id="AAR31685.1"
                     /translation="MGCDVHDPSWQCQWGVPTIIVAWITCAALGIWCLAGSSADVSSG
                     PGIAAVVGCSVFMIFLCAYLIRYREFFKDSVIDLLTCRWVRYCSCSCKCSCKCISGPC
                     SRCCSACYKETMIYDMVQYGHRRRPGHGDDPDRVICEIVESPPVSAPTVFVPPPSEES
                     HQPVIPPQPPTPTSEPKPKKGRAKDKPKGRPKNKPPCEPTVSSQPPSQPTAMPGGPPD
                     ASPPAMPQMPPGVAEAVQAAVQAAMAAALQQQQQHQTGT"
     gene            complement(190818..191060)
                     /gene="UL148A"
                     /locus_tag="HHV5wtgp128"
     CDS             complement(190818..191060)
                     /gene="UL148A"
                     /locus_tag="HHV5wtgp128"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148A"
                     /protein_id="AAR31686.1"
                     /translation="MSSDSNFDPWIPVCVVVVMTSVVLFAGLHVYLWYVRRQLVAFCL
                     EKVCVRCCGKDETTPLVEDAEPPAELEMVEVSDECY"
     gene            complement(191190..191432)
                     /gene="UL148B"
                     /locus_tag="HHV5wtgp129"
     CDS             complement(191190..191432)
                     /gene="UL148B"
                     /locus_tag="HHV5wtgp129"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148B"
                     /protein_id="AAR31687.1"
                     /translation="MALDTLAGLAICVGLVMGVTVIASCALLVFYYCDEREDGRPSKL
                     LQRSIRRWRHGLSTESLTAILPDGSSTEQEIYHTRL"
     gene            191522..191755
                     /gene="UL148C"
                     /locus_tag="HHV5wtgp130"
     CDS             191522..191755
                     /gene="UL148C"
                     /locus_tag="HHV5wtgp130"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148C"
                     /protein_id="AAR31688.1"
                     /translation="MLTPAVFPAVLYLLALVVWVEMFCLVAVAVVEREIAWALLLRML
                     VVGLMVEVGAAAAWTFVRCLAYQRSFPVLTAFP"
     gene            191980..194348
                     /gene="UL148D"
                     /locus_tag="HHV5wtgp131"
     regulatory      191980..191985
                     /regulatory_class="TATA_box"
                     /gene="UL148D"
                     /locus_tag="HHV5wtgp131"
     mRNA            join(192009..192428,193169..193542,193654..194348)
                     /gene="UL148D"
                     /locus_tag="HHV5wtgp131"
                     /product="protein UL148D"
                     /experiment="Northern blot"
                     /experiment="RACE"
                     /experiment="RT-PCR"
                     /note="other spliced forms exist"
     CDS             192137..192325
                     /gene="UL148D"
                     /locus_tag="HHV5wtgp131"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148D"
                     /protein_id="AAR31689.1"
                     /translation="MTAPKCVTTTTYLVKTKEQPWWPDNAIRRWWISVAIVIFIGVCL
                     VALMYFTQQQARNGSGSG"
     gene            complement(192341..194260)
                     /gene="UL150"
                     /locus_tag="HHV5wtgp132"
     CDS             complement(192341..194260)
                     /gene="UL150"
                     /locus_tag="HHV5wtgp132"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein UL150"
                     /protein_id="AAR31690.1"
                     /translation="MLTLYLFTATCCFVCALPRQAQVDTAICHHTWPMCSDVPHPTSS
                     AHNTALSSSHAISIEHRLLHSPSPPRENIRHSMRCRRRAIASSASTPVSHTQPLAANH
                     RRSRITYATTDPTNSPTASPAKSDKLEADADPALHRRPDSLLRHLFQPCHAQRGTSNR
                     ATSQRASLNAVHHKLCGAMISSSWSTTCTPAIMDLPSLSVELSAGHKKKETPTEGGWG
                     GEEGEDDVLATIRNTLSAPTSPAAATTHRLSFPEGSSFCLTAVSEYSQRLTSTAALTP
                     PPPAVAAPFSFSSTVSETGAFPQSTAGRTRVDDTAVVTAGDPRSPVTHVTLLQIFRLR
                     SSLLTSRSGDTLRGGEHEAIPKVASLFWTLLKATQTVEITHKTPSADSHRNPQKYTDR
                     PQRLLLTALAIWQRTYNNTRADHAPQVRLLGNILTYRRPQTATASAKAHTQQQPEEPK
                     GQQIWAQTAGQAAPHGDEPHSDGELRRESHSAPPTSRTLPDTILAVKRRSVAQRSHVR
                     LDAKPGLNDRDGFRRRLLLPLSGYFRANELRNQQFMGYGTENGLKNTCLTRPLGAAGG
                     VRETIGERQDRDVADSATQRVFHTLYAALQTVRVWYTALGTAWRTSGSRTRDSLFDGP
                     RRRDRQAGRLRRLEL"
     CDS             join(193200..193542,193654..194126)
                     /gene="UL150A"
                     /locus_tag="HHV5wtgr005"
                     /codon_start=1
                     /product="protein UL150A"
                     /protein_id="AEJ33669.1"
                     /translation="MASCSPPRRVSPDLLVSSELRRRNIWRRVTCVTGERGSPAVTTA
                     VSSTRVRPAVLCGKAPVSETVDEKENGAATAGGGGVNAAVDVRRCEYSETAVRQKLDP
                     SGNDSRCVVAAADSSTDSDGKSIIAGVQVVDHDEDIIAPQSLWCTAFKEALWDVALLE
                     VPRWAWQGWKRWRNSESGRRWSAGSASASSLSDLAGEAVGELVGSVVAYVILERLWLA
                     ARGWVCETGVEAEEAMARRRQRMLWRMFSRGGDGECSRRCSMEMACEEESAVL"
     ncRNA           193587..193607
                     /ncRNA_class="miRNA"
                     /gene="UL148D"
                     /locus_tag="HHV5wtgp131"
                     /product="hcmv-miR-UL148D"
                     /inference="ab initio prediction:miRBase:rel16"
     regulatory      194306..194311
                     /regulatory_class="polyA_signal_sequence"
                     /note="UL148D, UL150A"
     repeat_region   194344..195667
                     /note="IRL"
                     /rpt_type=inverted
     repeat_region   195090..197626
                     /note="IRS"
                     /rpt_type=inverted
     repeat_region   195090..195667
                     /note="'a' sequence"
                     /rpt_type=inverted
     gene            195976..198519
                     /gene="IRS1"
                     /locus_tag="HHV5wtgp133"
                     /note="immediate early gene"
     CDS             195976..198519
                     /gene="IRS1"
                     /locus_tag="HHV5wtgp133"
                     /note="transcriptional activator; blocks phosphorylation
                     of eIF2alpha and host shutoff of protein synthesis; binds
                     dsRNA; involved in gene regulation; involved in
                     translational regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein IRS1"
                     /protein_id="AAR31691.1"
                     /translation="MAQRNGMSPRPPPLGRGRGAGGPSGVGSSPPSSCVPMGATSTAG
                     TGASAAPTATPGHGVHRVEPRGPPGAPPSSGNNSNFWHGPERLLLSQIPVERQALTEL
                     EYQAMGAVWRAAFLANSTGRAMRKWSQRDAGTLLPLGRPYGFYARVTPRSQMNGVGAT
                     DLRQLSPRDAWIVLVATVVHEVDPAADPTVGDKAGHPEGLCAQDGLYLALGAGFRVFV
                     YDLANNTLILAARDADEWFRHGAGEVVRLYRCNRLGVGTPRATLLPQPALRQTLLRAE
                     EATALGRELRRRWAGTTVALQTPGRRLQPMVLLGAWQELAQYEPFASAPHPASLLTAV
                     RRHLNQRLCCGWLALGAVLPARWLGCAAGPATGTTSPPAASGTETEAAGGDAPCAMAG
                     AVGSAVTIPPQPYGGAGGSAICVPNADAHAVVGADATAAAAAAAAAPTVMVGPTAMAG
                     PAASGTVPRAMLVVVLDELGAVFGYCPLDGHVYPLAAELSHFLRAGVLGALALGRESA
                     PAAEAARRLLPELDREQWERPRWDALHLHPRAALWAREPHGQWEFMFREQRGDPIHDP
                     VAFRLSDARTLGLDLTTVMTERQSQLPEKYIGFYQIRKPPWLMEQPPPPSRQTKPDAA
                     TMPPPLSAQASVSYALRYDDESWRPLSTVDDHKAWLDLDESHWVLGDSRPDDIKQRRL
                     LKATQRRGAEIDRPMPVVPEECYDQRFTTEGHQVIPLCASEPEDDDEDPTYDELPSRP
                     PQKHKPPDKPPRLCKTGPGPPPLPPKQRHGSTDGKVSAPRQSEHHKRQTRPPRPPPPK
                     FGDRTAAHLSQNMRDMYLDMCTSSGHRPRPPAPPRPKKCQTHAPHHVHH"
     misc_feature    197627..233108
                     /note="US"
     gene            complement(198543..199013)
                     /gene="US1"
                     /locus_tag="HHV5wtgp134"
     CDS             complement(198543..199013)
                     /gene="US1"
                     /locus_tag="HHV5wtgp134"
                     /note="contains duplicated TT virus ORF2 motif; US1
                     family"
                     /codon_start=1
                     /product="protein US1"
                     /protein_id="AAR31692.1"
                     /translation="MASGLGDLSVGVSSLPMRELAWRRVADDSHDLWCCCMDWKAHVE
                     YAHPASELRPGSGGWPEHAEAQWRQQVHAAHDVWCNCGDWQGHALRSRSRTAESGRSS
                     SSSSVSVLSDGDQQPWWRRLRVKRPKFPSWARRWTQRHDSEERASQQAKNDSTS"
     gene            complement(199331..199930)
                     /gene="US2"
                     /locus_tag="HHV5wtgp135"
     CDS             complement(199331..199930)
                     /gene="US2"
                     /locus_tag="HHV5wtgp135"
                     /note="contains potential transmembrane domain; causes
                     selective degradation of MHC-I and MHC-II; involved in
                     immune regulation; US2 family"
                     /codon_start=1
                     /product="membrane glycoprotein US2"
                     /protein_id="AAR31693.1"
                     /translation="MNNLWKAWVGLWTSMGPLIRLPDGITKAGEDALRPWKSTAKHPW
                     FEIEDNRCYIDNGKLFARGSIVGNMSRFVFDPKADYGGVGENLYVHADDVEFVPGESL
                     KWNVRNLDVMPIFETLALRLVLQGDVIWLRCVPELRVDYTSSAYMWNMQYGMVRKSYT
                     HVAWTIVFYSINITLLVLFIVYVTVDCNLSMMWMRFFVC"
     gene            complement(200345..200905)
                     /gene="US3"
                     /locus_tag="HHV5wtgp136"
                     /note="immediate early gene"
     CDS             complement(200345..200905)
                     /gene="US3"
                     /locus_tag="HHV5wtgp136"
                     /note="type 1 membrane protein; inhibits processing and
                     transport of MHC-I and MHC-II; involved in immune
                     regulation; US2 family"
                     /codon_start=1
                     /product="membrane glycoprotein US3"
                     /protein_id="AAR31694.1"
                     /translation="MKPVLVLAILAVLFLRLADSVPRPLNVVVSEIKSAHFRVEENQC
                     WFHMGMLYFKGRMSGNFTKKHFVNVGIVSQSYMDRLQVSGEQYHHDERGAYFEWNIGG
                     YPVSHTVDMVDITLSTRWGDPKKYAACVPQVRMDYSSQTINWYLQRSMRDDNWGLLFR
                     TLLVYLFSLVVLVLLTVGVSARLRFI"
     ncRNA           201371..201392
                     /ncRNA_class="miRNA"
                     /product="hcmv-miR-US4"
                     /inference="ab initio prediction:miRBase:rel16"
     gene            complement(201615..202163)
                     /gene="US6"
                     /locus_tag="HHV5wtgp137"
     CDS             complement(201615..202163)
                     /gene="US6"
                     /locus_tag="HHV5wtgp137"
                     /note="type 1 membrane protein; inhibits TAP-mediated
                     peptide transport; involved in immune regulation; US6
                     family"
                     /codon_start=1
                     /product="membrane glycoprotein US6"
                     /protein_id="AAR31695.1"
                     /translation="MDLLIRLGFLLMCALPTPGERSSRDPKTLLSLSPRQACVPRTKS
                     HRPVCYNDTGDCTDADDSWKQLGEDFAHQCLQAAKKRPKTHKSRPNDRNLEGRLTCQR
                     VRRLLPCDLDIHPSHRLLTLMNNCVCDGAVWNAFRLIERHGFFAVTLYLCCGITLLVV
                     ILALLCSITYESTGRGIRRCGS"
     ncRNA           202317..202337
                     /ncRNA_class="miRNA"
                     /product="hcmv-miR-US5-1"
                     /inference="ab initio prediction:miRBase:rel16"
     ncRNA           202444..202455
                     /ncRNA_class="miRNA"
                     /product="hcmv-miR-US5-2"
                     /inference="ab initio prediction:miRBase:rel16"
     gene            complement(202589..203266)
                     /gene="US7"
                     /locus_tag="HHV5wtgp138"
     CDS             complement(202589..203266)
                     /gene="US7"
                     /locus_tag="HHV5wtgp138"
                     /note="type 1 membrane protein; possibly involved in
                     immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US7"
                     /protein_id="AAR31696.1"
                     /translation="MRIQLLLVSTLVASIVATRVEDMATFRTEKQWQQDLQYRREFVK
                     RQLAPKPKSNIVVSHTVSCVIDGGNMTSVWRFEGQFNPHIASEVILHDTSGLYNVPHE
                     VQNDGQVLTVTVKRSAPADIAKVLISLKPVQLSSGQYECRPQLQLPWVPRPSSFMYDS
                     YRLWYEKRWLTIILYVFMWTYLVTLLQYCIVRFIGTRLFYFLQRNITIRFTGKPTYNL
                     LTYPVKG"
     gene            complement(203469..204152)
                     /gene="US8"
                     /locus_tag="HHV5wtgp139"
     CDS             complement(203469..204152)
                     /gene="US8"
                     /locus_tag="HHV5wtgp139"
                     /note="type 1 membrane protein; binds to MHC-I; involved
                     in immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US8"
                     /protein_id="AAR31697.1"
                     /translation="MRRWLRLLVGLGCCWVTLAHAGNPYEDDDYYYYREDEPRQHGEP
                     NYVAPPARQFRFPPLNNVSSYQASCVVKDGVLDAVWRVQGTFYPEKGIVARVGWSGRR
                     GRKWGRLHAPECLVETTEAVFRLRQWVPTDLDHLTLHLVPCTKCKPMWCQPRYHIRYF
                     SYGNSVDNLRRLHYEYRHLELGVVIAIQMAMVLLLGYVLARTVYRVSSAYYLRWHACV
                     PQKCEKSLC"
     gene            complement(204167..204910)
                     /gene="US9"
                     /locus_tag="HHV5wtgp140"
     CDS             complement(204167..204910)
                     /gene="US9"
                     /locus_tag="HHV5wtgp140"
                     /note="type 1 membrane protein; possibly involved in
                     immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US9"
                     /protein_id="AAR31698.1"
                     /translation="MILWSPSTCSFFWHWCLIAVSVLSSRSKESLRLSWSSDESSASS
                     SSRICPLSNSKSVRLPQYPRGFGDVSGYRVSSSVSECYVQHGVLVAAWLVRGNFSDTA
                     PRAYGTWGNERSATHFKVGAPQLENDGALRYETELPQVDARLSYVMLTVYPCSACNRS
                     VLHCRPASRLPWLPLRVTPSDLERLFAERRYLTFLYVVLVQFVKHVALFSFGVQVACC
                     VYLRWIRPWVRGRHRATGRTSREEEAKDD"
     gene            complement(205296..205853)
                     /gene="US10"
                     /locus_tag="HHV5wtgp141"
     CDS             complement(205296..205853)
                     /gene="US10"
                     /locus_tag="HHV5wtgp141"
                     /note="type 1 membrane protein; delays trafficking of
                     MHC-I; involved in immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US10"
                     /protein_id="AAR31699.1"
                     /translation="MLRRGSLRNPLAICLLWWLGVVAAATEETREPTYFTCGCVIQNH
                     VLKGAVKLYGQFPSPKTLRASAWLHDGENHERHRQPILVEGTATATEALYILLPTELS
                     SPEGNRPRNYSATLTLASRDCYERFVCPVYDSGTPMGVLMNLTYLWYLGDYGAILKIY
                     FGLFCGACVITRSLLLICGYYPPRE"
     gene            complement(205929..206576)
                     /gene="US11"
                     /locus_tag="HHV5wtgp142"
     CDS             complement(205929..206576)
                     /gene="US11"
                     /locus_tag="HHV5wtgp142"
                     /note="type 1 membrane protein; causes selective
                     degradation of MHC-I; involved in immune regulation; US6
                     family"
                     /codon_start=1
                     /product="membrane glycoprotein US11"
                     /protein_id="AAR31700.1"
                     /translation="MNLVMLILALWAPVAGSMPELSLTLFDEPPPLVETEPLPPLPDV
                     SEYRVEYSEARCVLRSGGRLEALWTLRGNLSVPTPTPRVYYQTLEGYADRVPTPVEDI
                     SESLVAKRYWLRDYRVPQRTKLVLFYFSPCHQCQTYYVECEPRCLVPWVPLWSSLEDI
                     ERLLFEDRRLMAYYALTIKSAQYTLMMVAVIQVFWGLYVKGWLHRHFPWMFSDQW"
     gene            complement(206762..207607)
                     /gene="US12"
                     /locus_tag="HHV5wtgp143"
     CDS             complement(206762..207607)
                     /gene="US12"
                     /locus_tag="HHV5wtgp143"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US12"
                     /protein_id="AAR31701.1"
                     /translation="MVQIQFHQGEPLGHKKEKPPPVSPPSPPPIRRVTVITKDEDTLR
                     SVQHFLWMVRLYGTVVFQTSATIATTILFMLIPWRVTTPYLRDTLPFWSTLLPCALRC
                     HAYWLERQRRPGTLMLVMVYTTLTTISVSTIGLCFDRTVVIQAYVLSSMLCVWCTGLA
                     WLMAWNMQRRLAILCLLSFMLPILWLFIAVQSWEPYQRIILALTVSFIYGLKIVLIRD
                     TLTVLYRSPSNCYTDGDLLRTAMLLYMDQVIMFLLVVVPLTAPIWYPNYAGALGRTAH
                     WLFHK"
     gene            complement(207687..208472)
                     /gene="US13"
                     /locus_tag="HHV5wtgp144"
     CDS             complement(207687..208472)
                     /gene="US13"
                     /locus_tag="HHV5wtgp144"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US13"
                     /protein_id="AAR31702.1"
                     /translation="MDPPLPSLHSPQWASLLQLHHGLMWLRRFAVLVRVYALVVFHIA
                     ISTAFCGMIWLGIPDSHNICQHESSPLLLVFAPSLLWCLVLIQGERHPDDVVLTMGYV
                     GLLSVTTVFYTWCSDLPAILIDYTLVLTLWIACTGAVMVGDSFRAKRWELICSRVLTS
                     VFFITLWVIGDQTVFHHQRILLYGYGAIVFLMMTVTFYGTRYIRDELPAAQTLRGSLL
                     IYVGLVTMFKITLIVLSPNLWRLPWTTVFAAFRSSYCEGGGGS"
     gene            complement(208541..209473)
                     /gene="US14"
                     /locus_tag="HHV5wtgp145"
     CDS             complement(208541..209473)
                     /gene="US14"
                     /locus_tag="HHV5wtgp145"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US14"
                     /protein_id="AAR31703.1"
                     /translation="METVSTQRETASSETERTREAASAETTDATFRSLEEGSTISSRY
                     SETASTASEDAVCWLRRTAIVMRVYGLLTLETAFSVLISALVWLGYPSLGYECRDDPS
                     PLLLSCTPVLVLGALELTDHRHPSNGLVFALYVALLSFTTAGLNLCATAPIGVSSLIL
                     TWTLFVACNGVAWEHRLSSVWRDALFTSTLLTVMVSVLASTYTWLHKTLLCLYTVFVG
                     CILAVLFQDVRYIATKMPVSHIIRSSLVLYATETLIYHTTLLMLTPVVWSARWDQMFS
                     YLAKLGTYHHYRVDNGTLSVILNSTTATFQSRVA"
     gene            complement(209518..210306)
                     /gene="US15"
                     /locus_tag="HHV5wtgp146"
     CDS             complement(209518..210306)
                     /gene="US15"
                     /locus_tag="HHV5wtgp146"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US15"
                     /protein_id="AAR31704.1"
                     /translation="MRREKGFQVPTDGTVIYVPPGIQETRLATRSLAWVDCCRVALHT
                     YGAVGWQLAGLTALLSAFCYAAPATWFHHSRLCLTESSPSLVFVIPVTSVIFIHCYET
                     SHPSNIGVLLFYTLLHVPPLIVICLCLDGTLVISAALFTLLAFLSCTGVALLAPERTV
                     RRQIVVIHALITLTFTAIVVVILRRGWSWCFKIVLSFSVLITCLAVSHFHEAALAVRY
                     ETPLERALLAAVKVFLSLVFTLLMVLRIMTLRTFLQTYFSSDKL"
     gene            complement(210366..211295)
                     /gene="US16"
                     /locus_tag="HHV5wtgp147"
     CDS             complement(210366..211295)
                     /gene="US16"
                     /locus_tag="HHV5wtgp147"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US16"
                     /protein_id="AAR31705.1"
                     /translation="MGLRFPTATQRQIVFRRLFDSGNNDDYDEAAVVAVLGWVHRFEV
                     VVRIAGLLLFQISTAVAVLGSFSLVFPTATLKSRPGFPCHVVWAPEVLLLVPVASALF
                     VYFRYERPVLAQRNRHPRCRRPFRQLVLLLAGLLAHIPALGVTCACQEPREVLTSFVL
                     TLVITLLCAEVVFICRDNCTLSDQFALINGVWVVVFLANVLIVFTRPWTWPLRLLLGF
                     YSTVGLIFAGHFSQQVLFVRHVLMPRDVAHTSLQLFITFISLFFLILRIRNCQDLLSD
                     LRLLELPSSDAMTLTPNDLSHASSSTPLSTLSP"
     gene            complement(211440..212321)
                     /gene="US17"
                     /locus_tag="HHV5wtgp148"
     CDS             complement(211440..212321)
                     /gene="US17"
                     /locus_tag="HHV5wtgp148"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US17"
                     /protein_id="AAR31706.1"
                     /translation="MSPNSEATGTAWAPPPPRPSRGVIMISSVSTNDVRRFLLCMRVY
                     STVAVQGTCTFLLCLGLVLAFPHLKGTVFLCCTGFMPPLSLMVPTICLALLHGKRDEG
                     SFTSPPSPGLLTIYSVLTTLSVIVASACSSSTLVTFSGLLACVLFSLCSCVTGLAGHN
                     HRRWQVIVTLFVIGVIAFLIALYLQPVPLGHKLFLGYYAMALSFMLVVTVFDTTRLFE
                     IAWSEADLLTLCLYENLVYLYLLILILFTTEDSLDKLIAWMTWLSSRATGATNAASIS
                     GCDLLREVQRNLTRTMA"
     gene            complement(212589..213413)
                     /gene="US18"
                     /locus_tag="HHV5wtgp149"
     CDS             complement(212589..213413)
                     /gene="US18"
                     /locus_tag="HHV5wtgp149"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US18"
                     /protein_id="AAR31707.1"
                     /translation="MGDTASVSEHHESPTVTIVPLHRSHALVAEQQLFQWLKRFKLLM
                     EVYHGLVWQLACTLTVCLLAWLAFPDVQGQCANGIVPALSSIVPVSTLAMLRGFAEFR
                     PHTTNFAHLTVACLLINTGITVCTGFCGERRVIGLSFALVMVFFVLCSGLTYLAGNNP
                     TRWKVIGIGYGWSVIVFYLLLYFSPVLWVSKIYSGLYVLVVTAASAVLIYETLDLIYQ
                     RGTLSKNSVCVSVVLYTIVMSLLNMSVAIFSGHVWVQQYAEKHGGRIDGVSLLSLL"
     gene            complement(213551..214273)
                     /gene="US19"
                     /locus_tag="HHV5wtgp150"
     CDS             complement(213551..214273)
                     /gene="US19"
                     /locus_tag="HHV5wtgp150"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US19"
                     /protein_id="AAR31708.1"
                     /translation="MLHVVPLEWTVEEVVPYLERLAVWLRASVLVAFQLTATVALSVL
                     SWWLMPPPVAELCERGRDDDPPSLSHLSLVVPVGCLFLLLRGPSIDRCPRKLPLLLAY
                     CLPHALAFLTLLMCQPSPQAFVGAALLALAVDLSCLGASLLGCDPGASLRRLWLPSVL
                     SLLCATALGLWLLRAAAPFFLGLHATTLLTVTLMLIHDLSLITCQSSFPESFQPSLRL
                     YVENVALFIGMYHLLRLWLWSP"
     gene            complement(214320..215084)
                     /gene="US20"
                     /locus_tag="HHV5wtgp151"
     CDS             complement(214320..215084)
                     /gene="US20"
                     /locus_tag="HHV5wtgp151"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US20"
                     /protein_id="AAR31709.1"
                     /translation="MQAQEANALLLSRMEALEWFKKFTVWLRVYAIFIFQLAFSFGLG
                     SVFWLGFPQNRNFCVENYSFFLTVLVPIVCMFITYTLGNEHPSNATVLFIYLLANSLT
                     AAIFQMCSESRVLVGSYVMTLALFISFTGLAFLGGRDRRRWKCISCVYVVMLLSFLTL
                     ALLSDADWLQKIVVTLCAFSISFFLGILAYDSLMVIFFCPPNQCIRHAVCLYLDSMAI
                     FLTLLLMLSGPRWISLSDGAPLDNGTLTAASTTGKS"
     gene            complement(215191..215922)
                     /gene="US21"
                     /locus_tag="HHV5wtgp152"
     CDS             complement(215191..215922)
                     /gene="US21"
                     /locus_tag="HHV5wtgp152"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US21"
                     /protein_id="AAR31710.1"
                     /translation="MSLRGQVQIARSVFLLRIYILIWVQCLILMSVCAFCWLVLPHRL
                     EQLFSSVRLTLSCLMISIVCLGLLRWAEPNFPKNVWILLTYTLLTSVAVTASGFHFSH
                     RSVIYAMVATVTLFCFLTLATYLFARDVELQRSLLTGASTLILLLFAVFSLFPEAVSE
                     ILVMIAGLAVIVTSVVCDTQDILHDIEYESYIPGALCLYMDLMYLFVSVLYFMPSEPG
                     SAHTAQTTVAATVAATAAASPQFVS"
     gene            complement(216099..217829)
                     /gene="US22"
                     /locus_tag="HHV5wtgp153"
                     /note="possible beta gene"
     CDS             complement(216099..217829)
                     /gene="US22"
                     /locus_tag="HHV5wtgp153"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein US22"
                     /protein_id="AAR31711.1"
                     /translation="MSLLTKAAAEAWGTYLRQRDERCEDAIRCDYGVFQFRNTVFQKT
                     LSMLQGLYLRQYDPPALRTYVQRHQGTTVALRNPANWFLVMREQAAIPQIYARSLAAD
                     YLCCDDTLEAVGVLAVRPPDSDLTRNTKQAQELPCVLMLSHYGTVYVYDWETDGLYEV
                     ASDIKAFSKNGLLWCEYVYRHPQTPFATTEPRYHVQKFLCTDPTDAAAVAKTAREMNG
                     LNLVIRTPGRTEVEPLLMLGSIEGLRACRPFDHMPAADFRDLLNFIRQRLCCEWYVVG
                     LVGYYLAYGPFVPSGMVLLDKFGVVYLHKIEDSDLYRIADNFHMFLKCGLLKLRGLCR
                     FDRGLRGECRLEELPVCHHTLKRDVLRWHGALGTITRSQLESALDWFLRPTRGTDKVP
                     NNSSAWGRTDLLPTGALQDNQNWAFPSHSVETLPALQGGLWEDNDETTQTVDGQRCFR
                     MPKFFPPPMCRAPYNECGVELPGGDSSDEDESGRPRRIANRIGDTPETPCNSENEDDT
                     TVEGTSGGPEAMDSQAPYPSEDSPTTEKEAWLQRGRRAKAMHARGHTLKQVPIPEPDQ
                     MGDDGPDPGP"
     gene            complement(217943..219721)
                     /gene="US23"
                     /locus_tag="HHV5wtgp154"
     CDS             complement(217943..219721)
                     /gene="US23"
                     /locus_tag="HHV5wtgp154"
                     /note="US22 family"
                     /codon_start=1
                     /product="protein US23"
                     /protein_id="AAR31712.1"
                     /translation="MWRTRWEDGAPTFTRNDEFLYCHTRYETFLRVMGDFQGIFECQY
                     SADVLRDWVRNHVDQVLSLGIPHNWFLQVRPGSTMPELRDQLLDDVICCPERLIVLGK
                     CVIMVDDHYEETELVLCMGGGTRLYIYEPSQEILLLCARHLDELARYGMMYTEAVYRQ
                     PQTPFATRVPHDVVAMLLRHGHDTDALAACVGEHHGRDVNFHTPGRHAKTLKLLTSFG
                     CLTDCWPFEVAPAARLAECEMYVTLQLRCRWYLLGAVGSYRAGGFFDTSFLIIFDRFC
                     RFYVVIVKSHLDRSPPLQRLAGEIYRLADSLEELFRAGLMKVYVRRRYEHGLRRAARL
                     ERNGGCVHMGEAARLHFTMFDSGVDRDYARQFRWLCRGDRFRAEMLNNWDGWDAFTIW
                     QARVVRGDFAERRRPRSLGDGEEEDEGNDGRAMPVVRRRPPPMPRDDDEDNHVVPDNQ
                     NLEVIHDALADDEEQGEDDDDSGAEPMEPEENNVVPNVDRRGGEDAVAARMAAGHESD
                     DDEWEDLGFDLEEDTVFDLKDVDEWFEQRRLAEKERWHLGQRIVNAYRTEAEVSEAEV
                     EARRINLNTDLSPEWVKSFDFREHFV"
     gene            complement(219817..221322)
                     /gene="US24"
                     /locus_tag="HHV5wtgp155"
     CDS             complement(219817..221322)
                     /gene="US24"
                     /locus_tag="HHV5wtgp155"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein US24"
                     /protein_id="AAR31713.1"
                     /translation="MMDPAAGSGPDGAAVVPPELPALPVAAEDPMALYRQVLRDFKEL
                     FFCLEPMEITRYVHRNEGRCLSLGPPKGWHVMLRTEDGIITAAKQAASKLICCREPLT
                     PLGYAVILLPEPRRDHHDGMVATPYVVFMGRFSRVYAYDTREKYMVLVSHNLDELARY
                     GVSRSEIAYRDVIHTTLRRMTVPVPRRYPKGARTMHVLFLNDTTPEGSYATAERILGC
                     DVKLHTPGYGTVIMRLMKTVQQLHRIWPFCALTEVESRRWWWAVRANLATPWYVLGVT
                     GRPRPGRSFVAEVLVLLDWFGAVYAIQMDDPNHYVRRVANTITEFFRMGLLKMVFRHR
                     RFERERQRQTRMEHRHLCPHHHERAVDHKRDILFNEDAALPDERRERERRILQQQYDW
                     LCLTERFDPHEGAWERLDPNTLVLHRYDTNSQSYVLDPDIVGVEAAEREAAGHQDDTG
                     PRLHCLVTTRSSTREGAERVITALVHQSRLVTYSDPFPLKSLTGVREYIQI"
     ncRNA           complement(221474..221495)
                     /ncRNA_class="miRNA"
                     /product="hcmv-miR-US25-1*"
                     /inference="ab initio prediction:miRBase:rel16"
     ncRNA           complement(221518..221538)
                     /ncRNA_class="miRNA"
                     /product="hcmv-miR-US25-1"
                     /inference="ab initio prediction:miRBase:rel16"
     ncRNA           complement(221679..221701)
                     /ncRNA_class="miRNA"
                     /product="hcmv-miR-US25-2-3p"
                     /inference="ab initio prediction:miRBase:rel16"
     ncRNA           complement(221738..221759)
                     /ncRNA_class="miRNA"
                     /product="hcmv-miR-US25-2-5p"
                     /inference="ab initio prediction:miRBase:rel16"
     gene            complement(221956..223767)
                     /gene="US26"
                     /locus_tag="HHV5wtgp156"
                     /note="possible beta gene"
     CDS             complement(221956..223767)
                     /gene="US26"
                     /locus_tag="HHV5wtgp156"
                     /note="US22 family"
                     /codon_start=1
                     /product="protein US26"
                     /protein_id="AAR31714.1"
                     /translation="MRQSYRYASGAVVRRTLKGLRKLILCQDLRQDIRHLVRSYADMN
                     ISLPVSAPPGWRLDFVEFEDIFGSAAVTDGPETPWGQLICCEESLESLGVLQFSTTVL
                     PRVHGPRSSSEDEDSDDDDFFVYVEEIEPPSQARLVLLLGRYETVWCLDRDCGVLYYL
                     AHSLDDFARHGLLHCEAIYGEQMRTPLLTTQPDHIICDLRLHDNSISELQRVTCRYRG
                     ECVPLRTPGEMTRPLLLCGQAENLKGVWPFICMETEQFNDLLKFFVDRLCCETMIMGV
                     VGESLPSGVFHADFVILVDRACEFFYFDVSRREIWRLADSVDMLLTVGLLKIYQAGRR
                     FHYAVDDAERLEVPGRCPHENFPFWDRFGTVERVRASTRHHELRYKWLIRKDRFIVRP
                     DWCSMRNSLDEVSGTADVSWDPRIRPDYPQTSDLECAKQYWQELNDHVREQTARYGPV
                     RRYSVWCGMSSRLERAVKRLQQRIPRQNLMNPSLMNQGLCVYYSDEEEDQEEDDTSDD
                     DDQEKETENPQNNIGSLTRTPSSPGSLEGVEERMLNVMKEAVAEQDRKKTQKKHKIDT
                     AQRRVLTRRAARAAVLEGRPTPKPTMPHPVSYLPFWM"
     gene            223800..226529
                     /gene="US27"
                     /locus_tag="HHV5wtgp157"
     regulatory      223800..223805
                     /regulatory_class="TATA_box"
                     /gene="US27"
                     /locus_tag="HHV5wtgp157"
     mRNA            join(223832..224024,224100..226529)
                     /gene="US27"
                     /locus_tag="HHV5wtgp157"
                     /product="envelope glycoprotein US27"
                     /experiment="Northern blot"
                     /experiment="RACE"
                     /experiment="RT-PCR"
     CDS             224133..225227
                     /gene="US27"
                     /locus_tag="HHV5wtgp157"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     putative chemokine receptor; possibly involved in
                     intracellular signalling; GPCR family"
                     /codon_start=1
                     /product="envelope glycoprotein US27"
                     /protein_id="AAR31715.1"
                     /translation="MTTSTTTTTNIMLQVSNVTNHTLNSTEIYQLFEYTRFGVWLMCI
                     VGTFLNMLVITTILYYRRKKKSPSDTYICNLAVADLLIVVGLPFFLEYAKHHPKLSRE
                     VVCSGLNACFYICLFAGVCFLINLSMDRYCVIVWGVELNRVRNNKRATCWVVIFWILA
                     ALMGMPHYLMYSHTNNECVGEFANETSGWFPVFLNTKVNICGYLAPIVLMAYTYNRMV
                     RFIINYVGKWHMQTLHVLLVVVVSFASFWFPFNLALFLESIRLLSGTQNETLQTVITF
                     CLYVGQFLAYVRACLNPGIYILVGTQMRKDMWTTLRVFACCCVKQEIPYQDIDIELQK
                     DIQRRAKHTKRTHYDRKHAPMESGEEEFLL"
     gene            225435..226529
                     /gene="US28"
                     /locus_tag="HHV5wtgp158"
     CDS             225435..226499
                     /gene="US28"
                     /locus_tag="HHV5wtgp158"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     broad spectrum CC chemokine receptor; constitutive
                     signalling; mediates cellular migration; involved in
                     intracellular signalling; GPCR family"
                     /codon_start=1
                     /product="envelope protein US28"
                     /protein_id="AAR31716.1"
                     /translation="MTPTTTTAELTTEFDYDEDATPCVFTDVLNQSKPVTLFLYGVVF
                     LFGSIGNFLVIFTITWRRRIQCSGDVYFINLAAADLLFVCTLPLWMQYLLDHNSLASV
                     PCTLLTACFYVAMFASLCFITEIALDRYYAIVYMRYRPVKQACLFSIFWWIFAVIIAI
                     PHFMVVTKKDNQCMTDYDYLEVSYPIILNVELMLGAFVIPLSVISYCYYRISRIVAVS
                     QSRHKGRIVRVLIAVVLVFIIFWLPYHLTLFVDTLKLLKWISSSCEFERSLKRALILT
                     ESLAFCHCCLNPLLYVFVGTKFRQELHCLLAEFRQRLFSRDVSWYHSMSFSRRGSPSR
                     RETSSDTLSDEVCRVSQIIP"
     regulatory      226498..226503
                     /regulatory_class="polyA_signal_sequence"
                     /note="US27, US28"
     gene            226662..228050
                     /gene="US29"
                     /locus_tag="HHV5wtgp159"
     CDS             226662..228050
                     /gene="US29"
                     /locus_tag="HHV5wtgp159"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="membrane protein US29"
                     /protein_id="AAR31717.1"
                     /translation="MRCFRWWLYSGWWWLTFGCARTVTVGFVAPTVRAQSTVVRSEPA
                     PPSETRRDNNDTSYFSSTSFHSSVSPATSVDRQFRRTTYDRWDGRRWLRTRYGNASAC
                     VTGTQWSTNFFFSQCEHYPSFVKLNGVQRWTPVRRPMGEVAYYGGCCMVGGGNRAYVI
                     LVSGYGTASYGNALRVDFGRGNCTAPKRTYPRRLELHDGRTDPSRCDPYQVYFYGLQC
                     PEQLVITAHGGVGMRRCPTGSRPTPSRPHRHDLENELHGLCVDLLVCVLLLALLLLEL
                     VPMEAVRHPLLFWRRVALSPSTSKVDRAVKLCLRRMLGLPPPPSVAPPGEKKELPAQA
                     ALSPPLTTWSLPPFPSTRIPDSPPPPYQLRHATSLVTVPTLLLYTSSDIGDTASETTC
                     VAHATYGEPPEPARSTATVQECTVLTAPNCGIVNNDGAVSEGQDHGDAVHHSLDVVSQ
                     CAADTGVVDTSE"
     ncRNA           complement(226711..226730)
                     /ncRNA_class="miRNA"
                     /product="hcmv-miR-US33-3p"
                     /inference="ab initio prediction:miRBase:rel16"
     ncRNA           complement(226747..226768)
                     /ncRNA_class="miRNA"
                     /product="hcmv-miR-US33-5p"
                     /inference="ab initio prediction:miRBase:rel16"
     gene            227854..228903
                     /gene="US30"
                     /locus_tag="HHV5wtgp160"
     CDS             227854..228903
                     /gene="US30"
                     /locus_tag="HHV5wtgp160"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein US30"
                     /protein_id="AAR31718.1"
                     /translation="MGNPRSPLDRRLRFRNVPFLPPRIAASSTTTARSLKAKTMEMRF
                     TIAWMWFPSVLLILGLLTPPSNGCTVDVGRNVSIREQCRLRNGATFSKGDIEGNFSGP
                     VVVELDYEDIDITGERQRLRFHLSGLGCPTKENIRKDNESDVNGGIRWALYIQTGDAK
                     YGIRNQHLSIRLMYPGEKNTQQLLGSDFSCERHRRPSTPLGKNAEVPPATRTSSTYGV
                     LSAFVVWIGSGLNIIWWTGIVLLAADALGLGERWLRLALSHRDKHHASRTAALQCQRD
                     MLLRQRRRARRLHAVSEGKLQEEKKRQSALVWNVEARPFPSTHQLIVLPPPVASAPPA
                     VPSQPPEYSSVFPPV"
     gene            229018..229503
                     /gene="US31"
                     /locus_tag="HHV5wtgp161"
     CDS             229018..229503
                     /gene="US31"
                     /locus_tag="HHV5wtgp161"
                     /note="contains duplicated TT virus ORF2 motif; US1
                     family"
                     /codon_start=1
                     /product="protein US31"
                     /protein_id="AAR31719.1"
                     /translation="MSLLEREESWRRVVDYSHNLWCTCGNWQSHVEIQDEEPNCEQPE
                     PAHWLEYVAVQWQARVRDSHDRWCLCNAWRDHALRGRWGTAYSSGSSASSSGFVAESK
                     FTWWKRLRHSTRRWLFRRRRARYTPSNCGESSTSSGQSSGDESNCSLRTHGVYTRGEQ
                     H"
     gene            229621..230172
                     /gene="US32"
                     /locus_tag="HHV5wtgp162"
     CDS             229621..230172
                     /gene="US32"
                     /locus_tag="HHV5wtgp162"
                     /note="contains duplicated TT virus ORF2 motif; US1
                     family"
                     /codon_start=1
                     /product="protein US32"
                     /protein_id="AAR31720.1"
                     /translation="MAMYTSESERDWRRVIHDSHGLWCDCGDWREHLYCVYDSHFQRR
                     PTTRAERRAANWRRQMRRLHRLWCFCQDWKCHALYAEWDGKESDDESSASSSGEAPEQ
                     QVPAWKTVRAFSRAYHHRINRGLRGTPPPRNLPGYEHASEGWRFCNRRERREDDLRTR
                     AEPDRVVFQLGGVPPRRHRETYV"
     gene            230319..231527
                     /gene="US33A"
                     /locus_tag="HHV5wtgr006"
     regulatory      230319..230324
                     /regulatory_class="TATA_box"
                     /gene="US33A"
                     /locus_tag="HHV5wtgr006"
     mRNA            230350..231527
                     /gene="US33A"
                     /locus_tag="HHV5wtgr006"
                     /product="protein US33A"
                     /experiment="RACE"
                     /experiment="RT-PCR"
     CDS             230374..230547
                     /gene="US33A"
                     /locus_tag="HHV5wtgr006"
                     /codon_start=1
                     /product="protein US33A"
                     /protein_id="AEJ33670.1"
                     /translation="MSLRFPERAGYEKLGYRPHAKRVWVHDPLGLTRFIMRQLMMYPL
                     VLPFTFPFYVPRS"
     gene            230716..231527
                     /gene="US34"
                     /locus_tag="HHV5wtgp163"
     CDS             230716..231207
                     /gene="US34"
                     /locus_tag="HHV5wtgp163"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein US34"
                     /protein_id="AAR31721.1"
                     /translation="MNLEQLINVLGLLVWIAARAVSRVGPHGSGLVYRELHDFYGYLQ
                     LDLLGPVVAGNRSVRTWREQADRARGTFVRRSGLNTSHILPVGGLSGGSGTLPAGLYR
                     PEEEVFLLLNRCHGPLSTPKSACLAEVGVANASFLSRFNVGDFHGASWENGTAPDGEP
                     GVC"
     gene            231201..231527
                     /gene="US34A"
                     /locus_tag="HHV5wtgp164"
     CDS             231201..231395
                     /gene="US34A"
                     /locus_tag="HHV5wtgp164"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein US34A"
                     /protein_id="AAR31722.1"
                     /translation="MLKFFLKLRKRRRPVVVPRFVRFIVYVVLFTVAVQRVKQERDAH
                     LRRYEERLQKNRARRRQSFP"
     regulatory      231506..231511
                     /regulatory_class="polyA_signal_sequence"
                     /note="US33A, US34, US34A"
     misc_feature    231682..231693
                     /note="G string, not detectably variable in length"
     misc_feature    231909..231920
                     /note="variable length G:C tract; 11-13 residues in
                     majority population; G string, variable in length (11-13
                     residues)"
     misc_feature    232204..232217
                     /note="variable length G:C tract; 13-15 residues in
                     majority population; G string, variable in length (13-15
                     residues)"
     gene            complement(232393..234759)
                     /gene="TRS1"
                     /locus_tag="HHV5wtgp165"
                     /note="possible beta gene; immediate early gene"
     CDS             complement(232393..234759)
                     /gene="TRS1"
                     /locus_tag="HHV5wtgp165"
                     /note="transcriptional activator; blocks phosphorylation
                     of eIF2alpha and host shutoff of protein synthesis; binds
                     dsRNA; involved in gene regulation; involved in
                     translational regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein TRS1"
                     /protein_id="AAR31723.1"
                     /translation="MAQRNGMSPRPPPLGRGRGAGGPSGVGSSPPSSCVPMGATSTAG
                     TGASAAPTATPGHGVHRVEPRGPPGAPPSSGNNSNFWHGPERLLLSQIPVERQALTEL
                     EYQAMGAVWRAAFLANSTGRAMRKWSQRDAGTLLPLGRPYGFYARVTPRSQMNGVGAT
                     DLRQLSPRDAWIVLVATVVHEVDPAADPTVGDKAGHPEGLCAQDGLYLALGAGFRVFV
                     YDLANNTLILAARDADEWFRHGAGEVVRLYRCNRLGVGTPRATLLPQPALRQTLLRAE
                     EATALGRELRRRWAGTTVALQTPGRRLQPMVLLGAWQELAQYEPFASAPHPASLLTAV
                     RRHLNQRLCCGWLALGAVLPARWLGCAAGPATGTTSPPAASGTETEAAGGDAPCAMAG
                     AVGSAVTIPPQPYGGAGGSAICVPNADAHAVVGADATAAAAAAAAAPTVMVGPTAMAG
                     PAASGTVPRAMLVVVLDELGAVFGYCPLDGHVYPLAAELSHFLRAGVLGALALGRESA
                     PAAEAARRLLPELDREQWERPRWDALHLHPRAALWAREPHGQLAFLLRPGRGEAEVLT
                     LATKHPVICANVEDYLQDARRRADAQALGLDLATVVMEAGGQMIHKKTKKPKGKEDES
                     VMKGKHSRYTRPTEPPLTPQASLGRALRRDDEDWKPSRVPGEDSWYDLDETFWVLGSN
                     RKNDVYQRRWKKTVLRCGLEIDRPMPTVPKGCRPQTFTHEGIQLMGGATQEPLDTGLY
                     APSHVTSAFVPSVYMPPTVPYPDPAARLCRDMRRVTFSNVATHYHYNA"
     repeat_region   233109..235646
                     /note="TRS"
                     /rpt_type=inverted
     repeat_region   235068..235646
                     /note="'a' sequence"
                     /rpt_type=direct
                     /rpt_type=terminal
     misc_feature    235646
                     /note="unpaired T residue at 3'-end of upper strand;
                     complementary to unpaired A residue at 3'-end of lower
                     strand"
BASE COUNT        50536 a        67176 c        68279 g        49655 t
ORIGIN      
        1 ccattccggg ccgtgtgctg ggtccccgag gggcgggggg gtgttttctg cgggggggtg
       61 aaatttggag ttgcgtgtgt ggacggcgac ggcgactagt tgcgtgtgct gcggtgggta
      121 cggcgacggc gaataaaagc gacgtgcggc gcgcacggcg aaaagcagac gcgcgtctgt
      181 gtctgtttga gtccccaggg gacggcagcg cgggtccttg gggacacacg caaaacaacg
      241 gccagacaag acgcgggcgc aagggaggag tcgcgggccc cggggcacac tgcacaaccc
      301 gcgtcgagga cacacgcaga cacggcccgc caacacaccc cgacacaccc ctgacacacc
      361 ccgccgacac acccggcaca cgcccgcgac acacccggcc aacacacccc gacacacccg
      421 gcacacgccc gcgacacacc cggccaacac accccgacac acccggcaca cgcccgcgac
      481 acacccgcgg cacaccctga cacacccgcc acacccggca cacacccacc ccgccgcgcc
      541 cccgacacac cccgaccgcc gccggtgcgg gacagggcta agcgccttta tggcgccgca
      601 agcgctccgc cgcttctgcg gcttgctgtc cacggcgctt tctgcgcgct gccggtgcgt
      661 gtggctccac agcacttgtc gttccgccag tccgacactg gacagggctg agggagtgtt
      721 gcgtgacata agtaagcgcg tcggcgtcct cagcgcgttt gcggcgtgct gtgtccggcg
      781 ctttgtgcgc actgccgttg cgtggcgtcc cgcggtgttt tttttcgcgg accagcgccg
      841 gggacggggt gttgcgggcg ctcgggggtt ggcggcgggt gtttctacgg tgtttgtgcg
      901 gcgtttctac gcagcttttg cgcagcgctt cgcttttcgg ggcggcgacg gcgttgtttt
      961 cgggcgtgct gggcgccggc gccggtaacg ggagttacgc tggggacagg gacgggggtt
     1021 gcgccgggga cggggggtgt gcggggacgg ggggtgtgcg gggacggggg gtgtgcgggg
     1081 acggggggtg tgcggggacg gggcgtcgcg ggatggcggg ctgttgcgtg ccggggacgg
     1141 gggactcttg cggcggggac ggtggtgagg acggggacag gggcatttcg cggcggggac
     1201 ggggagttgc gggatggcga gctgttgcgt ggcggggacg ggggactctt gcggcgggga
     1261 cggggacggg ggcctttcgc ggcggacacg gggaacacag acggcacgca cacgcagctc
     1321 gcctatttaa cctccaccca ctacaacaca cacatgccgc acaatcatgc cagccacaga
     1381 cacaaacagc acccacacca cgccgcttca cccagaggac caacacacgt tacccttaca
     1441 ccacagcacc acacaacctc atgtccaaac ttcggacaaa cacgccgaca aacaacaccg
     1501 cacgcagatg gagctcgacg ccgcggacta cgctgcttgc gcacaggccc gccaacacct
     1561 ctacggtcaa acacaacccc aactacacgc ataccccaac gccaacccac aggaaagcgc
     1621 tcattttcgc acagagaatc aacatcaact cacaaatcta cttcacaaca taggcgaggg
     1681 cgcagcgctc ggctaccccg tcccccgcgc ggaaatccgc cgcggcggtg gcgactgggc
     1741 cgacagcgca agcgacttcg acgccgactg ctggtgcatg tggggacgct tcggaaccat
     1801 gggccgccaa cctgtcgtca ccttactgtt ggcgcgccaa cgcgacggcc tcgctgactg
     1861 gaacgtcgta cgctgccgcg gaacaggctt tcgcgcacac gattccgagg acggcgtctc
     1921 tgtctggcgt cagcacctgg tttttttact cggaggccac ggccgccgtg tacagttaga
     1981 acgaccatcc gcgggagaag cccaagctcg aggcctattg ccacgcatcc ggatcacccc
     2041 catctccaca tctccacgcc caaaaccacc ccagcccacc acatccaccg catcgcaccc
     2101 acatgctacg gctcggccag atcacacgct ctttcctgtc ccttctacac cctcagccac
     2161 ggttcacaat ccccgaaact acgccgtcca acttcacgcc gaaacgaccc gcacatggcg
     2221 ctgggcacga cgcggtgaac gtggcgcgtg gatgccggcc gagacattta cgtgtcccaa
     2281 ggataaacgt ccctggtaga cggggtaggg agatctacca gcccagggat cgcgtctttc
     2341 gccgccacgc tgcttcaccg atatccaata aacccatccc ctcgccacga cgtctccgcg
     2401 tatctttgta gcctcaggaa tccgtcccca cgtccaccca tcccgagcac tccacacgct
     2461 ataacagacc acgaacacgg caaaaaatgc atgcaaactt ctcatttatt gtgtctacta
     2521 ctctgtgttg ctacagggag tgaagggggt gaaggcaaag aaaaaaaaaa ggaacaaaat
     2581 aatagattag cagaaggaat aatccgtgcg accgagcttg tgcttctttt cttataagga
     2641 ggcaaatata ctagggaaaa cataagaata ggaagaaacc gaggtttggg agaaaagctg
     2701 agataaaata gcgcattttc catacagagg ttgttgtttt tgtggatcct aagaggtttc
     2761 aagtgcgaat ctcaaagttc tcacgagaat attgtcttca agaatcgaca actgtggtcc
     2821 aagatttttt tttggtcttt ttaggttctg cgagggacat cacgatggat cgttgcgatg
     2881 aagtcacgcg tacgcctctg gtgtggcgcg gtgtcgtgac aggagagtgt gttttcagtg
     2941 cagagctgtc ttgattccta tatccgagta tctgttttct cgtaaggacg gtaatcttct
     3001 ttggtgtaag tacatctaaa agctgcaaac tatattttaa gggctgtctc taggtgtact
     3061 ttgatgctgg agtttttcgc tgtgttgatg tgaataaatc tactactact attatatgca
     3121 gaaagagtga ttatgccgag acaagattgc attggctgaa ctgtttcaaa aacgcctaca
     3181 ctctacttat ccgtaaacct aaggtaatac tatgtgtaag ttgttttttt ttctttttgt
     3241 agtaaaatgg tgatacgtgc aattaaaact gtattccatg tttccatcct ttcatttcaa
     3301 ctttaaaggc ggctttgaga gcgaagaagt gcgaggataa aaatggatga ctccttcgtg
     3361 tccagggagt cgactactgc aacgctgatt gattaaaaga tggtctccga tgatgatgtt
     3421 gttattgatc gaatcatggt gcagaacggc gacggagagg agcgtgtccg ccgccgggaa
     3481 ggtggtctct ttctcttttc ttttttcaag aaatcttcca tgtgtttatc gtagtgatcg
     3541 aaatcgactg atctcgggtt ctttttgttg gtttcttttc ggttaatcat gtattgtttt
     3601 ctttttttac agaaagatac ttttttcatg agcaattcct cgcccggcgc cggcatgccg
     3661 aggtggggcc actgcgatca gcggcatgcc gacgccgacc cggggatctt ggattcaccg
     3721 ttttctctct tctctctcta catacagacc gggtggcagg agcggtaagg aatcatcgtc
     3781 gtctttcatt cttcgatgat tatggtaata ctaaatctta tctaggagca tatacatcta
     3841 agattggagt actagtagtc gtttgtggtt tctatttttt ttttatattt atctatgaca
     3901 gtttttctgt ttttcgtttt gataataata taataaaaac tcatggacgt gaaatctggc
     3961 ttggttgtgg tgatttcatt ctcattattg ttgttttctt tccgtcttgc ggatgaagat
     4021 gttgcgatgc ggttgttgtt ggtgttgcta tacaccgaga gagatgatct ttttgttctt
     4081 ctggttcatt tcctatgatt gtttggctgc tgaccgacgc gtcaggatgt gcagggcatg
     4141 cggggaatca ggaccggaca cgggataatt tcatctacct atacggagat cgcggtcctc
     4201 gccatgagga tcgcgacagg cgcgtcgagg gggcaggaac acccttgcgg attgacattc
     4261 ttggtggtat ttcgttgttg tcggtagttg ttgttgacga tgaggataaa taaaaatgac
     4321 cttgtttttg ttctgttttc tcttgttggg aatcgtcgac tttgaattct tcgagttatc
     4381 ggaaagctga ggtacccaaa tgtctgtagc ttttttcttt ttaccctctt gtttatcatc
     4441 tgcgattcgt ggtaggtagg agagggaaat gataatccga gattaaggaa aggagaagat
     4501 aaaaaataaa aaaaaaaata aaacagaagc cgaccggccg ccgacccgtt ccccaggacc
     4561 agcctacgag gaacggataa cgcggtggcg acggcagcgg tggtggcgct gggggtggcg
     4621 gtagtggtac tgctgatggt agtcgggacg gaggagagac gatgcataca tacacgcgtg
     4681 catgctgcat gggtggatgg tccgaccggg agacgcggaa gagaaactca cataaaaagg
     4741 tgacaaaaag agcggttgaa aaaagaaaac gagattcgac cagacagaag agaaggaccg
     4801 gggcttggcg acccttccac gactgctgtt gtcatctcgg ctcctccgtc ttctcccggc
     4861 cacgggcggc taagtcaccg ccgttctccc catccgtccg agcgccgacc gaccagccgg
     4921 ccgattcgcc cgccggggct tctggagaac gccggagcag cagcgatctg gggaagccgc
     4981 taaacccctg cgtttttata tggtagctct gccgagcgcg ggctgacgcg ttgagtaagc
     5041 ggaaagacgt gtgtgacgaa aaggggtccc atggtatttc acgtgacgat gaggagatgc
     5101 ggtttggagc acatacggtt taaaaaaagg gagttgtcgt gacaagggct gagggacctc
     5161 tgtctccatg tgtgtataaa aagcaaggca cgttcataat gtaaaaaaga acacgttgta
     5221 aacaagctat tgctgtatca ttcggctgac tatgcttcat tcggactgat tttcttttcc
     5281 taacggcgta acttaaagtg attaacgtat gatatttgtt ccccagagtt atactatagt
     5341 catcatccta aaattcagat ataaatgaac acacgtcgta tgggattatt aagaaaccga
     5401 aactctccac agttcaccat cttcttcgtc attcaaccga tgacccactc cgtacaacga
     5461 atcagtctgc tgcgtcatat tgcaaagcac aagcgacgta tgcgaacaac ttgaaacaca
     5521 ggctgttgta ttgatgaccg ttgtaccatt attagtcaca tcgtatagag actctccacc
     5581 gtcatcccat gtttcccacc cgatggaaaa ccgtcttcta tcatcaactg tggtaagatt
     5641 tcgaccctgc gaggtattca gtttcctcat atccataacc tggattttat cattaaaccc
     5701 caatattaaa tactttttta gtacccccca cccaccaaaa aatgtgactg gaccggttcc
     5761 tagcagctct gggagccatg ttcaggttga accacagcta cagcgaaacc gagtccagtg
     5821 accggtaacc acgtccagcc cctgcgtatg taccagtcca agcacgtccg gtcattgttc
     5881 tacacaggaa atctaactag gtcaacgcaa ttttattcca ccgttacgca gaatactaac
     5941 aaaaaaacac acaaatttaa cgaattacac gtagtttatt acatgaaaac tgtaagaaca
     6001 ccaattcact aagcgataca acatttagct gacttccaag tgccacacat caccactgta
     6061 ttcatccatg ttttcaccga accaacgaga cagatcgaag aagccagaat ctcccgactt
     6121 taaattacat aaatccaacg tattatgacc acagctcgac acacaaatag ttgcgttacc
     6181 attcacagta gcattaccta tacccgtaac gttgcacaac cactgatcac cattgttacc
     6241 aaaaacggtt ttccacttag ttgtcaacgg atctttccta tgcgtaatgg taaaattact
     6301 cccagtcgtc gcttttagct cattacgagt attatccgca tccacatata tcaacgtcat
     6361 agctaggcac gctataagta cccccccccc acaatggaat gttgccaaac cggttctttc
     6421 ccgttatagc catagcgttc ccaggcaaaa gcaaacgcca aacctaatgc agtgaaaagc
     6481 gcttgcagcc agaaccagct tatgtaccag ccacaatcac atccggttat tgtttccaca
     6541 ggaaatccta ccaggcaaag ccccgcttgt tgtgttcctg accatcttgt ttagcaattc
     6601 gtaaactgtc agcctagcga cgtccgttta gatcaaaagt cacgtatata gcgacgctgt
     6661 ttccacccgt ttccccgtcc cgccgtttcc gaacaaccca cccgggttca gacaaccgac
     6721 caccaacaga aatatacaca cagaccaccg ggagttcagt taaagatttc atcaggttta
     6781 ttttggctgc tgctagtctt ttgcttctta gaaaaaaaat acccatatag agaaataatg
     6841 atagtttgac aacacatatg gcagggattt cttcttcatc aataagatat gcaattcccc
     6901 cagggagaga ctttcaacaa ttgaatttac aaaaacaaaa ttacatcagg agaaagagag
     6961 gatacattaa taaatatatt atatctggtg tatatactga atgctgctgg ttcataaggt
     7021 aacgatgcta ctttttttaa ttccaagatg gtttttcttt gttagtcttt tgttgacttg
     7081 ctggttccta aaagttcgca aaaacgattg tgtgaagatt ttatgacgtt ggttgactag
     7141 ttcatgagat tctgctgtac gtgtgatggt tattcgctgg ttcgttctaa gatgagtatc
     7201 gtactgtgtc tgcgatggtc gtctcttact ggcattctct cggctgcctc ttgctttcat
     7261 gattgaaaag gaaaaaagga ctccgagggc gcggtcatct tttacttttc ggttttctcg
     7321 ttggcgggtc agaggtagtc agatcatgag actgtcgtgg tcgatgaaac tgtgtctgct
     7381 caagtgacgt ccatttcttg tacggagaaa aaagtcatcg ggataaataa ggctatacaa
     7441 ggcgttgtca agcgtgcggc tctaaacaaa ttaagcgata caaaattaca gtaatacgaa
     7501 taataaatta cccccctccc cctgtggtcc cccgagacga gagccaccca tcgtgtactc
     7561 tcgcaccacc cacgaccaca gagggagacg ggacgaagag acgacgcaca gcgccatctc
     7621 ctcctggagg ccggcgacgt taactgctac agctgcggcg gcgaagacag ctgcgatttg
     7681 tcggccgaca tgccgatggt atgggcggcg gcggcagtgg ccgcggcagc ggggaggaga
     7741 ggagagagaa gaggagcggg gcgtccgaag gcgaggatgg catggtctcg ccggagcgcc
     7801 cggcttttat ggaacactcg cgtccggttg ggtatcaccc acaggaagat gagtcacaac
     7861 ttccaaacca tcttgagacc cgagtaacgg tttacaggtc gcacgccagt ctcagctaaa
     7921 aacagcggac agtcccacgc tgtttctgtt gtggctctct ccagtttcct catcaccgtc
     7981 ccggtctccg tcgtcatcgg aagaatacca cccgctctca tgcggcagtc gatcggcctc
     8041 gacgaacgag acgcggcgac gcctctccac ggccgactgg ttgtggtggt gaaagaagag
     8101 caccagcaat cccaggagga gcaacaagcc ctcacatgtc caggaggtcg gggagagggc
     8161 ctgtcggaga tggccgtgag gcatcacgta cggcagctga ggagaaacgg agaagaaagg
     8221 aaaattaccg tcaggggccg gggttcttat tagagaaaca gcacgtaggt caggatccag
     8281 atgctaatgg cgatcatgat gacgatgatc atgcaggcca agacgcggcg caccaatgcc
     8341 gaatccaaga gccgccgtgc cgccggttgg tggctggcgg catctagaga catggtttgg
     8401 gggggaccgg cggcgcgaaa agacagggag atggacagtg acacggtgtt ttgttatgat
     8461 taggacatgg gaaccggaag ccgagacaga gtactacaga gtgttgaagg gtaacgtgag
     8521 ggagatcatg tcatgggcgg gctgaagacc gtgcgggaag gattgacgtg tgcggtgctt
     8581 gtggaacacg gtgttttaat atgtatccgc gtgtaatgca cgcggtgtgc tttttagcac
     8641 tcggtttgat aagctacgtg gccgtttgcg ccgaaaacac ggttaccacc aactgtctcg
     8701 tgaaagcaga aaatacccac ctgacatgta agtgcaatcc gaataccaca tctaatacca
     8761 acaatggcag caagtgccac gcgatgtgca aatgcagggt cacagaaccc attaccatgc
     8821 taggcgcata ctcggcctgg ggcgcgggct cgttcgtggc cacgctgata gtcctgctgg
     8881 tggtcttctt cgtaatttac gcgcgcgagg aggagaaaaa caacacgggc accgaggtag
     8941 atcaatgtct ggcctatcgg agcctgacac gcaaaaagct ggaacaacac gcggctaaaa
     9001 agcagaacat ctacgaacgg attccatacc ggccctccag acagaacgac aactccccgt
     9061 tgatcgaacc gacgggcaca gacgacgaag aggacgagga cgacgacgtc tgataaggaa
     9121 ggcgagaacg tcttttgcac catgcagacc tacagcaccc ccctcacgct tatcatagtc
     9181 acgtcgctgt ttttgttcac aactcaggga agttcatcga acgccgtcga accaaccaaa
     9241 aaacccctaa agctcgccaa ctaccgcgcc acctgcgagg accgtacacg tactctggtt
     9301 accaggctta acactagcca tcacagcgta gtctggcaac gttatgatat ctacagcaga
     9361 tacatgcgtc gtatgccgcc actttgcatc attacagacg cctataaaga aaccacgcat
     9421 cagggtggcg caactttcac gtgcacgcgc caaaatctca cgctgtacaa tcttacggtt
     9481 aaagatacgg gagtctacct cctgcaggat cagtataccg gcgatgtcga ggctttctac
     9541 ctcatcatcc acccacgcag cttctgccga gctttggaaa cgcgtcgatg cttttatccg
     9601 ggaccaggga gagttgtggt tacggattcc caagaggcag accgagcaat tatctcggat
     9661 ttaaaacgcc agtggtccgg cctctcactc cattgcgcct gggtttcggg actgatgatc
     9721 tttgttggtg cactggtcat ctgctttctg cggtcgcaac gaatcgggga acaggacgct
     9781 gaacagctgc ggacggacct ggatacggaa cctctgttgt tgacggtgga cggagatttg
     9841 gaataaaaga tgcgtgttga ccgtcaaaaa cgcaacaact tcacgtatcg acaaacggta
     9901 tatataatcc tgaccttcta cattgtatat aggggcaaat gtaacagcac tgataccaat
     9961 aattctacgt ctacttcaga tagcaccgtc tctgatacta gtgtgtactc tactccaaat
    10021 cttcccagta cattttttac aactcttgat acatctactg gctcacagat atcaaccacc
    10081 tcaaacacca tatccagcac tacaaataca ttggccgcat cttctataac tacgttaaac
    10141 acctcgacta acactacgtc ttatacagct tcaactctta ctgctctctc cagtacccac
    10201 acaaattccc caatactctc caacaacgca acattataca ccacatcgtt ggataatacg
    10261 actacagaca taacgtccag cgaaagttcg attaacgcgt caaccattca taacactacg
    10321 tacagtcctg taacatcgat tgctgttaat tgtactgtcg cagctaatga aacaaacaat
    10381 tcaagttcaa aaaattgcca acaagatatt ggaacaatac gtgttaaatc aactacatta
    10441 acggcagaag aaggaaaaaa cattacgata cagggcaatt caacatggaa ctgccccaat
    10501 gtagtttggt accgacatta caattggtct acacatggac accacattta tcccaataga
    10561 cgttaccaaa cgccaacgta tcaacacaag atcttaacat cacatcccat atgtcatcct
    10621 gacgtctcat cacctgcggc gtaccacgat ctatgccgtt cgtgtaataa gacagaacta
    10681 cgtatatacg atttaaacac tacaaattca ggcagatata gtcgacggtg ttacaaagag
    10741 tacaaccacg atggaccaca cgaggatgaa aatttcggac taactgtaaa tcccagaaac
    10801 gacactgaca atcataccac cccactatgt cccagatacg taggaacaca atcagaagaa
    10861 gacgaagacg acgattatac actaagcact atcacaaata ataacatgcg caaaacaagt
    10921 caccgtgaca tctcacatgg cacgcgcact acatgggctc ttacactaat ctgcatagcc
    10981 tgcatacttc tgttttttgt tcgacgagcc ctcaataaaa gataccgtcc attacgggac
    11041 gatattagtg aatctagctt tgttgtacga tatcatcctg aacatgaaga ctgacgtttc
    11101 cggacacgca acacatgaaa ttaagtaaca tatctaccat gaaatacagc aaagatatac
    11161 taatgtctat ccatccaata gcggtaccat gcactggcat cttgcgatta catggacggt
    11221 aatcatatta acgttttcgg aatgttacaa ccaaacttgt ccgtgcccct gcatttgtgt
    11281 caattctaca acagttagca tatccaccag tgaaacaacg tctaaaaaca tcactccaac
    11341 taccacgaca aattccaaaa aaacaacgtc aagtattgct accactacac cctcgttagt
    11401 aacgactggc aaagtcgttt ctactgcagc gtcgtcaacc ataatatctc aaaccaaccg
    11461 cagtcatacg agtaatgcta tcacaacccc gaaaacgcga tttgaatata atatcacggg
    11521 atatgttggc caagaagtga ctctaaactt cactggatca tggaattaca ttcaatggtt
    11581 ccggtacggt tctccaggct ggctttattc ctcggaacca atatgcaccg ttaccagcaa
    11641 ttatcatcat actttccctc gtggtgctct ttgctttgat tgtgacatga caaaacttct
    11701 aatttacgat ctgacgttaa acgattctgg aaagtacgtt gtcaagagaa cgcgccatga
    11761 caatcaatac gaagaagcat gctacagcct cacggtgatt tttgccaaca cgacatccat
    11821 agtcaccaac agaacgtgtg atagaaaacg aacagaaaat acagacacta ctaaccatga
    11881 aatcgggaaa catattattg aaactattaa gaaagccaac attcctctgg gaattcacgc
    11941 tgtatgggcg ggtatagtag tatcggtggc actcatagcg ctatatatgg gcaaccgtcg
    12001 cagacccagg aaaccgcgtt ataccagact tcctaaatac gatccagatg agtcttggac
    12061 taaaacctaa tatgcacatc aataaaattt tttatcttta gtcattaatg tttgggtgtg
    12121 tttattctga gttaatcact tataagtcgg gatatccata gacatttaaa aacatgggtg
    12181 tacaatgtaa cagtaaactg ctgctactag ccgtactaat aacaattatc ctatctagca
    12241 ttctggtaca ggcaattcca cataaacaaa aaacatccta ccagcagctc ttgctgcaaa
    12301 gtgaacatgt acaaataccc atcacagtag ccgaaggaga tacaatttgc tttaacgtta
    12361 gtgataaccc ctgcaacttt tctagttact ggaatcacaa taactgcgaa ctttgcggtt
    12421 ggacaccatt ttactcggaa tatgctggat attccgaaaa caagtcgtgt cacccacgat
    12481 ttacctgtct tcacgatact aaaggtctga aactacacaa cgtaactaca aatgattcag
    12541 gaatttatac ccgaaacgtt tattactgtg acattccatg caacatcagc gatgatcata
    12601 aacataacgt agaggacttt gacaactgta acaccactat aaatagaact cactatatta
    12661 ttactgtctc gtcttcacgt tattctaaac gcaccaattc ccacgtagcc actcacgttg
    12721 gttggacagc caccgtggtg ataattatct gcgttttaac ttacgttaac gttacaacaa
    12781 ccctgaagca cagactacga actagaaaca acgtcaacca cacaatgtga tcacaaagta
    12841 ccaacgctaa tttatttagg gtacatttgt actactttgt gtagttctca aaaactgtaa
    12901 ggtcccgctt ttccactccg tcatgaagga tcgcaataaa atacttctat gtatcatctt
    12961 tatttgcatc atgtgcctca tttgtattta ctttaaacgt cattgtattc ctactccgtc
    13021 tccggacaag gcggatttcc gagtagaatt tccttcgtta ctcccgtgta tcggcgtaca
    13081 gtgcgctgca tagaaagacg cgtgacacat accgtacccc tggacggtac agtctatgat
    13141 aacgtaattc aaataaagta caggttccta gtgacatgtt atcataaaac atagattttt
    13201 ctacgtgttt ttacaaaaga gcgtctcgaa gcagcttgag ccacactgcg gtccaaatga
    13261 caagcatgat caaaaatatg ctgcgtagca gtcgaaagcc gtactgagcg tgcgaggcgg
    13321 gtaggctgcc gaacgacgga tatgcgtcgt catcttcgac tataaggatc gtgaccgagt
    13381 cttcggccat gctaaacgct accctgtgtg gctggtatgt agtgtatccg gtttggaatt
    13441 gttctgttcc ggctcggggg atagtgagga attctcaagg gacaatacgg gacccaatga
    13501 ctggatatga gaagggtttt tccccgtaag atgatcctgg tatcacatga ggtctggata
    13561 tgtataaatg aggagtgaaa taggtaaagg gaatcagatg ccgccttcgt gatgcagccg
    13621 ctggttctct cggcgaagaa actgtcgtct ctactgattt gcaaatacat cccgccttaa
    13681 gcgataagtc cataaaacgc cgttgtccgg atacggtgaa ggtgacccgg attatagcac
    13741 gttccttttt ttttgttttt gcatcactta tcgccactat cagtgcaata ttttgattgt
    13801 gagactgaaa gagtatcgtt atgatgctta gaacgtggat atcattaccg atggtactgc
    13861 ttgacgcgta ctgtttttgt atttttgtga gttgttcaat cagcacgacg actgctcccg
    13921 tggaatggaa gtctcccgac cgtcagattc ctatgaatat tacttgcgct aattactcag
    13981 ggaccgtcaa cggcaacgtt acatttcgag gtcttcagaa caaaacggaa gattttttgc
    14041 actggctgtt agggtggggt cataagtcca tttgttcatt ttttccgaaa ctccaaggca
    14101 ataaagaaca acattatatg tatggaataa cgaatctcac gtataactgt acctatgacc
    14161 gcctgacgtt gctgaatttg acgacggaaa acagcggaaa gtattatttc aaacgagaag
    14221 atgtgaattc caccttttat tactcttgtt acaacctgac cgtgacctaa acgcatgtaa
    14281 agttccacag agccgcgtgg ctgtagctat tgtgtttacg ttgcttttga aatgttaagc
    14341 gtccctacgg cgctaacatg tttctaggct actctgactg tgtagatccc ggccttgctg
    14401 tgtatcgtgt atctagatca cgtttaaagc tcatgttgtc ttttgtgtgg ttggtcggtt
    14461 tgcgtttcca tgattgtgcc gcgttcgagt cctgctgtta cgacatcacc gaggcggaga
    14521 gtaacaaggc tatatcaagg gacgaagcag cattcacctc cagcgtgagc acccgtacac
    14581 cgtccctggc gatcgcgcct cctcctgacc gatcgatgct gttgtcgcga gaggaagaac
    14641 tcgttccgtg gagtcgtctc atcatcacta agcagttcta cggaggcctg attttccaca
    14701 ccacctgggt caccggcttc gtcctgttag gactcttgac gcttttcgcc agcctgtttc
    14761 gcgtaccgca atccatctgt cgtttctgca tagaccgtct ccgggacatc gcccgtcctc
    14821 tgaaataccg ctatcaacgt cttgtcgcta ccgtgtagct agttagccag ctgtgtgtag
    14881 ttgtattttg cttttgcata tttgttttca gtcagagagt ctgaaacggg gtgggaggga
    14941 cttttgcggg tagtgcatgc taagatgaac ggatgggctg gggtgtgctt gataactcac
    15001 tgtttgaata cgcgctcacg cacatatgta gcactcaaca tgttagcttt tgcccgcacg
    15061 ccccggggcg tgccgagctg cctttttaat aaagtctggg tttccagata cgcgctggtt
    15121 ctgattttga tggtttgtgc ctctgaaagc tctacgagct gggccgtgac atccaatgga
    15181 ctgcctaact gtagcacggt aactagaaca gcgggtcaag acgctgaatt gcacggtccg
    15241 gcaccgttaa gctgtaatgt gacccagtgg ggacgttacg agaatggaag cacacccgta
    15301 ttatggtgca ctttacgggg atcacgcatg cgagtctcat taggacaccg tgtagcgttt
    15361 ggctgttctt ggaaaacatt ttttatttat aacgtttctg aaagtagcgg tggcacttac
    15421 tatcaaaaag gttacaactg caccgacaaa catataacac tatcttgttt caacctaacg
    15481 gtggttcctc gagcggttca aagcacaacc accgtaatga cacccacgct ggttacaaac
    15541 tccacattca gtgtgtcact tgttgcgttg agactgacga caaattccag cgcgtttgga
    15601 cacgctattt atcaacgaca acagcgtgtt gaaaacggga cgttatccaa gaacataact
    15661 aacttggcat tcacctatgg cagctggggc gttgcgatgc tgctgtttgc cgccgtgatg
    15721 gtgctcgttg atttgggttt gcctcaatcg gcttggcgac gctggcgaag ccacgtggac
    15781 gatgaagaac gtggtttgtt aatgtaggaa ataaaaggca gtttgagcat gactgtttcc
    15841 aaaccgtaac gtggtaaata aatcatggct tctgacgtgg gttctcatcc tctgacggtt
    15901 acacgattcc gctgcagagt gcattatgtg tacaataaac tgttgatttt aactttgttt
    15961 gcccccgtga ttctggaatc cgtcatctac gtgtccgggc cacagggagg gaacgttacc
    16021 ctggtatcca acttcacttc aaacatcagc gcacggtggt ttcgctggga cggcaacgat
    16081 agccatctca tttgctttta caaacgtgga gagggtcttt ctacgcccta tgtgggttta
    16141 agcctaagtt gtgcggctaa ccaaatcacc atcttcaacc tcacgttgaa cgactccggt
    16201 cgttacggag cagaaggttt tacgagaagc ggcgaaaatg aaacgttcct gtggtataat
    16261 ttgaccgtga aacctaaacc tttggaaact actccagcta gtaacgtaac aaccatcgtc
    16321 acgacgacat cgacggtgac cgatgcgaaa agtaacgtta cagggaacgt cagtttagca
    16381 ccacaactac gtgccgtcgc tggattctcc catcagacgc ctttggaaaa caacacgcac
    16441 ctggccttgg taggtgttgt tgtgttttta gttctgatag ttgtttgtat tatggggtgg
    16501 tggaagttgt tgtgtagtaa atcagagtta tagtaatgtc ctttttatca gggagaaggt
    16561 tttgttccca caatgactag ctcgagacta tctgcgtcgg aaaattatga cggaaattat
    16621 gaattcacgg aaactgccaa tacaacgcgt acaaatacca gtgactggat aacgttagga
    16681 agcagtgcat cgctgttgaa aagcacggag actgcagtca acctcagcaa cgcgactacg
    16741 gtcatcccac aacctgtaga atacccggct gggggagtac aatatcaaag agcggcaacg
    16801 cattattctt ggatgctaat cattgtcatc attctcatca tttttattat catctgtcta
    16861 cgagcacctc gaaaaatcta ccatcactgg aaagacagta aacagtacgg acaagtgttt
    16921 atgacagaca cggaactgtg acagtgatgt ctaagcgttt gcaggtattt ccatggataa
    16981 caattttatt ttacacatca aaatcccagt attggaacta tatgacaata ccatgtaccc
    17041 ctacagttgg atacggcagt cataatatta gcttgcatcc gcttaataac tcattatttc
    17101 aagacgatgt ttttgaatgg tacatagaca aaccaatggt tactaacaag ttatgtcttt
    17161 atcaaagtaa tgaacgcata aaatccaatc tagactctcc aaatattatg tggcagtgca
    17221 cagataatcg tacactaatt ctcatgaact taaccacaac atacagtaga aactattatt
    17281 ttcaatcttt taaatatctc ggacaaggag taccaaaacc gaataacttg tgttataacg
    17341 ttagtgtaca ctttacccac caaacacatt gccatacaac tacatcatcc ctgtatccac
    17401 ctacatctgt acacgattca ttagaaatat cacagtcatt cacctcaacc aacttcacac
    17461 ataccgcggt ccactacgcc gccggtaacg ttgaagcaca acacgacact gccacttcac
    17521 atacaatgtg gatcataccc ctagttatcg ttataacaat catcgtttta atttgtttca
    17581 agttccccca aaaagcttgg aataaattca cacaataccg atacagcggt atgctcgccg
    17641 ccgcttaaag aatcaacgcc aaggaaatca aaacgtaaaa agaatagata tgtacgttta
    17701 tttttcagct cactgtttga ataccgtaaa cataatgacg tacatatacg tggttataca
    17761 acaggtgttt gtgttatgcg gcaactgatt aaccatatcg tgaaccatga tcttttccga
    17821 tggtccgtcg tgaccgcaat gatattttac agatattccg aaacctgtat ggaggtcact
    17881 gtcagagtag gtgatccagt taccctcggt agtggacatg gttatcatcc aggacaaaaa
    17941 gtacactggt ataaccagtc atgcgtcggc atcggcaacg gcgaaaatac gcatcctatc
    18001 tgcacctacg accctcctaa acctggtaga caaaagacaa tgaaaactac tccgttgcca
    18061 tcaccattgt tgtacgagtg tcacaattcc acattaagca ttcttcatgt aaacgtctca
    18121 gatcccagaa actattgcag gcgaaaatgt ccaccaaagg gtaactgtga gtttcccaca
    18181 tgttttacat tatcgctgat ttctagaact acgaccagaa aacccgaaca aaaaactacg
    18241 ttgttgcgat taaaaaccac gccaaataaa catacgcagc acaaaagatc cacgcggaga
    18301 acgtcaccta aagattacaa tgtaacgggt cttccaaaag gctttgcgga ctcgtttacc
    18361 ggtaacgtag aggcacatcg aaccaaagat gccgcacaca gcgcatggat tctcattatc
    18421 atcatcatta tcatagtcgt cattctattc ttcttcaaga ttcctcaaag actccgagag
    18481 aaatgggaca ccaagggata cctttacaaa ggaaccgatg gcctgcccac tacggactaa
    18541 ttatcgtgag cggacggata tgttcggttt caaactcact gtttgaatat agggacagtc
    18601 cctacggaac ctgagaacat gtggaaatca cctgtggtag aatgctgttc aggtacatta
    18661 cctttcatcg cgaaaaggta ctttacctaa cggctgcatg catctttggt gtctacatca
    18721 gcctccacga tgcctgcata ccggtggtcg gcaaaatagg taccaacgtt acgttaaacg
    18781 cggtagatgt tcttccccct cgcgatcaag ttcgttggtc atacggtcca ggtgggcaag
    18841 gctacatgtt atgcattttc actggcacat caacaacaac atttaacaat acgcgcttta
    18901 atttttcatg tctaagcaat tacagccttc tcctcattaa cgttaccacg cagtatagca
    18961 ccacctatcg tactatgaca tcactagacc attggcttca ccaacgacat aaccatggtt
    19021 ctcgatggac tttagacaca tgttacaatc tgacagtgaa cgaaaacggt acattcccca
    19081 ctaccaccac caaaaagccc actacgacta cgagaacgac aactaccaca acacaaagaa
    19141 caaccaccac gagaacaacc accaccgcca agaagacgac gataagcact acccatcata
    19201 aacaccccag tcccaaaaaa tccaccaccc ctaacagtca cgtagaacat cacgttggtt
    19261 ttgaagccac agcagcggaa acaccgttac aaccaagccc acagcaccaa cacttggcta
    19321 cacacgccct ctgggtttta gcggtcgtaa tcgttattat catcattatc attttctact
    19381 ttcgaatacc gcaaaagctg tggctgctct ggcagcatga caagcacggc atcgtgctca
    19441 tcccccaaac cgatctgtaa gcaagtcgcg taggaaatga ttgcatgaaa tcactgtgaa
    19501 acgccaactc cgtgccagct ggcgcggcgg acaggccttt gacgtatttg aagccaggcg
    19561 cgctctcgat accgaaagga tccaaggggg ctttccaaag ccgacgtccc tgattccctt
    19621 cataaagctg ttgaccggcc ctagaaagac caagagcatg ctgtgggccc actgcggtcg
    19681 cttcttgcgt tatcatctgc tcccgctgct actgtgtaga ctgccattct tactcttttt
    19741 tcagcggccg cagtgggccc acggcttgga cattgtcgag gaggacgagt ggctacggga
    19801 gatacaagga gcgacgtacc agctgtccat agtacgccaa gctatgcagc acgccggatt
    19861 ccaagtcaga gcggcgtcgg ttatgacacg gcgaaacgcc gttgacctgg accgaccgcc
    19921 gctttggtct ggatcgctcc cgcatttgcc cgtctacgat gtgcgttccc cgcggccgtt
    19981 gagaccgccg tcatcacagc atcacgccgt atcacccgaa ctgccgtcgc gaaacgggat
    20041 acgttggcag taccaagagc tgcagtatct ggtggaagaa caacggcggc gaaatcagtc
    20101 gcgtaatgcg attccgagac cctcgttccc ccctccggat ccaccatcgc agccggcaga
    20161 ggatgcacga gacgcggacg cagaacgtgc cgaatcacca cacactgcag aaagcaccgt
    20221 cagccacgac gcgagtgaca acgcagtgcg gcgacggcac gaaagacggc gctataacgc
    20281 tctgacggtc cgcagcaggg actcgctgct cctaacgcga atacgcttct ccaaccaacg
    20341 gtgtttcgga cgcgggcgtc tgagacatcc cgcgggaagc ggtcccaaca ccggcggacc
    20401 gcgacccggc ggtgcgggac tccgtcaact acgccaacaa ctgacggtcc gctggcagct
    20461 gttccgccta cggtgccacg gttggacaca gcaagtctct agccagatca gaacccgctg
    20521 ggaggaaagc aacgtcgtga gccagacggc cacgcgagta cgtacgtggt ttgtgcaaag
    20581 aaccacgttg tggcgtcgca cgtgggttcc gggacagaac ccggcggccg aagcgcaaga
    20641 actggcgatc ataccgccgg cacccacggt gctccggcag aacgaggaac cacgtcaaca
    20701 gcttacggga gaggagacaa gaaattcaac gcacactcaa cgtgaagaag tggaggacgt
    20761 ttcgagagag ggcgcgagag aagggaatga tgggagccga gcaagtggaa acgacgagag
    20821 aaggaataat gcgggaagat atgatgatga tcatgaggtt caagagccgc aggtcactta
    20881 tccagcggga caaggagaac tgaataggag gtcacaggag gagaacgagg aaggtggacc
    20941 gtgtgaatcg ccgccaatga cgacaaatac gctgaccgtg gcctgtccgc cccgcgaacc
    21001 cccgcatcgt gccctgtttc gtctatgctt aggactgtgg gtctcgagct acctggttcg
    21061 acggcccatg acgatttaga atacaccgag ccattccttt atttcccccc atccccggtc
    21121 gcttatgcgt gtcaaacact accaataaag ataatctgcc aatcgcacct tatatataat
    21181 atgtggtcgc gtgtggtctt tttaaggagc tctgaaacac agacaggtat ggggggtggc
    21241 cggctgccgc cgctgtggct gccgctgctg atcgcctgga gcgagtgggg caactgctgt
    21301 ctcgatgcgc ctccggtggt gcgttcgccc tgtctgcagc cggtgcgcga ccgcaaccgc
    21361 gagcggaacc cgggctcacc gcagttgctg ccttacggcg accgtctgga ggtggcctgc
    21421 atcttccccg cgcacgactg gccagaggtc tctatccgag tccacctctg ctactggccc
    21481 gagatcgtgc gttcgctggt ggtggacgca cgcagcggtc aggtgttaca caacgacgcc
    21541 agctgttaca tcgccggcgg gcgctggcgt ttcgaggacg gcggcgcggc gcagcggctg
    21601 agcctctcgt ttcgtctcat caccgagacc gcgggcacct acacctgcgt gctgggcaac
    21661 gagacccaca gcctggcgac cgagaccacg gcgctggtgg ccgacgtgca cgacctgcgc
    21721 cactcggacc gctcctgcga cctggctttc ggatcgcgct cacagacgcg gtacctgtgg
    21781 acgcccgatc cctccaggtt gcgcagtata aactgcggtt gggagggtga acggcaccgc
    21841 gtagtccact acatccccgg cacctcgggt ctgctgccct cgtgcgagga ggacgagcgc
    21901 gaactgtgcg tgcccttcat cagccagagc atcgcggaca acaactgcag ccgccggcat
    21961 cgggtagacg gcgctaggcg gcgctatcat ctgcggaggg attactggct gacggatccg
    22021 aagatcgggc tgctggccgc gggatcggtg gccctgacct ccctctgcca cctgctgtgc
    22081 tactggtgtt ccgaatcgta ccggcgtctg aacaccgaag aggaaaacga ggcggcggag
    22141 gaaactgccg cgggagaagc ctctgcggta gcggcggcgg ccgtctctga ggaagagcag
    22201 cagcgggagt aaacgaggag agccatgaag cggatgattc gcagtcacgg caggaaaacg
    22261 gagtgtcaga tgacgggcgc cggcgagcga cgcggctccg ccgtcggtgc gctcatctgc
    22321 ggcagcggta cccgacgcgg cagcggcgcc aacgaacgcc gcgactccga cgtcggtccc
    22381 atcgcccaca gtagcggtac cagacgcggt tcggcgaatg aaacgtccgc ctgtacgcgg
    22441 accgatcacc agaaggcgga cattgggctg tggttcatgt ttctggtttt tggactgtgt
    22501 tcgtggttgg cgatgcggta tcgcgcacaa taaattttga atcgatgtca aggaacgcgt
    22561 gttttgtatt ttattgggaa tattggcggg gacaaaccgg tttcggatgt ttacccttaa
    22621 tcttaccggg gacctcgttg tcctctcctc cttcttcctc ggacacgggg cttcatgctg
    22681 acgtaggtac cgactggggt caaaagcctg ggtacttatg gggagcgcgc acaaaggacc
    22741 gtcaggcgcc ggcatggagc gtcgccgagg tacggtaccg ctgggatggg tgttttttgt
    22801 tctttgctta tctgcctctt ccccgtgtgc tgttgatctg ggtagcaagt cctccaactc
    22861 gacctgccgc ttgaatgtga ctgagttggc ctcgatccat cctggggaaa cgtggacgtt
    22921 acacgggatg tgtatttcta tctgctacta cgagaatgtg accgaggacg agataatcgg
    22981 cgtggctttt acttggcagc ataacgagtc tgtggttgac ctgtggttgt accagaacga
    23041 cacggtgatc cgcaatttca gcgacatcac cactaacatc ttgcaagacg gactgaaaat
    23101 gcgaaccgtc cctgtgacta aactgtacac cagccgcatg gtcactaatc ttaccgtggg
    23161 ccgctatgac tgtttacgct gcgagaacgg tacgatgaaa ataatcgagc gcctctacgt
    23221 ccgattgggc tcgctatatc cgagaccgcc cggatccggg ctcgccaaac acccctccgt
    23281 aagcgccgac gaggaactgt ccgcgacctt ggcgagagac atcgtgttgg tctcagccat
    23341 cactctgttc ttcttcttgt tggccctacg gatcccccag cgactgtgtc agcggctgcg
    23401 cattcgcctg ccgcatcgat accagcggtt acgcaccgag gactgaacgg ataaccgcaa
    23461 aggccacgtg caacgttcac gctgctataa gaaggccatg tcccccgtgg acgggtctct
    23521 ttgacacgag cgcggcacgc cgttgccacg agcatggatc acgcgctctt cacacacttc
    23581 gtcggccgac cccgtcactg tcggttggaa atgttgattc tggacgaaca ggtgtctaag
    23641 agatcctggg acaccacggt ttaccacagg cgccgcaaac atctacctcg acgtcgcgct
    23701 ccgtgcggcc cccagaggcc cgccgagatt cccaaaagaa gaaaaaaggc ggccgtcctt
    23761 ctattttggc acgatttgtg ctggctgttt cgacgacttt tctttcctcg ggaggactca
    23821 gagccactga tgtcggatcc ggcacggtct cccgaagagg aggagtaaac aacacacggc
    23881 taagaggata catcatcaaa gaagatagga ggggtcaaaa cgcggactga aagtatataa
    23941 cgccgatcat gttcgaggaa ctgttaataa aacgccatga tgacaatgtg gtgtctgacg
    24001 ttgtttgtgc tgtggatgtt gagagtggtg ggaatgcacg tgttgcgtta cgggtacacg
    24061 gggattttcg atgatacatc gcatatgacg ttgaccgttg tggggatttt tgacgggcaa
    24121 cactttttta cctatcacgt taattccagc gataaagcgt caagtcgggc caacggtacc
    24181 atttcttgga tggctaacgt ctcggcggcc taccccacct acctggacgg ggaaagagcc
    24241 aaaggtgacc ttatttttaa ccaaaccgag caaaacctgt tagagctgga aattgcgttg
    24301 ggttaccggt cacagagcgt gctgacgtgg acgcacgagt gtaataccac ggaaaacggt
    24361 agttttgtag ccggttacga gggatttggg tgggacgggg aaactttaat ggagctcaag
    24421 gataacctga cactatggac gggccccaat tacgaaatta gttggttgaa gcaaaacaaa
    24481 acgtacatcg acggtaaaat taaaaacatc agcgaggggg atactacaat acaaaggaac
    24541 tatctcaagg gtaattgcac tcaatggtcc gtcatttata gcgggtttca aacccccgtc
    24601 acccacccag tggtaaaggg cggtgtccga aaccagaatg acaacagagc tgaagcattc
    24661 tgtacatctt acgggttctt tccaggggaa attaatatta cttttatcca ttacggtaat
    24721 aaggcgcccg atgatagcga gcctcaatgc aatccgctac ttcccacctt cgatgggact
    24781 ttccatcagg gatgttacgt agccatcttt tgcaatcaaa actacacctg ccgcgttaca
    24841 cacggtaatt ggacggtgga aatccccatc agcgttacct cacctgacga cagttcctcg
    24901 ggggaggtcc ctgatcaccc gacagctaac aaacgctata acaccatgac catcagcagt
    24961 gtcctcctag ccctgctttt atgcgctttg ctattcgcgt tcctgcacta ctttaccacc
    25021 ttgaaacaat acctacgtaa cctggccttt gcgtggcgct atcgcaaggt ccggtcgtca
    25081 tgaccagcaa cgccctgtat gagctgtttc gacgtcggtt accgcgtgcc cccgtcaaca
    25141 cggtcatgtt tctcacgcga cgcactcgtg atgggttctg cggtcggttg acgtccatcg
    25201 ccacgaattc ccactacact atgttcgtgt tagatcacgg atccgtgcgc atcgagcgac
    25261 cgagtcagtc agaagtggat tgcgccagtt taatggaaac gctgaagcgg attcggttac
    25321 gaaattcgtg ggtagcgtca gaagacgagc tagatgtgag tcgcagggac gcgtgacacg
    25381 aaacgcgttc aggattaacg taggttttcg aaataaccta cgtccgtgag tgacgcggtt
    25441 tcgtgttgaa acccgcgccc gcttctcacg gcggtttatg atgaaaccgg cgttgcggat
    25501 ccacgcgggt tcctcattca acctgcgaaa agaggaagtt gcggtaaaac cacgtcaata
    25561 aagacgtcaa tgacacctca atgttgcgtt ggaacggtct ttatatatac aaacgccgtt
    25621 atgatcagtg tccggcaaga tgctcgggat acgggctatg ctggtgatgc tggattacta
    25681 ctggatacag ttgataacga acaatggcac tcgaagcaac aataccgata ccatctttgt
    25741 atctctcctt accgggccca acggagttac tcgcacagcc atcggaggtc tgtattcaaa
    25801 ctacaccaac ttaactggag catttggctt cacttcaaca aatatgtcag caaccaactc
    25861 ttccgctgag gataattgga gcgtaaccaa cctgacggag agttgcatca accgcggtga
    25921 gtcctatgtg actaccatct ggcttctgga ctgcactaaa aacgatactt attggtacta
    25981 tggaaatgcc tacaatcata catgtgaagg tacaatttcg ggatatctcc tgggcatgtg
    26041 caagctatgg aaaagttggg tcaataatat tacttcttat aacactgtca gagtcgaatc
    26101 gctgggaaat gaaacacggt gcatgctgct ccctagacag tatactctca acgccacggt
    26161 ggaatggtac aacaaatctg aaggtgacgt accagaagaa ttcatggact atgttatcct
    26221 gacccccttg gctgtgctta catgcggact gcaggaagct tatatactcg acaaaggtcg
    26281 tagatacatg tatttgtttt ccgtgtcctg cgtgggaatc acaggtaccg tatctattat
    26341 actcgtctcc ctatcgctgc tcatcctcat ctgttactat cgctgtggcc ggcttctgat
    26401 atgcccacgc ggctttgaac tcttgccaga attcactgag gaagaggagg aaaaagaaaa
    26461 attgttaacg cataatgaca ttgaagtcca agtgcctatt cgcacgcggc gactactcgt
    26521 cccttggatc cgggagagca aaatgtgggt actaccaccc ccgttgcctc cacgacctcc
    26581 ccacttaata gaattcccgc cgtctcctcc gccatcgcct gggcccatgc acatggtggt
    26641 ctgcatgcca gcatgacgaa ctttggactc tgagccccaa gcggtacgaa ctacatattt
    26701 tccataaatc tacactgaac ttgagcacaa agatactgac aatagactgg atatacagac
    26761 ttttatatga tccctgtaca gatgtaaata aaatgctttt atttaaaact ggtcccaatg
    26821 ttcttcggga atcatggggt ggggacgggg gacgcggtag ggagcaaaac cgggtacatg
    26881 ggggggaaca tcgtccagca gtagcaccag cggattgggt aggggttgct gcggaggtcg
    26941 gtcgatgacg atgtcgatct ccatcggcag atccggcaac atctcttcat ctccctcacc
    27001 gaccagcact cggcgctgtt ctggatgtat atgattctgg aaaagcctcc gacgagctcg
    27061 cggcgcgtag aaagccaagc ggcgcaaggg ccggcgagcc cgaaagtcca tgcgcacaga
    27121 tggcatgagt ccttgagtga cggtggtgag ctggggaaca gggctacctc ccatcgcgac
    27181 ggtgacagtg gatccatgag agaggcgccg cacgctgcat ggctaaatac cgtgaatccc
    27241 ctgacgtcgt ctttcgtccc gaacgcgtca tgttgggggc gaggcgtaaa ccgtcgaggt
    27301 tgaaaaaccg cgtatctgcg acccgtccgg actacgttgt tttttagaag cggccacatg
    27361 acctcgagat gtcgtcaccc aaggtattta acggcacaca gccagacgcg ttcgtcagca
    27421 gcgacgccga caagacctca gcatggctcg gaggctatgg atcttgagct tactagccgt
    27481 gaccttgacg gtggctttgg cggcaccttc tcagaaatcg aagcgcaggt aaacggaatc
    27541 tggggaattc aacacaggta agaaatacaa aaaaataacg tgattgtgaa cgcggttatc
    27601 gtgttttgca gcgtgacggt ggaacaaccc agtaccagca ctaactccga tggtaatacc
    27661 acccccagca agaacgtaac tctcagtcag ggggggtcca ccaccgacgg agatgaagat
    27721 tactccgggg gagactatga cgttttgatt acggatacag atggaggtaa ccatcagcaa
    27781 ccacaagaga agaccgacga acacaaggga gaacacacca aagaaaatga aaagacccag
    27841 tagcagcagc agatcccaag ggttaaagac catgttgact attttgtttt ttattaaaaa
    27901 gctgtaaggt tttgctctaa aaacaccccg cctccggtct tttttctttt gtattcggca
    27961 cgcgaaacac ggtttcttcc catagcctgt ctaactagcc ttcccgtgag agtttatgaa
    28021 catgtatctc accagaatgc tagtttgtag aggctatgcg ggatgctgcg gcggcgcgac
    28081 cttccctctc cacccagccc cgtcaaaaca cacgcgactc gagcggttcg tatgaaaaat
    28141 aaaaaacagc tttttattta caggaacggg gaaaaaaaaa ggcacacggt ccgtgggaga
    28201 cgcgggttca cgcgtcgtca aaaagttggt ggtccactcc gtaaggacag gtaggcttat
    28261 ttagcttccg catgctcctg gttccgtaat aaatgccgtt ttcgtggcag cgtgtcatgc
    28321 cgcgagtcac aaactccatc aaactgtcgg ccacgatgca aacgtgctga ttgttggcag
    28381 caaagacgcg catacagtcg tccacgaaga ggttgatcac gtcgtagggg ctcaccaacc
    28441 agcctaaagg ttccacgtgg ttactgccga ccatgaccct ccagtcgtta atctcgctcc
    28501 agtcgtacag ccgaatcgtg gagacgcgaa tgacgctgta atcacccatg accatgagtc
    28561 ggccgcgata cgtagcacgc cactgcgcga acgcgtggat gtgcatgcag ccggccagcg
    28621 ctctaagcga ggcggtgtgc ggcagctcct ctgggacggt gatgaagttg cagcgtcgca
    28681 aaccgatgtt gagaaattca gtgatgctct cggccacaaa ggtcaacgag tcagagtaga
    28741 tgtggtcggt ccataggtac atggcgcccg aggcgcccag gtacagttca gacggcacgt
    28801 tgtgatcgcc cttgtgttta agaaagttgt aggtgcagat gctgccgacg aaacgcagcg
    28861 gctcggggca gcagaggtag ctggccagac gctgtgcatc ccgtccttcg tcgcgcacca
    28921 agcgccagcg acgccggata acgaggcagc ggtctttggg ccagaccagg gccacgcgtt
    28981 gcccgggttt ccacggtcgc gacgtcttag gaggcctcca gcggtcgagc agattgagaa
    29041 aacagtcctt gattaccgac atcgcggtcg cgcgtcggtg gacaaaaaga aatcgggccg
    29101 atccggaaaa aaaaaacgac ggcaaaacac cgccgtgctc gagcgaaggg tggcggaggg
    29161 ccagaagagg cggccttgac ggcgttggca gcgaaaaaat tggcacgcga gtcaaacggg
    29221 aagtagcgtc ggtgttttat gccccaagca gcgtcgtcgt cactcgtggc gtcacagtca
    29281 acggtgctga cgtcctttgg ggcagtcggg cacgcgatcg tagatgccgt tgtggccgct
    29341 gaaacgtcgg ttttcaaaca gcaggttaag tcccagacac atgaacgtgt tgagattatc
    29401 tcccacccgg atgtagcggt cgtcgcgcac gtcgcaggcg tagacggccc cggtataggc
    29461 gacgacgatg gggataaggt cgacgggcca gcgcaagtga ggaaagggcg cgttctcgcc
    29521 cttgaggctg acggttccca ggccgagaac gcgcattccg aaagcggttt tgatgttgcg
    29581 cagcaagtga ccgccttcca cgctgttttc gaaacacctg aggttgcata gacgcagttc
    29641 cgttcccggc gggtacgtca acggcatgaa ctgcccgtgg tggcggatga tgaatcgcgc
    29701 catggtatcc aaaccgaggc tccaggcgcg caacagcggg cgaaagtagc gcttaaccaa
    29761 cgacgaggtc aggtagcgca tgcagtgcag ggtctcgacg gcgcgcagcc cgacgcgcgc
    29821 aaactccatg aggttgcggg ccaggtagta gacggcggtg tcctcgcgta catagcaaaa
    29881 aacatagccc tcgtccgaga tgaggcacac agcggtcttc ttctgctgat ccggcgacaa
    29941 cacgccctcg ttcacgaagc gacccacgaa ggccaggcgc gtctggcaac acaggtagtg
    30001 actccaagcc ttcacgtcct ccggtttgaa gtcctcgtcc gtctcgatct cctgcagcac
    30061 taggttccag cccggcggcc agaccacggg caacacctgg cctgcgttga tgcgcacgta
    30121 agcttccaga cagcccaggc cgaactcggc cgtgagcgcc aggctagcca gatcgctcat
    30181 gtgacgcgcc gagtcagtgg gcgagcccgg gggcccgtcg cacaccacgc tccgtcttct
    30241 tgtcctcacc gcggccagcg tggcgaggac actttccgcg cccgaggctg tatcttcggt
    30301 ttgcccgccg gagccggccc tcactatata acgtcccgcc cgggtctcct ccatgtatgc
    30361 aggtaagcaa ctgagccgaa cgcacctcag cagacgagag gatgtcgtcg cggcgtcgca
    30421 gctcgtcacg tcgctctggc gaaccctcga cggtgattta tatcccctcg agcaacgagg
    30481 acacgccggc ggatgaggag gcggaggaca gcgttttcac gagcacgcgg gcgcgcagcg
    30541 ccacggaaga tctggatcgc atggaggccg gtttgtcgcc ctacagcgtc tcctcggacg
    30601 ctccgtcgtc cttcgagctc gtgcgcgaga ccggcggcac cggcgccgcc aagaaaccga
    30661 gcgaaaagaa acgatcgtcg tcgcgtcggc aaccgcagat cgcagcgggc gcgcctcggg
    30721 gctcgccggc gacacccaag gccggcaagt cgcctaaagt ctcgcgaccg cctagtgtgc
    30781 cctcgctgcc cgagaacggc gccggcggcg gtggcgacga taacagcagc agcggcggta
    30841 gcagcagtcg caccaccagt aacagtagca gaagtaccag tcccgtggcg ccaggtgagc
    30901 cgtccgctgc cgagggcgat gagttttcct tctgcgacag cgacatcgaa gactttgagc
    30961 gcgaatgtta ccgggtcagc gtggccgaca atctgggctt cgagcccagc gtggtcgcgc
    31021 cgcagcacgt cgagtatctc aaattcgtgc tgcaagactt tgacgtgcag cacctccgcc
    31081 gcctcaacga atgcataccc atgccggcct tcgcgctcac cagcctcgtc gaccccgtct
    31141 taaacaacgt agcgcctggc gagcgcgatc tcacgcgtcg gataatcacg cacgcggtga
    31201 tcatcaacta ttactacgtg gcgcaaaaga aagcgcgcca catggtggag gccatacgga
    31261 ccaccgtgcg gggcgacacg gtacgccggg tagccgcgca ggtcaacaac cagagccgtt
    31321 cggggcgtgc ggccgcgcta gcgcttcact ttctcacgtc acgaaaagga gtgacggacg
    31381 gccagtacgc cacgtctctg cggcggctgg acgaagagct gcggcatcgc ggcacgcccg
    31441 aatcgccgcg gctcaccgag gtctaccaga cgctacgcga ttacaacgtg ctcttctata
    31501 ccgcccacta cacctcgcgc ggcgcgctct atctctatcg gcaaaacctg cagcggctca
    31561 acgagaacca ccggggcatg ctccggctgc tttcggtcga agagatatgt gaagagcaca
    31621 cgctcaacga tctggcgttc ctagtaggcg tcgagcttat gatcacgcac tttcaacgca
    31681 ccattcgcgt gctgcgctgc tatctccagc accagctgca gagcatctcg gagctgtgtt
    31741 acctcatcta tgtacaactg ccgtcgttgc gcgaagacta cgcgcagctt agtgacgtga
    31801 tctactgggc cgtcagtcaa aactacgact acgcgctcta cgcgagcacg ccggcgttgt
    31861 ttgacttttt acgcgtcgtg cgtcagcagg acgccttcat ttgcaccgac tacgtgtact
    31921 gcgccctgcg tctgctggcc tgtcccgaca gacctattat cggtgacacc ggcggcagca
    31981 gtagctccca acgcctcgta ggcgagttta tggtgcgcga tccgctgttg cgcgacccgc
    32041 gcgccaccca cctgcgccag aaactcatca cccgcgacat atgcgtggcg cggttgcaag
    32101 cgcagccctc gagtcgacac attccggtcg aacacacggg tgtctcctcc gtcaccctgc
    32161 tcaaaatctt tagccaggtc ccccccgacg aacgcgaaga agacacgtta cgcgagatgg
    32221 ctcttaaagc gtttatggaa gcgaacggta atcaccccga acaaatctgc cgatccccac
    32281 cacccccgct gccaccgcgc gactatcctc aacgcgacga gcgggaccgt caccgtcgcg
    32341 accgccgcga cagcggggaa tactgttgct gatggtggga cgaaacagca gggcggaaca
    32401 gtttatgata gaaagtcaca ggaaagtatg tgttgttttt ttttttaatg taccaagaat
    32461 aaaaagtgcg tctacgacca aagcggtgtg tggacgctcg tcctctgtct tctccggttt
    32521 tttttttatg tgtgtgtttt tcttttcctt cctattttgt tacggcaaca gcgctgatgg
    32581 cacgttgccg gcttcgaaca tcgcgtcggt gatttcttgc ttgcccggcg tcacacggtg
    32641 acgcagcagc gcgcggctca cgtagcaggc cgactcacgg atgacctggc cgtcggcgtc
    32701 gcgtcgcagg cccgagcggt tgccgtgacg cagtctgccc tgcgcagcgc gctccacgtc
    32761 ttcaaagtag ctgtgtagca ggccgcgctc cagcaactgc ggcagcgagt cggcggcgcg
    32821 caccacaaag ttctcacggc tgatctcgta gcacagcacg ctgccgtcgg ccgccacgcc
    32881 ggccacgctg cggtcccaac tgaaaaggtt ggcgagtccg atggtgccga tgacgcgcaa
    32941 ctgaccctgg gtcaccacca gcagcttcca gtattctacg tcgcgcgggg tgaggatggt
    33001 ctcctccacg tcgcagacaa acaacgtgta gccgcgcgga tagggcagat ccaggtggcg
    33061 accgcgctgg cggcgcataa aatcgtctaa attcaaaccg ccgtcgggtg cgcgcctgct
    33121 cgtcatcgcc gcgcctcgtc ggtcgatgac cccacggtgc ttataacgcg ccgccgcggc
    33181 ttcatgtggc gtgacctccg acctcgtgag gccgaaaacg gcgtacatga agacgctcaa
    33241 acttttgaat gtgggcccgg tagcgcaccg agggccccgg ggcggcgacg acggcgggtc
    33301 cgagttccag cggggccttg cggcggcagc ggttggcgtg gttgctcagc tcggcgtccg
    33361 agagcgccga gctgaactgc ggcagccgcg tgcgatcctg cggcgcgtcc ccgtgtcgca
    33421 gcgagtgcca gagtaggcgc tggacgcgca ccgcctcggg cgtcggcggc gcgcgacagc
    33481 cccggcgcag cttgaaaacg tgcaggcaca gcagctcgcg cttgatgcgc agcgacacgc
    33541 tgcggtagtc gggaatccgc tgcaccagct cgagaaagtc gcagaaggtc tccacgaacg
    33601 tgtcctcggt gaagcgaatg cgcttcagat cgtggacgtg tttgcgaaac cgcgacagtt
    33661 ctcgacgttg cacggggttc tgagcgagtc ccttgcgcag cagcgcagcc tcgcctttaa
    33721 acagcctgat gagccgctgc acgtccccgc tcaacatacg tatacacgcc gtgtactcgt
    33781 gacgtatact ggcgcgcagc agccgaatga tacgcagggc cagcacggcg ttggaggcca
    33841 ggtacatggc gtagccgcga cgcgggttgg cacaggccca gcccgcgggg agcagaaagt
    33901 agtcgtcgac cagcgtctgc gaccagtcgg cgaagcccag gtcacgtgat acgctgtcct
    33961 ggacgcgggc cacgtcgccg gctgtgaggt ggcggatcgc cggcaggtga aacgcgccca
    34021 ggtgtcgatt gcgctccagc ctcagctcgg cgtgctccaa acgggaatgg tgggacgcca
    34081 ccgcggaggg cgacaaagag gagtggtcgc cgccgccgta gttaccgttg tgattaccgc
    34141 cgtcgtcgcg cccgtcgccg cactcgcaaa aggccgcgta gaggtccttc aacgccgctt
    34201 cggctcgcgc cataaacgtg gcgtggaaaa aaacggcggc gcggtgcgtc cggtacttga
    34261 cgggcaaccc gcggcacagg gccgccggca ggcagcggcc gatgagttcg cgctcctcgg
    34321 gctccagaaa caggcacagg gtgccgtcca ggcgcaggta cagctcctcg gtcatcgagc
    34381 atagctgccg caagtaatgg gtgcgcgtcc caaaggtctt gtaatcgagc aacgtgcaca
    34441 ccacgtattg ccccgtggcc acggccagag cgatgcgttt ggcggcgcga ctgatctctg
    34501 gcaagtactg cgcctcgtgc accagacggc ggaaagcgcc ggcgttgagc cagcgaaaat
    34561 gctgcggatc gggcggcaag ggcacgcctc gaagcgcggc ccagacagcg aggtccgact
    34621 cgagcgtcag accgcggatg tcgtacttgc cgtgcgccgt agcgcaggct gaatggacca
    34681 gacagctgcg gcgaatgtac accatggcgt gcttgggatg tttgggcgcc ggcgttttcc
    34741 ttttctgacc gccggcggcc gccagatcct cgggcgtgcg acacaacagg ccggcgcgca
    34801 cagcctcctg tcgattacga atcggcgtca ggtaggcgcg caggaactgg tgacaaaact
    34861 cctcatcatc acgacagtcg tcgagatact cgtacgtggt gagcggatcg cgaaataggc
    34921 gctcgtcacc gtcgtcatgg tcttctttag cctgctcctc cggctgctgg gttagcggtg
    34981 gaggtggcgg ctgatccacg gggttcatga ctgagaggaa gaagaaggtg gcggcgaagc
    35041 gacgcggagc gacggcggta aagccagaca gcggctatat agctagtcat cacagtctcc
    35101 tccttcacga cgcccccgtg ccgctcacgc tatccagcac gctacgaccc gaaaacacgt
    35161 actcgctgac gtcgtacgcg ggcgatgtat ggctgctcac cggtttcgcg gcaacggttg
    35221 cgctcgagtc caacggcgag aagcaaaaac gccgtgggca acgaaaccag aaggagccct
    35281 gacggataaa accgcgcagc gtctcggcca acttaaccag catcgtaccg tacagcagta
    35341 cgtgaatgcc gccatgcgcg tccataaata cggctttgtt cacgggttcc atccatccga
    35401 tgactacaaa atgggcctgt tctagcacgc cgatcacgaa attgttggcc tcgtcggcct
    35461 cggccacgtt ccacgagccg aaagtgaaag tacaagcggg cgagccgccc aggcggatct
    35521 tgctaccggc gtggagctga catacgcgca gcagattggc gcggtcgtgc agtatctggg
    35581 agagttcgta catgcccgca aaggtgtgct taaaccacgc gccctctacg atctcatcca
    35641 cgtagtcgcg ctcaaagaag ctgtacacgg caaagaggcc gttctcaaaa aactcgccga
    35701 acgagagccc cagcacgtac accttgtcct cgccgggcag gtacgcaaag gcgtgcccgt
    35761 gcccggagac ccagatctcg ggcgccgtgt ttgcgtccgg cacgcattcg tacacactga
    35821 cgaggccgat aaagtacaag cggccagcct ggcgcaggca cgagaagcgc cggtaggtct
    35881 tgtgatcgcg caccacccca aagtactgag tgtcgcccag catgatgccg tgcagcggcg
    35941 gccagcacag cgggagccaa cgacccgccg tggcgcgcac gtagcgctgc aggtgaaccc
    36001 cgctcgcacg ctcgcgcggc ttcgggcgct tgtgggtcca ggcatcacgc agaccgcgcc
    36061 agatgctgct gaacttgggc tgcccgcgca gatagagcga cgagagcgag tcaaagtagc
    36121 ccacgacgag cctgtcggga gacacaagag cgcgaaaatc aaacctagag cgacgacggt
    36181 gaaaaaaccg accagaagcg cgtgtctcaa acacgctact ttcggttata aaaacaccgt
    36241 cgccctattt ctgggcgcgt gtacactgat gactcaccta cgctttttga acggcagtct
    36301 cagctcggga ttggcctcgt acagcgagct gcggtccacg gggccgatgc tctcgtagcg
    36361 aaagtcgtcg atgagcagcg ccagccccac gcgcacgaag cccctgaggt cgcgcgacag
    36421 ccgcaccaac ttatcctgcc ccaccagcgc cgcgtacacg gtgcccgtgt cgccgcagag
    36481 aatccgcacg cggtgaaaga aggtcttgtc ctcggcgccc tcaatttcgc ccagcggcat
    36541 gacgggctcg cgcgtgtaca acgaacgttg aaagcggcgc agcatcgagg ccgagagccc
    36601 cagatcgcgc gccgtgcgca gcactaggga atgcttctcg ggccagatga gggtcagttg
    36661 cgcctcgcgg tgcgcctcta cgtaggcgca acgagcggcg gtgtcctcgc aggccagcaa
    36721 ctcgcggaaa gccagcagcg aacgtaggta gcggccgcga gcggaggcgc gcgagcggcg
    36781 gcacagctcg gcccgatggt cgggatgcac caagggcacg ttaggttgca gacgcgcgca
    36841 gatggattcg tgcaccgggt cgcagcggat catgcccttg gcaaaaaatc cggccagatc
    36901 cgaggccaac tcgtacaggc agtcctcttg cgcgtcgtag gcgaacacgg cgccgtacgc
    36961 gtccacgaac acctggtacc ggcaggtggc gtgcgagacc gtgccaatga gatgcagagc
    37021 tcggaattcg ccgaaaaagt cgttctggca gtgctccaga tcgatctcag tcagcgagtg
    37081 cggcgaatgc tcgcccccga ccacgtagat gcactgcgag ggccagccca gcgacacgca
    37141 cgagccctcg aagcgccgca agtaacgccg caggccctca tagtcgcgtc gcacgcacag
    37201 gtcggccaag tcgcgcgtgc aaaagacctc gggtaccaag cagcgtttgc gacgcggccg
    37261 acgcgcgtgc ccaggcagag gaaggcgcga cggcggcgac gacgaggagg aagacgccgt
    37321 ggccgccgag cagcccttgc gacggccgga catgccggca gtccgcgacg atccacagga
    37381 gacaaaaaag cagaagcagt agtagtctcg gcgacccgct ccaccccgtc ctccacacgc
    37441 tcagccgcga ctgagcgccg gggcgcgccg ctacttgggt ttttatagcc atctgccccc
    37501 cgtctcgggc acccgggagc gatctacgga gacctgacag cagttgggca acacaagaca
    37561 gggaaataca aagacacttt taataaaaaa cgagactact ttgtgtgtgt gctccgtaaa
    37621 ctgtttattc tccccctccg tctcgctctg gatgggctcc gggtccgtca acacgcgacc
    37681 cgcgcggcaa aaggcacgct gttgacggcg cgagagcccg tcgtgatagt ccatcatgcc
    37741 ccggagatcg tgcacaaagc agctgtcgcc gcgtagaaac cgacgcagcg tctccacgtg
    37801 ctgcagctgt cggcgcgtat caggagccgt catcgccgat gtcgtcatcg ccctgacagg
    37861 cgcgtagatg gctccgcgag atcatgcgcg ttttcaaccg ccgtgacaca tcaggtccat
    37921 cttgagctgg cgccgggcct cgcgcaggtc tcgcacgcgt tgtgagcggg aggcgagttc
    37981 ggcttcttgc tcgaactcct gctgctcact gtccgagagg gtgcgataaa aggcggcaaa
    38041 gtcctccaag tcggctacat gcgccctggg tctgacgctc caaagcgtac gcagtctgat
    38101 gaagcggacc catcgagcgt cacggcacgc cgtcttgaac gcagggcccg ggaagagatt
    38161 cttctccccg gcgcgctcgg gccggcgagg ccgacgcggt ttatatacac cgtctcggac
    38221 ggcgggacgc cgagcccgcg ccgcggccgc tcatccggag acggcggaaa ccgcggcgcc
    38281 ggaggaaacg gggaccggca acgacggcgg tggcggcgac cagattatgg gggacaagcc
    38341 cacgcttgtg accctgttga ccgtcgccgt gtcgtcgccg ccaccgtcgt cgccgctgcc
    38401 gctcgtcagc ttcacggagc tgctgttacc gccgccgtcc gtcgccgccg ctgcggtggc
    38461 ggcaacagcg acgagcgagg tgggcgagaa aaccgcggag caagaggtag cggctgcggg
    38521 tccggagacc aggaatgaga gaagagaaaa cagggaggac gaaggagggg agacgaggac
    38581 gacgggcacc accgcggtca aaaggtcgca cgacggtatc cctcgccaac tggcagagcg
    38641 cctgcggctg tgccgccaca tggaccccga gcaggactat cgtctgccgg cgcaggacgt
    38701 ggtgacctcg tggatcgaag cgctacgcga cgcggaccgc gacaactacg gccgctgcgt
    38761 gcgccacgcc aagattcacc gttcggcctc gcacctgacg gcctacgagt cgtacttggt
    38821 gtccatcacc gagcagtaca acacggcctc gaacgtgacg gagaaagctt cgtacgtgca
    38881 gggctgcatc tttctctcgt ttcccgtcat ttacaacaac acgcagggct gcggctacaa
    38941 gtacgactgg tccaacgtgg tgacgcccaa ggcggcgtac gccgagctct tctttctgct
    39001 ctgctccacc agcgagagct ccgtggtgct gcaaccgctc atcaccaagg gcgggctctg
    39061 ctcgtccatg gcggtttacg acgaggaaac catgcggcag tcgcaggcgg tgcagatcgg
    39121 ttttctgcac acacaactgg tcatggtgcc cttcgtgccg cacgcctgcc cgcattacgc
    39181 cgtgcctttc acgacgccgg gaaagccggg ctgcggcggt gctccgagcg gcgttgcggg
    39241 gttggaggag acggcgccct ttggacgggt cagcgtcacg cggcatggcg cgacgctgct
    39301 gtgtcgcgtg gaccatctga cctggatcag taaacgcgta accacgtacg gacacaaaaa
    39361 aattacgcgc tacctcgcgc agttccgcgg cacgatggac gacgacgagg cggcgctacc
    39421 cggcgaggac gaggcgtgga tcgcgtccaa aaacgtacag tacgaattca tgggtctcat
    39481 tttcaccgtc aacgtggatt cactatgcgt ggacgcggaa cagcgccaac tgctgggcac
    39541 cgtggccacc tccttctgtc accgcgtctc ggacaagatc acggcgcgca acatgccgcg
    39601 cgccttttcc ttctacctgc tgacgagcgc gcagcgcggg tacgacctgc gatttagccg
    39661 caacccgtca ctctttttta gcggcgacgc gctcaactgt ccgcttctca acgagcccaa
    39721 cgtgttttcg ctcacggtgc acgcgcctta cgatatccac ttcggagtgc aaccgcggca
    39781 gacggtggag ttggacttgc gctacgtgca gatcacagac cggtgtttct tggtggccaa
    39841 cttgccacac gaggacgcct tttacacggg gctcagcgtg tggcgcggcg gcgagccgct
    39901 caaagtcacg ctgtggacgc gcacgcgttc catcgtgatc ccgcagggca cccccatcgc
    39961 cacgttgtat caaatcaccg agggcgacgg taacgtgtac tcgtacaatc accacacggt
    40021 gtttcggcag atgcacgccg ccggagcaac cacgttcttt ctgggcgaca tgcaattgcc
    40081 cgcggacaac tttctcacgt ctccccatcc ctgaccctcc gtccgtcctc ctttcccgac
    40141 acgtcactat ccgatgattt cattaaaaag tacgtctgcg tgtgtgtttc ttaactattc
    40201 ctccgtgttc ttaatcttct cgatcttttg gaggatgttc tgcacggcgt ccgacggcgt
    40261 tttggcgccc cccatgccgg cagaacccgg ttgcggcccc gtaccgctct tctggggcga
    40321 cgataagtcg aaagccaccg ttttcatgcc cgtcgtgctc ttgacggggg aacctacggc
    40381 ggcgatcccc gtcgagcggc gtgattgcaa agccgcgctc gcccccggtt tcaggatgga
    40441 gggggaggcc acaggcggcg cattcgatac gctgcttttg gccgtagacg acggtgggta
    40501 aacggtggtt accgcgggat acgtcggcgt ggtcgaggcg gcccggctgc tgccggacag
    40561 gcgacccggc gcgctaccgc tcacggggac cgagggcggt cgacctacca ccgccttgcc
    40621 gcccaaagta ggtttcaagg aaggaacacc gacgcggctg ccccggcctt tcaccggaga
    40681 cgggggggca ctcttggccg gggacggaga ggctgacgaa agcatggaca gcggcgatgt
    40741 ggcaggggac acgacatcat cctccgtggg cgacaaaacg gacgccgagg ctgacggctg
    40801 tcgagccgaa gaagcggaag aggttcccgc gccagaagtc acgttccttg atgacgtcgt
    40861 tttagacgaa gccggttgag gttgcaacag cgtggcgggt accgtcgacg gcgtgcccga
    40921 cacctgtttc tctagccttc cctgaaccgg cgtcgacgtc accgtctgcg ctcgggcgga
    40981 cgcgtgcggc gtcgcgactc gcttgcccag caccggtttc tggctcgtgg atgtcgtcgt
    41041 cattggagac gataacttag ctttacgtat tctggacggc gtcgactgct cgggcgtctg
    41101 actgggaggc gaaatgacgt cgttgttgta atcggacgac ggtgttgtgt gtcccaggct
    41161 gacgacggag ccggtgtccg aggagtcgtc gtcttcctcc tcgctgtctt cgaccggtga
    41221 ctctgcagtt tggtccctta aagcccaaac ctcatcagcg gcgtcccgag acgctgtttg
    41281 tgtcaccgcg gcgcgtggag tcgacggcct ccgaggggtg gtggacacgg tgttttgaga
    41341 agccgtggaa gtcgtaggca tcctgaaggg attgtaagcc aggtgaggat tcttgagggc
    41401 ccacgcgcgt tcgcgcggcc agttggcggg gttcatatcc ccgggcaacg gcgccgtcgg
    41461 agcccagggc gagttaccgt tgaccggggt ttgggtaccc gcgaaggtag gtgtcggggc
    41521 cggagcgggg gccgtggaag gattgacagg cgtcggcgtg aggatggcag cgccggcgcc
    41581 agcaggaacg ttaactccgg cgccgaacgt caacgtcggt tgctcgaact tgtacgcggt
    41641 ggtgacgggc ggtttggcgc tcgtctcggt atccgtgatg tccaccagcg tgtcggtgaa
    41701 acgcggatct tgacggttgg ggggatagcc atccgagctg tcggaatcct cgtcgcccga
    41761 gaaaagatcc cctctggtct ccgtgagcgg cctcacgtcc cacgcgctgt cccgacggac
    41821 ccttcccggg ctggccttgg tcacctgcgg ggaaacgaga ctgaaagccg cgtgacgctg
    41881 ttgttgctgc gggatgttca agggaccgct ggtcggtttc tgactgcccg aggataacag
    41941 gccgctgaaa atgctggaaa caccgccacc actagcggcg cccttgccgc tagttcccgg
    42001 tttcttgatg ggcgtaaaga tgtttttctc gtcatcatca tcgtcgtcgt cgtcctcatc
    42061 ggcactggag ccaaagagcc tccgggaggc gcccggttta cgtgtcgggg gcggcggttg
    42121 ctgctgacgt tgctgcaggt tctgctgcct ctcctcccaa gccttcagct gctgtttctc
    42181 acgctgcacc acctcgtcgt ccacccgttt ctgccgctcg cgacgctttt cctcttcgtc
    42241 gtaatagccg acggccgccg aacgggcagc gtgggcttcg gcggccggtg ccagagaacc
    42301 atgggcctcg aagcggaacg gtttgtgtcc cttccaggga ctggcgatcc agctccagcc
    42361 gtccagcggc tgcgtgggga catgtttctt gggtaccgac gagaaggctg aaccgccgcc
    42421 gagcgagagg agattggcgt catcatcaaa ctccaacgac ggcgagcgcg cgcccaaaaa
    42481 ggtgtgcgcc gactgcggga agctgtccac gtagatgtca aagtcctcga tgagcagctc
    42541 cagcagcgtg tcggccgagt cgccgttttc cacggcgtgc ttgaggatat tgcgacagta
    42601 gttggaatca aaggaaaggc acatgcgcag ctccttgacc agcagcttgc aacgctcctg
    42661 aatgcgcgcc agacatttgc gctccagctc ctcccaagac ctgcgcacgt tcatgatgag
    42721 acggcccgtg tacacgagct tgttgacggc gttgaccagc gccgtgttgg cgtgccggtc
    42781 caggttaagg tcgagcggtt tcgcacagaa catgttacgg cgcacaccct ccaggttttc
    42841 ttcaatgcgc tgcacctccg tatccttgag gtgcacaaag gcgatgggtt ccgtctggcc
    42901 gatggctgtg accagcgtct cgcgcaccga catcttggcc agaatgaccg cgcttacgag
    42961 cgcgcgctcc acgatctcgg catcgtggcg cacgtccgta tcgaattcgg tacggtctag
    43021 cacagccagg tggtcacgcg ccttaccacg atcaccgaac gggtaagtgt agccgcgacg
    43081 cgccacggcc gcgcaacgca cctcgaactc ctcgagcacc gaggaaaggt cggggttgtg
    43141 gaaacgcagc tcgcggtagt atcccaacca aagcatgagc tcgttgaaca gcaccgtacg
    43201 ccggtgcagg cgtttttcgc cgcatttttt caggatcttg gggtgtgcct cgagatccac
    43261 gtcgggcttt tgcgtgagat ggcgcagaaa gttgaccagg gctaccacat cgcgccgctg
    43321 tagaccgata aactgcaaac tcatgctggc ttttctccag aacccggaag cgtcgtcgcc
    43381 ccggactgcg cccgcggtct gctattcgtc cacgatggac accatcatcc acaacaccac
    43441 ggtgagcgcc ccacctagag ggaggggggg tagtttaata gcggaggcgg atacgcggtt
    43501 ttcacccggg cgccgctgac ttgtttcttc tgttttttac tccgtatgct gttccgccca
    43561 gaaccgcagt accgatactc cgcatgtcaa catcacctgt aacataacgg agccgctatc
    43621 cgccatccgt accacagaag ccgtgatcaa cacgttcatc attttcgtag gcggcccgct
    43681 caatgccata gtgttgatca cgcagctgct cacgaatcgc gtattgggct attcaacccc
    43741 caccatctac atgaccaacc tctattccac caacttcctc acgctcaccg tactgccatt
    43801 tatcgtgctg agcaaccagt ggctactacc cgctagcgtg gcttcgtgca aattcttgtc
    43861 ggtgatttac tactcgagct gcacagtagg ctttgccacc gtagccctga tcgccgccga
    43921 ccgataccgc gttcttcata agcgtaccta cgcgcggcag tcgtaccgct ccacctatat
    43981 aattttgcta ttgacctggt ttgccgggct gatcttttcc atgcccgcgg ctgtctacac
    44041 tacagtagtg atacataatg gtacaaatgg acaaagtagc aatggacacg ctacctgcgt
    44101 attgtacttc atagccgacg aggtgtacac ggtactactc tcgtggaaag tgctgctgac
    44161 gctagtgtgg ggcgccgcgc ccgttatcat gatgacgtgg ttttacgcct tcttctactc
    44221 aaccgtacag cgtgcgtctc aaaaacaaag gagtcgcact ttaaccttcg tcagcgtgtt
    44281 actcatctcc ttcgtggcgc tacagacgcc ttacgtgtcc atcatgattt tcaacagtta
    44341 cgccacggcc gcatggccca tggactgcga acacctgaca ctgcgacgca ccattggcac
    44401 gctgtcacgc ctggtacccc acctacactg cctcatcaat cccattctgt acgcgctgct
    44461 gggtcatgac tttctgcagc gcatgcggca gtgtttccgc ggccagttgc tggaccgccg
    44521 cgctttcctg agatcgcagc agaatcagcg agctacagcg gagacaaatc tagcggctgg
    44581 caacaattca caatcagttg ctacgtcatt agacaccagt agcaaaaact gcaatcagca
    44641 cgccaaacgc agcgtgtctt tcaattttcc cagcggtacg tggaaaggcg gccagaaaac
    44701 cgcgtccaac gacacatcca caaaaatccc ccatcgactc tcacaatcgc atcataacct
    44761 cagcggggta tgagctttcc tgttacttta ttcagaaagc accagaaccc gtcgccattt
    44821 cccctcatat acggtacacg tccccctgat ctgtcatcac ggtacacaga tttcgcccga
    44881 ctgcggacgc cgacggccaa tcgcgtggcg taggagtggc gccccggctt cattataacg
    44941 ccacgtcgga gcccctgcgc gccacaacgc cgtccggcgc aacttctgtc tcggcacggt
    45001 acgataaaaa cgacgtcccc cgtcgacgtt gttttctccg agcggtgatc gttcccgtcc
    45061 ctctcctccc tccgcggccc ccacggcggc ggcctgctcg cacggaccta tactattacc
    45121 gccccaccgc cgtcgtcgtc atgaacttca tcatcaccac ccgagacttc tccaacgacg
    45181 attcagtcct gcgagccgcc gagatgcgtg acaacgtggc aggctcgatt tccaaagcgt
    45241 acaagggcac ggtacgcgcc gaaggcaaga agaagctgct gctgaagcac ttgcccgtgc
    45301 cgcccggcgg ctgctcgcgc cgcaacagca acctcttcgt tttctgcacc gagcgcgact
    45361 accgcaagtt ccaccagggc atcgcacagc tcaagcgcgc gccggccgaa ctggaccccc
    45421 acgagatcca gcaagtcacg gccagtatcc gctgccgcct gcagcccagt ctccgcgagc
    45481 cgcccacgcc ggccgacgag ctgcagacgg ctgtgtcgcg cgtgtgcgcg ctcttcaacc
    45541 agctggtttt cacggcccag ctgcgccact actgcgagca ccaggacaag gtggtgagct
    45601 acgcgcgcga cgagttgacc aaacgctgcg gcgaaaaatc ggcgctgggc gtagaggtgc
    45661 atcaactggt agccttgctg ccacacgagc gccaccgcga actgtgccac gtcctcatcg
    45721 gcttgttgca ccagacgccg cacatgtggg cgcgctccat ccgtctcatc ggacacctgc
    45781 gccactacct gcagaacagc ttcctacacc tgttgatgaa ctcaggtttg gatatcgcac
    45841 aagtcttcga cggctgttac cacagcgagg cctaccgcat gctcttccag atcggtcata
    45901 cggactcggt gtcggcggcc ctggaactct cacacagcgc ggcggccggg ccgcccgagg
    45961 ccgatgagaa caacgacgag ggagaggagg acgacgacga gctccgtcac agcgacccgg
    46021 cgccgcttca cgattccaag aagccccgca acgcccgtcg tccccgcaca cgcgtgccgc
    46081 ctcacgagca aaagcccgaa gaaaacgagg aggaagaaga ggagctgttt ccctcctgca
    46141 aggcaaccgc agcattcctg cgggcagaac cctccgtctc caacgacgac ggcaacggtg
    46201 gcgaacgctg cgacacgcta gcgaccgccc tgcggcatcg cgccgacgaa gaagacggac
    46261 ctctagccag ccagacctct gtgcgagtcg ccgcgacccc ctcaccttca gtcacctcag
    46321 cccttacccc cgtcacgtcc cccataaccc cgttgtgtat ttaacgtcac tggagaacaa
    46381 taaagcgttg atttctcaag ttccgctctg gttttggttt cgttttcaaa gggggcccca
    46441 tcatggccca gggatcgcga gccccatcgg gcccgccact gcccgttctc cccgtggacg
    46501 actggctcaa ctttcgggtt gacctgtttg gagacgagca ccggcgcctg ctgctcgaga
    46561 tgttgaccca gggctgctcc aactttgtgg ggctgctcaa ctttggcgtg cccagccccg
    46621 tatacgcact cgaggccttg gtggacttcc aggtgcgcaa cgcttttatg aaggtgaagc
    46681 ccgtggccca ggagattatc cgtatctgca ttctcgctaa ccactaccgc aacagccgcg
    46741 acgtattgcg ggacctgcgc acgcagctcg acgtgctgta ctcggagccg cttaagacgc
    46801 ggctgcttag agggctcatc cgactctgcc gcgctgcgca aaccggcgtt aagcccgagg
    46861 acatcagcgt gcacctgggc gccgacgatg taacattcgg cgtgctaaaa cgagcgctgg
    46921 tccggctgca ccgggtacgc gacgcgctgg ggctgcgcgc gtctcccgag gccgaggcgc
    46981 gctatccgcg cctcaccacc tacaacctgc tgttccaccc accgcccttc accacggtcg
    47041 aggcggtgga tctgtgcgcc gagaacctgt ccgacgtaac acaacgtcgc aaccgaccgt
    47101 tgcgctgcct cacctccatc aaacgcccgg gctcacgcac cctggaggac gcgctaaacg
    47161 acatgtatct gttgttgaca ctgcgacact tgcagctgcg acacgcgctg gagctacaaa
    47221 tgatgcagga ctgggtggtg gaacgctgca accgtctttg cgacgcgctt tacttttgtt
    47281 acacgcaagc ccccgaaacg cggcagactt tcgtcacgct ggtgcgtggg ctggaacttg
    47341 cgcggcaaca cagcagtccg gccttccagc cgatgctgta caatctgttg caactactga
    47401 cgcagctgca cgaggccaac gtgtatctct gcccgggata tttacatttc agcgcgtaca
    47461 agctgctgaa aaagatccaa tcggtctcgg acgcccgcga gcgcggcgag ttcggggacg
    47521 aggacgaaga gcaggagaac gacggcgagc cgcgcgaggc ccagctcgat ctcgaagccg
    47581 atcccacggc gcgcgaaggc gagctctttt tcttctccaa gaacctgtac ggcaacggcg
    47641 aggttttccg cgtgcccgag caacccagcc gctacctgcg tcgacgtatg ttcgtggaac
    47701 ggcccgaaac cctgcagatc ttctataact tccacgaagg caagatcacc accgagacgt
    47761 atcacctcca gcgcatctat agcatgatga tcgagggcgc ctctcggcag acgggcctga
    47821 cacccaagcg cttcatggaa ctcctcgaca gagcgcctct gggccaggag tcggaacccg
    47881 agatcacaga acatcgcgat ttatttgccg atgtttttcg ccgtcctgtg accgacgcgg
    47941 cttcttcgtc gtccgcgtct tcgtcgtcgt cctcagcatc tccgaattct gtttcgctgc
    48001 cgtctgccag gtcgtcatcc acacgaacca ccacgcccgc gtccacgtac acctcggccg
    48061 ggacttcttc taccacgggt ctcttactct cctcttcttc tttgtcgggg tcgcacggca
    48121 ttagctccgc ggacctggag cagccgcccc ggcaacgacg ccgcatggtc agcgtgaccc
    48181 tcttttcgcc ctactcggta gcctacagcc accaccgacg tcaccgaagg cgacgcagcc
    48241 cgccacccgc accccgaggg ccggcccaca cacgcttcca gggacccgac agcatgccga
    48301 gcactagcta cggcagcgac gtcgaagacc cgcgggacga tctggccgaa aacctacggc
    48361 atctctgaac gcggtttttc ctctttttct acgtgtctgt ctcaggacga gacgtcgata
    48421 tcaataaaaa taccgtcgac gtggttttct aacagcgtgg ttttctttat tgaccagcgg
    48481 agtacacagt ttacgagtaa aaaagacagg gaaaggttat ataaaatgct gtgttatata
    48541 caaaaacatg cacatagaca gacagaacca ccgtgctcgt cgtcccctcc ttaatcagtt
    48601 gttcatgtag gcgtgtggcg gggtgagggg cggcatgccg ttggcggcgc cgggaataat
    48661 gtgccgtcga ccgacgtcgc acaccttgaa acgccgtcgg cgcacgcagc ggtcgcagga
    48721 cgggatatcc cagaggaagc ccatgtaggt ctcggggtcc tcgtcgtgaa agcggtaaga
    48781 gagttcaaag tggtgcaacg agcccgtccg agctcgcagc ttctggcgaa caccctccac
    48841 gtcatcggtg cacagcgaca gtgctgggct gtcacacagg gcctgaagct cctgcggcca
    48901 caggtgcgta gccaggggcg agtccgtcgt caccagtttg acgcagtgca tcaggttctc
    48961 ggtgatggcg tcgtacaggc gactctcggc ctcctcgtgc gtcatcacgt ttcgaggcag
    49021 cgacagctcg tcgtcgtcat cctcgtcaaa catgatcatg gggtcagggg tttttttggg
    49081 atgttgacag gtgggtgtct tttccagacg cacgatggcc tcacgccggc cgctgaaacg
    49141 gtggtttcgg tgtcccttct ttcccatgac gcaggtgaac ataaccacgt cctcggccag
    49201 acggtagacg gcgtccatgg cggggtcgta gccgtagacg acgccgaaag tgtccaccaa
    49261 gacgtactgg cgtacgagga actctttgcg ttctggcacc tcgtggccca gcgcgcccaa
    49321 caactggtgg taacaggtga tgcgcggcac ggtacggatc atgagctcca tggtctggat
    49381 gctgccgccc gcgcggacga cgctgaaaga tgtttccttg aacttcataa cctctgtgtt
    49441 gtgggtccag aaggcgaaat gggtgtcggg acactcatcg aaagggtcgt cgatgctgta
    49501 ggaagcgtag ccccgcttgg tcacctcggc cgacaggctc tccacgtcgc cgcggtagag
    49561 cataacggcg ttccagtagt cgtcatactg caccatgggc cgctggtagt cgcgcatagt
    49621 gtggaagtgg tcgcagtgac gaaagccatg ccgcagaaaa tccttcatgg tgggcgccag
    49681 ctcgtagatg cagtcgcgca ggtcatcgta gcagtagatg ccgccgcgct gcccgatgag
    49741 cacgatgagt tggtagcgca taaagcccgg accctcgacg aagccaaagg ggtgcaggta
    49801 ctcctgacag cagacgtaag cacctggtag agaatagaaa aaatccacgc acgttgaaaa
    49861 cacctggaaa gaacgtgccc gagcgaacgt cctctttcca ggtgtcttca acgacgtggg
    49921 gcttaccttg cgaacagacg gtgcccatct tgcccacgaa gggccccagg gcgctgcgcg
    49981 aacggagctg gatgaagcag cgttcgggcc aggccacgtg cagccgggtg ccgcattcct
    50041 gctccagaaa gtcgttgaga ccgttgaagt ccccggctcg gatggcgatg cagccgtagg
    50101 ccatcagcgt gtcccgtagg tcgtccatga cggactcctc taccttcgct cgccgacgct
    50161 gcgcttctcc agccaccgct gcggtcgaca gactcctccg tccgccttcg gagaactacg
    50221 gcgcggcggc acggccttta tagacactat cagcgttgac gtcagacgat ccaatgaacg
    50281 tcgttttttg tgctggaact tccctcgtcc cgacaaatgt agcggaaatc ttcaagcaaa
    50341 tcgcgacgaa gtccgatgag gaggatgcag aagaggctga gcaacgcgat gctgcccgcc
    50401 gccacagtac atatgctcaa caacgcccag tgtcccaacg cgcgactttt ggctcggagc
    50461 agagccgaac ggcggttttt ccacatgatg gataacgtag tccaatattt ccacccctgg
    50521 cattgttgta gtgtccactc gggaagcgac gtcacgttag ttcccgtaaa agttgtgttt
    50581 cttctgttgt ttttcgcaag cttaacgctc ctcttaagaa accgcggaca catgtcttgt
    50641 agaaaaatgt aatcactttc cgcatatacc gttaagactg acatcacggt gacggtgttg
    50701 ttttccgaag acgtcgcgtt gtcggtgacg ttggtttcct cccaatttac ggatgactca
    50761 aacggactcg tgcgcgccag tgcccgtaat acgtaactgc ggccggtaag gttaagcgtc
    50821 agctgtccca tggtaatgtt agtgtcattt gtaaaacacg caacctcccc gtagacctcg
    50881 gtgacgttga tatcgcggct ctcgttcagg atgcgcaggg gaaaccagcc ttccaggtgg
    50941 tactgaaaac caaacgtgag catgacgctg tgccactgcc gacgtgattg ccgaaacgtt
    51001 acgttcaagg gcagtttgga ttcggctccg gcgcaggggc cgttgtagat ttgcgtatga
    51061 ttgcacgtgc agtttaaccg gcagttcata ctcgtggcgt tggaagtgac gttaatgtcc
    51121 gtaccgtggt acgtacatcg aacagaaaca ccgtatcccg tgctccaaaa cagcgtcaac
    51181 aacagccaca cagacaccta cgtggggacg acacgggact ttttattgac ggagactcac
    51241 gtttctgccc tcccctttcc cgtaggtaaa aacccacgtt tatcacacac gttgttttta
    51301 cctgaaaccc gcgcagcccg tggacgcgac aaaaaaccgc ggcactagaa agaaaatgaa
    51361 acaagtatgt ttattaagca gcatgtgggg ctaatagggg ggataactga ggtatagcaa
    51421 ctatgaaaaa atactacaaa aaaaaagctg aacatggtca tctagcagca aagttctcct
    51481 tctagaccac gaccaccatc tgtaccacgt cgccctcccc ggccgtgtac atcacatcct
    51541 tcaccacgac cggcggcaac ggcggcgacg aggacaactc gctctcgacg gaggccggga
    51601 cgacagagga cgggggggtg gtggcggcgg aggacggagg ggtggcggcg gcagcggggt
    51661 cttcttccga cacgggcgac ggcaggctcg gcggcgcgga cagcacccgt tgcgccggag
    51721 cgtgagaagg ctgagccccg gtggcctgga tgtgggccaa cgaattggct cgcagcgagt
    51781 cgcgatccac gaaggtcata ggaattttcc cttcgcggat tcgccgctca gattccagga
    51841 tggcgcgcac gtagctgttc accgacttgg caaaagtgcg cggcccctcc gtattcttgt
    51901 cgcgacgcgc ttccagcacc tgcttttcgt agtccagctg gtggaagacc atcaccaggt
    51961 cgtccatagt gtgcgcgtgc tgacggacgt gggagcgcac ctccaccggg aacaaagcgt
    52021 tccaatactc cagcactatg gcaccgtgcc agaactgcgc catgctgggc gccaggaaaa
    52081 acaggatacc ggagtcgtag gcgaacacgt cccacttggg cgtcatgaac aacaccagct
    52141 gacgcgtggg ccgcaccgaa gcttcctccc aggcctcgat gaccccgaac atgatgagct
    52201 cctggtccaa cggggggcag tgtcgctcca gccaactgat cttgctcagg ttcatctgca
    52261 gaaactcgta agaggggtcg cagatgcaca cgtagagacc cgagtcgtgc cgcagcctgg
    52321 ctccgcgctt catcagtttc ctcaccgcgt agcgaagcgc caccttgccc aacgccgacg
    52381 cctggatcag tccccccacg tccatctgcg tctgtcgcca ctcggcctcg tccagcaggc
    52441 tcatgatagc ggcggtgcta tgcgtggtcg tagtcatcct ttctatcctt ctctatgaat
    52501 agcagcaata gcggtaaagt cccttcttat actatcccgg agtctgtggt ttttttgttt
    52561 acccctgctt actggtgaga ctgctggggg ccgttgtgct gcagcagccg agctcgtcgc
    52621 cgccgttgcc acaggaaccg gtgcctccgc agggcctttt tgagagcctc gcaggcttct
    52681 cgcgcaagtc ctgagaggcc ctcggcgtcc atggggttca cctcgggcgt ccgagcctcg
    52741 ttttcttctt cttcatcctc cctttcctcc tccgtgtcct cccgctctgt gtcctccgtt
    52801 acgctctcct ccccggcctc ggccaagagc gcggccacca agtccacgga ccgctcggtc
    52861 tccgagttct caccgtcaat tacgccatgt tggcggcgta accggtgccg agaacgccgg
    52921 gtgagcgcac atgctttttt ctttcttaac caaggcggga gaggatcttc aaggcgtttt
    52981 cgctggatcc agcggtagct aaagtaccaa aaggccagca ggcccacgct acctaacaga
    53041 ttcacgtaga ctggagacat aattaaagaa agaagtgaaa cccgcgtgtg ggtctcacgt
    53101 cgtcttgaaa caccgtctta tatacatgaa gatgccggac atgacgcgcc caagacacgt
    53161 ggggttttcc ccttaggcga cccggtttct taagatgttt ttcatcttcg cacgcgatgt
    53221 actacatcaa agggtcggct gaccgaccgc attgacgcac agtttccgag tacgcgcgtc
    53281 tcggagcacc tgacggtgaa ccacccaact cacgcggata ggggacaaca ctgacgtgag
    53341 gggcgattca cgtcactgac ggctgacggg aataagacgg gtgagggatt tccacatttt
    53401 tcttaagtgt gactctcctt acggtaaatc gcacctgtga cttcttaacc cctcctccct
    53461 ggtacccgat aacagtgaaa aacacacacc acacgtcacg acaccgatcg attttcttta
    53521 ttcttagtgt gatgataggt aagggcactc gtgaggatgt gcagttatca ttatcaagcc
    53581 ttcttcaagg cgtagtgatg atcgttgggc agaaccccca ggctcctagc gatctgggaa
    53641 tagaaggagg agaacgaccc caaggccaga atgcccacag tgtacatggc ccaggtctcc
    53701 agaccgaacg tggcgggtcg cagcttcaga tggtaggcca cccgctccga gagttgtgaa
    53761 tgctcgttca ggcaacagga ctgcaggtgg gtgagcccaa aagcgctttc gtttacgccg
    53821 cgcacgtgca ccgtctgggc cgggcaatcc tggtgttgcg cgcgaaaatg gtcctgacag
    53881 gagattccgt ctacgtggcg acgcgtgttg ttacccactt cgatcagcaa cgtgttatcg
    53941 gcaggatgat gcgagaacgc gacgacggtg ttgctggagg tctggcggca gcagtacacg
    54001 tcgagcgtca tgaggaccat gtcgccttgg tggtacacgg cgtacgccca accctggaac
    54061 acgagcggac atagcggacc gtgagcggac gtcacgccgg cggttgttac cgtcgtctcg
    54121 acaggagaag acaataaact cctgatcctc atacacagga gtccaaccgt cagaattaaa
    54181 gtccgcggag ccataaccgc gcaagtgaag ccgatacgag tgttgctgaa tttgttcatt
    54241 ctgccgactg ttgctcacga gcgttcggag gcggtgccac aggctgttgg ccattaaaaa
    54301 gtcctggccc gaatgacgac gagacagagc ccgaggcgaa gaaaaaggcg cccgtcatga
    54361 agacgtaggc aggggaattc ccatattttt atggcttctt ttaaaagtct gtatccgact
    54421 ccatccggcg cttttcccaa accgtggtct cctcgtcgtc cgactcggta cccaggaggt
    54481 ggtaagtctt ttgccgcacg tagaaagctt tcaacgtgga gcaaaagatg agaataaaga
    54541 ccccgaaaac gaaacaaacc acgccgatca tgccgatgca gacgttcatg tcgacgtagc
    54601 cggcggtgct gttggcggtg cggcaaaaga gtgtcatgtc gtgcgtgcac aaaaaacaac
    54661 acacaccaca ggccaggtcg tagcgtagtt attattccgt agcagcaatg atggtacagt
    54721 caagcacatg ctctatcccc gttaccccga tgatgcttgc gtccccgttg ttatattggc
    54781 actgtcccgg ttaatcacca cggtgaacac cacggccaag aaaatgatcc ctaatatagc
    54841 gaccactaag agagcaaaag tccatttcca gccgttgtca aagtacgccc ccgtggtggg
    54901 atgcatggtg gcgggcattt ccatcatatc catgtcgaac gtgtgtcgcg gcgacggcga
    54961 actaaccagg cagtacgggg gtcgataggg cggtgggctg cagtcgggtg gtggcggcgg
    55021 tggcgtggaa accgtcgtcg ggcacagacc catggcctgc tcgtaggtgg ggggcgcgtc
    55081 gtcgtgatcc cggtcgcgga gcatcggcgt gggctccatg tcggtggcag tgacggcgac
    55141 ggtggtaact gtggtggaga cggtaccgac ggcgtccgcg gctcaccttc gagcaaagag
    55201 ccccttcttt ttgcgcaaac gacgacaaaa cagttctctg ggacagccgg tggcgcggta
    55261 agcgggtgcc acgctttcag ggtgggtaaa acagtcgcgg gcgaagcagt agttgttgca
    55321 gaaccgcaag aacccgacgc gaaagaagcc caggagtccg cgcgccagaa agtgcgcctg
    55381 ccgcgtatcg ggatgcacgc cgaagacggc gccgctctcg ttcaccagta tggagatgtc
    55441 caggcgctgc tgcgactcca ccggcacggc ccgcaccaca aatacctgca gcacgttcag
    55501 cgagcacgtc tcttttaacc agttgccgtg ggccggatcc tcgtaagtct ggctcccgtt
    55561 caagacgacc gtcgtcagcg cctcgttacc gtctcgccag ctgaagatag aaccctcgcg
    55621 cttcatgcac aggcgccaca gggccagcag gtcgcgcgcc aacatgaact cgcgacccac
    55681 gtcgccgccg gtctcgaagc ggacatagcc cagttcttcg cgcagcggcg cgtagttgcg
    55741 caggccctcc tgcacgaagc cgcggaaacc ggaccgcgac accaggtaca gcgattccac
    55801 cacaggcgag tagacgtaga cgcgaccgcc ctcgccgatg agtacgggta gcggtgggcg
    55861 gccgatggct tcgcaacgac tcacagtgcc caccggcagc aagaacttgt cgcagcacag
    55921 gaaggtcttc tccaaacctt taatattgag atgtccaaag tagccgacgc gtaacaggtc
    55981 gcagtaggtg aagaaccaac cgtttggcca gctgagacgc agcaccgtgc cgctgacgcg
    56041 acgaaccagc ttctgcaagt ccttgcgggc gtcggaggtg acagagcagc ggaaggtctc
    56101 gttgaccagc tcgacagcca gcgcgtcctc cagcgtgcgt tccttcatct cgtcgttgat
    56161 gctctggcgg cgccgccgga tttcgtcgaa acgggccgcg gaggcggcga ccgacgcgga
    56221 ggtcgtccga acgccctctg tgacgctgtc gtccggccag tcaagaaagc taaggctggc
    56281 gctgcgccgc ctaaagtgtc cgatccgcgc gggacgtcgc tgagggacgg tggctggtct
    56341 gctggggcgg gtacggccgc gggtgtccgc ggacacgtta gttatacacg gaattgagtc
    56401 acgtggcacg ttgccagctg aaaccgccgt cgtctccgcc ggcgttttct ccatcgcggg
    56461 accgcgccgt gcgcacgttc ccaggcacgc ggcccacgct ctagccgcac ttttgcttct
    56521 tggtgttagg gacgaactcg aacgttacag aatcctcgct gtcgctctcc tctttcgcgt
    56581 cgttgaagta attgccggag ttgcgatcca aaccgccgcc tcctcctccg ccgccgccgc
    56641 ccgatccacc tttggacgtc aggtagctgg tgatcttgtg ctgctcgtat ttttccttgg
    56701 aggaaagacc gtggtcgtga tcaccgccgc cgccaccgct gctcattttc cgcgtaccgg
    56761 aaccaccgcc gccaccgcgg tcgtgcttct tgccgccacc gccgccacct cctcccagac
    56821 cgccgagacc catgggctcg ttcataatat cgttatccag acccgggccg tcgtcgtgca
    56881 gaccgccggc attagccagc gaagagaggc tgccgctacc accgccgccg ccacgcgatt
    56941 tgccgctgtt cccgacgtaa tttttgtcga agggatcgcc acgctggaaa ggttcctcgg
    57001 tgagaaaatt ctccacggcg aacagaccgt tgcggctggc cacgtacaac agcgtgtcgt
    57061 gctccgtaac tatacgcaac gtgcacggca gtttggtgac ggcgcaattg agcagcgtct
    57121 ggtagaagtt cttcagctgc acgttgatac gcatgttttt cacgccgtgg aaactgacgc
    57181 ggttattggc tgtgaattcc agctcgctgc cgttggtcag gataaacttg atggccggtg
    57241 gaccggcgtg caccagaatc tgcacggtgc ccgtagggca gggcgctttt ttaacgttac
    57301 gcttgacgcg ggtatgcggc ccgatccact taagcaggtc ggccaccacg ccgaaatcta
    57361 gatccacgtg cacggccgaa ttctcgcttt cgcgcacaat gtcttggccg tgcacgcagg
    57421 ccgagctgaa ctccatattg aaatcgggcg cgcacatgga gatcttggcc gacaggtccg
    57481 agatgtcctg cacgtagaac ttggtcaggt ccttgctgga agtcaggtac atgaaattac
    57541 ccagcagcgg cgtggaattg ttaatggtct tgggctgaaa cgacttgtca gtgatgtaga
    57601 ggcatgagct gttaaaagtg atttttgaca cgcagtgact gcgtaccgtt tgcaagataa
    57661 gcgacggcgt gggcaagaag gtaaccgtgg tgttctcctt gagcgcacgg atcacagatc
    57721 gcagctgctg gatagccgtc ttgtacggct tcagccgcag cgccagcgtc ggcggctccg
    57781 agaggcgcgt cttgcgatcc atcccggaca gcgtgcaagt ctcgactaag gagcgggcgc
    57841 gagcgagcga aagttttata gagagcacac acgacgaccg ggaacgctgc gaagacgccc
    57901 ggcgtctaat aatacagccg cgccgagcca gcgggccccc gactaagagg cacagtactt
    57961 atatactccg accttaaagc gccagtggta ccacttgagc atcctggcca gaagcacgtc
    58021 gggcgtcatc cccgagtcat agtagaaaac cagggccacg cactggtcca caaacacgct
    58081 caggttcacg gccgccattt ccacgtcgtt ttggatcgcc ggtgccgcct ggaacagaca
    58141 ctgcgtcgcc ttgccctcct cctggtgctg ctccaaccac gcgtaattca ccacgggcac
    58201 gcgcagcggc ctccgcacca cggtggggaa gtaacactca cggttgggcg ggcacaatga
    58261 ccacaccgtc tcctcctcga acacggtgcc gcgcgaagcc cacactgacg gcgtcacgcc
    58321 ccacagatgc gccacctcgt cgtcgggacc caccgccaga aactgacagt tgcgcaatcc
    58381 gaactcgagc atgtcggcgc gcagcgcttc ccagcgcgcg ctggcgatgg agagccgcgg
    58441 caaccgatac aattcgaaaa tgaatttgcc ctcttgatag atggtgcgtt cgaaccactc
    58501 gcagcgcggc aaacccgact tgcacaaatc gacgctagcg cgcaccgcgg caaagtacat
    58561 gtgctcaaag atgcgctcga tcaagtccca agaggcaaag tacgtgaacc ctaaccgcat
    58621 gagcgccgtg tgcaagccag ccacgccgat gtgcagcgga cgcagttttt ccagcgcgct
    58681 ctctacccac cattcggacg ccgacattag cgcgtccaag cgcgcgttgc cccaaaccac
    58741 cgcctcggtc accaactcgc gcagcacgct caaatcaaag taacgtcgcg tgttccccaa
    58801 aaccacgtcg ggtagatgca gcttctgctc gtcgctacgc gcaaacacgc agcgagccac
    58861 gttcaccgtc agccgctgca ccggcatgtc acactcgcca aagtggcacg acgccatatc
    58921 gggactcaag cacggcggca ggcacacgct gtcggccata atcgagtact tgactacgtg
    58981 atggacaaag accaccgagg cacggccctt gagcgcgcac agcaacatct ttttcagaaa
    59041 atcgtccgtg ttcacgacca ccttggggca cgattgctcg cagcgcgaat actctttctc
    59101 gaaagccgac tcctgaccca ggtccgagag ccgccgggag acaggccgcc caaacagcga
    59161 gtagcgctgc tcacgcgcac ggtagcgctt cattaacacg ctaggcacgt tgaaagcgta
    59221 gcaaaccccc gtcaactccg acgtgctttc tttgagaata aagttaatca cgcggatagc
    59281 ggccacgtcc cacatgtcca caaacacacg taccacgggt cgatgcacct ccttctcgcg
    59341 tatcaaatcg cagtatcccc ccaggcaacg aatcacgctg ttcacatcgg cgttaagtcg
    59401 cgttacgttc accgacacag aaacgccgca actcaaggta ctcatccact tgcacatggc
    59461 cgcccaactg gcgtcacgcg agaaagggtc ggccgagatc agaaagtcgt actgcggcac
    59521 gcgatcgaaa cccacggtag acatggtgaa ggtggacagc gacagctgcc catcgcgaca
    59581 gcgcttcaac accgattcca acacctcgcc ctcgaaacgc gcatccagat ggaaacgata
    59641 gatgcgcgag tgcctactgt tctcgatagc ggccgtcaac gccacggcga tgcgcaaaaa
    59701 cacgccgccc gggctctcgt cctgtccgtg cagttggcga cacaccttat ccaaacacaa
    59761 aatggccgcg tacaagcccc agcaaccggc caattccaca aaacgcgccg tctcctcggc
    59821 cagcttgggt agatcctcca tgtgacgcag cacaaaacgg cgcaccgact catcgcacag
    59881 ctccgaagcg taacacagtg gcgtgcggct ttcacgcgcc cagttggctt tgaaataaaa
    59941 gcgacccaac agcaggtcgc aacgcggcga gtgacgaatc agacagggac cgtggcgcat
    60001 aatgagctga aatagcctga aactgcccaa accggcactg tgccgcgaca cggtgtccat
    60061 ctcgcgccac agcgcgttcc tgtcggacgg cagctcccgc gccggctcct gtacgccgca
    60121 aaagcgaaac ttgccccagt agccgtgaca atgacacttt ttgcccatca acatgcgcat
    60181 agcttgtatc ggcggcgata ctttgcagag cgaagccccg aaatcgtcct cctcctcgac
    60241 actgtccagc tccatcctgg tcgcgccggc cggattaaag gtgctcagac cgctactcac
    60301 gcgtccaccg cgactgggca cggcgggacc gctgtcacgc gtcaacgaca gcacagacgg
    60361 cgtgccgtcg ggagacggcg actcgggacg ccaactgacg acgccgccac cactcgtaaa
    60421 acccgctaca catgctacac cgctcgatac gttggtattt ccagcggacg cttccttgtc
    60481 acccccgggc agcggcccct cctcgagctc gctgtcatct cccccgatag tatcagcggc
    60541 gacctctgcc gacgattcct ccgtctcggt ttccgcgctg cggcttggaa tcctacctgg
    60601 ccggcaccga tgtgcgggca ccgaggacac ccgctgttcc tcgtccgcgt cagccggatt
    60661 cataagttta cgaggaaaat aacaaagaaa tcaggtagat ttcaataaag tgagtctaga
    60721 tggcgccgac aactacggtt tataaagtct gtgtgcgatg tgtttttttc ttctgtgtct
    60781 cctccccgta tgctgtcagc gccgctcaga cgaattctcg aaagtctccc aattcgacgc
    60841 taaagttgtc caaacggacg acggacagtt tgagttcttt gtgtaccagg aacgaggtgt
    60901 gaatgtcgtc agccaggcac cagcccagct tttgtatgac cccggtacac agagggatct
    60961 ggcgcgggcg cgtgatgcga cggttgacaa agctacagcg ctcgcgggcg aactttccgc
    61021 gtgcaacgtc gaccaaggtc tgccagtgtg cgatgctgga ggtgagcacg tagatgccgg
    61081 gacgtgtttc gggcccgtca tagtcataga cgatgattaa atacacgtat tgcagccgtc
    61141 cccgggtctc ttcccacgtc aggtacatgt ctttcggtat catcaacgcg aacacctccg
    61201 ttttgagcgt gttgtaaagg tagccgcgca tgacgcaggt gagcaacgag gtgatgccca
    61261 gcgagacggt cttgacgcag cccagcgtct cgaggcggcg gtgcagcaga tgcgggccca
    61321 ggtccagcca ctgcagcgcg gcgcgcgcgg ccgaggccgt gtacacgctt tcgagcaggc
    61381 agcgcgtgct ggccgagacg ttggaggcgc gaatgcctaa caggtaaagg ctaatgtaga
    61441 ggtgtcgcgg cgagtcgcaa cccgtctcca tgcggatgag cagcgcgccc ggctgcgcct
    61501 cgaactctac caggccctcg ggcacgaaga aacgcgccgt gagcgcctgg tgatcggcgt
    61561 ggtagagata gcgaaccgat atagtattta cctcgcgttt ggctttgagc gccgtcacta
    61621 gttcattgtc ctcgtcggcc gggtcgcgcg gccgtttggc caccgcgcgc gcgtccatga
    61681 tggcgaggcg cacggtagat ttcaaaaagt tgatagagca gctgcgggca cgggccacgg
    61741 acaaagcgga ggcgttaaat accgtgagcc aattggagat cggcgcggtg gatgcccagg
    61801 acgtgaccgc gagcgccgtg cgcgccttcg tgggtgcgtt gccgagctcg ggctaccact
    61861 ttggcttcgt gcgtcagaac gtggtctttt acctcctaag ccacgccacg gtacagacgg
    61921 cgcgcgaccc gctgtacgcc gccgagcagt tgcacgaaca gctggaccgc ttcctgcgac
    61981 accagcacga cggcggcgga gacgaggacc ggttgccgtt ctaccacaac ggggccacgc
    62041 tgacggcttt ccagaagctg ttgcagaccc tgcgcgagat ccagaccgta atagccgaac
    62101 agagcggcgg caccgcggcg gcggcggact tgatcgccag taacaacgcg tcgaccgagc
    62161 gccgcggcaa gaagggcggt tcgagttccg ggggccagca gccgctggtc cgccgggtga
    62221 tcacgcagct ggaaacggct gccacggagg cgcggcccta cgtcaattgt cgcgccgtgg
    62281 ccgaactcct ggacctgacc taccagcggc tcatctactg ggcctgcacg ctcatgccct
    62341 acgtgttgtt tcggcgcgac accgacaccg aactggacac ggtgcttctg atgcattttt
    62401 tttacacaca ctaccgttcg gttaacggcg atttggccgt ggagtttcaa aactacgtca
    62461 agaacagcgt gcggcacatg agctctttcg tcagttccga tatcgacggc gaccagaagc
    62521 ccggtgccga acacatgcgt gacgtcagct acaagctgtt cgtgggtaat ctgcaagcgc
    62581 gtgacgccag cggcctcatg tttcccatca ttagcacgcg catctccacc gtgaaccttt
    62641 acctgtcgcc cgaacgtatg tttttccacc cgggtctgat ctcgcgtctg ttgagtgagg
    62701 aagtttcgcc gcgcgccaac ctagacgctt acgcgcgcgt gtgcgatcgc gtgctggaag
    62761 accacttgca tacgccgcga cgcgtgcaac ggctactaga tctgacgcag atggtaatgc
    62821 gactggtgga actgggtttc aatcacgata cctgcgcggc ctacgcacaa atggcgctga
    62881 tccagccggc cagtcagaag agctcgctct ttgtcagcga gattcgcgag aaactcatac
    62941 agatcatcta caatttttac acgtttttca tgtgcctcta tgtgtacagc cccacgttcc
    63001 tgttcgacca ccggcggcgg ttgattttgg agcagcatcg atccacgttg atcggctcca
    63061 aggaggaact acagcacgtc tggagcaacg tgacactgaa cgtcaatacg cactttgcgg
    63121 ttcagtacac ggaagaagac tttgaggcac atacgaaggg tgccacggag gcggagcgcg
    63181 agtacctgta tcgggacctg cacagcaagt ggggcgtgca cctgtttacc ttgcgtccgt
    63241 ctcgcggcgc ggccggcgcg gcctcgcctt tgcctccgct tgacggcgtc acacgctccg
    63301 acatcttacg cgaatgcgcg ctcgttaatc tgaacgaagg ccgcgtcaac tacgcctccc
    63361 tgctagcctt cagccatcat cccgagttcc ccagcatctt cgcgcagttg gtggtggtaa
    63421 ctgagttctc ggagatcttt ggtatcccgc agggcctgtt tcaagccgtg ggttcgccgc
    63481 gtcttttcgc actcattcag ctgtgccgtg tattgttgcc cgagcaggtg acgctgtacc
    63541 agaacctggt ctccatctac aacctgacca ccttcgtcaa gcacatcgac gccgcggttt
    63601 ttaagacggt acgcgattgc gtcttcgaca tcgccacgac tctcgagcac ctcagcggtg
    63661 tacccgtcac gcccaatgtg gacctgctgg ccgagctcat ggcgcgctcc gtagcgcata
    63721 acctgtacac caccgtcaac ccgctgatcg aggacgtgat gcgcagcagc gccggcagtc
    63781 tgagaaacta tctgcgacat acgcgactct gtttcggtct ggcgcgtggc cgggcgcgcc
    63841 tctcggagga cggcgtgacg gtgtacgtgg aggtacaagg tcaatacgga ctacgcgtac
    63901 ccaccacgcg tttcgtagaa cagttgcgcg agctggttcg ccgcgatcgg ctgttggccg
    63961 agaatctgcg cggcttgaac gagcgcctgc tgagtgttcg cgtgcgcgta cgtcagatca
    64021 gcagcgacac agaggaagta agccgacacg ccaagggtca ccgcacggtg gcccagatga
    64081 gcaaggcgct caaaaagacg gcctccaaaa tcaaaatgtt ggaaacacgc gtgacattgg
    64141 cgctcgagca ggcgcaacgt tccaatggcg ccgtcgttac cgcggtgcaa cgcgcgctag
    64201 ccgtctttga cgtactaagt cgcgagaact tggaacgccg cggcgcacag ctctgtctga
    64261 cggaagcgac gagcctactg caccgacatc gcgcgctagc gccgatgacc tggcccgcgg
    64321 gcacgggcgt tgcggcggcg gccgaagcgg atggcgcctt acgcgagttc ttggaggcgc
    64381 cctgggaatc ggcgccccaa ccgccgcgac tccgcatgac gcccgacacc gatcacgaag
    64441 aatcaacggc aggcgcgacg tccgtaccgg aggtcctggg tgcgcgctac gaacccgcac
    64501 acctggccgc gagcgaccta ttaaactggt acatcgtccc cgtaagccag gcgcagcagg
    64561 acatcttgtc ttcgatcgac ccgcccgccg gctcgacatc ggtgtccctg ccgccggcct
    64621 cgccatgaaa gtcacacagg ccagctgcca ccagggcgac atcgctcgct ttggagcgcg
    64681 agcgggcaat caatgcgtct gcaacggcat catgttccta cacgccttgc acctgggtgg
    64741 aacgagcgcc gtcctgcaga ccgaggcgct ggacgccatc atggaagagg gcgcgcgtct
    64801 ggacgcgcgg ctagagcgcg agttgcaaaa gaagctgccc gccggcgggc ggctgccggt
    64861 ctacagactg ggcgacgaag tgccgcgccg cctggagtcg cggttcggcc ggaccgtgca
    64921 cgcgctctcg cggcccttca acggcaccac cgagacgtgc gacctggacg gctacatgtg
    64981 tccgggcatc ttcgactttc tgcggtacgc gcacgccaaa ccgcgtccca cctacgtact
    65041 cgtcaccgtc aactcgttgg cgcgcgccgt ggtcttcacc gaggaccaca tgttggtctt
    65101 tgatccgcac agctccgcgg aatgtcacaa cgccgccgtg tatcactgcg agggtctcca
    65161 tcaggtgctg atggtgctca cgggcttcgg cgtgcagctg tcgcccgctt tctactatga
    65221 ggcccttttt ctctacatgc tggatgtggc gaccgtacca gaggctgaga tcgccgcgcg
    65281 tttggtctcc acctatcgcg accgcgatat cgacctcacc ggcgtcgtcc gagaaagcgc
    65341 ggacacggca gcgacaacga ccaccgccgc accttcctta cctccgctgc ccgaccccat
    65401 cgtcgacccg ggttgccctc ctggcgtggc gcccagcatt cccgtctacg atccctcgtc
    65461 ctcacccaaa aaaacacccg agaaacgccg caaggacctc agcggtagca aacacggagg
    65521 caaaaagaaa cccccgtcca cgacgtccaa aacactggcc accgcctcct cctccccctc
    65581 agcgatagcg gcggcctctt cttcgtccgc ggtaccaccg tcctacagct gcggcgaagg
    65641 ggccctgccg gccctgggcc gctaccaaca gctggtcgac gaggtagagc aggagttgaa
    65701 ggctctgacg ctgccgccgt tgcctgccaa caccagcgcc tggacgttgc acgcggcggg
    65761 taccgaaagc ggcgctaacg cggcaacggc cacggcgccg tccttcgacg aagctttcct
    65821 caccgatcgt ctccagcagc tcatcatcca tgccgtcaat cagcgctcgt gtctgcgtcg
    65881 cccctgcggt ccgcaatcgg cggcgcagca ggcggtacgc gcctatctgg gcctatccaa
    65941 gaaactggat gcctttctgc tcaactggct gcaccacggc ctggatctgc agcgcatgca
    66001 cgactacctg agccacaaga ccaccaaagg cacgtactcg acgctggatc gcgcactgct
    66061 ggagaaaatg caagtcgtct tcgatcccta cggacgtcag cacggcccgg cgctcatcgc
    66121 ctgggtggag gagatgctgc gctacgtgga aagcaagccc actaacgaac tgtctcaacg
    66181 actgcaacgt ttcgtaacca agcgaccgat gcccgttagc gacagcttcg tctgcctgcg
    66241 acccgtagac tttcagcgtc tgacgcaggt catcgaacag cgacgtcggg tgttgcaacg
    66301 tcaacgcgag gaataccacg gcgtttacga gcacttggcc ggcctcatca ccagcatcga
    66361 cattcacgac ctagacgcca gcgatctgaa ccgacgcgaa attctgaaag cgctgcagcc
    66421 gttggacgac aacgccaagc aggaactctt tcgcctgggc aacgccaaaa tgctagagtt
    66481 gcagatggac ctggaccgtc tgagcacgca gctgctgacg cgcgtgcaca atcacatcct
    66541 taacggcttt ttgccggtag aggacctgaa gcagatggaa cgcgtcgtcg agcaggtact
    66601 gagactcttt tacgacctgc gcgacctgaa actgtgtgac ggcagctacg aagagggatt
    66661 cgtcgtcata cgcgaacaac tgagctacct catgacgggc actgtgcgcg acaacgtacc
    66721 gctactgcaa gagatcctgc agctgcgaca cgcgtaccag caagccacgc agcaaaacga
    66781 gggtcgcctc acgcagatcc acgacctgct tcatgtcatc gagacgctgg tgcgcgaccc
    66841 gggcagccgc ggctcggcgc tgacactggc cttggtacag gagcagctag ctcagctgga
    66901 agcgctaggc ggcctgcagc tacccgaagt gcagcagcgc ctacagaacg cgcaactcgc
    66961 gctaagccgc ctctacgaag aggaagagga aacgcagcgt ttcctcgacg gactctcgta
    67021 cgacgatccg cccaccgaac agaccatcaa gcgacaccca caattacgcg agatgttacg
    67081 tcgcgacgaa cagacgcgtc tgcgactcat caacgccgta ctgagcatgt tccacacatt
    67141 agtgatgcga ctggcgcgcg acgagtcgcc gcgaccgacg ttttttgacg ccgtcagtct
    67201 gttattgcag caactgccac ccgactcgca tgaacgtgag gatctgcgtg ccgccaacgc
    67261 cacgtacgcg cagatggtca agaaactgga gcagatcgag aaagccggta ccggcgcatc
    67321 cgaaaaacgc ttccaagcgt tacgggagtt ggtttacttt ttccgtaatc atgaatattt
    67381 ctttcaacat atggttggac gactgggcgt cggacctcag gtaacggaac tctacgagcg
    67441 atatcaacac gagatggaag aacagcacct ggaacggctg gaacgtgaat ggcaagaaga
    67501 ggccggcaag ctcacggtaa cttctgtgga ggacgtgcag cgtgtcttgg cccgggcacc
    67561 gagccatcgt gtcatgcatc aaatgcaaca aacgttaacc accaagatgc aagacttttt
    67621 agacaaggag aaacgtaaac aggaagaaca gcaacggcag ctactggacg gctaccaaaa
    67681 aaaggtacag caggatttgc aacgcgtggt ggacgccgtt aagggcgaga tgctctccac
    67741 catcccgcac caaccactgg aggccacact cgagctgctc ttgggcctag atcaacgcgc
    67801 ccaaccgcta ctggacaagt tcaaccagga cttgctgtcg gcgctgcagc agctgagcaa
    67861 aaaactagac gggcggatca acgagtgtct gcacggcgtg ctaacgggtg atgtagagcg
    67921 gcgctgtcac ccgcaccgag aagcggctat gcaaacccaa gcctcgctaa accacttgga
    67981 ccaaattttg ggtccacaac tcctgatcca tgagacgcag caggccctgc aacacgccgt
    68041 ccatcaagcg cagttcatcg agaagtgtca acagggcgat ccaactacag ccatcacggg
    68101 tagcgaattc gagagcgact ttgcacgcta ccgcagcagt caacagaaga tggagggaca
    68161 attacaagag actagacaac agatgaccga gactagcgag cggctagatc gctcgctgcg
    68221 ccaggatccc gggagcagct ccgtcacgcg tgtacccgag aaacctttca agggtcagga
    68281 gctggcgggt cggatcacgc ccccgcccgc cgacttccag cggcccgtct tcaaaacgct
    68341 gctagatcag caggccgacg cggcccggaa agcgctcagc gacgaggccg atctgctgaa
    68401 tcagaaagta cagacgcagt tgcgacaacg cgacgagcag ctgagcacgg cgcagaacct
    68461 gtggactgat ctggtcacgc gccacaaaat gagcggcgga ctggacgtga ccacccccga
    68521 cgccaaggcg ctgatggaaa agccgctgga gacacttcgc gagctgttgg gcaaagccac
    68581 gcaacaactg ccgtacctgt cggcggagcg cacggtgcgc tggatgctgg cttttctgga
    68641 ggaagccctt gcgcaaatca ccgcggaccc tacgcacccg catcacggaa gcaggaccca
    68701 ctaccggaac ctgcaacagc aagctgtcga gagcgccgtg acgctagcgc atcaaatcga
    68761 acaaaacgca gcctgtgaaa attttattgc acagcatcaa gaggcgactg ccaacggcgc
    68821 gtccacgccg cgggtcgaca tggtccaggc ggtggaagcg gtctggcagc gactggaacc
    68881 cggacgcgta gccggcggcg ccgcgcgtca tcaaaaagtg caggaactgt tgcagcgctt
    68941 gggtcagacg ctaggcgacc tagaactgca ggaaacgttg gcgacggaat actttgcgct
    69001 gttacacggc atccagacct tcagctacgg gctggacttt cggtcgcagt tggaaaagat
    69061 ccgcgatctg cggactcgtt ttgcggaact ggccaagcga tgcggtacac gtctctccaa
    69121 cgagggagcc ctgcccaacc cacggaaacc gcaggcgacg acttcgctgg gcgcctttac
    69181 acgcgggttg aacgcactgg aacgacacgt ccagctgggt caccagtatc tgctcaacaa
    69241 gctcaacggc tcatcgctag tctataggct ggaagacatt cctagcgtgc ttccgccaac
    69301 acacgagacc gaccccgcgc tgatcatgcg cgaccgcctg cgtcgtctat gcttcgcgcg
    69361 tcaccacgac acctttcttg aagtggtaga cgtcttcggc atgcggcaaa tcgtcacgca
    69421 ggccggcgag cccatttacc tggtcaccga ttacggcaac gtagccttta agtacttggc
    69481 gctgcgagac gatggccgac ccctggcatg gcggcgccgc tgtagcggcg gaggactcaa
    69541 gaacgtcgtc accacacgtt ataaagccat cacggtagcc gtggccgtct gtcagacatt
    69601 gcgcactttc tggccgcaga tctcgcagta cgacctacgg ccctacctca cgcagcatca
    69661 gagccacacg caccccgcgg agactcacac gttacataac cttaagctct tttgttatct
    69721 ggtgagcacc gcctggcacc agcgcatcga cacgcagcag gagctgacgg ccgccgatcg
    69781 cgtaggcagc ggcgaaggtg gtgacgtagg ggaacagaga ccgggccgcg gcaccgtgct
    69841 gcgtctgagt ctccaagagt tttgtgtact catagcagct ctgtaccccg agtacatcta
    69901 caccgtcctc aagtacccgg tgcagatgtc gctaccctcc ctcacagctc acctacatca
    69961 ggatgtaata cacgcggtag tcaataacac acacaaaatg ccccccgacc acctccccga
    70021 acaggtcaag gctttctgta tcacccccac ccaatggccc gccatgcagc tcaataaact
    70081 gttttgggaa aataaactgg tgcagcaact gtgccaggta ggcccgcaaa aaagcacacc
    70141 atccctaggc aagctatggc tctacgccat ggccacgctg gtctttccac aagacatgct
    70201 gcagtgtctg tggctagaac tgaaacccca gtacgccgag acctacgcct cggtgtccga
    70261 attggtacag acgttgtttc agattttcac gcaacaatgc gagatggtga ccgaggggta
    70321 cacgcaaccg cagctcccca ccggagagcc ggtgcttcag atgatccgcg tgcgacgcca
    70381 agacacaacc accacagaca caaacacgac cacagagcca ggacttttag atgtttttat
    70441 tcaaacagaa accgccctag actacgcgct gggctcctgg cttttcggca tacccgtgtg
    70501 tctcggcgtg cacgtagccg acctgctgaa aggccaacgt gtattagtag cgcgccacct
    70561 cgaatacacg tcgcgagacc gcgacttcct ccgcatccaa cgctcccggg acctcaatct
    70621 cagtcaactg ctccaggaca cgtggaccga aacgccgctg gagcactgct ggctacaagc
    70681 ccaaatcaga cggctacgcg attacctgcg tttccccacc cgcttagagt ttattcccct
    70741 agtcatttac aacgcacagg accacaccgt tgtacgcgtg ctgcgaccgc cctccacgtt
    70801 cgaacaggac cacagtcggc tggtgttgga cgaggccttc cccaccttcc cgctgtatga
    70861 ccaagatgat aacacatccg cggacaacgt cgctgcgtct ggcgccgctc caacaccgcc
    70921 ggtacctttc aaccgcgtac cagtcaatat tcagtttctg cgtgaaaacc cgccacccat
    70981 cgcacgagtt cagcagccgc cgcgccgaca tcgtcatcga gcggccgcgg ccgcagacga
    71041 cgacggacag atagatcacg cacaagacga tacatcaagg acagccgact ctgcattagt
    71101 ctccaccgcc tttggcgggt ccgtctttca agaaaaccgg ctgggagaaa caccactatg
    71161 tcgagatgaa cttgtggccg tggcacccgg cgccgccagc accagtttcg cctcgccgcc
    71221 tatcacggtg ctcacgcaga acgtcctcag tgctctagaa atattgcgac tagtgcgatt
    71281 ggacctgcga caactggcgc aatccgtaca ggacactatt caacacatgc ggtttctcta
    71341 tcttttgtaa ccgacactga cagtagcggg caataaaaac aagaggattg ttatcgtttt
    71401 ttatgataca aaacaacgtg tcactttcac ggtgatttat tcttgctatt acttttcccc
    71461 atgggctgtc agcgtcgggt gcgcgacacg gctatcatgc gcaacaggtc cagcttaaag
    71521 gcgcacttgt cgttaaacag actggacatg cgcgtatact tgctcagcat ggtggccagc
    71581 accgggtggg tggcctctga gatctcggtc ggcaactcca aaacgacgtt gacgacgtga
    71641 cggtgttttt cgtcccgctt gttggccacc gtgggtcccg gcgcggtgtt agacatgggg
    71701 caggccgtgg ggggaggacg aggaggacgt cgctgctaaa ccgccgcgcg cctgctgcac
    71761 aatgtggccg ccgacgtggc aggcggtctg tttaaccagc gcgcagcctc gacacagcgg
    71821 ggcgccgtct tcgctttcca aacagctgtc gcggtactcg cccgtctgac agcgcgcgca
    71881 cagcaggccg tgcccgtgcg aagtgagacg caggagacgc gggaccgtca cgccgcgtac
    71941 caccacagtg gagtcgcagg tgcgtgccgc gcagggcaga atgacgtcga aagccagccg
    72001 gtgatcgtac acggcacaag ccgcgttgag gcccagcacg gctttccagc ccacgcgtac
    72061 gcagcgctgt ccaaagagcg tctcggagac gagctcgtag acgcgctgcc gcactacccg
    72121 ctgactgccg cagagcgagc agtgtacgag ctcggcgtgc gtgttgaaga tgacgctctt
    72181 ttcttgacgg tcccgataat agaacatcga gttgagcgga aaattttgct ggcagtgtag
    72241 cttttcctta cccaggttga ggcagtgtcc gcactgccga cagaccacgg ccaccagcga
    72301 gcgcgcatcc agatggcgct cgcacttgag tcgacacaga caccagagcg gcaggtcgat
    72361 gacgctgccg atgaggccgc cgcgcagcgc ggcgctgagt gcaaagagga cgatcttggt
    72421 gggctctacg tgatgcgcct gctgtccggc gcccgcgtgt cctaccgccg cagctgccgc
    72481 cgtcgagcct cctccgcgcg tctcgtcgtg cagacccagt gcccgcaacg gcaccaggta
    72541 tcgcggacac gtgtcgcaaa acgtctgcac cgcttgtcgg gccagtacgt agagcgggtt
    72601 tccgcagggt accttcccgg cgtgccgacg caaggctgcg atgaggcccc gcagctgcgg
    72661 cgaccgcggc tgccgttggt gacaccactg gttacggtgg tatacggcca aatcagcgcg
    72721 ggcgtcgaag cgcttggcgc gtagtagtgc taggcacggc gagctggtgg ggtgaagcac
    72781 gggcagccga aggtccaccc cgaaaaggaa acggtgaagg tcacctagca gcgagacggt
    72841 gacaccgtcc aacaacgcgt gcagccgctc gggcgggtag agccgcagac ggcgcagcag
    72901 gtagtcggtg tcgtagcgtt cgaaacgcag aaaggccatc gtgcggacgg ccacggtgtg
    72961 cagacagtcc atgctgtaga cgtaagcgag aaacacaaag tagggcttgg tcataaccat
    73021 acgctgaaag agcgccgtca ccgcctcccg ctcggcctgc cgacacacca gccattcgcg
    73081 caggaagcgt tggtagagac ggtcgcccag ctcgcgattc agaaagcgct tatccgtcac
    73141 gaagagatga aggacgcaag aacgtggcac gtgatgcacc agctgctgct ggaggaccgc
    73201 cgacgtctgc gccgcaaact gcgccggtgg ctgcgacgtt tctaccgccg cttcctccgg
    73261 ctgcagcgca ccgcggccga tcaccagctg cacatggaaa tggtcctcgt gaacgcagag
    73321 gggcgcgaag agacggcgca gagcctggtg gaactcatca gtcgcggtgt gcggagcgtg
    73381 tcggagacga cgattggcca tgaccgcgcc acagcagagc cagcaccagc agaagagcca
    73441 gcaccagcgg gcccagagtc gcaaagcgcg cgggcagcca cggcccagac tgcggtcgcg
    73501 atggcccgga gcgcgctcgc caccacgatg acggtgccca acgataacca gtccgctcca
    73561 aggacggcgt gcacggcgga gacggcggat gacggtgatg ggtcgacacc cctcgccgac
    73621 gactcacgtg ctcctccaga ggccgacgcg cggaccctcc gatgtcctgg cccgccgctg
    73681 ccgctgccgc cttcccttct cccgccagag ccagcaactc ctcctcctct tcatcagcgt
    73741 ctccctcgct tgcgcatccg catcgtccca tacaggcctc acaacgacac agccgccacg
    73801 accccgccgc catgggtggc ggcggcggcc gaggcccggc agcggcgccg ccagcggcga
    73861 ccatggtggg agagcaactc ggatgacgag gaggaggagg agggggagat gcggtccgag
    73921 gggaccgctt tcccgccgtt cgcgtgagcg cggccgacat gcgggcgcgc cacagagatg
    73981 gaccactgcc gctgtgactg cttacggtga cgtggttccg gaccgccaac gacgtcgacg
    74041 cggctttctt ggcgtacagc tcgcgcagca gattctcgta ctcgccctcg ttttcgggtc
    74101 cgaaggcgat gagctcgatg ttgaacaccg acgccgaatt ggatttgcgc accacgcact
    74161 tcgtcagcac tccgtaggcc gagggcttga tctcctcgat gtccttgagc gtgacgatga
    74221 gcgactcgtt caccttaagc acattgaact cacctacgtg gcgcgccggc gagacgagct
    74281 tgacgggcgc tcgcacaaaa cagcagaggg agacggcgca gccagtgttt ttaaagataa
    74341 aacaaggcac gtggtctgtg cggctctccc agtagctgag cagatattcg acacaataga
    74401 ccgtgtctgt cttgagcatg gcgtcgcaca ccgagtaatt gggattttta cagataaggc
    74461 cggcgtcggt gacgcgcagc tcgctaggac ccaacttgag gatacgccgc gtggcctgca
    74521 ccagatcctg atggagaacc ttgttcatct ccatcgcacc gacgccaccg ccgatttatt
    74581 tacccggcgc cggctcgtct tttccctcca ggattccgtt aatgtccatg agcttgctga
    74641 cgatcgccgt taatagttgc gtcttctcac ggaggatctc tccgtgactg caggtcgcgc
    74701 agtcgccgtg cacgtacttg aggaaggcgg cgtacttctg acccgcgttc acgaaattta
    74761 agcgcgcgtc cagagagggc agcaacagat cgtagacgcg cggcagcatc ggctcgaact
    74821 gtaatagcag atcgtcgtca agatcgggta gcgcgtgtcc gtcttcaccg tcctcgtcgt
    74881 caccacctcc cccctcgagc ccaccgctcg taccagccgc gggctccgcg tcctcgtcga
    74941 tcaccagcgg tcgcgtcggc accggagaat ccacgtcatc ctgcacgtcg ttttcctcct
    75001 ctccgtcgtc atcgtccaga aacggcaccc gctgcttagc ccaggacatt ctttttccgc
    75061 gtcctcaatc agcggcgccg atcgccatga atccgagtac ccacgtgagc agtaacggcc
    75121 caacgactcc ccctcacggg ccccacacca cgtttcttcc cccgaccagc ccggccccgt
    75181 ccaccagctc cgtcgccgcc gctaccttgt gcagtccgca acgacaggcc gtttcgcgtt
    75241 acagcggctg gagcaccgag tacacccagt ggcactcgga cttgacaact gagctgctat
    75301 ggcacgcgca cccgcgtcaa gtacctatgg acgaagcgct ggccgccgcg gcggccgcct
    75361 cataccaggt gaatcctcaa caccccgcca accgttaccg tcactacgaa ttccagacgc
    75421 tcagcctcgg cacctcggag gtagacgaac tgctcaactg ctgtgcggaa gaaaccacgt
    75481 gcggcggcac gcaatccacc gtactcacca atgcgaccaa caccactagc tgcggcggag
    75541 ccgtcgccgg cagtagcaac gcaggacccg ccggcgcttc ggccgcctgc gacctagatg
    75601 cagaactggc cggcctcgaa acctcggcgg ccgactttga acaactgcgg cgactgtgcg
    75661 cgccgctggc catcgacacg cgctgtaacc tatgcgccat catcagcatc tgcctcaaac
    75721 aggactgcga ccagagctgg ctcctcgagt acagcttgct gtgcttcaaa tgcagttacg
    75781 cgccccgtgc ggcgctcagc acgctcatca tcatgtccga gtttacgcat ctgctgcagc
    75841 agcacttttc cgatctgcgc atcgacgacc tgttccgaca ccacgttctc acggtcttcg
    75901 atttccacct gcactttttc ataaatcgtt gctttgaaaa acaagtgggc gacgcggttg
    75961 ataacgagaa tgtcaccctg aaccatctag ccgtggtgcg ggccatggtc atgggcgaag
    76021 acacggtgcc ttacaacaag cctcggcgcc acccgcaaca gaagcaaaaa aacaaccctt
    76081 atcacgtcga agtgccgcaa gaactgatcg acaactttct agaacacagc tcacctagcc
    76141 gcgaccgctt cgtgcagctg cttttctata tgtgggccgg caccggcgtc atgagcacca
    76201 cgccactcac ggaacttacg cacactaagt tcgcgcgact agacgcgtta tccacggcct
    76261 cggaaagaga agacgcaagg atgatgatgg aagaagagga ggatgaagaa ggaggagaaa
    76321 aaggaggaga cgatccgggc cgtcacaacg gcggtggcac cagcgggggg ttcagcgaga
    76381 gcacgctaaa aaagaacgtg ggtcccattt acctatgtcc cgtacccgcc ttttttacca
    76441 agaaccaaac tagtaccgtg tgtctgctgt gcgaactcat ggcctgctcc tattacgata
    76501 acgtcgtcct gcgcgagctg taccgccgcg tcgtctcgta ctgtcagaac aatgtgaaga
    76561 tggtggaccg cattcagctg gtattggccg acctgttgcg cgaatgcacg tcgccgctcg
    76621 gcgcggcgca cgaggacgtg gcgcgctgtg gactcgaagc gcccacctcg cccggaggcg
    76681 actcggacta tcacggcctg agcggcgtcg acggcgcact ggcgcgaccc gacccggtat
    76741 tttgccacgt cctgcgtcag gcgggcgtca cgggcatcta caagcacttt ttctgcgacc
    76801 cgcagtgcgc cggcaacatc cgcgtcacca acgaggccgt gctcttcgga cacctgcacc
    76861 cccaccacgt ccaggaggtg aaactggcca tctgtcacga caattactat ataagtcgac
    76921 ttccgcgacg tgtgtggctc tgcatcacac tcttcaaggc ctttcagatt acaaaacgca
    76981 cctacaaagg caaagtgcac ctggcggact ttatgcgcga tttcacgcag ctgttggaga
    77041 attgcgacat caagctggtg gaccccacgt acgtgataga caagtatgtc tagcgtgagc
    77101 ggcgtgcgca cgccgcgcga acgacgctcg gccttgcgct ccctgctccg caagcgccgc
    77161 caacgcgagc tggccagcaa agtggcgtca acggtgaacg gcgctacgtc ggccaacaac
    77221 cacggcgaac cgccgtcgcc ggccgacgcg cgcccgcgcc tcacgctgca cgacctgcac
    77281 gacatcttcc gcgagcaccc cgaactagag ctcaagtacc tcaacatgat gaagatggcc
    77341 atcacgggca aagagtccat ctgcttaccc ttcaatttcc actcgcaccg gcagcacacc
    77401 tgcctcgaca tctcgccgta cggcaacgag caggtctcgc gcatcgcctg cacttcgtgc
    77461 gaggacaacc gcatcctgcc caccgcctcc gacgccatgg tggccttcat caatcagacg
    77521 tccaacatca tgaaaaatag aaacttttat tacgggttct gtaagagcag cgagctactc
    77581 aagctctcca ccaaccagcc gcccatcttc caaatttatt acctgctgca cgccgctaac
    77641 cacgacatcg tgccctttat gcacgccgag aacggccggt tgcacatgca cgtcatcttc
    77701 gaaaactccg acgtgcacat cccctgcgac tgcatcacgc agatgctcac ggcggcgcgc
    77761 gaagactaca gcgtcacgct caacatcgtg cgcgaccacg tcgttatcag cgtgctgtgt
    77821 cacgccgtct cggccagcag cgtcaagatc gacgtgacta ttttgcaacg caagattgac
    77881 gagatggaca ttcccaacga cgtgagcgag tcctttgagc gctacaaaga gctcattcag
    77941 gagctgtgtc agtccagcgg caacaaccta tacgaggagg ccacgtcgtc ctacgcaata
    78001 cggtctccct taaccgcgtc gccgttgcac gtagtttcca ccaacggctg cggcccctcc
    78061 tcctcgtctc agtccacgcc gcctcatctc cacccgccgt cgcaggcgac gcagccccac
    78121 cactactctc accaccagtc tcagtctcag cagcatcatc accgtcccca gtcaccaccg
    78181 ccgccgctgt ttctcaacag cattcgtgcg ccttgacact gtacggcaga aaagccggct
    78241 ccaagtgcaa gcgccgcggc agcaccatgt gcaaaaactt gtccttgcgc gcggtttcgc
    78301 cgccgggaaa gacgggcgac agcacgttgg ttacagcctt gagaacctgc tcaaagtact
    78361 tgtcggcgtg aatgggcacg ccgtgctcgc gcacgtagct cggatcttcg gctacctcgt
    78421 agttgcacac ggccgacggt ggtttccgcg ccctcttctt tgccggctct cctcctctcc
    78481 tgttgctctc ctctaccccg ccgccgtcag cgtcgtcgtc cgtgccatca atcgcgtccg
    78541 accgggaaac cacgccggtg gttacagaat caccgttgtc ggaggaaccc tgcggcgccg
    78601 cccggacacc gggcgccgtc aggacgtaaa agacccgatc cccgaccgag ggtagctcct
    78661 cagaacgggc cgccaatcgc ttaatgacgg caatgtgcgg caggttagat tgacggtaca
    78721 acgagatgtc cttagaaagc accgacgaaa gcaccaggtc ctcaacacgc acacggtgca
    78781 ggtacagatc gtcgcgggcc tgcaccaggc ggcgcaagat acgccagaaa ccgcgtggca
    78841 caccgtattt cttaacttca tcgagtgaga ggcgcgacag gcgcacggct gcttccgaga
    78901 cctcgcgatc ctcaaagagc agcgagagga cgtcacgcgt gacgcccttg acgaactcgc
    78961 aggccgtctt gcgcaccaga tccacgccct tcatgctcag acccgaggcg ccctccactt
    79021 tgccgatgta acgtttcttg cagatcatca taagagagac gaagaccttt tcaaactcca
    79081 gcttgacggg ctccacaaaa agacaagccg tcacgtagtg cgccaggctg ggcccacgcg
    79141 ccaccagagc ctgcggcgtc aggccacgaa agcggacaaa cacgctgtcc gtgtccccgt
    79201 agatgacccg cgcctccacc cgccgttcgt ttaagccccc tgatgatgtt tcgagcccct
    79261 ccggtaacgt gctgctctcc tccgaatccc cctcccgcgt tcctactaca tagtcttcct
    79321 gattaaaaaa attgtgcaaa aaacacggct ctgaaaagtt gtctttgatg aaccgcgccg
    79381 tgcgctctag catgtcgcga ccgatgcgcg taatgctggc ggcgatgggc agacacggca
    79441 tcatgccgtt gaccacgccg gtaaaaccgt agaaagcgtt gcacgttact ttgagcgcca
    79501 tctgttcctt gtcgagcagc atacggcgca cggggtcttg acactcgcgc atgcattcgc
    79561 gcacggcacg ccgctgcgaa acccacttgt tgagcagttc cgaaagcacc gagacgcgca
    79621 ccgaagcacg cacaaagcgg tgtgtcacgc cgttctctag cgtgacgctg tatacgtcgg
    79681 cagggtccac ggggtactcg ccacccggca ccagcagggt ggagtagcag aggttgtgag
    79741 ccatgatgat ggaagggtag aggctggcaa agtcgaacac ggccacgggg tcgttgtagt
    79801 aacccacctc gggctcaaac accgtggcgc cctggtacga aaccgccgca gtaccaccgg
    79861 cgccgtgatt gtcgttggaa acgccgacgc cgccactact gccggagccg acgctgaaaa
    79921 cgccgacgct gctactactg ttactgccgg agccgggtga aacgccgtcc tgactggacg
    79981 gcgcagattg caagggcggc gacatctgaa acatagccgc cacagaaccc gcgtcgccgg
    80041 gcacggcggc ggtagagatg atagcggcgt taggtgacac ggcaacacta ttcgtttcgg
    80101 gcaccgtcgt acctttgctg tagtggttgg gcaggataaa atcgcggcag gcgcactcgt
    80161 ccagcagcga ggtgtagata cggatctgct gtccgtcaaa gatgacacgc cgcaacggaa
    80221 ttttagccag ccgcgcgatg gccccggcct cgtagtgaaa attaatggtg ttgaacagat
    80281 cgcgcaccaa tacggcgtcc tgcagacagt aacggcctac ctgggcgcgg ccctcggcat
    80341 tagccacgaa acaacgcggg atgtccttgt aggacaggtc atccttgcgt tgccgcaggt
    80401 aaagctcggc catagtgttg agcttatagt tgggcgagtt agtcttggcc atgcatacgg
    80461 ggtacatgtc gataaccacc gaacccgcaa tatacacctt ggtggcggcc gtgctggccg
    80521 gattgttgtg agaagccgag ggaaaggcgg cggcgtactg ccgcttaaaa cccacggcgg
    80581 ggctgtgtaa aaagaaacgg ccgccctgcg ccgtaggcaa cttgcagaag cgctgcgagt
    80641 ccaccttata caggtactcg aggcgcgtga ggatgtactt caagtcaaaa gagttgatgt
    80701 tgtaaccggt cacaaaggcc ggcgcgtacc gttgaaagaa aagcataaag cccagcagca
    80761 gctcgtattc ggaagggaac tcgtagacgt ccacgtctgg gcccacctgc ccgcaggtgc
    80821 cgatcgtgaa gagatgaaga cccgagtgcc caaagatcac accctccgaa gtgcagcccc
    80881 ggccatcgtt cccgtttggg atcccctgat ccacggcggt gtttcccccc gtctcgtagc
    80941 acacgcacga gatctgaatg acaatgtcat cggacttctc ggcgcaggga aaaccaccct
    81001 cgccgctcat gcactcgata tcgaaggaca ggcatcgata gcgcggccac gagctgtcgt
    81061 cgggcacggc caccaggtca gagacatcgc agtcgacctc gatatcacaa gtcgacgcgc
    81121 gaccctgctg ccgccagtcg taacgattca cggagcacca gccgaacgtg gtgatccgcc
    81181 gatcgatgac caaacgcgtc agcggatcca cacggacctc gtacacggga aaaccctgct
    81241 ccagcagata ctcgccgatt tttctggcca tggtccagtt gctgatagac acacactgca
    81301 aatcgggcac gggtcgcgtc ccgtacccgt agatcgaggt tttggtggcc ggcgtgacag
    81361 acacggcgta tggcgtccgc ggttcgggca ctagttcgcc cacgctggca atgacctcac
    81421 gcagcctatc ggtgtcgctg tactcacagt aaaagtagct gcgctgcccg aaaacgttga
    81481 cgcagatact gtagccgtgt tctgtggccc cgaagaaacg caacacgttc cccgaaggca
    81541 ccagatgctg acgatagcgc ggcgacacgt tttcgggcga gtcgaagaag agcacggcgt
    81601 ccgtctgatc gtaggtgtga aaacgaatag gtcccaccac gcgacccacc agggtctcgc
    81661 gccaaggaca cggccaaacc atgtcatgac tcaacaaatg tttaatctct cgatagaaca
    81721 tgagaggcag ccgtcccgtt ttatgcttga tcaaccccgt ctgaccgtcg aacatgacgc
    81781 ctcgcggcac gatctgcaaa aactgtttct gtggcggccg cttgcccgag ccctgcgcgg
    81841 agccgggctg cgaacgctga cgccggccac ccgcgaccgc accgccggtc acgccgccgc
    81901 tcagatacgg gttgaaaaac atagcggacc gtgagaggct gacagcttac gaagcaaaat
    81961 cacaaagaaa atacacatgc agcacctaga tatccagttt aaccccgtat atcacaagtc
    82021 tctgtgtcac tttttttttg tctgtttttt ttttcttctc ctggttcaga cgttctcttc
    82081 ttcgtcagag tctttcaagt gtcggtagcc gtttttgcga tgtcgcagtc ggtctagtag
    82141 gttgggcttc tgtcccttgt cctgcgtgcc agtccgtccg tccaaagaat ctgtaccgtt
    82201 ctgctgcgct cgctgctctg cgtccagacg ggccagggcc agaagcatct ggtaagcctg
    82261 ctcgttggtg taaggcggag ccgccgtgga tgcatcagac gacggtggtc ccggtccttt
    82321 gcgaccagaa ttataaacac tttcctcgta ggaaggcgga gcctgtaacg acgtgtcttt
    82381 ggtgctgccc gacgtcacgg tggtcccgtc ggcggacacc agatagggaa agaggttctg
    82441 cagcggctgc gtgcacaaac gccgctgtcg agtatagatc aaataagtga taatgactac
    82501 agctatggcc acgaggatga tggtgaacgc tccgaagggg tttttgagga aggtggcaac
    82561 gccttcgacc acggaggcca ccgcgccacc cacggcccca atggctacgc caacggcctt
    82621 tcccgcggcg cccaggccgc tcatgaggtc gtccagaccc ttgaggtagg gcggtagcgg
    82681 gtcgactacc ttgtcctcca cgtactttac ccgctgcttg tacgagttga attcgcgcat
    82741 gatctcttcg aggtcaaaaa cgttgctgga acgcagctct ttctgcgagt aaagttccag
    82801 taccctgaag tcggtatttt ccagcgggtc gatatccagg gcgatcatgc tgtcgacggt
    82861 ggagatactg ctgaggtcaa tcatgcgttt gaagaggtag tccacgtact cgtaggccga
    82921 gttcccggcg atgaagatct tgaggctggg aagctgacat tcctcagtgc ggtggttgcc
    82981 caacaggatt tcgttgtcct cgcccagttg accgtactgc acgtacgagc tgttggcgaa
    83041 attaaagatg accacgggtc gtgagtagca gcgtcctggc gactccttca cgttcatatc
    83101 acgcagcacc ttgacgctgg tttggttgat ggtcacgcag ctggccaggc ccaagacatc
    83161 acccatgaaa cgcgcggcaa tcggtttgtt gtaaatggcc gagagaatgg ctgacgggtt
    83221 gatcttgctg agttccttga agacctctag ggtgcgccgt tgatccacac accaggcttc
    83281 tgcgatttgc gccagcgccc ggttgatgta accgcgcaac gtgtcatagg tgaactgcag
    83341 ctgggcgtag accagattgt gcaccgattc catgttggat aaatgagttg cattgttgcc
    83401 atctgtactt cttttggttc tattatgagt aagattcaga ctggagcggt tggccaaacg
    83461 ttcgagttcc accagagatt tttgcttgat accttgccag aacactacca aaccaccagt
    83521 ggtttcaaag acggacacgt ttccatattt ttcatatgtt tgattgtatg aagtattgaa
    83581 aatctgctgt aacttattta tagcctcatc acgtacgcag tccagcgcag agtcggacat
    83641 gttcacctct tgcttcttag ataagaaagt ggcggtcatt ttggcagaag aaaagtgata
    83701 cgagtcctcg gcttcggaac gaatggtgcg ttccgaggct tcccagaaag tgagttgaca
    83761 agtgacattc ttttcgtcct gtatatccca ggagatcacc gagtccgcac gttcaagaaa
    83821 agccaccaac ctgtgggtct ctaacgcaga attcggtctt ccaaagtcgg agacgatagt
    83881 gtagttcgga aaaatgaaaa acttgtcggc gttttctcca aagtagctgg cattgcgatt
    83941 ggttccgttg tagaaaggag aaatgtcaac cacgtcaccc gtggaagtgg cgaaaaaatg
    84001 ataaggatat ttggagcgcg cagtagtgat ggtcaccata caattcagat tacaggtctc
    84061 acgatagagc caggtgctgc cgcggctgtg ccattgatcc ttgaccgtca cgtaacgggt
    84121 actgtgggtg ttggaataat cgtcgggcat taattgcatg gttttgtttt catagctgtc
    84181 cctatgataa gccacgaaaa ccgtgcctgc tataacgcgg ctgtaggaac tgtagcactg
    84241 actgtggctg ttgatatgat gaatctccca cataggaggc gccacgtatt ccgtgttgct
    84301 gcccagcaga taagtggtgt ggatgtaagc gtagctacga cgaaacgtca aaaccttctg
    84361 gtagactcgt accttaaagg tgtgcgcgac gatgttgcgt ttgtagacca ccatgatgcc
    84421 ctcgtccagg tcttcattga tgggcttcat cgaggtgcag acgatattac gttcaaagcg
    84481 aataagatcc gtaccctggg ccatagaaca cacgcgatag gggtacttgg tggtattgac
    84541 ccccaccaca tctccgtact tgagggtagt gttgtagatg gtctcgttaa caccatggct
    84601 gaccgtttgg gaagaagtta cgcgttgaga gactgaaccg gatcgagagt gagcagcaga
    84661 cgtcgtatga gaggaatggt gactgtgagt agcagaagtt ccacgagtag aagatgagga
    84721 aaccgcagca cccagacaga cgatacacaa gttaacgcag actaccaggc accagatcct
    84781 ggattccatg ttcgtcgcgg gccaaatcca gcagcgatga ggcgcgtcgt ggtctcttgc
    84841 gtgttgcgcg gaccctccgg gaaacgcccg cggtcgagga ggaggggtac ggacttggca
    84901 gccaaggtcg gtccggctcc ctgaaggcac ccgagacggc cgcggcggcc gtcagggtgg
    84961 agggcttggc cacgggagct gttggcacgt cgccactctc atccggtctg gacagatgcc
    85021 tgtagaggag gagatataga tctttggact tataaagact tccttcgtga cgaagcagca
    85081 gcggccactc tttgttatac gtgagaatca catctctgtc cgggtgcagt tcgtcgcgca
    85141 ggcacgcgat cgagagttgt ttcccgaaag tttcattata tagtgcgacg gagagcacga
    85201 gctcccgcac gtgcatccac atctccttct gcagcacgtt taggtcctga cagtccgaaa
    85261 aattgaaaaa acccatgtac ttcaccacca tccactcact gggatacacg gtaccttccg
    85321 cgcatttgac caaatcgtcc ttgacgtggg gtagtacgcc cgcgttgtcg caggcatagg
    85381 ccatgtccac attgtgagag aggggatagc gatcggtaca gtgtgtgaag aggggcccgt
    85441 tacacaactc gtagatctgc tgacccagta gcgggaggga ttccacaggc agactcttgt
    85501 ggatcaggtt attgaccaca tacaggtgct catcgtacgt gaactgattc cccacgtcca
    85561 ccacgtcttg gtcctggtgg tattggctgc ggtatagaaa cccattcatg agcttagaga
    85621 taaagtccag acacaagggc cccactaggt tgacatcgat gagtttgcta gtcagacgct
    85681 cctgcgtttt gatgcaacgg atcaccttgc catagcccac ctccgagacc ttctgcaggt
    85741 aggcgcgttt gcgcacgttc acctcgcggg tgacgttgtg gatgcgggaa cgcgcgtcca
    85801 ccaagtcgag agcttcgtgt tcgtcgcagt tgcgcacccg taagccgttt tcgctgccgt
    85861 cgccgtcctg cccattcgcc cctcccccta cagctttctt gcctcctcca cgggcccggc
    85921 cgccgccacc gttattcctc tgactgtgag tactgctgtt gctgctgttg ctggccgtca
    85981 tcaaagtcgt acccgtcccc gacatcgcct cccgtccacg caggtgaata acctcgccct
    86041 cggggccgtc gccccccgtg ccatcgggca gcggacgtcg aatctcctcg agaatatgct
    86101 tgattttggt gtacatctcg ttgctttcgt ggagcttgtt gaacaccggg ttgtcctcga
    86161 aagcttgaat gctgagggat gtgatgaggt cgatgatcct gttgggggcg gcaaagaccg
    86221 accccacgaa catgcgctcc tccccgtcca acgccttttc cccgagcacg aagatgtcct
    86281 ccacgtcctc cccgtacaga tggcgactga tgccgttcat gagcgcccgg cacagctggt
    86341 gatacacatt tagctgctgg atggtgatgc ccacccgctt gacgataacc tccgaggtac
    86401 gggaccagta ggtaaaatcc gacaaggaat atattcgttc cggtatatcc gtaaacaggt
    86461 tgtactccct cagcgcctcc tccgcctcct ggatgtagct gtggtaggcc gatgaagaag
    86521 agaataggct tttgagggcc gaaaggactc cagccaagtg ggggatgcgc gttgtcaggt
    86581 ccagcaggtc ctgctccacc gtctggatat tcacatcgga ctggcttgac ggacggtgga
    86641 ccgctatatg gttgcacagc aagccctgca gccgcttgtt cagcgagcgg ccctgattcg
    86701 ggatgatggt cagctcctcg tagcattggg cgcatgtcgt cccttcgacg tacacttcct
    86761 gacgcgccac cggcgagatg ccgcataggc gacggaggag ctccagcagc tgcgcgcaga
    86821 cctccaggcc ggcctccggc gccaggatcc cgtacacgta gttcattttg cacaggaagc
    86881 gctcgatgtc gttgagtgtg gccagactga cgctgaaacg gacgttgtcc gtaaactgga
    86941 gctccacggt gtgatggcga tcgcagcgat ccaaacggag gacggtacgg tagaaggccg
    87001 cccggtccgg ctggcgcgag taggccatca gcgcccgatc cagcaaagcc gtatcctcgt
    87061 gcagcgcctt cagcagcatc tccagataga gagtcagcag cgaactctgc gtacgattct
    87121 gcgccaccac ctccgggtag atcttccggt acagatacac tatagccgcc gcgtttctct
    87181 tgaacggcgt ggactccgcc agtaacacgt tcggatcgca gtactttaga cactccagct
    87241 ccatggcgta ttcgttgcat ttcgaacaca ctacgcatag tttctgtaac aaattcatct
    87301 ccatgactcg actcgctcac gtacgagacg ctgtcgtccg gtctggcgcc ggccagagac
    87361 atggagtcgg tgcacaaata actcgcgggc cgctcgctat gccgactgac gttgacgtta
    87421 atatataacg acgtcgtcga cgacgcgggt tctgctcccg aagctgttgc cgccgcttgc
    87481 ggcgcaacct cctccaccac cgccgccgcc ggctcctccg cctcgggcga cgggggctcg
    87541 gagatgaccg gctgtgtctg acactcctcc ccttcctcag gcggcccggg cgccgacgcg
    87601 aatgtcggag tttgccagcg cggcggcggt ctctgtctct ggtgccgcgg cgctaacctt
    87661 cggggctgtt gctgctgttg atgatgcgac gccgtccgtc gccgctgttg cggcggtagc
    87721 tgatacggtg tcgcctggtg ctgctgtgtc ggtggctgct gttgctgctg ttgttgcggt
    87781 ctgaaaagcg gccacggggg ctgcgactgt tgctgctgtt gttgcgatgc tcgtggctgc
    87841 ggcggccgtt gtcgcggcgt ttgctggcgg ttacaaccgg ctgcgtttgg ccggcaataa
    87901 cccgctgccc ccgccgcccc cgctgctccc gccgacgccg ccagcctcgt cttcgccggc
    87961 gttcacgaga aagcagccac ctcccgtctc gccgggcacg ccgaagcaaa tggagttgcc
    88021 cgcgacggac tcgccgagaa gaagaccgcc acccccgacg ccggacgccg cgccgacgcc
    88081 actgggcgcg aagagcgccg acaggtcgtg cacctccccc ccggcggcgt ccgttaatcg
    88141 ctgggcgtcg gcgtccagca cgcgtcgcaa gttctccagc gaaaagtcct ccacgccctg
    88201 ctcctgcaac gcggcaaact tgtccatcag cgacgcggcc agcgcctcgc agccatccac
    88261 gaagaagagc acatcgtcgg acgcggggat ctcctcacgc acgctcaaaa tctcgtacac
    88321 ggccatcact tcggggtcgc aatccaagtt ctcggcgtcc agcgccagca tgacgcggtt
    88381 ttttataaga tccgcgtcaa aaagcacgtt ctcgcggcgc gagcgtttga tgagcacgtc
    88441 ggccagacgc gtagccaaga gatagcgctg gcgcatgaaa cgataatctt gaccgctcat
    88501 agagctcacg ttaaggctgc gttccacacc gttgcccgaa aaatagccga tctgcccaaa
    88561 ctgatagatc tccttgctgt tgttgatacc agcatatttt tccacgctca cgggcacggt
    88621 caccaaggaa cgatgctcaa aaacgctccg taccaacgat tcacgcgcca cagtggcggc
    88681 catgggcgcc ggcacgcctg cggtcttcaa gcccttgaca tgcaacgcaa attcggcggg
    88741 cgacgagaaa cgcggactag cacctaacac gtgaggaaac tgcgcgtggt tctgcgtcgt
    88801 taagcgcgtc gttaacccgt gcagcgagcc gatgtagtcc ttgaagccgt agtagcagag
    88861 gaatttgtta tggaaacggc tttccacgta actcagcaca cagtctggcg ccacatccag
    88921 cagatcgtgc tcctgatagt cagccgtcac agccaccaga aatttgacga aagcattgaa
    88981 ctcgcccatg tcacctatgg gcacattctt gggcaacgcg ttggaacaaa ccttctgcca
    89041 aaactgtaag caggggagac cacattcagg aaagagtcgc tcgtgatgtc gatacagcag
    89101 aaatcccaag cagcccttag ccggattacg acgcggaacg tgatcgcggc gaaaaaacac
    89161 gctacccgcg ttgcccttgc ccgcgcggta gatgggtcgg tttttcaccc gcaccatgat
    89221 caacgtgggt accgatagcc gcgagagctt gatctccatg ggcaccacgg cgtacgtgcc
    89281 ctgcgcgtac agcctaaagt ccagcaggcg gtcgtgatcc gaattcttgg acgacttgat
    89341 ctgcttggtg aagagaaagc ccttgcgcga cgacgtggtg gagaacgcgc cgtgaatgga
    89401 ttgaaaatgc tgcgtcatcc atttggatac caagttggtg gtcaacggat tgtccacaat
    89461 gtatgaggta gcggtaataa gcgccacgtt ctggatcacg taaaagacgg atctgaaata
    89521 ggcgtaggcc agcagcggct ggaaggccac ggcgtaggga ttcagatcca ggttgaaggc
    89581 ctgcgtggcg cccgccacct cgtcgcggct gctcttgagg cgcacctccg aaacgaaacc
    89641 cagggcctcg tcgtccacaa acttgttgag cgccgaaaag acggccacaa agtcgctttt
    89701 gccgtgcgcg ctaaaggtat cctcgcccgt cacggggtcg atgagccgca tcttgcggca
    89761 gtaatccaag atgcgattga gccgataggt acggtccacg ctagcgccca gcatgcgacc
    89821 gccgcgcccc atcattcccc cggaatcccc gccaccccca ccaccacgac cgccgcccag
    89881 accgtcgctc gggcccccgc tcacgtcccg tccaccaccc ccgccagcac cgccgcccgg
    89941 aaccccgtcg tcacctttgc cgtccaaacc cccgtccttg gcgtcgacgt tgtaacgccg
    90001 accgaagctg cccaaaatat ccacgtcgtt gagaaaacgc gactgcacgg tgatcacgca
    90061 gggctccttc ttgggctgct tgggcaccac gggcaagcgg gtgcgcaccc gcacgaaggc
    90121 cgtctgataa cacgtgtggc aacaagtacc cccacaggcc tcgcacagcc ccgcggcgca
    90181 gcccaccagg tgattcgtga gcgtcgacga acccgacaag cccgtgttat acaccgagac
    90241 acgatttaga taccagacga agcccgaaac tagctgcgga cacgtgccac acaccaacgc
    90301 caaatgctgc ggcccatagc gttcgtcctt gagcggcgcg ccttgaaact tgagcacctt
    90361 gcgcgcgtcg ttgtagacgt cttcgcaggc cgccgacaac ccgttggtga actgaatagc
    90421 cttgagcaac gtctcctgac tggccgtacc gccggcgctg ggatgccgcg ccgacgactg
    90481 gagatacacc agcctgtgct ggtagagcac cgaattagcg ctgaagacca aggcggccac
    90541 gtgcgtcgag agatgcaact tgagctcggt cagcgcgcgg atcagatcgc ggtgatcggt
    90601 tgcgttggtc actaaaggcc actcggaaaa gagcatagac tcggcaggtt ggtaggccga
    90661 atcgaaaaat accgaggcaa aactgaaggc caactcgcaa accaccgcgt cactcagcat
    90721 cagatgatcc ttttccagac tgctgagtcg ctggctcatg taccccaagt agcgcttatg
    90781 tggcgccagc ttcaccgact gctgactgtc gtgcacaaac tgccgcaacg ccgcctcgat
    90841 cagcacacgc ggctccgaga agcgcagcga ttgacaccat gacgtgtaca cgtagtagaa
    90901 aagcgtctcg cttacggccg gcacgtagag ccctcgcgcc tccacaaaag cgctgcgcgc
    90961 atccagcgag acctcgtcgg cttcggcgtc aagctgcagc gaattaaaga gcgtaggcgg
    91021 gtacaacggc acgcgcaccg cctcgccgcc gtgcagtcgc accgtggtcg cctcctccac
    91081 gcatggaatc agctgaccgg caaagagaaa ctccttcaag ccgttgccca ccaccacgtg
    91141 cacagtcgtc tcggacgcct gacagcccac cgccgcgcac aacgccgcca gatcggtagg
    91201 cacgcgatcc gcctcgggcg tgtaggcctc caacgcgtac ttctggcggg cgtcctcgca
    91261 cagccgatgc acgtctccgt gatcctcggt aaaagccacg atgccttgcg tatgatgaaa
    91321 gtagagcgca aaaggacaga aggacgtgac tttcgtgagc accccgccgt cgtaacaaag
    91381 cacaggcgta cgcacagaga cgccgaaatc cgcctccacc gtgagccccg ccaacagagg
    91441 agcgatcacc acgctcgagg aacggtcgca tagcgagaga gtggccagaa tctcctgcgt
    91501 ttctgcgttc aacctgctga agtagagaaa agccgcgggc cccaccggcg ctagcgcggt
    91561 tagttcctcg tggctcatgg tggatgaacg gaagacaatg gctacgccgc cactgagtga
    91621 attttatacc aaggaaaagt tcagcacgtc atgtttgacg cacgacgtct gagacaccac
    91681 cgtggccacc actgcggtct ggctgcggtt gcggaccacc aaaggcgaca accgcaacga
    91741 tcccagcaat tcgtaagaaa agctaaccgc tacggtcggg tagcctctcg cagccagacc
    91801 gctagccgac gcacccgccc gcgaaaatag cgtgatgttc gggacggctt tgcgtcaccg
    91861 ccaactaacg tcggtagtcg agcacgtcgt ttatcctcag cacaccgtcc gatcacaatc
    91921 cgttttccca ctcagtcgca caagcagcac ataaaaaccc cacacagggc acgtgaaaac
    91981 accgtcccta gaaaacggtg ttttctgtcc taccgtcacc ggtatacaca ggcaaatccc
    92041 aagcccgatc cccgaaaaca ccgtacggtg tttgtgacct ccaaaatcac atcagctaac
    92101 aaaccgtgaa aagtcacgtt tcacgaacac ggtgttttta aatcacaaag aaccgcctaa
    92161 cggtttacaa gcagaaacac cgcaccacgg tggtacaagc gcgatgaatc tggtctcgca
    92221 acctcaatcg ccgctatcac caccgatttt cgctgcgctc cgccgacaaa acgtcgtaca
    92281 agctacacac cccaaaaacc cgcgcgccta cgggcgccaa acctgtgtat tatctcaacg
    92341 tcacaacacg acacaaaccg cgtaacgtgg tttcccgaac acgtacgcgg cacagacccc
    92401 cgacacgtac tcgaagacct tacagtttac gagtcaataa aacaggaaaa gatccgaact
    92461 ttaaaattgt gtatttttat tttcccatcc ccctcttttt accaaaaaac acatttttcg
    92521 tcttgtaaaa agtaactttc gcccattgcc atgaaacacc gtgatgggga acggtgttgt
    92581 gtgtcgactg acgtcactac ggcgatcagt atcgacgtcg tgtatacata acggtgcccg
    92641 gtgtttttat tcggggcgtt gtcgcgtctt gatgtagtgt aacctgaaac cgccgtgccc
    92701 aagaatgcgg aagccagcgt gtaatcataa cggggttttg ggtacaatct gacgacatct
    92761 ggcggcgagc gtacaccatc gaatgtggcg atcgccggct ctacgtcaca atgacgcaaa
    92821 aacacactgt aaaacccgcg tagacagctt tcctggtcaa cgagcgccat ctggtgtcgg
    92881 cataagaaca ggcatcaacc ccgtggccgg cgaggcggtg agcacttttc ctggtcacgt
    92941 gaccatcagt gcaggaagcg aggcccgtag aaccgcccaa gaggcggtgc cagatgccaa
    93001 cgtcataatc acaaggtgat ttgttacgtc acgcgtgtgc gcacacgcgc acgcgcgcac
    93061 acgcgcgcgg tagaatacag cgatccctag tgaagccaca cccattacgt gtagccatat
    93121 ccgcttacgt atacaaccac acccctaggt acgccacctt atctaccaat cacagaaacg
    93181 gatatacaat gagccctccc tagactccac cccttgtacg gaaatttcag ataggtggaa
    93241 cccgttaggg ttccaccgtc ctcggtgtac gtacaggctt ctccgtctac cggaaatata
    93301 cacctgctga cgtagacgct actcccggat acgcgtcata agctactgga ccctaggggg
    93361 gagtgtctac agggctacgt gcacgtcccc ttacctaggg tatccgcccc cttccgctgt
    93421 tttggcctag taaacttaac gccgccgctt ctcacgtgac ccctgacaag cccacgtcac
    93481 actcgcgtag ccacacccac tccggatata cgtcatcctg tggacttccg gacatacggt
    93541 gacgtagcga gcgtagcgag ctacgtcacg tatgcgtacg tcatctccgg cggaaatcat
    93601 ctctgatgac gtagcgagcg aagcgagcta cgtcatcagt ccgttttacg tataccggat
    93661 gctaggcgac gccccgtagg ggcggagcct agcttccacc cctaggatgc ataccctata
    93721 tagcataatt cttctaacga aacgttctac gaaaacggac tggcggaacg ggaaccaccg
    93781 taaccccccc ccctcacccc cccccttctc ctccggaacc ggggggggca aatttttacc
    93841 aaatttgggc aaccatgatt tccaatggga cggcgtttcc gtgcgcatgc gcagtcgggg
    93901 cgaattttcg gttgttaggg cgttgccacg cggattatgg gatgtggcct cgagtgcgca
    93961 tgcgccgggg atgtcgtata aaaagcctat atataaagag gggtgaacca ggggacccgg
    94021 tgcgcatgcg cgggccagga cccgcgggag gcgcgccctg cgcatgcgcc ggtaaaattc
    94081 cactgggcat gcatcgtgcg catgcgccgg tatttttcca ctagaggcgg tcagtgcgca
    94141 tgcgtcggta aatttccact ggatgcgcgt cgtgcgcatg cgccggtatt tttccactgg
    94201 gcggccgcac ctagggagcg cgagccccgt gccgggcatg ggtcgcggcg gtggaaaatt
    94261 accgctccgc ccacctaggc ggggcctctg aaaacctata aaacccggcg tgcccgccgc
    94321 cccccggcgc agtccgcggc agggttccgg ccgtgctgcg gtccgcacgc tgcgcccgct
    94381 cccgcctgcc tcccgcccta ccccccaccc tccccggccg aggcccggcg ccggtccgtc
    94441 cgcgggcccg tcccaccgcc ctggagcacc atccggggcc gtgggccggg caccgggcgc
    94501 ggcccgctcc ggacctcggc cgggggtccc tgccctcccc ccgctcgacc ccccatccga
    94561 cggcccggcc gggctgggac ccccgcaccg gggtcccggt tcccgtccgc ggcccggggg
    94621 gacccgagcg ggggcttccc acccccaccc cgctcctccc cgggctccgg cccgggatcc
    94681 ctcgctgctc ccggcgacct ccgccggctt cccggtccac ccgccgcgga acggacggga
    94741 cccggggtcc gcgcccttcc cctcccccca cggggggctg ggtcgcggac cccggttcct
    94801 aggctcgttc cgcggtgggc gaccggggat cccccaccca gctccccttc ccggcccgcc
    94861 ccgctggctt ttgggcccct ccgggctttt tttttccggc tgggggtcgc ggcggtcggc
    94921 cgacgacgac ggtaggtggg ccgggtggac ggtggtgggg acgggcgacg ccccggctcg
    94981 acggcagtcg gtcccggaag gttgggggct gggggcccgg tcaggagctt cgggagcggg
    95041 gtcgaccgcg acggcttccg ggtctcgcgg cggctccctc tcggcggctc cggttgggct
    95101 cccctccccc ctctcgaggg tccggccgcc agtcgtgacc gggggtccct cggcctagcc
    95161 gccggctctc ggtccgcctt atcctgggcg ttggccggtc ccgtgacgct cccctccccc
    95221 actgctcccc aaaaaaactc cgcccgaacc gtcgcggctt gctggccctg ggcgtggtcc
    95281 cccactcccc tccccccatc ggccgcccag ccggggtcgg cgcctcggac cccaccaggc
    95341 tgtggcgtgt gtgctggccg atgcggcggc gaggttgggt gtggccggaa gcgctcgggg
    95401 tcgacggtgg gccgccatga cacctcaatt gccgtcagta cgcccctcca caatcaccgt
    95461 ccccacacga tgggcccggc aggtcaccca acgttggttc aggcccagtc gagtttttcc
    95521 ccggcacgaa cgcacgtccc cgtgggctcc acgcgttttc caccctttcc tggaggggtc
    95581 cggaacaccg tgaatccacg gggagggtcc cggcacgggc cgaggagacc acgaccgtcc
    95641 cacccggcgt gtcgactcgt ccgagacccg ggaagggaac aggccccacc tttttttccc
    95701 ttctccgatt ttgccgtgga aaacccgtga accgatacgg gtgcagacgg ccgaaaaaaa
    95761 tcgagacgac aatatgacgg cagggcgcga tcttctcccc catccgacaa aaccgtgtcc
    95821 cttaaaattc cccacctttc tctgttcaaa tgggcccgaa actgtaaaac accgtttgac
    95881 cgcaccccaa ccggcgccat cttggtgact ttctcgacgg ttctctcgct cgtcatgccg
    95941 ttctgagctc cgacatggcg gacgagagaa aatggcgtcg agagcctagg agcgttttcg
    96001 ctccaggcgg gtaaaaaaat agcacgataa cttttctgtg cttttttttg agacgtttta
    96061 gaagagcttt tttctgctca gagcgaaaaa atgatagccc tgaaaatctc gacgagtctg
    96121 gccgagcggc gccatcttgg aggaggggcg agtcgcgggc accgcctcgg taccccctgg
    96181 ccgaggcgag tccgcggtcg ccgcctgttc cgtgatgcta cctagagggc gctgtcgagg
    96241 cgactcttcc tgttttcgcc ctgagggcta acggtcgctg acgtcaaacc atctcgtgct
    96301 cgctgagtca catccggttg ttgacaagcg atggaggacc gcacccaaag tgcgccctct
    96361 agtcatcgcg cctgacccct tttataaact gctcgaagaa aagaacacct tatgtgaaaa
    96421 aatacagaat gatgacaagt tcatccaaca caaccgctca acaacgccat atctatcagt
    96481 gtccaaaaac tatcttctat cctttgaaac tataaatgct gcctatatac atatttagta
    96541 tccaagactc ttaccacgta gacgaaaaga agtgatacaa tgatcttgac gtgtatcgtc
    96601 tatatcgtgc tagatatatt cagataagac gcgcaaacca tagatttctc atcagtatca
    96661 tgaaagacct atagctctat atacgaacct agtcatttta ggacagccgc cggagaagcc
    96721 gacgagggat cgggcgggtg cagccagaac ctcacgcccg atcccgcctc cggtaggcga
    96781 tttgcatctg tttggtaaaa agctcataag tctgtatgtg acctatatat atattatacg
    96841 ctatgtacac cgaactgtcg ctgttgtata agaagaaaaa actctccata tttatatcgt
    96901 ctgaattttt gcttgataga cacgtgtttg gaactctgtc cccccacgtt ttcactgtgt
    96961 ataacaaaaa tatgtgtttc tcaaaagatc ttgaggtgtt tgaaaacggg ggaaacctgc
    97021 gtttgggtgc gctaagcccc ggactgggac gtagccggcg tccggcacct atatttttct
    97081 atttttttac aaaatatatg atgaaccaag aataaaactc tagctctcgt ctatttttaa
    97141 tatgctctac ttagaacctt tttaatgaca gaatgaactc catgttatac gctctttata
    97201 tagtttctct gcactaacct ttaaaaccgt atccttccct gttgtacaaa tcatcttttg
    97261 atacacaatg atgacctgat atccctccat atatatgatc ggatattatt ccgttagact
    97321 tgtcctcctt ttttttcctc atctcctata tctggagata tatgttgacc accaccgcca
    97381 tgaccaccaa aaagctagcc gtcacgacta gaaatgtgta ggattcggac tttccgttcg
    97441 agaagaaaga gaccgcgtct ctggacgctc tttttgtcgg tctgaatcga cccgggatac
    97501 gtaagagagc ggccctacat cggggggcgc tcgagaccga cgacgttcca tctgaccaga
    97561 aaaaaaggca cccctcggta gcgacctctc accatcgttt gcccgtccgc ccgtccttcg
    97621 tagccatcat catcatctca ggctctatcg gtaccatcgt tgtcatctga aaaaaaaaac
    97681 tgcctcaccc acctgcgtaa aaacaccatc tttccggagg tgcggtaaga cgggcaaata
    97741 cggtcgtgcc gaggcaaaaa aaaacgcacc atcgacacca caccctcatg agcaccacct
    97801 gtcggtgttg gtcgtcctcc atcgttctct acgaacatct cgacgcccgg gtgacggacg
    97861 acggcaagac gtcccggaga agacggtgtt ctctcgggcg gtacgctctc tggatctata
    97921 atatctatag tagctaaacg agactgtgag tacgacgaac cacatcatct tttttttatg
    97981 ttgcttcttt agaaaatgac ttatgtcgac gacactcggc atcagccatc tcgtgaaaca
    98041 cgctcgcttt tcgtctctcc aaggaacact gggtccgctg aaagggaccg tgtaccgacc
    98101 aaagcaaaaa acacacacgt agtaacatga tcaaccacgt ctgaatgaca cgaaaacaca
    98161 atcgtataac gctctattca tggaacgaac ttggaataaa aaaaaccatc gcaggccaga
    98221 ggctaagccg aaaccgtccg gggaagcggg cgcgagtttt ccgacttagc ctttggtgct
    98281 cgttgagcct cttttttttt ttctgattct ctgaagaatc accgtcacag ccctatgacg
    98341 cgaaatcaat tgctagaaca taaacgttct caacaggtat gaaatgaaca aactagatga
    98401 tgctataacc ttatattgtg tgtatataga taggtgtgaa atttgtagga taaaaagtgt
    98461 cgttgtatga tgcacaacga tcgtgaaact ggagactgta gctctctacc gaatgcaaat
    98521 acacaaatga catcgattcc cgtccccaca taaagaaatg tgctttactg tgaaagaatg
    98581 aagaagattc ttgttcctcg tacgacgggg ccctcgctcg tcgtgcctct tcccccctcc
    98641 gggagagggg acgtcggggc cctccgtcgc accgggccga agccagtgaa atgtttacta
    98701 cactgtcatc agaatatatg atgtatatta tttcctccaa actcctcacc atagccacca
    98761 attcgcatca cttaagaaag tagtagcaac cgcggcggcg gcgaccggcc ggtcgtcgtc
    98821 tcctcgtcct caaatgttgt acatgtgcag aaaaatgtgt aaatacgtgt tatttatccc
    98881 atgcgtcttg tacatagata tatgttttta tatacgctat ttatacttta tatatccttt
    98941 tgcataacca tagacagtca aggattttaa tgatttgctc atccgccttt gagccatcgc
    99001 ttaggagtta gttcctctat gttctcggcc caccttttcg actacagtag caaacccttg
    99061 tactaccacc ccgataaaaa ccacatcatc atcgtcacca cgacctggaa acgacacacg
    99121 ttccccccca atcttgggca tgtgtatata tatataaaga atgggaggga gaggacgtgg
    99181 ggctcgagaa gaaataaacg ccaagctcga ttcgaaccaa aaaaccacat gtgtattgtg
    99241 ctttgttttt tttttttacg gtggggaaaa ggagggggcc gtcattaacg gaaaccgtgt
    99301 atggggtccg gacacgaaca gtacacagct tatggggaaa aaagctcaca gagagaaaaa
    99361 aaaacaccaa gctcaggcac gcgtacatca ttatcatcat cggatatctc accacgagtc
    99421 atagtagtac caaggagtgt gtaacaccat tttttctttt ttctttgtaa cgggataagg
    99481 gacagcaatc atcacgcaca acacccttca ctctcttttt agtcatccat atcatcgctg
    99541 taacacagca tgtcctcgta atcgggcgtc tggcagcgca ttaccaccga gtcgtcttct
    99601 tgcggtaccg gtggtggcgg cggcggctgc tgctgttggg ttgccgtcgt actgtgatta
    99661 ccgttggcgg actgcaccgg gatgatgggc tgcttgtggg gaacctgggg tggactgccg
    99721 ccgtgagaag gcgacggcgt catcaagtta agctcaccac ggtgactccg gacaccggcg
    99781 aggggcgccg ggggactggg agggaccgcg gtcgtcttgt agacgacggt gtccccgtgt
    99841 cgatccgtgg ctcgtaccag atcttgactg ctagcgtcgt cactgtcttc gtcctcttcc
    99901 agctcgccct cagagtagtg ctgctgtggt tgcgacggtg gctgggcggg aggagcggcg
    99961 gcggcgatca ttggagaggg atgtcgatga ctcccttctc tgtccttttt atcgtaggct
   100021 gtcagcgttg ctgggtccgt cctgctttcc atacttgcgc attgctcatc ggtgggatga
   100081 atttggtctc ctccccgctg ttgtccgccg gcagtggcgt ggttgctggc ggttgtcgtt
   100141 gtcgtaccgg caaagacggt gagatccaat agcgactgct cgtcgaaggg acagtacgct
   100201 atcatgaaac gatagggtgc caacgcgcgt tggatgcgca gttcgcacat ctcgttctga
   100261 cactcgtggc actgcagggc gcctaggatc aggtccgaga cagcgccgca gcggtaggta
   100321 cccatggcgt tgttagtatc gaactggtca aaaaattggg gcgtaccggt gacttgcaac
   100381 gcgcgacggc gtagcgagac ggccacgcgc gagaaggagc acacgtaggc catggcgcgg
   100441 tgcatgggtt gcgagaaggt ctcgggcgga cgcttctgca gatcgcagac gtcgtcgcgt
   100501 agccaggcgc tcatttgacc gggcttcttg actagccgtt tgagcgtgct gcaatggtcg
   100561 ccccagccgt cctggtggtc caggatgcag cccaggtcca ggttgttgag tttgttgaaa
   100621 agcagctgac gcatgccgcc caccgtctcc agatagggat cgtgcgggtt gacgggtagc
   100681 ccgtgcaggt ggtggtactt catgtagctg agcgtttcgt cgatgatggc cagcaacgtg
   100741 tgcaagttgg gagcgttgta tacggcgaag atcttttcca ccaccagctt gcgcagcaac
   100801 ggttcctcca gccaatcgaa ctgttgacgg atgtgcaaca ggtagtcggt gtgcatgagc
   100861 tcgtcgtgtg acagcaggat gcgaccgcgc ggctgatgat cttgcgggaa ggcggtgggg
   100921 accttgaggt cggcggggta gggtgccaga cgtagactct cggccgtgta gcgctgaagg
   100981 tcgtagacgg gcgaggtaga actcggtgag gtacccgacg aggcggcgcc gcgctgcaga
   101041 cgcgctcttt ttttcttttc gatcaaacgg ctgagttgct gtagttcgtc ctcgtccatg
   101101 gcgtccagtt cgtcgtcaat aagcgccagc atctgttgtt gttgcggtcc ggcggacgat
   101161 ccgtgatgat tattggctga ggaggggtga gaagaaccga aagtcgtagg acaactggga
   101221 actcggcgac gaagatgcgt cgaatcgccg ccgtgatggt gcggttcgcc gtcatcgttg
   101281 tcgtaagact taccgtagtg ggggttaagg ggcaccgagg cggacgcggc cacgcgtcgc
   101341 ttgaaagagg aggacgccct atgtccgcca cggaagcccg cagtgcccat gatgatgtgt
   101401 ccgccggtgc ccccgagtgc gtggcgggag gagggtggaa ggggaggagg atagtggtcc
   101461 ggatcgcctt cggtatcatc gtctttgctg tagcggggtc gtcgtgcggg gacgcagggt
   101521 cggtgatgat gcgaggcggc gccgacggta tcttccgcga gatggtattc gctggcggct
   101581 gctccgttcc gtgtcgacgg cgaggttgga cttcgctcgc gtcggaactt ccgtggcacg
   101641 ggttcgtaat ccagacagaa gcgccgtgcg cgacgggcgc ggcgttcgcg ctcgctcagg
   101701 gaagataacg acggagcgtc gtgacggccg cgtgagtgca gctccatggc cgccgtcgct
   101761 aggaaggtca cgttctggca cgctgatgta tatatagatg agaccgctgc cggggggcgg
   101821 gtcaccggcg ccgtggaaag tgaggctcag acggcggtcg ccggcggcat gggcgcgtcg
   101881 ggcggtctga ttttgatgga aatgtggacg tttttggcgt tggagtgaca ctttttggtg
   101941 aaacagcggc tccagaggct ggcccagagc gcgtagctgt gctcggtgcg caggtcgatg
   102001 aacacctgca cggtctcttg cgggttgcgg tgcgtgtagt tgagacagcg aaaatcccgc
   102061 gtgcgcgcgc cgtcgcgtcg cttgacggcc acgcagcagg cgccgtgggg ctgaaagagg
   102121 aggacgtggg gcgcggtaaa ctgctcgctg acgtgcggtt cgtagtgttg cgtgaggtgc
   102181 tcgagcagcg gcggccacac gcgggtgacg acgagccgct gcaagtccgt gtcggaaatc
   102241 gcagcggcag tggcgccgtc gccaccgtac aggtgatagg cgagcacctc ggtgagaccg
   102301 cggcgtcgat aacgcgtcac gttaagcgag cgcgtctcga taaagttggc ttcggtcgag
   102361 gggcagattt tgtcgcgtac gctgagaatg acgcgtggcg gcggtgacag gggcaacgcg
   102421 ggcaggtcgt gcggcgggtg gtggtgaagc aggttacgca gatccagttg ggcgcgcaca
   102481 aagcctagcg ggtgttcgcg gtaggcgtcg ggcacgatga acagcggcaa cagacggcga
   102541 tgcatgaaat agccgtcgtc ttggtccatt ttatacatgt agggcagacg tacagagcgt
   102601 ccatggtggt agatgcctgt gtctaggctg ctctcgggat gcgagatggg gtccagcagc
   102661 gtgtgcagtt cggcgtcgag acagacggcg tgattgagca cctgcgccac ggcgcgtaaa
   102721 acgctggggt gtacggctat ggtacaggcg gggaacggcg tgatgatgcg cagccccagt
   102781 ttgcccttgc agcggcagta agggggtgac gtgtcaacag aggacgttgt tttttggaaa
   102841 acgccgttac ccgggacgtt atttttatcc tctttcccgt cttcgtcttc ctctgtgtcg
   102901 cgctcgtccc ggtaatcgag atagtcgtcg tcatcgaaag gcgcgccggc cgcgtccacg
   102961 ggcacgctgt tgggtgggca cgcgcttttg aagaaataga ccgggtgccg gtcggggtgc
   103021 gtgtagccaa agaggctcgc ccatacggtc atccagacgc gtcgtagtcc gcgacataac
   103081 tcaaagacgg tgtgtcgcgc cagaccggag acgccgtcgc gcagccgtaa atcaaagtcg
   103141 gccacaaaat tgaagacggg cagacgttcg ttgaagactt cgtgtcgcgt gtagtagaac
   103201 tgtgtctcgg ggctggtgct ggccacgtcg tcgtcgtgta gccacacggt ctcggtcagg
   103261 gcctcgtccg agaaacggct gtcgggtacg tgacggagca ggtcgcgcgg aaagaggctg
   103321 cgatgccagg tttcggaggc cacggcgcag aagacgtgct ggtcattggg caggtgtacg
   103381 cggtagacgg gcagcggtcg ctccagcagc ggtgccagcg cgggctcggg tagcaggtag
   103441 cgacgttgcg agtaacgcgt tagcgtgccg gtggtgtagg tctgagctgt gcgcagcgag
   103501 gcgcatagac gtaacaagcc ggacagggag cgttccagcg gcgagaagac agactcggaa
   103561 agcgtgttga tgcgttcgag ctggcgcgcc agctgcgtgg aggtgccgaa gaagcccgcc
   103621 aggtgcgtgc cgtcgatgcg gccgccgtag ccggccagcc ccaggccgtg cgggctggtc
   103681 gccgagtggg gggattcgtc gagacgtagt agatgcgtct ccacgtaatc gtgtagaaag
   103741 ttgtcgagcg agaagtattt ttgcatgacg tccagcagct cggtggaaag ccggcggccc
   103801 agaaaacccg gttcgcgcgt acactgcgct tcgggcgccg cgtcagcgtc gtaagccacc
   103861 acgcgccggt actcgagcaa ccgcgcgcgt gccagcgccg tgcggtaggc caggtagacg
   103921 tagtgcacgc agaccgtgtc gggcagacgc gcacgttcgc ggaacgcgtt gatctgcgtg
   103981 tccacctgct ctagctcggt gtagtcgcgg cggttgcgcg ccacggcgta cgccacgaaa
   104041 gcggacacgc gctgacggaa gggcgagccc agtagcagac gcgcgaactc gcccatggag
   104101 gcgtgcgtgg ggatgatggt gcccaggtcg cgcgtgcaga agctgcgcac gtactcctcc
   104161 acggtggaga tggtgctgta ctggccctcg aataggtagt aggccatggt cagtagcacc
   104221 tggccctcgg tgtgcccgaa gacgctgatg aaccacgagg gcgaggtggg gcagaggaag
   104281 acctggttga gatgacgtag cacggccgcg tggtgaaagt acaccaggtg cttgaattcg
   104341 cgcacctcgc cgccgtgttc gggcgagagc acgggcgtgc ggaagagatg ccggtagagc
   104401 ggccgcgtct cggcctcgtc cagactggcg atgagcgccg agagggggat gggctggcgc
   104461 gcggccaggt agcgcgagag ttgcagcgtt tcgttgttca cggcgaagac gggcgccacc
   104521 cgccgcgagt ccgagcactt ttgcgtctgt aggcagaaat aaacacgtcg cgagacctgg
   104581 tgtttgacca gcagggggaa gacgcagtgg tccgtcggtg tctgcgagag tacgttggcg
   104641 actatatgag cagaatcata ctctgttgcg aacagaacga gcgtcatcgt cgcgccggca
   104701 cgatgcagct ggcccagcgc ctgtgcgagc tgctgatgtg ccgtcgcaaa gccgcgcctg
   104761 tggccgatta cgtgctgctg cagcctagcg aggacgtgga gctgcgcgag ctgcaggcgt
   104821 ttctggacga gaactttaag cagctggaga tcaccccggc cgacctgcga accttttctc
   104881 gcgacacgga cgtggtgaac cacctgctga agctgctgcc gctctatagg caatgccaga
   104941 gcaagtgcgc gttcctcaag ggctatctct cggagggctg tttgcctcac acgcggccgg
   105001 cggccgaggt ggagtgcaag aaatcgcagc gtatcctaga ggccctggac attctcatcc
   105061 tcaaactggt ggtgggcgag tttgccatgt ccgaggccga cagtctggag atgttgctgg
   105121 acaagttctc cacggatcag gcctcgctgg tggaggtgca gcgcgttatg ggcctggtgg
   105181 acatggactg tgagaaaagc gcgtacatgc tcgaggccgg cgcggctgcg acggttgcac
   105241 caccgacgcc accggcggtc gttcaggggg aaagcggcgt ccgcgaggac ggggaaacgg
   105301 tcgccgccgt gtcggccttt gcctgttcct cggtttcgga ctcgctgatc cccgaggaaa
   105361 cgggggtcac gcgtcctatg atgagtttgg ctcacattaa caccgtctcc tgtcccaccg
   105421 ttatgaggtt cgaccagcgg ctgctggaag agggcgacga ggaggatgaa gtgaccgtga
   105481 tgtcgccgtc acccgagccc gtgcaacagc agccgccggt cgagcccgtg cagcagcagc
   105541 cccagggacg cgggtctcac cgtcggcgct acaaggagtc ggcgccgcag gagacgctgc
   105601 ctacgaatca cgaacgcgag attttggatc tcatgcgaca cagccccgac gtgcctcggg
   105661 aggcggtgat gtcaccgacc atggtcacca tacctcctcc ccagataccc tttgtgggtt
   105721 ccgcgcgtga actcaggggc gtgaagaaaa agaaacccac ggcggcggcc ttgctgtcct
   105781 ccgcgtgaac agcctggcac gttttggaaa acgtacgtga tcacgaacac gacgagtacg
   105841 aggtttctca tagacgtact ttattaggtc agggatgacg gggaggtttc ggaccgacgt
   105901 caaaaataac gtcactcgtg ttgacagggc tttctgcgtc ggagctcttt tcatcttctt
   105961 ctgtctcgtc gacgtcatcg tctaccggcg agggtgtccg ttgcagcaac gcgtgctcgg
   106021 gtgtgtgggt gaaaccgatg tcgggggtgg gcggcacgat catctgtcct agggggtgac
   106081 tgcccaccgg cagataggta aagcggtggg tggtaaaaac cgctttggct acggtggtgt
   106141 gtggggagat gcagacggtg gtgtgcgaag tgttgaccac cgtcacgccg gccgcggtac
   106201 ccgggagcca gatggtgggt cggatgatga gatccgattg actaaactgg cgcacgccca
   106261 ctatgagggc gcagataccg ggcgcgtgca cgtaggccgc gtcaaaatag acggtttgcg
   106321 tgtgacccgg accgatcacc agcgtctgac gggtacgtaa tgaaaagaaa cggtgttcgt
   106381 tgggcggcgg caagttcatg agctgccagg gttctggcac aaaacagggg aaaacgccga
   106441 tatcgccttc gatggtgccc ggaaagatgg actgaaaagt gtcgttgagg ttgacgacat
   106501 ccaactgcgg gacttgcagc ccggattcca gcagctcggg catgcaaacg aattgcgcgt
   106561 ccaggcattt gtaaaaggta atgccgaaaa aaccttcggg gatatagagg ctgacgccca
   106621 gcgaggtggg cactttgcgc tcgcgtgata gccaaatgat gtgtttattg taaaaggcca
   106681 gctgcgtgtg gcattgtttg acgatgaaac tggaaggcat ccacttgtag ggaactttga
   106741 gcggcgacgg taatggcgac gacgcttcat cctctcccgg atgctgctct ttgtcgtatt
   106801 tctcctcggt cgattggggc agcgtaaatg tggtttgaaa atcgctatcg ctagcgaaac
   106861 gcacgcagta acgcatattg acggatttct cggctaggat gatggagcct gatgacggtg
   106921 cggactcttc cttcattatt aacgtagggg tctcccagaa tcgctgaaaa cgggagcgcg
   106981 gcagccgcga cagtaccagt tgagagtcga ttcggtcggt taacatcgta agcatcgtgg
   107041 cggtggtgtg atggagtgga acacactagt attaggtctt ttggttttat cggtagtggc
   107101 aagttccaac aatacgtcga ctgctagcac accgcgtccc tctagttcta ctcacgcctc
   107161 aacaaccgtg aaggcaacga ctgttgcgac aactagtaca actacggcga caagtacttc
   107221 atcgacgact agtgccaaac ctggttccac tactcacgac cccaacgtga tgagaccaca
   107281 tgctcacaat gatttttaca atgcgcattg tacatcgcat atgtatgagc tttcactgtc
   107341 cagctttgca gcctggtgga ctatgcttaa cgctctcatt ctgatgggag ctttttgtat
   107401 cgtattacga cattgctgct tccagaactt tactgcgacc accaccaaag gctattgagg
   107461 gtggatagat ttgcagcccg gcggtgttcc ggcggggtaa gatttccata cgcgggtaac
   107521 tggaggctaa agttacggat tttatctaga aacagcagcg agtctagata gtcccatagg
   107581 ggatctatga acgttctctg aaacctcgtc gatggtgacg taggtgtagt ttcgttatta
   107641 tcggaagccg tttcgttttc cacggacatg gtttcgttgt aatataagga gctcatgtca
   107701 agagtgccat aaatagtgta cggcgtttcg ttacgaatca gtacgtgcgt gtttttcata
   107761 aattctgaca cggcggtacg gttacggtct ggtttacaaa agggttcatt ccgataccgc
   107821 agagtagtat atacccatgt tgcgagatct cttaactgcg tggccataat ggatttcata
   107881 aagttactat caggacgata acctgtcgta gatgtggcaa cccgcgttac agcagcggta
   107941 gcactataag tcacgttagt ggtgacgttg aaagcggtag acgttgtata ggaaagatat
   108001 ggcgtagtag tactttgaga tttcttattc tttttttgtg gttgttcttt gacaagcgct
   108061 tgtttacgtt tgagttttcg catagtgttt ttcaacttgg tgccgttaat atacttggga
   108121 acgcggaata aatttcggct catggcgtta accaggtaga aactgcgagt gcagttacgt
   108181 tgcgcgtatc gtaaaagtag ggcggttagg cccaaaaagt agattgtctg actatccacg
   108241 ttgactttgt tggaacctat gtacagtttt gtgttccaac gtggtacgtt gaaaaacata
   108301 ggattaaacg tggtgaaatt accgcaacct ttttcgccgg tatcattgcg tttggaaaca
   108361 tttaacattt cggataggca gttcatagaa ggcactgtgc cgcaaggtgg gggtcgtaac
   108421 gttattttgt gggccgtgtg attatattcg gaatatacgt acttggctgg ttttcggagt
   108481 tgagtactgt aaaagtcaaa ccacatatgg gtaatgctat catttctaat gggacccgct
   108541 aaaatgtagt cttgaggaaa tttatccatg ctaataacga tggcatgaaa tttttgctga
   108601 ctggggtaca ttaaaaaccg gtatccgtca gatgatgtag acatcaatcg ttttaagata
   108661 tcttccttct gtttcttcag aatctcttta cctcgataag atagcacggt atacggccag
   108721 gaacgtcttg ttcctctgga gtttaccaat acattacaat ttatgaggga aaggagcaag
   108781 aacgttatag agatcaggag cataatttta ggaatgcctt tcaccattat catctctttt
   108841 ttccccatta cagaggagga gaccccgcac cgtccgtctg ccttgtggtt tggtttgcct
   108901 gcgtgtactc actgctgatt ctggtcgttt tgctgctcat ctaccgttgt tgcatcggct
   108961 tccaagacga cctagtctcc cgcaccttgg ctgtgtaccg agcttgtata cagggcccga
   109021 tatgtaacca aacccacaac agtacctcgt aaataaagac gcacaaacct cacgcatata
   109081 gtatcatcac accgtgtggc gtgtacttta ttacaatgag caagagtgcc cctaagtatt
   109141 ggggcccgta ccgttttaga aggttttgtg cgaatgtctt taacttctct gtcccttttt
   109201 tcataaactg tcaggtccta caatcagcat gtcttgagca tgcggtagag cagatagatg
   109261 ccgatgatgg ccgatagcgc gtagacggac atcatgagga gacgactgtc ggtggcgtcc
   109321 acgacgacgt cagttacttc tagtaccgta ccgtttttca aaagcatgag gtagtgagtt
   109381 cgcggagatg agaccaccac ttcgttgtag ggatccaggg cgaaaaggac gtcgtccgag
   109441 tcgtgcatgt acatgatgtt gatgacgcct tgcgtgtcgt cgtattctag cagggcgctt
   109501 tggcaaaagg cgcagttttc tagcgaaatg ttgagcgcca ctgtgatgct gtgtgtggta
   109561 tgcatgttgc gcgtcagttc gcatttagtt tgactgtccg tctgggtgat gatgaggctc
   109621 tggcctacga cggtggtgga gacagggtag gagatacctt tgatcaggta ctggtttgtt
   109681 acgatataac tgacgtgttc ggagacggtc agcgcggaga aggattcgcc gagcggcaag
   109741 caaaacaggt cggggaaggt ttccagcgtg cttggttgca tggtagatag gatggagagg
   109801 gcggcgggaa cggtagcggg gacggtggca tcggggaaga gacgcgtgag gcgttcgagc
   109861 gagtgatcgc gtcgcccgct actggaacag ggtgtgtaca ggtcgctgag gtattcgtgg
   109921 tgtggatgag ctaacaactg cgtaaagtgt gatagctcgg ccaatgaaca gaggcccgtt
   109981 tctacgatga agatttcgcg tctctccgtc gtatgtacca gcatggagtg gacgaggctg
   110041 cccatgaggt agagttcttg gcgtgcgaag gctgaaagaa aagaggccag gtgcgttttg
   110101 tgtagtttta gggcaaagtc ggcgatctgt cgtagtgccc attgggggat gagatgttgc
   110161 tgattctgtt tagagagtat gtagaccagg cgtacgaggc tggtgatgtc ggtgatctga
   110221 ttcggtgtcc aaagggctcg tttggccagg tccacggccg tgggatacag cagcaacgtg
   110281 gtgcgtggtg gtgtttgtga gaggcaggtg atcataaatt cttgtatttg taagagtgcg
   110341 gcctggcggt ctagggcccg tgggacggag acttgggcgc cggcctcttc ttgtcgggct
   110401 gctgcgaaca gtgctaatgc gtaggcgaag gccatttcta ccgtgcggcg gtccagcatc
   110461 tgacatcgac cgctcttgag tacatccacg gcgtaacggt gaaagctgtt acgtagtagt
   110521 gcgctgaggt ctaggtagtt gaagtcaagt gcggcgtcaa gaaagtccgg gtctttgaga
   110581 taagagtgac ggttcagttg atctttctta actagcacca ggagctcgtg tttttcagtt
   110641 tgtcgtagta taaagttgtc gcgttgatag ggcgctttga aaagtacgcg tggaagatgg
   110701 ccgaagataa gcagcatggg tgtgtcgtcg tctatggaca ccgtaactac gaagaagtcc
   110761 tcggtcagtg ttattttaac gtaacgtagt tcgtcgatga ggtaaaagcc ttggtgcaaa
   110821 caaggtgtga cggtgctgaa tagtagatcg tgtccatcaa agaggataca ggtctggtta
   110881 aagtgtggtc ggtgtagtcc tgaggtggta tgtgattctg tccagccgtg tggagtggtt
   110941 tgcggtggca tccaaacgtg aggtattgac aggtcaatgg gcggtggcac agtggtgggc
   111001 tgttcaccta ggctgtcttg tgcctttagc tgctgcgaaa aagatcggta gctggccagg
   111061 tctttggata ccagcgcgta agtgttaagt ctctgttggt atctttccag ggtttcggtc
   111121 agatctacct ggttcagaaa ctgctccgcc agaggacccg caaaaagaca tcgaggcata
   111181 tggaatacat agtattgatt atagctttgg aaaaagttga aactgatggc gttttccctg
   111241 acgaccgtgc tgttacggag gctgctgttg taggtacact gggtggtatt ttcacgcagg
   111301 aagcggatgg gtctcccgta ggtgttgagc agtaggtgaa acgctttgtc cagcggttcg
   111361 gatacggctt ctgcgccata tcgtgacgaa agtaggtggc tgaagagaca gacggcgagg
   111421 atgatgaggt aggaggggag gcctggccgc atagcgcggc cgcgccgctg ggttcagcgg
   111481 cgtgatccag gtggtggttg gcgttacacc cgagagaagg agagaaagga tcccaggaag
   111541 gagcacccgg gtgtggcgct acgggttaca aaagtcgcgt ctccgtctat ttaatacgat
   111601 gtcattggcc gctgcgaagg gagaagaggg gacacgcgag taagccatgc cgtccgggtg
   111661 tggggacgac gctgattcga cggggaacgc tctgcggaga ttgcctcacg tgcgtaagcg
   111721 gatcggtaag cgcaagcacc tggacatcta ccgtcgcctg ctgcgggtct ttccctcgtt
   111781 tgtggcgctc aaccgcctgt tgggaggcct tttcccaccc gagttgcaaa agtaccgtcg
   111841 ccgtcttttc atcgaagtac gattaagtcg gcggattccc gactgcgtgt tggtgttttt
   111901 accgccggac tctgggtcac gcggcatcgt gtattgctac gtgattgagt tcaaaaccac
   111961 gtactcagac gccgacgatc agtccgtgcg gtggcacgcc acccacagcc tgcagtacgc
   112021 cgagggcctg cgccagctca agggcgccct ggtggacttt gattttctgc gtctgccgcg
   112081 cggtggcggt caagtctgga gcgtagtgcc tagtttggtt ttttttcagc aaaaggccga
   112141 tcgcccatct ttttaccggg cttttcgctc gggccgtttc gacttgtgta ccgattctgt
   112201 tctggactat ctgggacggc gtcaggatga gtctgttgca caccttttgg cggctacccg
   112261 tcgccgtctt cttcgagccg cacgaggaaa acgtgctgcg ctgccccgag cgcgtgcttc
   112321 ggcggttgct ggaggacgcg gcggtggcaa tgcgcggcgg gggctggcgc gaggacgtgc
   112381 tcatggaccg ggtgcgcaaa cggtatctgc gtcaggagct gagggatctg ggtcacaggg
   112441 tacagactta ctgcgaggat ctcgaagggc gcgtgtccga ggcggaggcg ctgttgaacc
   112501 agcagtgcga gctcgacgaa ggaccgtcgc cgcggacgct gctacaacca ccgtgtcgtc
   112561 cgcgttcgtc gtccccaggg accggcgtgg caggagcttc cgccgtccca cacggtcttt
   112621 atagtcggca cgatgccatc acgggacccg tcgccgcccc gtctgacgcg gtcgccgcgt
   112681 cagcggccgc cggtgcttct tctacctggc tggcgcagtg cgccgagcag ccgttgcccg
   112741 ggaacgtacc taactacttt ggaatcacgc agaacgatcc ctttatccgc tttcacaccg
   112801 attttcgcgg cgaggtggtc aacaccatgt tcgagaacgc ctccacttgg actttctcct
   112861 ttggtatctg gtactatcgg ctcaagcggg ggttgtacac gcaaccacgg tggaaacgag
   112921 tgtaccatct ggcgcagatg gacaactttt ccatttcgca ggagctgctg ctcggcgtgg
   112981 tcaacgcttt ggaaaacgtg acggtgtatc cgacgtacga ctgtgtactc tccgatttgg
   113041 aagccgccgc ctgtctgcta gtcgcctacg gacacgcgct ttgggagggc cgcgatccgc
   113101 cggactccgt gacggcggtg ttgagtgagc tgcctcagct gttaccgcgt ctggccgacg
   113161 acgtgagtcg tgagattgcc gcttgggaag gccccgtcgc cgcgggtaac aactattacg
   113221 cgtatcgcga ctcgcccgat ctacgctact acatgcccct aagcggtggt cgccactatc
   113281 acccgggcac ttttgatcgt cacgtgctgg tgcggctttt ccacaaacgc ggcgttcttc
   113341 agcatttgcc gggctacggg acgataacgg aggagctggt gcaagagcgt ctgtcgggcc
   113401 aggtgcgcga cgacgtgctt tctctctgga gtcgacgtct gctggtcggc aagctgggtc
   113461 gcgacgtgcc cgtctttgtg cacgaacagc aatatctgcg ttcgggcctg acctgcctgg
   113521 ctggcctgct gttgttgtgg aaggtgacca acgcggatag cgtcttcgct ccgcgcacgg
   113581 gcaaatttac gttggccgac ctgctgggtt cggatgccgt agccggcggc gggttgcccg
   113641 gggggcgcgc gggcggcgaa gagaagggct acgggggacg gcacgggcgg gtacgtaact
   113701 ttgagtttct ggtacagtac tacatcgggc cgtggtacgc gcgcgacccc gcggtcacgc
   113761 tgtcgcagct ctttcccggc ctggctctgt tggccgtgac cgagagcgtg cgcagcggct
   113821 gggatccctc acgtcgcgag gacagcgccg gaggtggcga cggcggcggc gccgtgctca
   113881 tgcagctcag caagagcaac cccgtggccg actacatgtt cgcgcagagc tccaaacagt
   113941 acggcgattt acgtcgctta gaggtacacg atgccctgct ctttcactac gaacacgggc
   114001 tagggcggct gttgtcagtg accctgccgc gtcaccgtgt gtccactctg ggctcgtccc
   114061 tctttaacgt caacgatatt tacgaactgt tgtacttttt agtgttgggg tttcttccga
   114121 gcgtggcggt gttgtaattt ccaccacgtg tcgctcgctg cataaagggc gaacgtcctc
   114181 ggagagggta tattcgttcg gcgagagcgg gcggcggtgg tgggtatgtc cccttctgtg
   114241 gaggagacta cctcagtcac cgagtccatc atgttcgcta tcgtgagttt caaacacatg
   114301 ggcccgttcg aaggctactc tatgtcggcc gatcgcgccg cctcggatct actcatcggc
   114361 atgttcggct ccgttagcct ggtcaacctg ctgactatca tcggttgcct ctgggtgttg
   114421 cgtgttacgc ggccgcccgt gtccgtgatg atttttactt ggaatctggt acttagtcag
   114481 tttttttcca tcctggccac catgttgtcc aagggtatca tgctgcgtgg cgctctaaat
   114541 ctcagcctct gtcgcttagt gctctttgtc gacgacgtgg gcctatattc gacggcgttg
   114601 tttttcctct ttctgatact ggatcgtctg tcggccatat cttacggccg tgatctctgg
   114661 catcatgaga cgcgcgaaaa cgccggcgtg gcgctctacg cggtcgcctt tgcctgggtt
   114721 ctttccatcg tagccgctgt gcccaccgcc gctacgggtt cactggacta ccgttggcta
   114781 ggctgtcaga tccctataca gtatgccgcg gtggacctca ccatcaagat gtggtttttg
   114841 ctgggggcgc ccatgatcgc cgtactggct aacgtggtag agttggccta cagcgatcgg
   114901 cgcgaccacg tctggtccta cgtgggtcgt gtctgcacct tctacgtgac gtgtctcatg
   114961 ctgtttgtgc cctactactg cttcagagtc ctacgcggtg tactgcagcc cgctagcgcg
   115021 gccggcaccg gtttcggcat tatggattac gtggaattgg ctacgcgtac ccttctcacc
   115081 atgcgtcttg gcattctgcc gctctttatc attgcgttct tctcccgcga gcccaccaag
   115141 gatctggatg actcctttga ttatctggtc gagagatgtc agcaaagctg ccacggtcat
   115201 ttcgtacgtc ggttggtgca ggcgttgaag cgggctatgt atagcgtgga gctggccgtg
   115261 tgttactttt ctacgtccgt ccgagacgtc gccgaggcgg tgaaaaagtc ctccagccgt
   115321 tgttacgccg acgcgacgtc ggcggccgtt gtggtaacga caaccacgtc ggagaaagcc
   115381 acgttggtgg agcacgcgga aggcatggct tccgaaatgt gtcctgggac tacgatcgat
   115441 gtttcggccg aaagttcctc cgtcctctgc accgacggcg aaaacaccgt cgcgtcggac
   115501 gcgacggtga cggcattatg agcggcggcg ctgtacggca gcggggagaa aagtggcaga
   115561 taaatcacgt caggttcaca cgtcgttagc cagcgtcggc atatgaaggg cgcgggcggc
   115621 cagtacggcc tctgggctga gacaggacga ggcagggtga gaaagaggag gatggggggg
   115681 accggggtgg tggtgctgct gctgttgtgg gtgcggacgg tgcgggtgcc gggacagcgt
   115741 gccggcgaac gttctgtaat cttccataat aaaagtaaaa atgcccgtct cgtgtcgact
   115801 ccgctggatg tcgaaggcgt cgggggtaat gcgcatcttg ccggtgccga tgagataaaa
   115861 gtaccacatt ttttgacaga tgatgcgaat caagggttcg tacgcttcgg caccccagtg
   115921 gcgcgtgaag aaggccgcca gacgaaacaa gcggtgtccg tagagcgtgc ctagggagaa
   115981 gaggatgttg ccgttgcgcg ccaggtcttc ggggaaaacg accggcaggc cggtgtggcg
   116041 ctgcacaaag cgcgtcagca gtccgccgct caagcgcggg tgacataggc gctggctgag
   116101 acgggcggcg cgcgtttcat cgaacacggc cgcctcaaag tccagccccg ggaaggcctg
   116161 gcgcagttcg cggtacagat gaggccagta gggttgcggc gtcttgcgac taagcacggc
   116221 gtggtccgag acacccaggt tgttcatggt ttcgcgcagt agcagcgttt cgagaccgcg
   116281 gtgaaagagg aggacgcaga tgaggcgtac gatcttgagt tcttccaaac gcagcgagct
   116341 cagcggctgt ccgcgcgaca tcttctcgct aatctgtaat attagatgat tggcgcaagt
   116401 aaaggagaat ttgcccgtgc ggacccgcgg gacggcgggg ttctcttcgt cgcgggccat
   116461 catcgttcgc tcggtgagcg ggtagcgacg gtgacgacaa tgacgatgga cgagcagcag
   116521 tcgcaggctg tggcgccggt ctacgtgggc ggctttctcg cccgctacga ccagtctccg
   116581 gacgaggccg aattgctgtt gccgcgggac gtagtggagc actggttgca cgcgcagggc
   116641 cagggacagc cttcgttgtc ggtcgcgctc ccgctcaaca tcaaccacga cgacacggcc
   116701 gttgtaggac acgttgcggc gatgcagagc gtccgcgacg gtcttttttg cctgggctgc
   116761 gtcacttcgc ccaggtttct ggagattgta cgccgcgctt cggaaaagtc cgagctggtt
   116821 tcgcgcgggc ccgtcagtcc gctgcagcca gacaaggtgg tggagtttct cagcggcagc
   116881 tacgccggcc tctcgctctc cagccggcgc tgcgacgacg tggaggccgc gacgtcgctt
   116941 tcgggctcgg aaaccacgcc gttcaaacac gtggctttgt gcagcgtggg tcggcgtcgc
   117001 ggtacgttgg ccgtgtacgg gcgcgatccc gagtgggtca cacagcggtt tccagacctc
   117061 acggcggccg accgtgacgg gctacgtgca cagtggcagc gctgcggcag cactgctgtc
   117121 gacgcgtcgg gcgatccctt tcgctcagac agctacggcc tgttgggcaa cagcgtggac
   117181 gcgctctaca tccgtgagcg actgcccaag ctgcgctacg acaagcaact agtcggcgtg
   117241 acggagcgcg agtcgtacgt caaggcgagc gtttcgcctg aggcggcgtg cgttattaaa
   117301 gcggcgtccg ccgagcgttc gggcgacagc cgcagtcagg ccgccacgcc ggcggctggg
   117361 gcgcgcgttc cctcttcgtc cccgtcgcct ccagtcgaac cgccatctcc tgtacagccg
   117421 cctgcgcttc cagcgtcgcc gtccgttctt cccgcggaat caccgccgtc gctttctccc
   117481 tcggagccgg cagaggcggc gtccatgtcg caccctctga gtgctgcggt tcccgccgct
   117541 acggctcctc caggtgctac cgtggcaggt gcgtcgccgg ctgtgtcgtc tctagcgtgg
   117601 cctcacgacg gagtttattt acccaaagac gcttttttct cgctacttgg ggccagtcgc
   117661 tcggcagcgc ccgtcatgta tcccggcgcc gtagcggccc ctccttctgc ttcgccagca
   117721 ccgctgcctt tgccgtctta tcccgcgtcc tacggcgccc ccgtcgtggg ttacgaccag
   117781 ttggcggcac gtcactttgc ggactacgtg gatccccatt atcccgggtg gggtcggcgt
   117841 tacgagcccg cgccgtcttt gcatccgtct tatcccgtgc cgccgccacc atcaccggcc
   117901 tattaccgtc ggcgcgactc tccgggcggt atggatgaac caccgtccgg atgggagcgt
   117961 tacgacggtg gtcaccgtgg tcagtcgcag aagcagcacc gtcacggggg cagcggcgga
   118021 cacaacaaac gccgtaagga aaccgcggcg gcgtcgtcgt cgtcctcgga cgaagacttg
   118081 agtttcccag gcgaggccga gcacggccgg gcacgaaagc gtctaaaaag tcacgtcaat
   118141 agcgacggtg gaagtggcgg gcacgcgggt tccaatcagc agcagcaaca acgttacgat
   118201 gaactgcggg atgccattca cgagctgaaa cgcgatctgt ttgccgcgcg gcagagttct
   118261 acgttacttt cggcggctct cccctctgcg gcctcttcct ccccaactac tactaccgtg
   118321 tgtactccca ccagcgagct gacgagtggc ggaggagaaa cacccacggc acttctatcc
   118381 ggaggtgcca aggtagctga gcgcgctcag gccggcgtgg tgaacgccag ttgccgcctc
   118441 gctaccgcgt cgggttctga ggcggcaacg gccgggccct cgacggcagg ttcttcttcc
   118501 tgcccggcta gtgtcgtgtt agccgccgct gctgcccaag ccgccgcagc ttcccagagc
   118561 ccgcccaaag acatggtaga tctgaatcgg cggatttttg tggctgcgct caataagctc
   118621 gagtaagaga gacgctatat ttagggcttc cctctctttt ttttctacac cgtgataccc
   118681 taataaagca caccgcggtt attatcaacg tctctgtgtt tttattattt agaaataaat
   118741 acagggaatg ggaaaaacac gcgggggaaa aacaaagaag tctctctcta gatgcggggt
   118801 cgactgcgtg gggtgctgga agtggaagcg gtgctgatgg gtgagggtcg tggcgcgggc
   118861 acggaccgca acgtgctgct gatgtctgcc gcggtacgca cgtcgccgtc catgtcgctg
   118921 cgcagataag aggtaggtcg tagtgcggcg tgctgcacgc tcaccgttaa tggtaccaag
   118981 tcgtcaaggc tcgcaaagac gtgccacgag gggatgacga gcgtgagagc cccgttgtta
   119041 ccgcttcgac gtctttgtcc ggtcaggatc agtgcccggg acagtccggc ttgggtgtcc
   119101 gagtcctcgt cgccgctggc ttcctcgaag ccggcaaaca tggcttcgga caggggggtc
   119161 ggcgtcggtg tggaggagag gtcatcttcg tcgtcctctt cctcttcttc ctcctcttcc
   119221 tcggtgggtg gtaatccggg ggactgcggg agaaactcgg agacggcgcc gcgcatgacg
   119281 ttgctccgtg gaaagagacc ggcgcgcagc tgcacctggg gacgcttgat tttgtccggt
   119341 ttaccgggtg tgagagtcca aaacccacgg cggaaaaagt ggatgcggcc tagcggctgt
   119401 cggtgttcca aatgaacggc ctgatcgccg gtcagcgtga cgcggagggt gattcgcaca
   119461 cgatcgggta gcgggccggc ttctatggag acgcccggga tgttttccgg gaaaaagatg
   119521 gtgtcgtgag tctgattggt ctcgaaagca ttctggatct gcacgatgta ctcgggatgt
   119581 atgcgcgtca gcgtaaaact tttgggaatc aacagctgga agccgttgtc cggcaagcgt
   119641 cgtaggtgcg ggtacggatt gtgtcgcgcc accacctcgg cgcgatgcgt gtaaaccgaa
   119701 aagtgcagaa acacgctggt cggcgggtgc ggtgagtcgt gatgcagaaa cagcatgatc
   119761 cattggcctc gttcgtccgt ctccgttttg tggatgtacg tgttagggtc cgaacaggcc
   119821 agctgctcca gggcgtctac cagcgtcagc gggatggcgc cggcgcgaaa ggcgaactgg
   119881 ctgacaaaga tctgccctgc ctccaaactg ctgtcggttc tgcggcgcca gttcggcgtt
   119941 acggtcagtc gcacggccca gtggtgagcc gtgcggcgga tgatggcgcg cgcttccatt
   120001 cgcggccgat tttcttcgcc gccgcgccgc tggctctgaa agaggtgcag tccgctaacg
   120061 ggcacgcggt ccagcggcag cgcaaaggcc agtaccgaga ccgtgttgtt ttctgagcct
   120121 ggcgtcaggc gtcgtgggcc aaagttgttg aggtccacca gcagtcggtc ctgttcgccc
   120181 accacgcagc ggcccttgat gtttaagtcg gtcaggtcta cggtgtcgtg cggagatttg
   120241 ttctcctgaa aacagcagag aaccgagggc cggctcacct ctatgttggt acgcaggtcc
   120301 aggagtcgca gacgaccggc ttccagcgag ccgccttcca cgttggtgat gagccgaagc
   120361 acctggcagt gcaggcgacc aaagcttccg ctggcggctt cggcctcgct gatcgcggcc
   120421 gcttccgacg agggtccctc accgggcgag gacgatgcct gagacattgc gaaggcggga
   120481 tggggggagg gtcaggggat gcgcaaaggt gaacgggtct tcgtgggagg tcgggaaggg
   120541 ttccggcaac tgtcgcaaat atagcagcgg tgacaggtgt ggcggccaaa agttgcgtgt
   120601 ctgagtggac gtgggttttt atagagtcgt cctaagcgcg tgcgcggcgg gtggctcaac
   120661 ctcggtgctt tttgggcgtc gaggcgatgc atggcccggg caaggcgtct tgccggtggc
   120721 ggcgacgttt gggttgcgca gcgggctgcc atacgccttc caattcggcg aagatgcggt
   120781 agatgtcgtt ggcgtcccag aagaactcct ggtacttcag attctgaccc tgaaccgtag
   120841 ccaccatggg caccaggttg cgggccagga tgccggcctg ccagggcggc caggtgaaca
   120901 cggccggatt gtggatttcg ttgtcggaat cctcgtcggt gtcctcttcg ggcgcgacgg
   120961 tggactcggc cttaaggcgg ccgcgtgtca taacgcccgc cgtgcacgcc gtcgccgagg
   121021 atgctgattt gcgtttgcgg cccgcggaag tggaggcgct cgccatggcg ccgccgccgg
   121081 tgacgcgggg cgtcttacgc tcggtggtta cgagttcttc gtcggagtcc gatccgctgg
   121141 tccagacgtc gtcgtcgccc tgggcggcac cctcgtcgtg ccggtcccag gtgtgtcggt
   121201 actcaagctt gccctggatg cgatactggc tggtgaaggt ggggtgctcg ctgtactgag
   121261 gcccgcgctg cagcaacaag tcgatatcga aaaagaagag cgcagccacg ggatcgtact
   121321 gacgcagttc cacggtctcg cgtatcgctt gtacctccag gaagatttgc tgcccgttca
   121381 tcaacaggtt acctgagatg ctcaggcccg ggatgctctt gggacacagc agcccaaaat
   121441 gctcgtgtga ggtaaaagcc acatccagca tgatgtgcga gatcttgccc ggtttgatta
   121501 tcatattttt gggacacaac accgtaaagc cgttgcgctc gtgggggcgc atgaagggtt
   121561 gcgggttgcg ggtcatcgtt aggtcctctt ccacgtcaga gcccagcgtg acgtgcataa
   121621 agagcttgcc ggagggcacg tcctcgcaga aggactccag gtacaccttg acgtactggt
   121681 cacctatcac ctgcatcttg gttgcgcgcg tgttctccat ggagcaaacc agctcgtgcg
   121741 cgcacaccac gtgccgcagt gccacgtcct tggtgggaaa cacgaacgct gacgtgtagt
   121801 agacgtcggg ctctttccac tggttctgct gacgcgtcca ggccagtccc gagaccgtga
   121861 gacgcgcctg ccacatctgc ttgcccgacg cgtgaataac agcgtcggct acgggcaggt
   121921 gtcggtgttt gcgctcggcc gccgacgggt agtggtgcac gttgatgctg gggatgttca
   121981 gcatcttgag cggcagcgcg tacacataga tcgacatggg ctcttggctg gggcagatgc
   122041 ttcggcccgt ggggttgtgc acgttgaccg acacgttctc cacctcgctg cccgtaaagt
   122101 acgtgtgctg cacctgcagc tgattgtcgc cgcggtggca tggcgtcgag tcgggcgtgt
   122161 actgcgacac caggatcagc gagggctggc tcacgcgtac gtggataccc gtctgcagga
   122221 gtcgcgtctc gtgcggcagc accggcgtat cgccgcgact aaacacggct ttcagcacgt
   122281 gccccgaaat gggacccagt acggatatca tttcgggaca acggcgaccg cgcgactcca
   122341 tgctgcctgc gcgtacgggt gtaggcgact gagcggcgcg ccctctgcgg ccgccgcctt
   122401 acataggcag gcgaccaaac gcggaacccg aaataaaaac gttatacaca gagacaaccg
   122461 cggattattg agtgtctttt tttattacaa aaaaaaagag gcaaagcccc accgtcacca
   122521 caccccatca cacaccacca ccgatttttt ttgttttaat cccgtattgc gcggacgcct
   122581 agtgtccgtt ttccatcacc agggtcctct gtttagagat cgccgcagac catggctaga
   122641 gtgacaggac tcgttttctc tgtcgtattt tccgtaagct tacagtcttg cggttccgtc
   122701 tccggggacg ccagtcgcat gggcagcagg tcctccagcg cgatggaagc gcccagcacc
   122761 gagagctgct gttgcgacgg cgaatgggac gtggaccgcg agtgtagcgt ggatttgact
   122821 tggtgcgtca ttgctgacag gcaaccgcga ttcagcgtat gctttgacga gataaaatag
   122881 aggcgtccca ggagcgcgtc ccgtgggaac gtggcgccgt tctcgtcgct taccagtacg
   122941 gttaattcca accaggagcg cggtagccag accgtaacgg gcattttgag tccctgacgg
   123001 ttgtgtggta caaaaacacc cagataaggc ccgtaaaagc ggcggtagat acgtaacgtg
   123061 tgcgagtttt tcagcgtcaa ttcgtaaggg acgcgcacct ccagtccctc gtccgccgcg
   123121 ccggagcgtg gcggtacaaa gtaaggcagt ggcgcgtccg aaaagaaggg tcgtcgcacc
   123181 gtttcgcgtc gcagccgcag gcgaaacgcc actgggtcgg ctggcgcctc ggtgcggtcg
   123241 caggtcacgt tgaaacgtaa tatgccgtct tggtatagcg tgagtgacga cagcgtcagg
   123301 tccggcggtg attcgttcgg gtctagctcc aatcgtccaa agacggaggg tcccaatgtc
   123361 ttggcagtgg tttccgagag gcgcgccgaa atacggctgg tgagtccacg cggccccgag
   123421 atgccgcctt ccactcgatg ccagcacagc gcgtgtcgta cgcgcaccgt cagtgtgggc
   123481 gtcagatccg cgtccgttga ttccgcggta tcagcgacgg aagccgcgtt ctccgttacg
   123541 ttgtttatat ccagcgtcgg ctcgaacgtg agttctggca gatgcagcgc cagacagtcg
   123601 tgtaacgccg tgtgatgcgc ggctttacgt cgtagcggta gccgtttcag cagcggcgtg
   123661 atgatacgga gcgcgaagag attgagtgat aagcgcacga tggccatgcg cgtcagttgt
   123721 tggtcaatta ccgagcgcag gatatggcag cctgggcgtg cgggaaagag agagaaggcc
   123781 gggcgcacgt cagaatcctc gttagagacc acgcatagaa tgccgcgttc acgatcgtcg
   123841 ttgcggtcat cctcgtcctc ttcttctttc ttctcttctt tttccttttt tttctcgggc
   123901 tcgtgggaag ccgccgtttc ttcttcttgc gacgtcgcgg gggcggtttg agactcgccg
   123961 ttcgcttccc ccaattgcag cggcgtagag agcaaaatct ggaagggatc ccgcaattct
   124021 tcgggtcgga ggtcgaggtg caactggatc agatggtagg tgccgcggtg cacccgaggc
   124081 tgacggatgt cgtgtttatc cgtcagtgtg aggatggtct gcggtgagcc gctgtgcttg
   124141 tccagctcgt ccggcgtttt caggaggaga ctgtcgtcgt cggtactggc gacacccatc
   124201 atggtcgtgg tggtagtggt ggcgaggaaa gtgagcggcg gcgtcgacag agctcggcgt
   124261 tggcggcggc atttgccgct gtgtcggctg ctattgctgc caacgccacc gccgccgcct
   124321 cgtctggctc gtggccgacg ggcccgattc cgaaggttgg ggtcgacgcg tggcatgctt
   124381 ggtgtctgcg ggcgcgagag ggccggctca gcctttaaat atgcaggtcg cggatttgtt
   124441 atcgggtgaa acgtcacaca ccgtgaagac gacctgttcg cggatgaggt catccagctg
   124501 tcgcagcatg acgaaaagcg ccgacagccg cgcgatctcg tcgtcgggcg acacgtgctg
   124561 cggccgcgcg ggcgtgcgcg gctcgccgac gctgcgctcg cggtccagcc gcatcagcag
   124621 ctcctggcac ttgacgagca gcatggagct gtcctctagc gctaacttgc gcacgtaggt
   124681 catggtcagc tccgaggcta ggttagccac catggacatg gagaggcagg cggtcttcat
   124741 gtcgatcagc aggtgctggt cgatgaccgg atcggggatg gtgaaggtgg cgtcgcgaaa
   124801 agtaatggtc tgcagctgct gcacggcagc ctttacctcc tcgtacgaac ggtcgagcga
   124861 gaagaggccc atgatgagta gtcgctggtt gatttccagc gccagtggca tgggtacgat
   124921 ccagggcagc accagctccc actggcccag cgtcagcagg ttctcgcgcg ccagcggtcc
   124981 gtggaagagc ggcggcagca cgcatagcgc gtcgcccttc tcccaagtca cgggtcccgt
   125041 gttgaggacg gtgtagagca gtccgtgcgt cggtacgtgt aggaggatct ggttgccttc
   125101 tacgcgccgc atcaacgtca gcgtcatatt gcgcagcagg ccgcgcagtc gtacgtagcc
   125161 gcgggtgtga tctacgaact ggtgtaggcc cagctggtag tgcttgatga gatgtagacg
   125221 ctgcggaatg ggcacaacgg ccgctactag tttggtcagt ttgcctacgt cggcgatgct
   125281 gagcttgtgg tcgaaagtgc agaagatgtt ggcctccatg gccgccatag cggcggtgaa
   125341 atcctggccg cgacggagga gaagcggaga cgaacaacgt ctgcaccggg cgcggcgtca
   125401 gagcgagcgt ggcgcgtccg ggcccgcgtt tgcgtctagg tgactcgccg ctaacctgcg
   125461 gtcgtcgccg tcctcctcac cggacggcct cacgagttaa ataacatgga ttgctgcagc
   125521 gggatgattt cgcctacgac gtagttacca aagtgcgttt cggacgtagc aaaagccccg
   125581 gcgccaccct tgagtttggt ctccatcagc gccagcgtgg tggtgctgag gatcggtagc
   125641 gcttcctgcg tcagacggca cgggttttcg atgagttgtt ccgtgccttc gacgcagacg
   125701 tactgcgtgt ccgtgtcgcc gcggatgcag tccttggcgc gtagcaggta ctcgtcgatg
   125761 gttttgaaga gcgttttgtt ggccgcgata atctcttctg tgttaaagta ctgcgcgcaa
   125821 gggctgtaga atttggagtt gtagcctaga cgttcgcgat gtcgggtgtt gtagagtacg
   125881 tcgctcagac agccggcttg cgaggcccag gggttgtgtg tggccgcgaa agtctgtgcg
   125941 tccgcttcgc gatggtcgta gatggccttg gtggcggcct ccgtgtcgta cggatcgacg
   126001 gccagcatgc aggaggcacg cccgcgcggg ttgttgggga tcttaaagta attaacgtcc
   126061 atcgtcaccg gcgtaaggat tagttcgcac gcggcctttt gtccgtgcac cgtggcggcg
   126121 gcattgcgct cggacatgct gccgaacgtc agcatggaga tggtctccgt gtctaacagt
   126181 tgcggccgtt ctacgccggc cgcgtgccgg atccagcggt ccacctcgtc gtgccggtac
   126241 acgttcatag ggaagacgcg aaagaggtcc tgcacgcgga cgcccatgtc ggttcgcacg
   126301 cggtttacgt aggctacgca ggtatttgac gtgtaaccca gacccatgtc tacggtgtta
   126361 atgttctgcg tgacgtggta cgtggtgctg atgtcgcgtt cctccttggt cacgataggg
   126421 ttgttgatga taactgacgt gcatgatttg ccgctgtaga gcagcatgtc cacctcgaag
   126481 gtgtcggtgc gtacggccgt gagtgcgaat cccgggtgga tgtgcgcctt ggtctgcagc
   126541 accagtgaaa ctggtgagat tttgtataac atggcggcca gcgtcatgac tgagtgcaac
   126601 acgttgggac aggtggccga gtaacgcgaa aagggcgagc gcagccagtt gtggtactcg
   126661 tgcgcgaagg ctgtgggtag cgggaaacca ccgtcgtgac ggtgatagtg cgggaactcg
   126721 gtcacgtagc gtttaatgtc gtcgctcaac gccgcgcaga tggtggggtt tgagtagaaa
   126781 cggtggaaag gtacgggtag gctgtactcg atcaacgtct taggcgccgt cacgacgcag
   126841 cagccgttgt aaagcacgtg ctgacgtgag ataaagtccg gcaggccctg acgctgcgcg
   126901 tggtccagag gcgcgcgcac ttcgagcacc ttgacgtgct cgcccacgaa ttgcacggcc
   126961 aaaaacagtt cacgacaggc ctgcagcagc ggcgtatgtg cgtcggtggc gacgtcctcc
   127021 accagctcgg tcagcatctc gcctacggct tgacgttgcg ccgctatcga gtcttcgggg
   127081 gtgacgccgc ttgtgctctc tttcgacgtc gtacctgacg tggagaccgc ggtggcggcc
   127141 ggcatcagga gaaacgccgg tcggtaaaag aggtctacta gcagcgtctt gaggttgagt
   127201 cccaggccgc aggcccggtt gttggtcatg gcgggcatga ggcagagata aaagaccttt
   127261 tgtaacgtcc attcgtcgtc ggtggcacgg taatcgtcca caaacagcgg ctcgtcggca
   127321 tccatggcgc ccaaacgcgg tacgtccgaa acgccgtggt gtcgcgcctc gatgttggcc
   127381 gggttcaacg gttgccggtc ggccactacc tgtacgcctt ccatgttacg cggcaggtgc
   127441 gtaacgaagg ggggccacag ccggtggtcg tgcagcgcgt tcacgtaagc cgatagcggt
   127501 tcctcagcca gttgaccgtt gttaagtccc ggcagcgctg agatgcgcgt taccagacgc
   127561 agcacggcga ccagattgcg gtagtgaaag agcaactgcg gtggtagggc gccatcagcc
   127621 aggtgttcgg cgatcaacgt caccagcgcg tagctgtgcg caaaaaccag cagctgacgt
   127681 gtgtgaaaca tgttgacgat acaacgtgct acgaaagtgc ggattagcaa aaaagcgtcg
   127741 acgttgccgt gtaccagcac gtcgaccagg tagcaaagct cggggtaatt ggggcttgta
   127801 acggtggttt tgaaaagtcg caacgtctct tcgtagtcgg gtggtggccg cagtcgcatg
   127861 tgttccatga tctcccaggt gcgcagttcg tggaaggggc ccggtgccag tccatctggc
   127921 aaattaccga tgacgatacg cggtgtacac agcgccaccg tttcgctgtt ttcctggcag
   127981 tgcgtaaagt cgaagaaggg gtgcagctcg gtgtagagcg tgatgttgcc caccttgtag
   128041 aagtcggtga ccacaaagtc ctgcttcatt tcgttcaccg tgcgcgggac ctcgcgtcgt
   128101 acgcggtaaa aatgcggtat gcggcgcgcc gcaccgccca tgggttcctg ctgaaaacga
   128161 cactcgagca gtcgttgcat ggcgggttcc gagggtggtc cgcgttccgt gaaggtctgt
   128221 agacagggcg cgggctcgtg cagcaccggg tggcacagcg tcttgagcgc gtccacaaag
   128281 tctatttttt gtacggcacg gtcccggttt agcaggtagg ccgtggtggg caacgcgttg
   128341 cgaacggtgt cgttaagctt aactttgctt tccaccgtgg tgtaaccgcg atcctcgggc
   128401 agatacagcc ctacggggaa gaaaaacgtc aggtccacgt tacgttctag cggatctttg
   128461 gtatcggtgt ttttgtagac gcgccgcaag ttttccataa tcaccgtttt ttcgcccagt
   128521 cggatcacgt ccatgctcag cggcgttaag ctgtgcgccc cggcctgcga aagcgagtcg
   128581 ttgggcaaat gcggttggcc cgaagtcaga tgagccttgt acgagttgaa atcggccagg
   128641 atcgagtgat aggatatggc agtgacggca ttttcgggac tgagtacaaa attgccgtag
   128701 gtggccggcg ccgagaccgt ttctttggtg atgtggcttg agagcagcga catgatgatc
   128761 tgcataacgt tggccgtgct taccatcacg ccactgatct tggcccccga gctcgtggtg
   128821 tacgtggtgg ggttgtctag gatgctatcg gtggccgctt cggccagacg cgtgaggaac
   128881 ttgagcacat agtcgcgatc gcgcgtgcga ttcagcaaaa agagcgtggc cagcattttg
   128941 gccttgaagc tctgcaagat gttgcttcgc tggatgcggt tcagcgcctg tcgcgccagc
   129001 gtggcgttct ctaccagcgt ctgcaccaca aagtacggcg gcgccttgcg tagcagtgtc
   129061 tgtaaaaagc tgtgaatcaa gccgcgttcc atggcgtcgg ccgtgttttt gagcgcgcgc
   129121 agcaccgtgt gcatagcttc cacgttgagg atcttgtcca ggatggtgcc ttcgaacgtc
   129181 tcgcgcagat acgtgaggca ggctgcgctg agctcaaagg ggatggtgat gggggatttt
   129241 tcactgtatt tggtgaccat aatggtggtc tgacgactgg taggcaaacc ggcgccgctg
   129301 gccacccgcg gcacctgtac gtggaacagc atttttcccg tagtcagttt attgaggtcg
   129361 tggaacttga tggcgtgcgc cgccgcggcc aagccgctgg tcaaaaaata aacccattcc
   129421 aggcgattgc agaaggtgcc gaagatggct tcgaagtgaa tattgtaacg ctcggggtca
   129481 tcgccgtagt agatgcgtaa ggcctcgaac atctcctcgc cggcgctggt cttgacgtgc
   129541 gtcagaaagt cagtgggaat gcctacttta ggcaggagct cgagcgccga ccagttctcc
   129601 atcgcggcgg cggcgtgagc gcgaggcgtc ggagctcggg gaaagcagcg cgacccggag
   129661 aatggccggc gctgcgccgc gccgcctcgg ctgtgacgct ctaatagtcg tcggcggctc
   129721 cgctatgccg cgccgggttt tacacgtccc cgtgcacgtt cgcgcctgca acctcaccca
   129781 agagctatcg acgggcgagg acgcccgctt ctgtcgtccg cgacccgtta acgtcgaacg
   129841 ggtgcgcgct gtttttgcgg ctctctaccg tgcctgtccg atacacgtga ggaccgaacc
   129901 cgagcgtgtc aagctggtac tgggtcgtct gttactggga cccgtggccg taccctgttt
   129961 ttgcgacggt gaagtggagg gccacggtga acatctggta cctacgacgc agttttgtcg
   130021 cgggccgctg ctctacgtgc accgacgttg ttgttgcgga tccgtgaccg ccgggcgcgc
   130081 gctgtcctac cacgttctcg aaaaccacgt ggccacgcat gtgctacgcg gattgctctc
   130141 gctgacggaa tggaatcgag aattgccgag cctcttttgc gactgtcctg gcggcggtgg
   130201 cgcctcggga accgaggaac gctacgctat ggcctgcctg ccgcgcgacc tcagcctgca
   130261 cctggacgac tatccttacc tgatggtgga aatcggacgc gtactcagtg tcagcgaggt
   130321 agacgactac gtaaccgccg tctccggcta cctgggcgag gccgcggcgc cgcgcatcca
   130381 ggttcactac aagctgctct ttggactcaa cgtgcgtccg caagcgccgt gcgcgttgga
   130441 cgctacacgc gacttttttc tgctggagct gcaaaagctt tggctgggcg ttgaatatca
   130501 ccacgaagtg acgtcggagt ttttcggtcg cgtgctggct cagctgcatc gcgaccgcgc
   130561 ccgcgtcatg atggcgcttc gcttgcccga gcagacggtg tgccacctga gcaccttcgt
   130621 tctcagtcgc ttcaagcgac aggtactgta cttcaagtta caggtgagct acggcaagtg
   130681 ccggactggc cacgctgaca gaagtggggg agggggaaac ggtggaaatc agggacacca
   130741 caacctgctg tgttatcgac gccttagcgt cacgtttgcc gacacggaca cggtgtggag
   130801 aaaccttttc tacgtttatt atgaactagc tcgggatctg gggtcccatg ggacagagaa
   130861 ccgacccgta aaccgcggtt acggtgtttc ttgcgctccg aggacgtcgc ggctatcacc
   130921 gtcagaatcg acggtggttt cggcgaacgg acacgcgctg tcttccaccg cgctcccgac
   130981 gacgagcgcg ggtcacaagc tgtcactgcc gcgcgacccg gccgccgatc gcgttcgacg
   131041 ttacgtgtgc atcatctcgc gtctcatgta cgctcggtac ggggagagat ggcgtaaaca
   131101 ccgtcaacgg cggtcggaga cgggagaaga ggaggaggaa gagacgctgg aatcggggga
   131161 gactgacgcc acgccgccat ttgactttac ggggcagcag ctgcgccggg cctatcagga
   131221 acaccgacgt cgtaaacatc tagccgtgca gcgttacgcg ccgtgtcgtc gtaagctcat
   131281 cggcgggatg gagtttgccg aggtgacggg cgtgagtctg gaccgcatcg ccgtcaacgc
   131341 tttcaacacc aaccgcgtta tcaatatgaa ggccgcgctc tcgtccatcg ccgcgtcggg
   131401 tctcggcgtg cgcgcgccgc ggcttcccaa gaacatgacc cacagttttg tgatgtacaa
   131461 gcacaccttt aaggagcccg cttgcaccgt cagcaccttt gtttccaacg acgccgtcta
   131521 catcaactcg ctcaacgtca atattcgcgg ttcctacccc gagtttctgt actcgctggg
   131581 cgtgtaccgg ctgcacgtta atatcgatca cttttttctg ccggccgtgg tgtgcaacag
   131641 caactcctcg ctggacgtgc atgggctgga ggaccaggcg gtgatccgct cggagcgcag
   131701 caaggtgtac tggaccacca actttccgtg catgatctcg catactaaca acgtcaacgt
   131761 gggctggttc aaagcggcta cggccattgt gccgcgcgtc tcgggcgctg acctggaagc
   131821 cattctgctc aaagaactct cgtgcatcaa gaacatgcgc gacgtgtgca tcgattacgg
   131881 tctgcaccgc gttttcacgc aactagagct gcgcaattcg taccagatcc ccttcctggc
   131941 caagcagtta gtgctgtttc tgcgtgcttg cctgctcaag ctgcacggtc gagagaagcg
   132001 gctgcagttg gaccgcctag tatttgaggc ggcacagcgg ggtctctttg actacagcaa
   132061 gaacctcacg gcgcacacca agatcaagca cacttgtgcg ctcatcggca gtcgtctagc
   132121 caacaacgtg cccaagatcc tggcccggaa caaaaaagtc aaattggatc acctgggccg
   132181 gaacgccaac gtgctgacgg tgtgtcggca cgtggaagcc cacaagatcc ctcgcacgcg
   132241 cctcaaagtg ttagtcgagg tgctgggcgt gttgcagagt atcagcggta cgccgcacac
   132301 gcgcgaagtg atccaccaga cgttgtttcg attgtgctcg gcggccgcag ccacatcggg
   132361 cctgtgttca tcccctcccc cattgtgtgt gtcctcatct tcctccgtcc cttctgtccc
   132421 aacctccgtc agcgttgacg gcagttctga acccacgtcg ccgcgagtgc ggtttgcatc
   132481 acgatgatgg aagccgcggc cgctgccgcc gcggcgtttc gtccggagga gcgtccgacg
   132541 ccgggttggc acgacgcggc gttgttaatg gacgacggta cggtgcgcga gcacgcgttt
   132601 cgcaacggac cgttgtcgca actgattcgc cgtgtgttac cgccgccgcc cgacgccgaa
   132661 gacgacgtgg tttttgcttc cgagctgtgt ttttattgca gcggtcgttt taaccgcagg
   132721 tcgtccgtct tctccatcta ttggcagaag catagcgatc tggtgtacgc gcttacgggc
   132781 attacccatt gcgccaagtt ggtggtggaa tgcggtcagt tggggagtag taggctacgg
   132841 tggcgcgacg gtgatgcgag tggtgaggag cgccggggag acgacgacag cagggacgag
   132901 ctgtacgacg tgccgggcat ttatatgatt cgcgtcaacg acggcggcag caccggcccc
   132961 agacacgtta tttggccggg taccagcgtg ctgtgggcgc cggacgttgt gatcactacg
   133021 gtgcagcgac gaatctcggc ggcgcgcgcc ctggtgaaca cgttccgcca atattttttt
   133081 ttgctggaac ggcgctcgca cgaggagctg gttctttgtc cgcccgagat ggaggagcgt
   133141 ctagcgccgt tgttgcagag tgccacgcga ggtgattcgg acatgtttga cggtgtggtg
   133201 gccagcgctt atcaccgttt gcgaatgagt aatattccgc gttcatccgc ccgtctgctg
   133261 gagcactgcg tggggctggc gggtgctaag aagctgctct tgctcgacgt gccgcgtctg
   133321 gagaactatt ttctttgtca agtctgtctt tacgagttgg acgaggacga gatgggcgag
   133381 gagatgctgg gcatgttggc cggaaagccc gaggatgccg ccgtctcggg cgcaagcggc
   133441 ggttttctgc tacatcgcaa gacgatgaag ctggccgcct gtctgtgttt gttgctcaat
   133501 tcgctgcatt tgcaccagga ggcgctggag gccttggatc ctccgccgcc gcgcgtcgag
   133561 gagaacgacc ttgtcaacgt ggtgctgcgc cgttattatc gcagtcacgg cggcgtgcag
   133621 gcgcggacgc tggcggcggc ccgggctttg ttagccgact acgctgaaac gttttcgcct
   133681 ttggggagtt ttacgcgcct gggttacgat cgtctcgttt ctgccgatgc cggcgtcagt
   133741 cgccggcacc tggtggctct gctgcgtgcc tagctgaccc tgaaacggat ggcgtgtata
   133801 tcgtcacaca ggtaggtggc catgatgacg gcgatgataa gatcgtccga gatacgattc
   133861 tggcgcttgg ccgagtagcg tgccgtcgtg ccttcggcca gcgtgacgcg gtgcaggttc
   133921 tgaatctgct ccagaagata ctcgatgggg tcgtggctca gcttgatggt gtaggagacg
   133981 agctcttgcg aggctttgat gtagcccgag ttgaaacgcg agatgaactg ttccacggcc
   134041 agcgccttgt cgcggcccat gaggtagaag ggctgttcga tgtggttctg gtcgggcgtg
   134101 tggtagaaga gcacgcggat gagcgtgctg ctctgcacgc tctgtcggat gaggcaggcg
   134161 atgcgcacgg ccgccgcctg gttggtgttg ccctccacgg cgatacgcag ttcgtccagg
   134221 taagggtgca ggctcagcac cgagatgatc atgtgcgccg cgcactcggc gatggctacc
   134281 tcagaactct cggagaggtc gcgcaaaaag aaatgctcta ggccgtaaat gagaaactgg
   134341 tgtcggtagg cgcctacggc cgccacgccc gtgcccgagg ccttgcggtt ggtggtgaag
   134401 gccgggtcca gatacacgta aagcgtcttg ccgaaataat cgtaggcgtt ggtgttgagc
   134461 gtgctgtaac gcaaaatatc gaactcttcg cggctctggt ccgtgatgag cacggtgttc
   134521 tgcgagattt tattggtacc gccgatgatc tcgtccatga aagcgcccgg cataaacatg
   134581 ttggccgtct tgcgcacctg cgagttgagg ctgatgaagg tgggcttgtg cagtcggtag
   134641 caaggacacg ccgtggcgtc gcccttctcc gtgaagctgt gcaggtgctc ttcgcacacg
   134701 taagagacca cgttgagcat gtcaaagggc gcattgttga ggcgcgtcaa gaaacacgtg
   134761 gcgtcactgg tagtgttggt ggacgatatg aagatgatct tggtggtatt ctgggccagg
   134821 aaccccagaa tggtgttgaa ggcctctttc ttgatgaagt gcgcctcgtc caccagcagc
   134881 aaatggaagt tttgtcctcg gatgctctgt gtagagagga gacagaaaag ggactcttat
   134941 gattacgcac gctcggctgg aagcctacag agtcggggtg gggccggaca ggtgagccag
   135001 gtgagccgcc aggtgaggcg ggatcgccgt gtgccaaccg ggctgcgacc tgaaaaccgg
   135061 aaccaatccg ccgacaccgg cgccgcgtga cgcgcgccca taaaaacgaa agtgtcgtcg
   135121 tcgcgacccg ccacagccgc catgaactcg ttgctggcgg aactcaaccg actgggggtc
   135181 gcgcacgcca ctacggagga tgtttttatc tttgtcgacc gcctctttca acacttttcc
   135241 ttccttttcc aggccgagga gtcaggcccg cgccgcttgg aactggtcgc gtccgtgttc
   135301 gagcacctga cggtggagtg cgtcaacgac atcctggacg cctgcagcca cccggacgtg
   135361 aacgtcgtgg agacaagcaa cacctgtcgt ccctgccctt ctcctgttcc ctccgccccc
   135421 aaaactgtca gcgacgctca gacgtcatgt gcgacgcctc gggcgcctgt gacatgaggc
   135481 acgtccagaa cgcgtttacc gaggagatcc agttacactc gctctacgcg tgcacgcgct
   135541 gctttcgcac gcacctgtgt gatctgggca gcggctgcgc gctcgtctcc acgctcgagg
   135601 gctccgtctg cgtcaagacg ggcctggtat acgaagctct ctatccggtg gcgcgtagcc
   135661 acctgttgga acccatcgag gaggccgcac tggacgacgt caacatcatc agcgccgtgc
   135721 tcagcggcgt gtacagctac ctcatgacgc acgccggccg ttacgccgac gtgatccaag
   135781 aggtggtcga gcgcgaccgc ctcaaaaagc aggtggagga cagtatttac ttcaccttta
   135841 ataaggtttt ccgttctatg cataacgtca atcgtatttc ggtgcccgtc atcagccaac
   135901 tttttattca gcttatcatc ggtatctact caaagcagac caagtacgac gcgtgtgtca
   135961 tcaaggttag tcgtaagaag cgtgaggacg cgcttctgaa acagatgcgt tccgaatatg
   136021 gaaacgcacc tgtattcgga tctggcgttt gaggcgcggt tcgctgacga tgagcaattg
   136081 cctctacacc tggtgcttga ccaggaggtg ctgagtaacg aggaggccga gacgctgcgc
   136141 tacgtctact atcgtaatgt agacagcgct ggccgatccg cgggccgcgt tccgagcgga
   136201 gatgaggacg acgcaccggc ctccgacgac gccgaggacg ccgtgggcgg cgatcgcgct
   136261 tttgaccgcg agcggcggac ttggcagcgg gcctgttttc gtgtactacc gcgcccactg
   136321 gagttgctcg attacctacg tcaaagcggt ctcactgtga cgttagagaa agagcagcgc
   136381 gtgcgcatgt tctatgccgt cttcactacg ttgggtctgc gctgccccga taatcggctc
   136441 tcaggcgcgc agacgctaca cctgagactg gtctggcccg acggcagcta tcgtgactgg
   136501 gagtttttag cgcgtgacct gttacgagaa gagatggaag cgaataagcg cgaccggcag
   136561 caccagttgg ctacgaccac gaatcaccgt cggcggggcg gactgcgtaa taacttagac
   136621 aatgggtcgg atcgccgttt gcccgaagcg gctgtggctt ctctggagac ggccgtcagt
   136681 actccatttt ttgaaattcc gaacggagca ggaacctcct ccgcgaacgg cggcggcaga
   136741 ttcagtaacc tggagcagcg ggtagcgcgt ttgttgcgcg gcgacgagga attcatctat
   136801 cacgcgggtc cattggagcc gccttccaag atacgcggtc atgagttggt gcagctgcgc
   136861 ctggacgtaa atccagacct catgtacgcc accgatccgc acgaccgcga cgaggtcgcg
   136921 cgtacggacg agtggaaggg tgccggtgtc tcgcgtctcc gcgaggtctg ggatgtgcag
   136981 catcgcgtgc gcctccgtgt gctgtggtac gtcaattcct tttggcgcag tcgcgagctg
   137041 agctacgatg accacgaagt cgaactatac cgggcgttgg acgcttatcg ggcgcgcatc
   137101 gccgtcgagt acgtgctgat tcgcgccgtg cgcgacgaga tctacgctgt actacgacgg
   137161 gacagcggcg cgttgccaca gcgtttcgcc tgccacgtgc cacggaacat gtcctggcgc
   137221 gttgtttggg aactttgccg tcatgccttg gcgctctgga tggatcgggc ggacgtgcgt
   137281 agctgtatta ttaaggcgct aacgcctcgt ctgagccggg gtgccgccgc tgccgctcag
   137341 cgagctcgtc gccagcgcga gcgctcggcg cccaaaccgc aggagctgct tttcggaccg
   137401 cggaacgaga gcggtccgcc cgccgaacgg acttggtacg ctgacgtggt gcgctgcgtt
   137461 cgcacgcaag tggatttggg cgtggaagtg cgcgcggcgc gttgtcctcg caccgggctt
   137521 tggatcgtcc gtgatcgccg cggacgcctg cgacgttggc tctcgcagcc cgaggtgtgc
   137581 gtgctctacg tcacgccaga cttggacttt tactgggtgc tgccgggcgg ctttgccgtc
   137641 tcttcgcgcg tcactcttca tggcttggcg cagcgggctt tgcgagaccg attccagaac
   137701 tttgaagcag ttcttgcaag aggaatgcat gtggaagctg gtcggcaaga gccggaaaca
   137761 ccgcgagtat cgggccgtcg cttgccgttc gacgatcttt agtccggagg acgacggctc
   137821 gtgtatcttg tgccaattgc tgttgttcta ccgcgacggc gaatggatcc tctgtctttg
   137881 ctgcaacggc cgttatcaag gccactatgg cgtgggccac gtacatcggc gtcgtcgacg
   137941 catctgtcat ttacctacct tgtaccaact gagcttcgga ggtcctttgg gtccagccag
   138001 cattgatttc ttgccaagct ttagccaggt gaccagcagt atgacgtgcg atggtattac
   138061 gcccgacgtg atttacgagg tctgcatgtt ggtgccccag gatgaagcca agcgcatcct
   138121 ggtcaagggt cacggtgcca tggacctgac ctgtcagaag gcagtgacgc taggcggcgc
   138181 cggcgcctgg ttgctgccgc gtcccgaagg ctacacgctt ttcttttaca ttctgtgcta
   138241 cgacctgttt acctcatgcg gcaatcggtg cgatatccct tccatgacgc ggctcatggc
   138301 ggcggccacg gcctgcgggc aggcgggttg cagcttttgc acggatcacg agggacatgt
   138361 agatcccact ggcaattacg tgggttgcac ccccgatatg ggccgctgtc tttgttacgt
   138421 gccctgtggg cccatgacgc agtcgctcat ccacaacgag gaacccgcga cttttttctg
   138481 tgagagcgat gacgccaagt acctatgcgc cgtaggttct aagaccgcgg cgcaggtcac
   138541 actgggagac ggcctggatt atcacatcgg tgtcaaggat tctgagggcc gatggttgcc
   138601 cgtcaagacc gatgtgtggg acctggtcaa ggtagaggaa cctgtgtcac gtatgatagt
   138661 gtgttcctgt ccggtgctta agaacctagt gcactaacgg ggtctgacag ttcacgggga
   138721 gaagaaacaa gaaacaacaa aaaaaaaaga ggacatggac tcgccacggt ttgtggcaag
   138781 gcgtatatta tcatcatgga gctactcacg ttggtgttgt agcaactggc aaaaagcgcc
   138841 gtgctcttgg cgccgcggtg gtcgatgctg atcacgttgt ccttgttctc gaccacgtag
   138901 tcgcgcgcga aggtgtggcg gcagcggaac tcgacctctt tgagcacaaa ctgcgacacg
   138961 tgcttttggt gcgccacgta gccgatgctg atgccgatca tgtgcttaag cagaaacgag
   139021 ataatgggga tgatgaacca agtcttgccg tgacgtcgcg gcaccaggaa cacggtggct
   139081 ttctgcttaa agatgtcgat ggaggtctgc gagaggaagt cgatctggaa ggcgtggatg
   139141 aggtactgca gcacgcgatt ggccagcacg gggatcttgg tcacggctat aaaaaagatg
   139201 acgtgtatca ataaattctt ttgaaacggt tcgagtcgga tggcttttgc gtcgccctcg
   139261 acggcggtac tgaagccgcc gtcgagccac tttttaaagt cggtcatgaa gttgttgatc
   139321 tgctgaaact gcggatcgcg gtagagctcg gtcaacgcgt ccagcttctg gtaggaggcg
   139381 cgctgctcct cggagcacgg gcgaaacgtc agttcatcga gcgcactctt gaggcgctcg
   139441 tgaaacagca gctcgcgctg gctttcctcg ggcgagttgt agtcgcggtg gcggccgcag
   139501 aaggccatga gcggcaggaa ggcctcgttg cacgagtggg ccagcccgag ttcggggtgc
   139561 atcatctggt agcgcttgcg gcacagcgcc gccacattgg tgaaggccgt ggagatgcag
   139621 gaggtggggt ggctcttgcg cttctgcagc tccgcgtagc gctcctggat cttggcggcc
   139681 gaatctccgc gcaacatgat ggcggcggcg gtggtgcgag cggaggttag gcggcagcgg
   139741 cgagaggaga ggaaaaagat ggcgtccgcg aggacgacgg aggatccacc tgaaaaccac
   139801 gttgtcgcgg acgtggcttg tgggacgggc gccgtcactc gttcgtcttc gtcgtcccta
   139861 gtggtgtcgt cttcctcggc gtcaggctca gacgaatctt cctccgcctc tcctctcagt
   139921 ttccccgtct cctctccctc aactgccgtc aggtctccgg ggtccgccgg ggtttcgacg
   139981 tccctgtgct cggtggaacg gatggtcgag ctgtcggcgc agtctccggc cgccgatttc
   140041 tcggtctccg aggcttggcg cttcgaggag gccgtaaata tggcgctggt ggcctgcgag
   140101 gccgtgtcac cttacgatcg ctttcgtcta attgaaacgc ccgacgagaa tttcttgttg
   140161 gtcaccaacg taattccgcg cgagtcggcc gaggtgccgg tgttggatag cagtagcagt
   140221 ggtggcgata gcgggccgga ggacaaaaag aaaaacgtcg ggaataaaac cgcgggggaa
   140281 aagaacggcg gtgggtctcg ggccaaacgc cgtcgtagac gacgcgctcc gaaaaacgac
   140341 gccgccacgc cgtcttttct acgtcgacac gacgtgctgg agcgtttcgc ggccgcggct
   140401 gagcctttgc cgtcgctttg tgtgcatgat tatgcgttac gcaatgctga ccgtgttacc
   140461 tacgacggcg aattaatcta cggcagttac ctgttgtatc gcaaggctca cgtggagctg
   140521 tcactctcca gcaacaaggt gcaacacgtg gaagccgtgc tgcgacaggt gtacacgccg
   140581 ggcttgttag atcatcacaa cgtgtgcgac gtggaggccc tgttgtggct gctgtactgt
   140641 ggaccgcgca gcttttgcgc gcgtgacacc tgtttcggtc gcgaaaagaa cggttgtcct
   140701 ttccccgcgt tgttgcccaa actcttttac gaacccgtgc gggactatat gacctacatg
   140761 aatctggctg agctgtacgt ctttgtttgg tatcgcggct acgaattccc tgcgccaacg
   140821 ccgcaggcga cgacggcggg tggtggtggt ggtggtggta gtggtggcgg cggcggggcc
   140881 ggcgcttgtg cggtcgagac gagcgcgtca gcaggccggg tcgatgacgc cggcgacgag
   140941 gtgcatttgc ctttaaagcc cgtctcgctg gaccgtctca gagaggtgtt acaggcggtg
   141001 cgcggccgct tctcggggcg cgaggtgccc gcctggccgg cctcgtcgcg cacctgtttg
   141061 ttgtgcgcgc tctacagtca gaaccgtctc tgtttagatc tcgcgcgtga cgaggcgcgg
   141121 accgtgagtt atagccccat cgtcatccaa gactgcgccg cggctgttac cgacgtcact
   141181 ttgagccaca tcttgcccgg ccagagcacc gtctcgcttt tccccgtcta ccacgtcggc
   141241 aagttgctgg acgctctctc gctgaacgac gcgggtctca tcacgttgaa tctatgacgt
   141301 cggtcaacaa acagctctta aaggacgtga tgcgcgtcga ccttgagcga cagcagcatc
   141361 agtttctgcg gcgtacctac ggaccgcagc accggctcac cacgcagcag gctttgacgg
   141421 tgatgcgtgt ggccgctcgg gaacagaccc gatacagtca gcgaacgacg cagtgcgtgg
   141481 ccgcacacct gttggagcaa cgggcggccg tgcagcaaga gttgcaacgc gcccgacagc
   141541 tgcaatccgg taacgtggac gacgcgctgg actctttaac cgagctgaag gacacggtag
   141601 acgacgtgag agccaccttg gtggactcgg tttcggcgac gtgcgatttg gacctggagg
   141661 ttgacgacgc cgtctaacag gtatagcaat ccccgtcacg cctctgttca gattttatta
   141721 aaaaaaaaac acaccataac gacagtgtcg gtgtggtagc tagtgcagcc ctaggaacag
   141781 ggaagactgt cgccactatg tcctccgcac ttcggtctcg ggctcgctcg gcctcgctcg
   141841 gaacgacgac tcagggctgg gatccgccgc cattgcgtcg tcccagcagg gcgcgccggc
   141901 gccagtggat gcgcgaagct gcgcaggccg ccgctcaagc cgcggtacag gccgcgcagg
   141961 ccgccgccgc tcaagttgcc caggctcacg tcgatgaaga cgaggtcgtg gatctgatga
   142021 ccgacgaggc cggcggcggc gtcaccactt tgaccaccct gagttccgtc agcacaacca
   142081 ccgtgcttgg acacgcgact ttttccgcat gcgttcgaag tgacgtgatg cgtgacggag
   142141 aaaaagagga cgcggcttcg gacaaggaga accagcgtcg gcccgtggtg ccgtccacgt
   142201 cgtctcgcgg cagcgccgcc agcggcgacg gttaccacgg cttgcgctgc cgcgaaacct
   142261 cggccatgtg gtcgttcgag tacgatcgcg acggcgacgt gaccagcgta cgccgcgctc
   142321 tcttcaccgg cggcagcgac ccctcggaca gcgtgagcgg cgtccgcggt ggacgcaaac
   142381 gcccgttgcg tccgccgttg gtgtcgctgg cccgcacccc gctgtgccga cgtcgtgtgg
   142441 gcggcgtgga cgcggtgctc gaagaaaacg acgtggagct gcgcgcggaa agtcaggaca
   142501 gcgccgtggc atcgggcccg ggccgcgttc cgcagccgct cagcggtagt tccggggagg
   142561 aatccgccac ggcggtggag gccgactcca cgtcacacga cgacgtgcat tgcacctgtt
   142621 ccaacgacca gatcatcacc acgtccatcc gcggccttac gtgcgacccg cgtatgttct
   142681 tgcgccttac gcatcccgag ctctgcgagc tctctatctc ctacctgctg gtctacgtgc
   142741 ccaaagagga cgatttttgc cacaagatct gttatgccgt ggacatgagc gacgagagct
   142801 accgcctggg ccagggctcc ttcggcgagg tctggccgct cgatcgctat cgcgtggtca
   142861 aggtggcgcg taagcacagc gagacggtgc tcacggtctg gatgtcgggc ctgatccgca
   142921 cgcgcgccgc tggcgagcaa cagcagccgc cgtcgctggt gggcacgggc gtgcaccgcg
   142981 gtctgctcac ggccacgggc tgctgtctgc tgcacaacgt cacggtacat cgacgtttcc
   143041 acacagacat gtttcatcac gaccagtgga agctggcgtg catcgacagc taccgacgtg
   143101 ccttttgcac gttggccgac gctatcaaat ttctcaatca ccagtgtcgt gtatgccact
   143161 ttgatattac acccatgaac gtgctcatcg acgtgaaccc gcacaacccc agcgagatcg
   143221 tgcgcgccgc gctgtgcgat tacagcctca gcgagcccta tccggattac aacgagcgct
   143281 gtgtggccgt ctttcaggag acgggcacgg cgcgccgcat ccccaactgc tcgcaccgtc
   143341 tgcgcgaatg ttaccaccct gctttccgac ccatgccgct gcagaagctg ctcatctgcg
   143401 acccgcacgc gcgtttcccc gtagccggcc tacggcgtta ttgcatgtcg gagttgtcgg
   143461 cgctgggtaa cgtgctgggc ttttgcctca tgcggctgtt ggaccggcgc ggtctggacg
   143521 aggtgcgcat gggtacggag gcgttgctct ttaagcacgc cggcgcggcc tgccgcgcgt
   143581 tggagaacgg caagctcacg cactgctccg acgcctgtct gctcattctg gcggcgcaaa
   143641 tgagctacgg cgcctgtctc ctgggcgagc atggcgccgc gctggtgtcg cacacgctac
   143701 gctttgtgga ggccaagatg tcctcgtgtc gcgtacgcgc ctttcgccgc ttctaccacg
   143761 aatgctcgca gaccatgctg cacgaatacg tcagaaagaa cgtggagcgt ctgttggcca
   143821 cgagcgacgg gctgtattta tataacgcct ttcggcgcac caccagcata atctgcgagg
   143881 aggaccttga cggtgactgc cgtcaactgt tccccgagta acctggacgc ggaacgtgac
   143941 ggttgccgag gggaaaggcg acagagaagg tacaaaccca ccggcgggga aaatactgag
   144001 gcgccgccat catcatgtgg ggcgtctcga gtttggacta cgacgacgat gaggagctca
   144061 cccggctgct ggcggtttgg gacgatgagc ccctcagtct ctttctcatg aacacctttt
   144121 tgctgcacca ggagggcttc cgtaatctgc cctttacggt gctgcgtctg tcttacgcct
   144181 accgcatctt cgccaagatg ctgcgggccc acggtacgcc agtagccgag gactttatga
   144241 cgcgcgtggc cgcgctggct cgcgacgagg gtctgcgcga cattttgggt cagcggcacg
   144301 ccgccgaagc ctcgcgcgcc gagatcgccg aggccctgga gcgcgtggcc gagcggtgcg
   144361 acgaccggca cggcggctcg gacgactacg tgtggctcag ccggttgctg gatttggcgc
   144421 ccaactatcg gcaggtcgag ctcttccagt tgctggaaaa ggaatcgcgc ggacagtcgc
   144481 gcaactcggt gtggcatctg ttgcgtatgg acacggtctc ggccaccaag ttctacgagg
   144541 ccttcgtcag cggctgtctg cccggcgccg cggcggcgga cggttcgggt ggcggcggct
   144601 cgcactacac gggctcgcgc gccggcgtct cgccgggcat ccagttcggt atcaaacacg
   144661 agggcttagt caaaacgctg gtggaatgtt acgtgatgca cggacgcgag ccggtgcgcg
   144721 acggcctcgg tctgctcatc gaccccacgt cggggctgct gggcgcttcc atggacctgt
   144781 gcttcggcgt gctcaagcag ggcagcggtc gcaccttgct ggtggaaccg tgcgcgcgcg
   144841 tctacgagat caagtgccgc tacaaatatt tgcgcaaaaa ggaggacccc tttgtgcaga
   144901 acgtgctgcg gaggcacgac gcggcggccg tggcctcgct gttgcagtca cacccggtgc
   144961 cgggcgtgga gtttcgcggt gaacgcgaaa ccccgtcggc acgcgagttt ctgctttcgc
   145021 acgacgcggc gctcttcagg gccacgctca agcgcgcgcg cccgctcaag ccgcccgaac
   145081 cgctgcgcga gtacctggcc gatctgctgt atctcaataa ggccgagtgt tcggaagtga
   145141 tcgtgtttga cgccaagcac ctgaatgacg acaacagcga cggggacgcc acgatcacta
   145201 ttaacgcgag tctcggccta gccgcgggcg acgccgctgg cggcggcgct gatcaccacc
   145261 tgcggggcag cccgggcgat tcgccgccgc cgataccttt cgaggacgaa aacacgcccg
   145321 agctgctggg ccggctcaac gtgtacgagg tagcgcgctt ttcactgccg gcttttgtca
   145381 atccgcgtca ccagtattac tttcagatgc tcattcagca gtacgtgctc agccaatact
   145441 atataaagaa gcatccggac ccggagcgga tcgatttccg cgacctgcct accgtctacc
   145501 tggtctcggc catcttccgc gagcgcgagg aaagcgaact gggctgcgag ttgctggccg
   145561 gcggtcgcgt tttccactgc gaccacatcc cgctcctgct catcgtcacg cccgtggtct
   145621 ttgaccctca gtttacgcgc catgccgtct ctaccgtgtt agaccgttgg agtcgcgacc
   145681 tgtcccgcaa gacgaaccta ccgatatggg tgccgaactc tgcaaacgaa tatgttgtga
   145741 gttcggtacc acgtccggtg agcccctgaa agatgctctg ggtcgccagg tgtctctacg
   145801 ctcctacgac aacatccctc cgacttcctc ctcggacgaa ggggaggacg atgacgacgg
   145861 ggaggatgac gataacgagg agcggcaaca gaagctgcgg ctctgcggta gtggctgcgg
   145921 gggaaacgac agtagtagcg gcagccaccg cgaggccacc cacgacggcc ccaagaaaaa
   145981 cgcggtgcgc tcgacgtttc gcgaggacaa ggctccgaaa ccgagcaagc agtcaaaaaa
   146041 gaaaaagaaa ccctcaaaac atcaccacca tcagcaaagc tccattatgc aggagacgga
   146101 cgacttagac gaagaggaca cctcaattta cctgtccccg cccccggtcc cccccgtcca
   146161 ggtggtggct aagcgactgc cgcggcccga cacacccagg actccgcgcc aaaagaagat
   146221 ttcacaacgt ccacccaccc ccgggacaaa aaagcccgcc gcctccttgc ccttttaact
   146281 cataaacttt caggtctcgc gtacgattcg cgagtcggga atgggacacc cgtgggtgtt
   146341 tctccgtgtg tatattattt tttttttttg tgtgtttgcg cccccgtgtg tctaatgtgc
   146401 tgtttgaaac acgtaaagta gctggtggaa gaacagataa acctttaata aaaaaaaaag
   146461 tatgtgctcc cgacccacgg tctgcgtgtc tcttttttat gtccatgtct ccaagtctgg
   146521 tgcgggtggc ggcggggtta agcgtcctcg aagtcttcat catcgtcgtc ctcttcttcg
   146581 cggaggcgac ggctttccaa gctgtcgtgg tgactgagcg cagcgacttc ttcgccggag
   146641 gctgtggcca gcgcctggta cttgacactg ccgctaccgc gtccgcgaaa gtagcggacg
   146701 gcgcgacacg tcgtaaacat ggcccatatg aaaaagagca tgccgaacga ccagctgatg
   146761 ccggtgcggt attcgttgct gaggaaggta tcgtactgca cgatggggta gatgaggccg
   146821 cagagtccaa agaaggcgcc caggtggtag ccgaattgca ccttgacgta ttgaaaaaag
   146881 acggcctcga tcagtaaaaa gtagatgatg gagatgatag cgtagaccac gaagacggct
   146941 aacaccatgt ggcctgtacg cacgaaaaag ttgtttccga agccgtagca cagggccatg
   147001 gctaccacgg tggtgttgaa accaagcgct acctctacca ggttgacgat gagcgtgcgg
   147061 aactgcaccg tacctttgag cttggggtgc agacgcgaga agaaaaagag tgagcgtttg
   147121 tagctgcggt actgcgtgac catgctcacg ttgaaaatgg tcaggcagaa aaagtgtacg
   147181 gcggccatga aggcgatcat gctgggcagc cgaaatgaca tggtcagtgt gaatagttgg
   147241 aacgtgtcca tgctgagaat gaagaggaag gctgtgaggc tgtcgcccat gtacgaaatg
   147301 tcgcgtgtcg actggtttag gctcatgcct ttgtccttgc gcatgctgat cttgatccag
   147361 cataccaggt agtagatggt cacggctaaa aagacgagct gcatgaacac ggcgtagcac
   147421 accaactgca ccgagtctaa gaaaagcata ggcgtgtgca ggtgcattac gttgtaggcc
   147481 gacatgttga gcctttcaaa gtccacgacg tgatagtaga cgcaggggta gcccaggtgc
   147541 ggaaaattgc tcagcactag atgcacgctg acgttgacaa aagtcagcac catgaaaacg
   147601 atagaagcgc tccatgtccg tgtattcacc ttatccacgt gcgagggggc catggcgata
   147661 gcggcggccc gctcgctcgg gaggcgatgg gggcgcgccg atgacgacag gctcgcgggt
   147721 cgttaaatac tacgatggga gccgccgcgg ctcacgacgc ggtttgagca cgtccgggcg
   147781 gtcggtgaaa aaagaccccg cgggccttcg cgactctctt ctgtccgagg atgaccgctc
   147841 agccgccgct gcaccaccgc caccacccgt acaccctgtt cgggaccagc tgtcatctca
   147901 gctggtacgg ccttctagag gcctcggtgc ctatcgtaca atgtctgttt ttggatctgg
   147961 gtggcggccg tgccgagccg cggcttcaca cgttcgtggt gcgcggtgac cgtctgccgc
   148021 cggctgaggt gcgtgctgtg catcgcgcca gctacgctgc gctggcctcg gccgtgacta
   148081 cggacgccga tgagcgtcgg cgcggcctag agcagcgtag cgccgtgttg gcgcgcgtgt
   148141 tgctagaagg cagcgcgtta atccgcgtgt tggcgcgcac cttcacgccg gtgcagattc
   148201 agacggacgc tagtggcgtg gagattttgg aggccgcacc ggcactgggc gtggaaacca
   148261 cagcgctgtc gaacgcgctt agtcttttcc acgtagccaa gctagtggtc atcggctcgt
   148321 atcccgaagt gcacgagccg cgtgtggtca cgcatgccgc ggaacgcgtc tctgaagagt
   148381 atggcaccca cgcgcataaa aaattgcgtc gcggttacta cgcctacgat ttggccatgt
   148441 cgtttcgcgt cggcactcac aagtatgtgc tggagcgcga cgacgaggcc gtcctggcac
   148501 gcctctttga ggtgcgcgag gtgtgttttt tgcgcacctg tctgcgtctg gtcacgcctg
   148561 tcggtttcgt ggccgtggca gtgaccgacg agcagtgttg tttattgctg cagtcggcct
   148621 ggactcacct ttacgacgtg cttttccgtg gtttcgctgg gcagccgccg ctacgcgact
   148681 acctggggcc ggacctcttt gagacgggcg ccgcccgttc tttctttttt cccggtttcc
   148741 cgcccgtgcc cgtctacgcg gtccacggtc tgcacacgtt aatgcgcgag acggcgttgg
   148801 acgcggcggc tgaggtgctc tcgtggtgcg gcctgcccga catcgtgggc tcggccggca
   148861 agctggaggt ggaaccctgc gcgctctcgc tcggcgtgcc cgaggatgag tggcaggtct
   148921 tcggtaccga ggccggcggc ggcgccgtgc gtctcaatgc cacggctttt cgcgagcgac
   148981 cggccggcgg cgatcgtcgc tggctgttgc cgccgctgcc gcgtgacgac ggcgacggtg
   149041 aaaacaacgt cgtggaagtc agcagcagca ccggcggtgc gcacccgccg agcgacgacg
   149101 ctactttcac cgtgcacgtt cgcgacgcca cgctacatcg agtgctcatc gtggatttgg
   149161 tcgagcgcgt gctggccaag tgtgtacgcg cgcgcgactt caatccctac gtgcgttata
   149221 gtcatcgact ccacacttat gcggtttgtg aaaagtttat tgaaaatctg cgttttcgct
   149281 cgcgacgcgc cttctggcag atccagagtc tgctgggtta catctccgag cacgttacgt
   149341 cagcctgcgc ttcggccggc cttttgtggg ttctgtcgcg tggccaccgc gagttttatg
   149401 tctacgacgg ctattcgggt cacggacccg tctcggccga agtgtgcgtg cggactgtgg
   149461 tcgactgtta ttggcgcaaa ctttttggcg gcgacgatcc gggtcccacc tgtcgtgttc
   149521 aagagagcgc gcccggcgtg ctgttggtct ggggcgacga gcggttggtg ggtcccttca
   149581 acttcttcta cggcaacggc ggcgccggtg gtagtccgct ccacggggtg gtgggtggtt
   149641 tcgcggcggg acattgcggt ggcgcttgtt gcgcgggctg cgtcgtcact caccgccatt
   149701 ctagcggcgg cggtggtagt ggcgtgggcg acgcggacca cgcgagtggc ggcggtctag
   149761 atgccgctgc cgggagtggt cataacggcg gtagtgatcg ggtttctccc tccacgccgc
   149821 ccgcggcgtt aggtggctgt tgctgcgcgg ccggtggcga ctggctctcg gccgtgggtc
   149881 atgtcctggg ccggctgccg gcgctgttac gggagcgcgt gagcgtgtcc gagctggaag
   149941 ccgtgtatcg cgagatcctc tttcgcttcg tggctcgccg caacgacgtg gacttttggt
   150001 tactgcgctt ccagcccggt gaaaacgaag taaggccgca cgctggggtg attgattgcg
   150061 cgcccttcca cggcgtgtgg gccgagcagg gccagatcat cgtacagtca cgcgatacgg
   150121 cgttggcggc cgatatcggc tacggcgtct atgtggacaa ggcctttgcc atgctcacgg
   150181 cttgcgtgga ggtctgggcg cgagagttat tgtcgtcctc caccgcttcc accaccactt
   150241 gttcttcttc ttccgttctc tcctccgcct tgccgtccgt cacttcgtcc tcttcgggca
   150301 cggcgacggt gtctcctccg tcttgttctt cttcgtcggc aacttggctc gaggagcgcg
   150361 acgagtgggt gcgctcgctg gcggttgacg cgcaacacgc tgctaagcgg gtggcttccg
   150421 agggcctgcg gtttttccgg ctcaacgctt aacgagtcac gtaggggaac tacgtgggta
   150481 agtgacgtgg atactagtaa aaaaaagtgc gtcaaagttc tcagcgtgtg acgtggatac
   150541 tagtaaaagg gacgtcaaag ctcactacgt gttgcgtgtt tttttttcta tgatatgcgt
   150601 gtctagttcg cttctcactc ttcctctccc cgttcccagc gcggtggcag cttggggggt
   150661 gagggcaaat tggggtagtt ggcgttgagc acgtctagca ggcccaggcc cacgggccaa
   150721 ccgtccacgg tcttacgctc ggtcagcttg aggctaaacg agtgtgcctc gtcttgaccg
   150781 gtaaggcgga aaaagaagcg tgctaccagc tgcaggcagg tatgccgcgt ctgctggaaa
   150841 agcacgaagg tagcgggcac gtactgcaca atgtgcggtt ctttttcctc aaagagtagg
   150901 tagagcgcgc tgcagatcag ccgccgggcg ctgtggtgca gcagccggcc gaagctttcg
   150961 cgcacgttca ccgcgtctag gtactggagc aggtcgtgca ggcacttgcg cgttaagttg
   151021 caattttcca cgcatgaaat aacggtacag agcgcgaagt gcagcaggtt gtcggccttg
   151081 acgatgccgc agcggtgttt gagccgcaga tccgagagcc tcacctgcgt gacggcgtct
   151141 tcggtctcga gcaaaaacac ggcggagtag cccagaaagg ccgaggtgca cagcaactcg
   151201 ctgcggtact cggccatgga aaccagcagc ccgtgctccg tgtgcagcca cagcttgtcg
   151261 ccgcgcaccg taaagtcgag cacttgcggc tccatgatca tcacattctg tctagtgaaa
   151321 tccgtatgga cctccagcac gccgcggatc atcagggcct ccatttcgaa atcggccgac
   151381 acgctctggg ccgcgccgct cctcgtctgc cgtgatcaag cggcgcggcg cggacctttc
   151441 aagcgttcct gggccgccgc tcgaggcagt tcccctttct ggcactccgc ccgccgcttc
   151501 gcggctcatt tggcgccggc gcgccttctc gcggctgcaa atcaactcca cgtatcggca
   151561 aaacttgctg tcgtcgtagg cggcggctac gatctcgccg aaggagagct gcaggtaggc
   151621 ctcgggtacg gggtccagcg tgcccagcgc caggatgtga cacagatagg gcagggtcac
   151681 gcgctctacc gtgtaattgg agtatacgat ggcctcttcg gccccctgat gcgtgaccag
   151741 acgccgcagg cgaaaggtgc ggaaatactc gttttcccac agctgcgtga ggaagcgttc
   151801 cagcgactcg gtgccgggca cgaactgcga gaagaagctg ttggccacca ggcggttgtc
   151861 ctccaccgcc agcggacgga agggcgccgc gtcgcgcgcc ttgcgcacgg cctccaacac
   151921 gggcaggtgg tacagttcgg cgtcgcgcgc gcccaggctc atggagtcct cgcgccgcga
   151981 ggcgtagcgc gtgagcaggt cgcgcagctc gcgcacgcga ttctcccagg tctggttgag
   152041 cgtgcgcagg tcctggatct cgtccacctg cgactggatc tgctcctcca ggcacttgat
   152101 gacctgcttc ttaaacaggt cgcggatgtc ccgctcgggc gccgccgggc cgggtggcgg
   152161 cggcagcagc ccgacgtggc ccgcgggtcc tcccaccacg gcgccgccgg gtcccaccac
   152221 gccgggtcca cccggaccac gcgcgggtag tagacggttt tggtccacca gcgagggggt
   152281 caggtcctgc agaaaggact cgacgctgtc ctcgatgccg atgcgcgatt tgctgtccga
   152341 gacgttaagc aaaaacttca taatggactt tttggcgtcg ctgccccggt cgtgctgctc
   152401 catcatctcc accagcttct tgcagttgag ctcgtggcgg ctggcggtca ccactttcac
   152461 aggaaaggta ttgagcaact ggcagatctt ttggtggcgg cagagcccgt cgtagcgcag
   152521 aatctcctcg tgcaggtgtg ccaccggcgt ggtgaacagc agcttgtcgc gctcataagc
   152581 cagcggttcg gccgccacgt acaagcggat gtgcttgccg cgcagctgcg cctccagccg
   152641 ctccgagcgc accttcttga agacgcgtac ctcgggcgcg ttggctatgc gcacggcgcc
   152701 caggcgctcg gccacctgca gcagtagcgc caggttagcc tgcagcaggt cctgcgccag
   152761 cgggtgtgtc tcggtggccc gctgcacggc cgcgcgtaca aattgcgccc gctcggccgc
   152821 ctcgctcggc ttggtcttca cgtccagcag cggtaccagt cccaccgtta cgcaccaatc
   152881 cacgtagaga ccatagtcgt cgttatcggc gtactgatat aaaatgtcgc ggagcgcgcc
   152941 cagcacgccc gtttgcacgc tctggcgcaa cgaggcgctc cacaccaaca gatactgctc
   153001 caggtcctct tcgtccagcg cgcggtaggg aaacaacgcc gcgtgtaact tccactcctc
   153061 ggccacgcgc cgcaccgtga tggtgtcaaa gagcgtcttg cacactccgt agagcagctg
   153121 cttgcgcagc acgcacgggt cgcgcagcac ctggtgcatg ctctggccgc gacacgtccc
   153181 cagaaagccg tgcagcaacc gcaggaagct catcgtctgg cccgtgggga aaatgtcgat
   153241 gacggcctcg tcatccacgc cgcggcccac gcccaagtac gacgacgcct tgatcctcaa
   153301 cctctcgtcg gccgccaaga tcgaacggat cgtcgacaag gtcaagtccc tctcgcgcga
   153361 gcgctttgcg cccgaggatt tttcgttcca gtggtttcgc tccatcagtc gcgttgaacg
   153421 aacgacagat aacaacccct ctgccgcaac taccgccgcg gcaacggcga ccgttcactc
   153481 ctccgtctcc tcttctgccg ccgctgccgc ttcgtccgag gccggcggca cgcgcgtgcc
   153541 ctgcgtcgac cgttggccct tctttccctt ccgcgcgctg ctcgtcaccg gcacggcggg
   153601 cgccggcaag acttccagca tccaggtgct ggcggccaat ctagattgcg tgatcaccgg
   153661 taccacggtg atcgccgcgc agaacctcag cgcgatcctc aaccgcactc gctcggcgca
   153721 ggtcaagacc atctaccgcg tcttcggctt cgtcagcaag cacgtgccgc tggctgacag
   153781 cgccgttagc cacgagacgc tggaacgcta ccgcgtgtgc gagccgcacg aggagaccac
   153841 catccagcgc ctgcagatca acgatctgct cgcctactgg ccggtcatcg ccgacatcgt
   153901 ggacaaatgc ttaaatatgt gggagcgcaa ggccgcttcg gcctccgccg cggccgcggc
   153961 cgccgcctgc gaggacctct cggagctgtg cgagagcaat atcatcgtca tcgacgagtg
   154021 cggccttatg ctgcgctaca tgctgcaggt ggtggtgttt ttttactact tttacaacgc
   154081 cctgggggac acgcgacttt accgcgaacg ccgcgtgccc tgcatcatct gcgtcggttc
   154141 gcccacgcag accgaggcgc tggagagccg ctacgaccac tacacgcaaa acaagagcgt
   154201 gcgcaagggc gttgacgtgc tctcggcgct gattcagaac gaagtgctca tcaactactg
   154261 cgacatcgcc gacaactggg tcatgtttat tcacaacaag cgttgcaccg acctggactt
   154321 tggcgacctg ctcaagtaca tggagttcgg tatcccgctc aaggaggagc acgtggccta
   154381 cgtggaccgc ttcgtgcggc cgcccagctc catccgcaac ccctcgtacg ccgccgagat
   154441 gacgcggctt tttctctcgc acgtcgaggt gcaggcttac ttcaagcggc tgcacgagca
   154501 gatccgcctg agcgagcgcc accgtctctt tgatctgccc gtctactgcg tggtcaacaa
   154561 ccgcgcgtac caggagctct gcgagctggc cgacccgctg ggcgactcgc cgcagcccgt
   154621 cgagctctgg ttccgccaga acttggcgcg catcattaac tactcgcagt ttgtcgacca
   154681 caacctctcc agcgagatca ccaaggaggc gctgcgcccc gcggccgacg tcgttgccac
   154741 caacaacccc tccgtccagg ctcacggagg gggaggatct gtaatcggga gcaccggcgg
   154801 caacgacgag acggcgtttt tccaggacga tgataccacc accgcgcccg atagccgtga
   154861 gacgctgctc accttgcgca ttacctacat caagggcagt tcggtgggag tcaactctaa
   154921 ggtgcgggcc tgtgttatcg gataccaggg cacggtcgaa cgtttcgtgg acatcttgca
   154981 aaaggacacg tttatcgaac gcacgccctg cgagcaggcg gcctacgcct actcgttagt
   155041 ttcgggcctg ctcttctcgg ccatgtacta cttttacgtg tcgccctaca cgaccgagga
   155101 gatgttgcgt gagctggcgc gcgttgagct gcccgacgtg agttcgctct gcgccgctgc
   155161 cgccgccacg gccgccgctc ccgcttggag cgggggagag aatccgataa ataatcacgt
   155221 cgacgcggat tcttctcagg gcggccagag cgtgccggta tctcaacgga tggaacatgg
   155281 ccaagaggag acccacgaca tcccctgcct gtccaaccac catgacgact cggacgccat
   155341 cacggacgcc gaactcatgg atcacaccag tctgtacgcg gatccctttt ttctcaaata
   155401 cgtcaagcca cctagcctgg cgctgctttc tttcgaggag acggtgcaca tgtacactac
   155461 cttccgcgac atttttctca agcgctacca gctcatgcag cgtctcacgg gcggtcgctt
   155521 cgccacgttg ccgctcgtta cctacaatcg ccgtaacgtg gtgttcaagg ccaactgtca
   155581 gatcagctcg cagaccggct ccttcgtggg catgctttcg catgtgtcgc cggcgcagac
   155641 gtacacgctc gagggctaca ccagcgacaa cgtgctcagt ctgcccagtg accgccaccg
   155701 catccacccc gaggtggtgc agcgcggcct ttcgcggctg gtgctacgcg atgcgctcgg
   155761 gttcctcttt gtgctcgacg ttaacgtctc gcgcttcgtc gagtcggcgc agggcaagag
   155821 tctgcacgtg tgcaccaccg tggactacgg cctcacttcg cgcacggcca tgaccatcgc
   155881 caagagtcag ggcctgtcgc tcgagaaggt ggccgtggac tttggggacc atcccaagaa
   155941 cctcaagatg agccacatct acgtggccat gtcgcgagtc acggaccccg agcacctcat
   156001 gatgaacgtc aacccgttgc gacttcccta tgagaagaac accgctatca ccccctatat
   156061 ctgtcgcgcg ctcaaagaca aacgcaccac gcttattttt tgacacaaca ccgtgtaagg
   156121 aaaacgtgac tttattgagc agggtaaaaa ccacgtacaa gaaccacgtt gtctatcccc
   156181 aaaaaacaca caccgtcagg gaacacatcg cctatagata gcggcacttc acataaaacc
   156241 accgtacctg catcacggtg gctcgataca ctggaaattc aataaaaacc accgtgtctc
   156301 cgtgacggta cttatcgggt cagcatcttt ctcttgagat ttttgttcgt aaacttatcc
   156361 gtttccccgg tccgcggtgt ctcctcgtaa ggctgacagt ctacgagtgg tacctgcaag
   156421 agaagaaacc cgggtgggag cgacgccgtc gctgggtatc aaccccgcgg ctgaccgtcg
   156481 tccggtaaag gaacaacccg tcgtcgcaag ccgggttcga ccaagagaaa aacccgggtg
   156541 cgggggggag acgggtcgtc ctttggttgt tcgcggacgg cgtacatccc gcgtgggtca
   156601 gtcgacggcg tcgctccgtg cggtcggtca tcattctgct tcacatatat gggttgtttg
   156661 tgtttttttt tttataatga atacgcactg atcctatccg tgactgcgcg tgtggcagag
   156721 aggatgcctt ataacatgta ttttgaaaaa ttgccaacag ctataatttc tctcatgtag
   156781 cagaatagag accttttgtc gtctttttgt ttgtcattac ttgttttcca gggaattaga
   156841 gagagggaac cgcgcctccg gcggcggtgc ccgcggaccc cggccccttc tcgcgtgcgc
   156901 ggtgtgactg gttgagcgaa tgagcagcta ggcttggtgg tgctccgcgt gcgggggaga
   156961 agacgattaa caacaaaaaa taagtggaag tggccggtgg gtctttgtcc gcgtgcgcgc
   157021 ccatccgtcg ccgggaccga gcagaaagtg atgtggtggt acattgattt tttccttgac
   157081 aggaaagaaa aaaaaagagt tttgttttcc tatgtgagag gagaaaggta tgtgaggaga
   157141 tgttcgatga tcgtatgtta cagttatgct gtaaggaagc ttttatcgtg cgtcctgttt
   157201 ttcatttgat gtatatgaca caattgaaac ctatcgatag gcgtatatcg aggattcatc
   157261 aattcttaga atcgtcgtct ttttggctaa ttggactttg cccatgttgg ttgtcattcg
   157321 tggcctgagg tcatcgtcgt ccatgacgac gtgtctatag cgtgcggtgt gatcattgtg
   157381 tcgagccaga gaaagcgcgc ctcgcacgac gtttgcggat cggctcgcgg gtgtgtggaa
   157441 ttcctaagaa cataatcagc tggtcgtctt tctttgatgt gttgttgtcg tcgaggtctt
   157501 gcttcgtttt cttttttctt tttagtcgat ggaacttttc ttcggtacgg gttcttgtta
   157561 tggaagcttg tgttttcgaa catgaattcg aaaaaataaa aaggcctatc ttcgtttcaa
   157621 aaaaaggaca gatatcaatc ttcttaactt atatcatggt aaattcagaa tcctatggtg
   157681 tcttattatc tctaaagtag tcaacattat ggtctaattt gtatttccct gacgagatat
   157741 atatgatcct tataacctgg ctactatcat gaacaacaat atccttactt acagtcatct
   157801 tcgtgagtta atgaagtata atatcggtca tctatcaact tatctgctat gtaacgtacc
   157861 cttttaggta ttttgcgttt cttaacgagt gtacccgcct gtgtgaggcg aaactctgag
   157921 aagtctaccg agtcgagtta caagtcacta aaacacttac acgagttatc tatactaaaa
   157981 tcactatcta tgttgtttgc ttacctaatt attatcctac atgacgaagc tacctcccaa
   158041 cgtaaggtag ggggagagga gacagaacaa taaaaagtaa ctaatgtttc ttagaactta
   158101 cccgctaagg acttaccaaa ctatattcac caaaaaacaa cagctacgtg tttcatttgt
   158161 tttaatctac cgaagtaaaa aaaaaaagat gattagctat ccagaaccta cttacttctt
   158221 aatgttttaa ctaaggatgc ctatgggatt ggaaaaaaaa tcacagcaac ttgctactaa
   158281 tcagttgaca gcgaagagac tcataacaaa gatttctggg taatacggtt ataataatgc
   158341 ttatggacta aaggatactt ggaaaaaaag aatgggctat gactatagag attcgttgag
   158401 atatcaaact tcaaataggc ggctatcatt catggttgtg gtgactatat cgtggagaaa
   158461 aaatgtgatc gttagttagc taggtgagac ttacagctat ccatccgtct agtttttcgt
   158521 tgtaatgatg atagtacgtc tatggtggtg atcgattttg gttagcaatt tgttcgttta
   158581 aaggcttaat gtacttatgc tacatgatgt attattcttt gattcatcgt tcctcctaag
   158641 ggggtgtatg tatgtatgta ctagtcgtat agtgttccta acatcatgac tattcagact
   158701 atggcttcat ctatcgtgtc taaagttcac ctattctact attactatat atatgcacta
   158761 ctatgtaact aggatatggt cctataaggt gtcttctatc acggtggctt gtttatcgct
   158821 tggcggttac gagcaagagt tcatcacgga ccagccgtga ggcagggcac acgcgggtcg
   158881 gcggcgatga tgttccccgc gaaggggaca acaaaaacaa gacaagaggc cgccggccgc
   158941 ggccacggac gcgtagcggt tacacaatgt ttggttgagc gttttgtttc atcgtcgtgg
   159001 tggtggtttt gttgttctct gtatatatcg tgtggtggct ttatcgtcat cattattatc
   159061 atcattcttg tttccatcat cacgatgagt tttctccgtt ttcctctcct ccagtggtag
   159121 tcgtgtatca tcatcaatca tcgtagtgac gtcgttgctg ctgctgctct tgccttcatg
   159181 gcggtatttc tcttcctccc ccctaacccc atattaactc gtgagtgtga tggttagagt
   159241 ggctgcttgt tttttttttc ttttctcttt ggaacaacaa aagaggataa agatggtcgg
   159301 tgaatgtatt attattatca tcatcattat gatacggtcg cggtcttctt ctccgatgac
   159361 gaaacctgcg cacatcgaag aaaagacgag cgcgcgaacc gatagccgtc cgtctgggac
   159421 gaaggagaag atgatgggga gaggaggaga gccccagaag ccagagcgag aagggagacg
   159481 acagacatac gtcgtcaccg tcctctggag gaggcacggc ggcgctgttt gttgtttgga
   159541 tgcttgatta tatcctgttc tatggggtag attattatca ataggcttgg ttttcaaagg
   159601 tcagcctgtg tattgtcgtg tctttttttt cgttctcatg atcgcggaga ccacacagac
   159661 gtgcgcgtct cccaatggct aggcgttctt tttaggtagt aattttttga tctttttttt
   159721 ttcttaacaa gtctggcttg atttctttta tctatgatcg attcttcttt ttctcggggg
   159781 ttgcatcttc cgtgaaagta aagtgacact actctaaatg gtaaccatat tatctgttga
   159841 ttaggagaaa aaataatttt ttcgcacgaa atcgatccta agtgaggtga tttacttgct
   159901 atcacacgaa atgattatct tttgctgcta acgtactgaa ttttttaaca gaattgcttc
   159961 tccgtaacta tttccgcaga ttcagacaga ttgtcaaaaa aaaaatacgg cacagaaata
   160021 gtgggtctgt ggcttttggt tcgtgtacat tcgcgtttgc gtgtcgagat ttctacggta
   160081 tgtttattct tcctgcgatg atgtagggtc cttggtgtaa gtaggatttc gagtatctct
   160141 cttagagcga acaaaataat caaaaaacaa cagctaggaa atcgagggtt actctacgat
   160201 aaagtgtctc tacaaagtga agaatgttac gttgtggtgg aataataaga ctcgcgtgat
   160261 cgatgagtga tcgagagcgg ctcgaacctt ctttaagagc tttgtttagt gcaactttaa
   160321 attacaagga gtagaaagct gaaatgaatc tatgaaggtg ctattctttg aatatcttac
   160381 tttgtacgct tcacattcgt tatttggata gagagttgtc tagagaaaat ctgtgattct
   160441 ctatgagtgt tatttttatt atccttttgg ggactacgat ttttcttctt gttctacata
   160501 ccactactac tcgtaatcac atacatggac gaaaaaaaaa ttcgtcaggc agtagatacc
   160561 agattctccg acgttacggc gtcttttttt cttttgagag agtatctgct gagattgtcc
   160621 gtggtgtatc tagtcgctat ttttgttgtt actagtagtt ttgcacacag tttattcagt
   160681 atagtttttc ttcttgccat gatcaattga gcccaccacc ttttttttta gagaggagga
   160741 atttcgtctt gatctccagc cggagacaac ggcggcggtg gtggtggtgg cgggagagac
   160801 ttcaaggcaa tgaaaaaaaa atttcgtttt gccatcaagt ggtgacgata acccgtcaga
   160861 ttgataattg gttcctacag aaactattct aaccgcggaa gaaagaaatt gaaaaaaaaa
   160921 attgacaaaa acatcataac ataaaggacc acctacctgg gacgcgcagt tgggcggcgg
   160981 attggggcgg catgctgcgg cgatgctgtc ggtgatggtc tcttcctctc tggtcctgat
   161041 cgtctttttt ctaggcgctt ccgaggaggc gaagccggca acgacgacga cgataaagaa
   161101 tacaaagccg cagtgtcgtc cagaggatta cgcgaccaga ttgcaagatc tccgcgtcac
   161161 ctttcatcga gtaaaaccta cgttggtagg tcacgtaggt acggtttatt gcgacggtct
   161221 ttcttttccg cgtgtcgggt gacgtagttt tcctcttgta gcaacgtgag gacgactact
   161281 ccgtgtggct cgacggtacg gtggtcaaag gctgttgggg atgcagcgtc atggactggt
   161341 tgttgaggcg gtatctggag atcgtgttcc ccgcaggcga ccacgtctat cctggactta
   161401 agacggaatt gcatagtatg cgctcgacgc tagaatccat ctacaaagac atgcggcaat
   161461 gcgtaagtgt ctctgtggcg gcgctgtccg cgcagaggta acaacgtgtt catagcacgc
   161521 tgttttactt ttgtcgggct cccagcctct gttaggttgc ggagataagt ccgtgattag
   161581 tcggctgtct caggaggcgg aaaggaaatc ggataacggc acgcggaaag gtctcagcga
   161641 gttggacacg ttgtttagcc gtctcgaaga gtatctgcac tcgagaaagt agcgttgcga
   161701 tttgcagtcc gctccgatgt cgttcaccca gttactttaa taaacgtact gtttaaccac
   161761 gttgcgtcgt gacgttgttt gtgggtgttg ctaggcgggc tggaaagatg atgtataaat
   161821 agagtctgcg acggggttcg gcgctctgcc ggctgcggcg gcactcgctc cacggcctcc
   161881 gacgagcgtt gcgctcgcgc tttgcgccgc cgcgtcatgg atctgcctac taccgtcgtg
   161941 cgaaaatact ggacttttac gaatcctaac cgcatcctgc atcagagcgt taatcagact
   162001 ttcgacgtgc gccagttcgt ctttgacaac gcccgtctgg tcaactgcgt ggacggcgat
   162061 ggcaaggtgc tgcacctcaa caagggctgg ctctgcgcta ccattatgca gcacggcgag
   162121 gcttcggctg gcgccaagac gcagcagggc ttcatgtcca ttgacattac gggcgacggg
   162181 gaacttcagg agcacctctt tgtacgcggc ggtatcgtct ttaacaaatc cgtctcctcg
   162241 gtggtgggct ccagcggacc caatgagagc gcgctgctca ctatgatttc cgagaacggt
   162301 aatttgcaag tgacttacgt gcggcattac ctgaaaaacc atggcgaatc ctccggcgga
   162361 ggcggtggtt gcggcgccgc gtctaccgcc tccgccgtct gcgtgtcctc gttgggtggc
   162421 agcggcggga ctcgcgacgg cccttctgcg gaggaacagc aacggcgaag gcaggaacag
   162481 cgtcacgaag aacggcgcaa aaaatcgtcc tcgtctgccg gtggtggtgg aggcggcggc
   162541 gctagtggtg gcggtggcgg cggcgggagc ggcggtcagc actcctcgga ctccgccaac
   162601 ggactgctgc gggatccccg gttgatgaac cggcagaagg agcggcggcc gcctccctcc
   162661 tccgagaacg acggtgagtc ccggccctcc tcgcgtcacg gtgctttccg agtggactcg
   162721 tgagcccccc gtagcgcacg agcgagcagg cgagcggtgt tggtgcgctg gtggttgtgt
   162781 ggatgataac catgtgcttt ttcgtgcgct atgtgtcgtc ccgtctgtag gctctcctcc
   162841 cctccgggag gcgaagagac aaaagaccac cgcacagcac gaaggccatg gcggcggcgg
   162901 caagaacgag acggagcagc agtccggtgg tgctggcggt ggtggtggcg gcggcagcgg
   162961 ccgcatgtcg ctgccgctgg acacgtctga agcggtggcc tttctcaatt actcgtcctc
   163021 atcctccgcg gtctcttctt cctccaacaa ccaccaccac catcatcacc accataacgc
   163081 cgtgacggac gtggccgccg gcaccgacgg tgcgttactt ctacccattg agcgcggagc
   163141 ggtggtttcg tcgccgtcgt cgacgtcgcc gtcgtcactt ctttcgctcc ctcgacccag
   163201 cagcgcccac agcgcgggcg agacggtgca ggagtccgag gcggcggcga cggcggcggc
   163261 tgcggggtta atgatgatga ggaggatgag gagggctccg gctgaggcgg cggaggcacc
   163321 accgcagtcg gaggaggaga atgattccac cactccagtc tctaactgcc gtgttcctcc
   163381 gaattcgcag gaatccgcgg cgcctcagcc tcctcgcagt ccgcgttttg atgacattat
   163441 acagtcattg accaaaatgc tcaatgattg taaggagaaa agattgtgcg atctccccct
   163501 ggtttccagc agactcttgc cagagacgtc gggcgggact gtcgtcgtca accacagcag
   163561 cgtcgcgagg accgccgcag ctgtctccac agccggcgtt ggccccccag cagtcgcatg
   163621 tccgccactc gtcaccaccg gtgttgtacc ctcaggttcc gtcgccggtg tcgcgcccgt
   163681 tgccgccgca gtcgaaacac cagctgctcc tccccggccc gtgtgtgaaa tcaagcccta
   163741 cgtggtaaac cccgttgtcg ccaccgccgc ggctgccagt aactcttcct cgtcttcttc
   163801 ggctccactg ccgccgccac caccaccgcc gggcggacgt cggggtcggg cccggaacaa
   163861 tacccgagga ggcggcggcg gtggtggcgg tggtagaaac agccggcggc aggccgcatc
   163921 gtcgtcgtct tcctcctctc ggagatcgcg acggagaaac aaccgccatg aggacgagga
   163981 caacgatcct ctgctccggt tgtcgcaagt cgccggcagc ggccgccggc gagggccctc
   164041 gttcctcgag gacggactcg aaattatcga tcccagcgag gaggctgcga tcgccgccgc
   164101 ctcgatcgcg gcgtttttcg acgattaaaa aacagagccg agaccggaaa aattatgaaa
   164161 caggacgcgc ttggacattt gggtttccac ccctttcggt gtgtgtctat atatattgtg
   164221 gtcactgatt tttttttaca ataaagtaga catcacagtt caccaccttg tctccccggt
   164281 gtatctatta tcatcaatca cccacagagt cgccagtcca tggtctctcg gtaatgcgtg
   164341 tccagatacg cgttggccag tataaagtgg tcgttgccca cgaaggcgcg ggtggtgttg
   164401 cgcggcgacg ggtggcagga cttgagtacc aagtgccgcc gtcggtcgat caggtactcg
   164461 caggtgtgcg cgtcggcgcc ccacagcatg aacaccagat gctcccggcg ctctgacagc
   164521 ctccggatca catggttact cagcgtctgc cagcctaagt gacggtgaga tccaggctgt
   164581 ccgtgcacca cggtgaacac ggtattgagc agcagcacgc cgcgtcgcgc ccaggcgtcc
   164641 aggcaacccg aggccggacg ctgaaacccg tccaccgtac gcgccagttc gcgaaacacg
   164701 ttgttgaggg agggcggcgg cggtcggccc gccagcgtgc cgaaggccag gccgctggcg
   164761 ctgccgtcgc agtacgggtc ctggcccacg atcaccacgc gcacctgctc gggcggacac
   164821 agatagctcc agcggtgtac gtgctcgggt gccgggtaca ccatctcgag ttgccgcgcg
   164881 ccctccaccg ccgccaccgt gtcgcgcagc agcaccgtgt cgtggtcggg caagctgagg
   164941 aagcggatcc agtcggcgct cagacaaaac acgcgagcct gctcgtcggg ggttaacaga
   165001 gagcctttat tatcagcaat gttagcgagc atccactgct tgagggccat agcgcgagtg
   165061 agccggcagg ttgacgcgcg tctgcttcag ctcgggcggc agtccggcgt agtatttatc
   165121 taggtggcgt agcagcggcg ggtccagctg gtgacgcagg cagaattcct tcactgcgtt
   165181 gtacaggccg taaaagagcg tgatgccctc gggcgcggca gcggtgctca cgggcagacg
   165241 cacggcgcgg ttggtacgcg tggcttcgtt gcgtatggcc accaccacgt taaagagaga
   165301 cggtggcacc agctcgaagc ctaacacgtg ttccgtgaag atgctgcgcc cgtatgacag
   165361 tcgcgtgagg tcgtagccgc ggcacaggtc gtccacgcac gtgtacacgg ccggcgagcc
   165421 atcgccgcac tcgctgtagc cgcgcatcac cgtcatccag cgcggcgctg tgtccgagct
   165481 caacagcgtc agcagggccc gcaattgatc cggattgttg tacagcaggg ccagagtgtc
   165541 caggaaagcc tcgtccaaca gcacggagtt ggcggcctcc ggcgtaacgg gacggtaacg
   165601 gataagttgc gatagcgggc catcgcgccc ggtaacattc accaacgggc gcagccaact
   165661 ttcatacttg tcaccctcaa acacctcacc caacaagcat cggcgcgtta gttcggggca
   165721 ctccgcgggg actttctcgg cggcggtagg agcgacgctg acggcggctg aggaaacaat
   165781 gggcagcaga aggcaacacc acagcagtat caccggtcca ggtgagaaag agaagccgca
   165841 atccgggcgg cggcacatca agtctgcggc acgatgagag tgtgacggta aggagccagt
   165901 tggcgccaaa agttggcact caggtcttcg atccctaaaa cgttatatat tgcatccagc
   165961 aggtgagcca ggctaaacgg attcacgtac caggtttggt tacccgcgac gatgacggcc
   166021 agaccgtggg cgctacagtt ggagaggttc ctgggtacga aggtaactga gtcgatgtcg
   166081 cgccacgggg ggaatgagac agacgactgg cgcacgctgt aatcacaact gtgattgacg
   166141 tattgtagcg tgtaatttag gttgcactca gcctcgaagt agagggggaa ccacagttcg
   166201 tcgtactcgt cgtcgtcctc cagttctggc tcttcttcat ccaccgcaat gtctacgctg
   166261 ctctgagatt cctcttcgta caggatgatt gacaggttat ggctacaaag gtcctgggcg
   166321 ggaggacgcg tgggagcgcg ggtggtggta atgttttcca ggtcaaaagt tggagtgtag
   166381 tcggatgtta catccccgtt gttggaggtg gtagaagtcg cggccggtgt cacggtggta
   166441 agtatggata cagaagagga gggggaagta gcgttcgtac cgatggttgt ggtattatta
   166501 ttccttgtat ttcttgttcc agaaaccgtt gacgttgaga tgagaatcga cgtggcgctg
   166561 gacgtcagat tgctgaccga ggaaaccgtg gtgggagtgg tgacggtgtt actcgtggtt
   166621 gaagtgacgt taggggaggt agtagtggta ccggtggtgg cgacggtagt gtttgtcgtg
   166681 gcggcggcag cggtggtact ggtaacggtg gtcgcgttgg tttccaccgc ttcacacagt
   166741 aagcaaaagc acagggccag gaaaagcaac cagccccgcc atcgccgccg ccgcttcatg
   166801 aggtgggcag gcgaaagctg gtgaattcgt tgtacagcgg caagtggggc gccgcgatcg
   166861 aagggtacgt caacaagctg acgttgatat taaatacgtc tggctgcttt tctacgatgg
   166921 aagcgcacag ggttacggcg tcgaacaggt ctttcttggt ggcgcccgag acccacatct
   166981 ggtatacacc cgtctcgtgg tacgaagtag agcgcggcac caccggacgg atgcagtcca
   167041 gaacgcggtt gggatcctgg tgaaagaatt tgaacgtggc tacggcctgt ggcgtgtgcg
   167101 gcatcgtctg cgtgatgagc tgctggcccg ctaacacggt gacgttgtgc aacttgagca
   167161 gggcactctt gagggcctgg aaagcgttgc cgcacgaggc gctgatttgc agctgcacgg
   167221 ccgtggagtc gtgcagccgc atgagacgtg acacctcttc gaagacgtac ttatacttac
   167281 tggcaaagag tggcgcgtac cgacagtcgg ccggcaaaat gtaggtggcg ttgccgccgt
   167341 tggtggccac ggcgggcgca gcggccgcgg aggccggcgt aaacagcgtc agcggccggt
   167401 ggtggctggt aaggtcgatc atgggcggcg tggtgaccgt ggcggtggcg ggcatgacgg
   167461 ggtttgcggc gacgggcact ccggccacag cggcggcagc ggcggccacg gcggcgctgg
   167521 ccgagcccac acctgccggc agtcctccgc cacccatgac gccgccgggc agagcgtcgc
   167581 ccagacagac ttccacagtg gcgggcgcgc tctcggcggt cagtacggtt tgccgatcga
   167641 cctcgcgacg aaagctggtg aggaactcac tatgatccat ggccgcaggg cccgagatcc
   167701 cgggattctg cgggtgctga ccgagtgcgg gccgagttat atggaagacg attagcttgg
   167761 agcggagttt tgcgtcccta gctgacctgc ggatcagcga cgtgccatag ggatagactg
   167821 tgagcggcgg ccgcaacggc ggggtcggcc gccgttcgtc gtcacggggc ggcgcgaggg
   167881 aggaggaggt ggtggtgggt acgatcttga cgtggttaac gtcctgcccg tccgggggaa
   167941 tacgcaaaaa accccgccgc ggcgctacca cgatggtgcg atgggtcttt ctcttgttgg
   168001 ccggggccag ggacttgcag atgcgtgtgg agccgtagac gatctggacg tggtcctggg
   168061 agaacatgac catcgccgcc aacgctcagc ggggggacgg gttgggaaca cagaggctga
   168121 ggggaaaccc cgtagaagtc agcgaaataa aaacaacaca gcagccgctc ctctcgtttc
   168181 gggccctacc actgcttgaa gtagggcacc gggtgtttct tttcttcaac gggctcctcc
   168241 agtctcttat aggaccagtc ccgccggcgc gccagcatgt aggtcacgta caaaagaata
   168301 attaccatga acaccaggaa agccagcacg ccgtaggcca gcagccggtc ctcgaacagc
   168361 gggtcgctct tgataaacac gtaggtggtg gtaaaacttc ggcccgcgat ctggacgtgg
   168421 agacgcacga cagtatacgt gccgttgagg tagaagacaa actcgcgtaa ccgttgtccg
   168481 ttatacgtca cgttactaat attccacggc ggaatgagct ggtcgccctg atgcagatgc
   168541 acggtgctgt tggggtgata gaggctgcta ccgttgagca agcagtgttc gtgttcctga
   168601 agcagcacgc ggacccgcat agtggtagcg ttcaagcgag tcccgtacac ggcgtaaatg
   168661 ggataggtga aaaggtccca agtggcgttg tgatggcggc cccagctgaa gaaagagcac
   168721 gtgtactcag tggtctcctg cggcctgagt cccgagataa gcagctcttg agcagtagcg
   168781 ttgtaggaga gatgtagttt tcctgtggaa aaaattaatg agttgtttat tttgttagca
   168841 ggttggcgag ggaggaaggg gaacaaaaca gaaaggtacg tgttacttac ctttatcgtt
   168901 ggagggaaaa gcgctaagat atcccacctg agtgaaggga cccttgcagt ctgtccgtgc
   168961 ataacaagta actgataaaa tgtctggatt tttggtatta ttcaacagga taactttgca
   169021 ggtggcgttt agagacactt ggtcgtagct gtagctggct tcgcaattca cagtatacag
   169081 gtgcccctct ttctgcgtcg tggctatcac ggaggtggag gcggacgagg tagaggtttg
   169141 taccgtggtg gtgacagcag aactgacgtt gttagaggta cttattgacg tagtagacgt
   169201 gacggtggta ttactagggg aagtgacggc gcttgtggtg ctacttttca ctcccgggtg
   169261 catgtcgccc aagagcgcaa ctacgagcgc gatcgccagc acggaacaca tgttgccgtg
   169321 tgacgagacg gcgtgtggac gagctatatg tggcaggagg tcgcgtcacc tcttgtgacg
   169381 cctaaacgtc cagctccaga taaaagaggc gttaataatg aacactacaa aaaccacttg
   169441 cgtcaatatg acgatcataa aggctcggtg atcgctgcgc ctaaagtatg cgggattctc
   169501 caccagctca ctatcttcga caaagtggat gaatgtgtta gtgttaccgg ccgttttgtt
   169561 gaccatggat cgtactatga aagtcccggc gccaaaagtt ccattagagc cccagcaagt
   169621 aacgctgccg ttcacgtagg ttcccggctc tcctgtcagc atgtgtgtca gttggtgggt
   169681 ataattctgt ttaatgtttt ccatgtcctc gctgtaatta acttttctgg tgagaaactg
   169741 tgtacggtgc gggagaacga tcatcatccc tgaggccaaa aagggcgaat cataagctgt
   169801 tgtgttacaa aaaatagtca ggttagtatc attgtgctca tagatataag ccatttttac
   169861 ttgaggttca taccaccacc ctaccctaat tgtagttgcc accgtcaccg agtcccatct
   169921 cccgaaactt accaccgcca ccactaatag cgtcaccccc gcacggtaca tagttaccct
   169981 ctcgacgtcg ccggctgtca atgacgtgcc tgcgtcagtg gctatgattt atagcttttg
   170041 gacacaaccg caacggatct gtcgtaatct accttccaca gggccgccgt gacgatgctg
   170101 aacgacagga tcagacagac ggcgtacagg agtcctaggt cggcgtcgac acggcaggtg
   170161 cggatgtctc gcagggtggg tagatgggcg atgcacaact ctttctcccc ccgcccgtac
   170221 atcccatctc gtatcagcag ccgtagcgtg gcattgatgg tcagcggggt aaccaaagaa
   170281 atcacatagg gatgtgtaca ggaagtacag tgatgggtat ccgtgagatg tacgtcatca
   170341 ccctcctcac cctcatcatg aaagaccagg actcgggtga gacgacccga tgaatactgg
   170401 atctcccacc acagtctttg gtccaacacc gagagggcgc aagagattct aagtctccct
   170461 gggttggggg agcagatgta agccccgtat gtgcctctcg ccatcagggc catacacatg
   170521 aggaggagaa ggacaagtat ccgggaccac ccgcaccccc acatcaggag accagagacg
   170581 gagatgtata aaaaagctac ttttattaaa cagcattctc accacacgtt aatactgtca
   170641 cgggaaatca ctatgtacaa gagtccatgt ctctttccag tttctcactt actgagattt
   170701 gttcctcagg tcctggatgg ctgcctcgat ggccaggctc agggtgtcca ggtcttcggg
   170761 aggggtctcg gtgggcttct caaactgccc cacggcgtag gccttcgcgg ccgtctcgta
   170821 gataggcagc atgaacccac cctggttggt ggagaagatg cgcaccatga cctgtttggg
   170881 aaacttttgc atcaggggca ggcacaggtt gagagcgccc aacaggtcca cgggggtggc
   170941 agcgtggata atcatgttgc ggtaatcaga agagcggggg cacaattggt gggtgtgcag
   171001 ttctttgagg ttccacacgg ccttgacacc gtcgttacaa gcatcggccg tgcgctgcgc
   171061 cacatcagga gggtgtgtca caggcatagt gtgctccatg aggaagggag tggagagggc
   171121 caggttgcac atgctaccca ggcgacaccg tacctgatcc acctcattct tcacttcatg
   171181 attgcgggtg tagatgatct gaatgccctt gttgttcacc tgcatggttt tgcaaacttt
   171241 gatggcctct tctaacactt ggtgcatact agggatcatg aatggcagat tcttgtactc
   171301 aagagaacga ttggtgtgac ggaacatgcg gctcacctcg tcaatcttga cgcgaccccg
   171361 ccgagtctgc acgttgggtg tgcagaaggg ggtgttctta tctttcatga tattgcgcac
   171421 cttctcgttg tccaactcgg agatgcgttt gctcttcttc ttgcgaggtc cggtgctcgc
   171481 cccgccgctg ctctgatggc cgcagctcag cagagaggag gaggccgcgc caccaaaacc
   171541 gccgcgccca tggtggctcg aggtcacgga tgctcctccg ccactgctgc atttcatctc
   171601 ctcggactca ctctccgagt ccgaagccga actgcaggag gaggaagacg aagaggaact
   171661 atcttcatcg ggccggccca aaggatcggg aagaggaggg tggttcatct gggagagcgg
   171721 gtgcgtggga gaggtcactc gcggcgtgcc gctgccggtg gaaggggaag acgcggtagc
   171781 accgcgggtc tcgacttctt caccctgttc ttcctcgcta tcagagatca cgatacagcc
   171841 ggcggtatcg ataatcttgt tgcggtactg gatggtaaag tcgggctcgg gcttgatgtc
   171901 ttcctgtttg atgaggggca gcatgatagg cgcgggaggc acgggcggtt taataatcac
   171961 cttgaaagga cgcgtggttt tgcgcggttt cttacgcggg ctgagctcgg gagtagcgga
   172021 tgccccgggg agaggagtgt tagtaaccgc gacgctggtg ggggtcggct tgttaagagg
   172081 ggcgctgcta acgctgcaag agtgggttgt cagcgtgggg ccggtgctac tggaatcgat
   172141 accggcatga ttgacagcct gggcgaggat gtcacctgat ggtgataaga agacacggga
   172201 gacttagtac ggtttcacag gcgtgacacg tttattgagt aggattacag agtataacat
   172261 agagtataat atagagtata caatagtgac gtgggatcca taacagtaac tgatatatat
   172321 acaatagttt actggtcagc cttgcttcta gtcaccatag ggtgggtgct cttgcctcca
   172381 gaggcggtgg gttcctcagc accatcctcc tcttcctctg aggcaacttc ctctatctca
   172441 gacactggct cagacttgac agacacagtg tcctcccgct cctcctgagc accctcctcc
   172501 tgttcctcat cactctgttc actttcttcc tgatcactgt tctcagccac aattactgag
   172561 gacagaggga tagtcgcggg tacaggggac tctggaggtg acaccagaga atcagaggag
   172621 ctggcaccag cggtggccaa agtgtaggct acaatagcct cttcctcatc tgactcctcg
   172681 gcgatggccc gtaggtcatc cacactagga gagcagactc tcaaaggatc ggcccccaga
   172741 atgtactggg caaagacctt catgcagatc tcctcaatgc ggcgcttcat tacactgata
   172801 acctcaggct tggttatcag aggccgcttg gccagcatca cactagtctc ctctaagaca
   172861 tagcagcaca gcacccgaca gaactcactt aagagagaga tgcccccgta catggtcatc
   172921 atacaagcgt cactagtgac cttgtactca ttacacattg tttccacaca tgtagtgagg
   172981 atatccataa atatgtgatc aatgtgcgtg agcaccttgt ctctctcctc atccaaaatc
   173041 ttaaagattt tctgggcata agacataatc tcatcaggag agcactgagg caagttctgc
   173101 aatgccgcca tggcctgact gcagccattg gtggtcttag ggaaggctga gttcttggta
   173161 aagaactcta tattcctgta gcacatatac atcatctttc tcctaagttc atccttttta
   173221 gcacgggcct tagcctgcag tgcacccccc aacttgttag cggcgccctt gctcacatca
   173281 tgcagctcct taatacaagc catccacatc tcccgcttat cctcaggtac aatgtagttc
   173341 tcatacatgc tctgcatagt tagcccaata cacttcatgt cctcgaaagg ctcatgaacc
   173401 ttatctaaga tatctaaggc attctgcaaa catcctccca tcatattaaa ggcgccagtg
   173461 aatttttctt ccgtctgggt atattttttc agcatgtgct ccttgattct atgccgcacc
   173521 atgtccactc gaaccttaat ctgtttgact gtagaggagg ataacaacac atataagtat
   173581 ccgtcctcct gactcattta tcgctatctc gatgccccgc tcacatgcaa gagttaatct
   173641 tcactctatc tgacatacac aagtaaatcc acgtcccatg caggttagta tatatcacat
   173701 acatgtcaac agacttaccg agttctgtca ggacatcttt ttcggggttc tcgttgcaat
   173761 cctcggtcac ttgttcaaag gttttgaggg attcttcggc caattctggg aacagcgggt
   173821 ctcccaggct cagctgactg ttaacctcct tccttaacat agtctgcagg aacgtcgtgg
   173881 ccttggtcac gggtgtctcg ggcctaaaca catgataaac aaagtcataa gcacatggat
   173941 cacatacagg aaatatgtat ataacattaa agatataact ttttattaaa aaaaggggaa
   174001 cacaagtccc gacacgtacc gtggcacctt ggaggaaggg ccctcgtcag gattatcagg
   174061 gtccatcttt ctcttggcag aggactccat cgtgtcaagg acggtgactg cagaaaggat
   174121 ccatggaaag gaacagtctg ttagtctgtc agctattatg tctggtggcg cgcgcggcag
   174181 caacgagtac tgctcagact acactgccct ccaccgttaa cagcaccgca acaggagtta
   174241 cctctgactc tcaacagaac acaactcagc tgcctgcttc ttctgctgct gccttaagtc
   174301 ttccatctgc gtcagcggtg caagcccatt ccccgagctc attttcagac acatacccta
   174361 ccgccacggc cttgtgcggc acactggtgg tggtgggcat cgtgctgtgc ctaagtctgg
   174421 cctccactgt taggagcaag gagctgccga gcgaccatga gccgctggag gcatgggagc
   174481 agggctcgga tgtggaagct ccgccgctac cggagaagag cccatgtccg gaacacgtac
   174541 ccgagattcg cgtggagatc ccacgctatg tttaataaaa actgcgggta ctggggacgg
   174601 tgttgttgta tatgtgaatt tgtaaataat aaatgggacc ccatcctgta aaaatacaga
   174661 gtccgtgtca gtctctgaag gacagagtat tggcatatag ccaataaaga gagttgtggc
   174721 aaagagccat gttatggatt agtaatggaa agtatcgcca ccaatagagg agtggtcaat
   174781 aatggtcaat aacccacacc tataggctaa gctataccat cacctatagc ataaggaagc
   174841 gggggtgtat agaccccaag ccaaaaacag tatagcatgc ataagaagcc aagggggtgg
   174901 gcctatagag tctataggcg gtacttacgt cactcttggc acggggaatc cgcgttccaa
   174961 tgcaccgttc ccggccgcgg aggctggatc ggtcccggtg tcttctatgg aggtcaaaac
   175021 agcgtggatg gcgtctccag gcgatctgac ggttcactaa acgagctctg cttatataga
   175081 cctcccatag taaacgccta ccgcccattt gcgtcaatgg ggcggagtta ttacgacatt
   175141 ttggaaagtc ccgttgaatt tggtgccaaa acaaactccc attgacgtca atggggtgga
   175201 gacttggaaa tccccgtgag tcaaaccgct atccacgccc attgatgtac tgccaaaacc
   175261 gcatcaccat ggtaatagcg atgactaata cgtagatgta ctgccaagta ggaaagtccc
   175321 gtaaggtcat gtactgggca taatgccagg cgggccattt accgtcattg acgtcaatag
   175381 ggggcgtact tggcatatga tacacttgat gtactgccaa gtgggcagtt taccgtaaat
   175441 actccaccca ttgacgtcaa tggaaagtcc ctattggcgt tactatggga acatacgtca
   175501 ttattgacgt caatgggcgg gggtcgttgg gcggtcagcc aggcgggcca tttaccgtaa
   175561 gttatgtaac gcggaactcc atatatgggc tatgaactaa tgaccccgta attgattact
   175621 attaataact agtcaataat caatgtcaac atggcggtca tattggacat gagccaatat
   175681 aaatgtacat attatgatat agatacaacg tatgcaatgg ccattagcca atattgattt
   175741 atgctatata accaatgact aatatggcta atggccaata ttgattcaat gtatatatat
   175801 cgatatgcat tggccatgtg ccaacttggt atcgcctcta tcggcgatat ggcctcatat
   175861 cgtctgtcac ctatatcgaa actgcgatat ttgcgacaca cagaatcgcc caagtcgcca
   175921 aagtcgtcta tcgccatccc ccgtaaacga tataagcgtt atcgccagat atcgcatatg
   175981 cccaaaaatc actttttaaa aaatggcgat atcagttaca cagaaactca catcggcgac
   176041 attttcaata tgccatattt tcaaatatcg attcttccaa tatcgccatc tctatcggcg
   176101 ataaacacca ctatcgcgcg acatgaattt agtcggcgac agaaatctcg aaacgcgtat
   176161 ttcggacaaa cacacatttt attattcact gcagcatata gcccatttta gcgcggcaca
   176221 catccagccg tttgtgtttc ttaacgctct ccaggtactg atccaggccc acgatccggg
   176281 ttatcttgtc gtattccaga ttgatccatc aatagggaac gctgccagcg gcgcccagca
   176341 ggtactgcgc cttgtcgttt actttgccgc agcgtattcg cccgtcagct tcgaggtata
   176401 acctacaaca cggaggggaa ggggggtaca aaacgtgaaa ttagactttt ttttttaatg
   176461 atgttttgtc cctctctgtc ttactctccc ataggctgta aggccctcag gaagagactt
   176521 acggattgta gttgcagctc gtcagtttgt tgtgtacgac ctggcgtgtc aatgaatggg
   176581 tcatggtggt gacgatcccg cgaatctcag ccgttttctc gggactgtag cagacttcgc
   176641 cgtccggaca ccgcagcctg tggattcatg aaaatctact ctggcattcc cgaggatcgt
   176701 cgatggaaca tggctatcag aaacgtcgag agacagatcc agacgcacca cagaacgcag
   176761 acaatcatga aaatacgtac gcgacggtga agcgattgca cattttgaaa tcgtaacagc
   176821 gttccggcgg gtggttgacg tttatgaatt cgcaacattc ttctgcgcgc acccgcggca
   176881 cgcggctgtg acccaatagc agccacaacg ccgtcaagaa cggcgtcaga tctttgggac
   176941 tcatgacgcg cggttttcaa aattccctgc gcgcgcgacg ggctcaaacg atgagattgg
   177001 gatgggtgca gaaggtgtaa gtctggttat tggcctcggt gaacgtcaat cgcacctgaa
   177061 aagacacgct gtagtcccgg aagacgtgag cccagctctc cagcttcatc acacacatct
   177121 gataacgtgt gccatcgttg acgacgaagc gtagcagctt ggtctgcttg ggcaccatgt
   177181 gcgctccaaa aatcttggcg tcttccacgc tgatctgcac gtttccgtcg ctcggtttcg
   177241 aagccgttcg gggcatccgt tggaggatgg tttggttccg accgctcagg taccagatca
   177301 cctttttcac ccaggtggag cttctctcca ccaaggtctg gccttcccgg ttgtacagca
   177361 gatacagggt ctcgttgcga cactcgggac ccgttgatac ccgctggaac cccgagaatt
   177421 gcaaggggga tcgtgggggc gagggataga gaaaaggaca gtaaaacgtc gccgcgtcat
   177481 gcggtttgga atacgtcagt ttagaccatg gcggggacgg attctggttt gctgttagcg
   177541 tcgaccacgg agacgccaga cagggcgttg cccaaaccgc gcacagaagc aggcagtgaa
   177601 agtggtgacg aagcagaagc cgcagcatat tatttcccgt gacgcaggct agttggcaaa
   177661 gagccgcacg ctgaactcga ggctccgggc gtgtggcgcc agcgaaccgg cggcgttgaa
   177721 cgtggtcctt ttgttggtgc cgccgcgacg gttctgacgt ctaaagtcgc tgatgagcaa
   177781 cgacacctcg gtcacgttga ttctgcaagc acaggttccg aacgtcattt cataccccat
   177841 gcggttactt acccgttacc cgttcgccct taccttcccg ttgtcatgca tctttagcgc
   177901 gtaccctcac ctcttgagca cgtcaaagtt gtccaagccg tggctcgcat cgtagtggta
   177961 gttcaacgtg aggtccacga gctgttccac atacttgtaa cgggtttggt cgggcagcgc
   178021 gcgagagcac gcgtcccagt aatgcggtac tcggtaataa tcgttttttt ccgcggtttc
   178081 ccgctggcac tgacccagca ccacggcgca cagacaaaca gacagccaca cccgacacag
   178141 ccgcatgttg cagactgaga aagaaagctt tattatgaga catcatacac atagtatagg
   178201 cgaggtgatg gggcggggaa agagttggaa ccgaaagaca aaaaaaaaag cctagtcgta
   178261 ctcgggatct ctgagcgaga cgggttgcat ggcaactttc attagtttgg gaatctgcca
   178321 gctggtgctg ttcgaaggtt cttccatttc cgaggcggtc agttcatcgt acaccgaaac
   178381 gtagtacctg atggggtcct cctcattgtc cgagaggtga gattcgatgg tcaaaggcga
   178441 gcctctccca taattgggat tcacgaacga cgtgtccaag ttgccatcct ttctgaaata
   178501 gatgacgttc tcaggatcat gtttcatgcg ctcgcgggcc gcggacgcct cctcctcctc
   178561 gtcccagtcc cgagtttcca accgctgata agggctcgag gaacaaaatc cggcggggat
   178621 ctgagaacct cgtcgggaac cgctgccaaa cgggctgctg ccgccactgt cgtccgtgtc
   178681 gtccaacagg ttgacggctt cttcgtcggc gaaacgaaag cgacccgggt gcttgcaaca
   178741 cgaggagtaa actaccgcga ccagtaccgc tatgaagctg aaaatggagg tgcctgtcac
   178801 gatgtagaag aggatagcca gcactttcat gatctcgtta ttgcgcacgt tgtgaacgga
   178861 agactcgtgg gtggtggtca tgttgatccc ggtcgtgggt ccgctactcg tggcgttgtc
   178921 gacgctattt ctgttgctgg tgctagtagg gacttttgtg ctgctggtca cattcgtaac
   178981 gtcgctgagg tctatctgaa gcagcaaccc gaacgcgacc agggccagga atgttgcgcg
   179041 aaggggaccc cgcggggccg gcattctcga gacgtggcga cgtggatttc ttgctatgtc
   179101 cgcgaacgac gtgtgacgag gacgtggttt ccgcaagcct ctaccgacgc cgcgacacca
   179161 ggtaggttat caaaacgcga gcccatatcg ccgccatcat tgtaatcagc aatgtgttga
   179221 ggtactgcac gatgaatctg tctagtgaca ccagccaacc ctctgctttt gcgggcaagc
   179281 gcgctttcgg tgacagggtg tatcgtacgt agccacgggt caggcgcgcg ttgtagcggt
   179341 acacgcagaa atctatccac aagccaacgc ccggttgtag cttcggatgg tggataatag
   179401 cgcggtgacg tacgccgcgg ggctttagaa tctccacctg taaggccatc tcctccaggt
   179461 agtgggtctg actgcgacgc agcgtccagt tcatgtaaaa gtcggtctcg ccgtgtccgg
   179521 ccacgaagag gctgcttact aaatcgggcg ccagagctag gtcaggcgta tcaaattcca
   179581 ctgtcaggcg acctgattct aacggttcca cgatccggga gagcgtttct agatatagag
   179641 caaagcgtac cacgtctacc tgcggtgtaa aaaactgttg tgggcgttca ccgtcgttga
   179701 ccacgtaggc cacgtagagg ccaacatttt ccaccacggg ttctagctgc aggcggcacg
   179761 taaagcttag aaacgacggc tgtacggttt ggttcccgtg aagctgaagc gtcacttcct
   179821 tgccggggct caccgtgctg taacgccgca ccgagtcggt catctgctcc agatcggtag
   179881 accagaaggg cgtgcaatgc atactgtccc agtcgcgaca cgcagcccag cctagctcgg
   179941 tgaagggtcg acgcacaccc gagaaagtgt gcttgaagac cagggggtcg cctcggtagc
   180001 tcagtagtcg aacatgcaca tagtcgcggc tagcgtcgac agacggtccg tagagggcca
   180061 gcagtacgag cgtgaacagc aagcgcaaca tgctgcgcgg gttaggaaat gcggcgtgcc
   180121 ggccaccgcc cgactcataa acgctaccag catgacgtct cagatcacac aagtgacgag
   180181 gagcgtaccg caaatcacta gggaaaaggc cagcagagcc cgatagtctt gctcttcgcg
   180241 aacgatctcg tccggttcct cgcaatcttc gtggtccaca gaagatgagg agcaggaatt
   180301 ttcgttaatc tctgcgagga tactagtgct gtaccacacc agagcgctta gtgtgcccag
   180361 agctaccgca cggtaaaata gggacatgat caccagcgca gtctaaagta gtggtaattc
   180421 agtttcttgg cgtatttcca gagaaaggct ttgtaggccg tagggactgg ccaggcaccg
   180481 aactcaatat ttgtagacac tacgtcgtaa atgcgttgtt cctcgtctaa gactaaccga
   180541 aaaaatagcc ggttgatgtg acgacgcacg gcttgcgcgt taggattgag acacttggtg
   180601 cccttgtcct ttaaaatagc cagcacttcc tgacgattgc agctttcgct cgctgcgatt
   180661 ggcttaagca attcggttcc gaccggcagg gtattcaaca gaatttggtt attacagcga
   180721 caccgcttgt cgtaatcttc tagttctaaa agacggacgg ctatgggaca tatggcaagt
   180781 aacatatatg cggtcaatga caggtatcgt accgataaaa gtttaatgcg cgaattcaga
   180841 atcggatgat gtaaccatgt tagcaacata ttgaaaacat gatattttct gctctaacaa
   180901 acttgtctgt ttaaaatata tactaaatat tattccttca gacctactag ggttacagtt
   180961 atttttcccg gccctcgttc cggttgtctt gttacattaa cattatacca cctgttatcg
   181021 ttgcgtttgt ctagccattt tgaaaaaggg tgatggggcg ataaacatac tccaggtcca
   181081 tgtttttttc ctccgcctag atacaagaaa tattcattgt tattgcatct gggaccacca
   181141 gattcgcgat gaaaccaaaa attacccaac ataattgttt tgggcggcag ttttttacca
   181201 tcaagacatt tgcagcgtaa ttccgttcca tgcacttcat aataatacat atacgttaaa
   181261 gaaataatca acgcaccaaa aattaatcgc attataattt tattatttac gtcactacca
   181321 ataattcgta atatccggta ttcccggaaa atcactcaaa actgcgtcca tgacacatca
   181381 attcccgata agtacccccc tttgaaatcg gatcccccca cataccaatc aatcatacaa
   181441 cacacaggtt taaaaatcga tcacacgtca attaggtttc aaaatcgata ccatttatta
   181501 tcaggaatct agactaattc tacaatgaca gctctgaatt tctctctcgt ctttcttgtc
   181561 aggttctcat catcaatctt cacttccacc catcggggag tcatcgtcgc tccaaaaccc
   181621 tttggggtca ctggttggaa aagtctctga cacgatccag gcaccccgta cccagtccga
   181681 ctgatctagc ctacggagca tctcaacagg catgagctgc agggccacgg ctgtcacggc
   181741 actgtatcga tgtaacacta gggactttct ttgcgatgta gccatcaaca cggcgtatgc
   181801 cccatagttc gcgtgatacg acgcatgatg ggttaaacgt tcccatccgg cagtgccgtc
   181861 tcgggtccgt gcacacaaca gctgcacagc gttatgatgc ttaaaattaa ccataacgct
   181921 gggactactg atgaaggagt agtaatgagc caggacgccg tacatcgaag gcaacaagaa
   181981 agagtgacag cacgatagca ccgggctctt atgtaggcga cagcttattt ttcctgacgt
   182041 cggcaaaaag tacctaaatt ccccacagat attcagacac ggttccgtaa agtgcttctt
   182101 tttttagtgc aggaattgga aaaaataata aaaaatatga acagctcatc tgtaattatc
   182161 tgtgtgactt catcgtaccg tgatgtaaaa acaacaacag gaagcttaca gggtgcggta
   182221 gaaaattttg ccgattgagc aacactgttg gcatctctca ctccgatagg cggctataag
   182281 atagagaatt aaaagtatga tacccacaag aaagataaag agagacaacc aggctagagt
   182341 atgacgaccg ctttttcctt gtttgacggt tatatgtgcg gtatgatttt gctgtcgttg
   182401 cttgtgatgt tggacgcctg gagtggaaaa gtacgtatgg ttcttaggcg cgcatacggt
   182461 attattggtg gaagtgcagt tacgaatcat gacttgagtg acgttacatt gagtgcaatc
   182521 ggtacagttg taaagtcccg atacatacgt gccgttgggg caaggggtac acgttacgct
   182581 ggtacgctcc gtgcatactt tagtaactct ttgtcccaaa ccacacggag gacagcattc
   182641 gttgcccagt tgcacttcat tatgctgaca cactttagtc accccaagct gcaataatat
   182701 cacaccgaag cagatgagca tcaccagagg cttcatgcct cctaccggaa gaataaaaat
   182761 aactcatggg gccgaacggt gtcatcctct ccgcggtttg taatacgaga tcgtaaacgt
   182821 aaataaatga cataacttca ctaacccgca tactacaaag tccacctacg acgctgaaag
   182881 tttttccagg acagaacagg atagtcagcc atcttcacag tctacctctt aggccgtatc
   182941 taggagcata ggtaatcagt ttgcagccac agtacagcga gcccaagaga ccgcacacgg
   183001 tccctgctgg gaacacgtac caccacatcg attcgtcgtg ccgtataatc gtagagtttt
   183061 ccgaactttt atacacgccg gtggcgttag ggccgtgtgt gctgctgtga ttggacgttt
   183121 tgtgagctag gtaacagctg tgatttcacc tgtcgccaag actgacagcg attacccagg
   183181 tggagcacaa tcacatagct gatagacgtt aattgatccg ttgattccca tggacatttt
   183241 aacggtaaca atacagctcc cgttaaacat tagattaata gacgttagtg gataacagca
   183301 tgttattcgc ccgtgatcgt ggttatgcac tttcttgttt tttgctcata tgctgtaagg
   183361 tgttcgagaa tcgtggggag tatatgtgtt gaatcagagt catctttact gaccgcgcca
   183421 tacttcgtat acgaacttaa ccggcgtaaa gtgtttcccg atatataaac cggcgcctat
   183481 tgtagctgta gcgcccatag gtatggcata tacccacggt gatgttgtgt tattcgtttt
   183541 ttgtgataaa acgtagctta tgtttagtgt gtgttccgtc acgttatgtg tgtcgttaaa
   183601 agacggcgtc tgtacagtat ggctttgagt tgtatcttta attgttattg catttggagg
   183661 tgttgtgtac agagttgtta ttgcgtgttc aggtgttacg ttttgaggta cagctgtggt
   183721 gtacacgggc tccaaggtgt agttacggag tctttctatg caggtagtgt tgagatattt
   183781 gtgaatgctg gttatgttcg attctgtgag gttaaagtgt gtactattta tggcggtgta
   183841 atttagacgg tcttgccatc ctgaggatgt tagtgttagg taattcgtgt tgttcacgtt
   183901 tgcttgatat gtataagtag gtgtactgtt tgtgaggtcg caagtgtgat tctcttgcag
   183961 agattttatc catcttgtgt gaaaatattg agatacgcga tgaatgtttt cgctatctat
   184021 attgtaaagc gtttcggtgg tacttagggg ttgtttgctg taactcttat tttggaccca
   184081 gggtgtgaac catgactcca atgtttgtat agtaaggtgt cctattaata aagacgaact
   184141 gattcctacc gtaatgttat atcgcacacc tagggtgccg tttacaaaca cggaaatgtt
   184201 tccgttacaa accacgttgg cagatgaatt agattccagg tggtaacgat aggataatga
   184261 ccgttcgctc ccaacggatg acacaaagta tccgaataac caacacgccc attcaatccg
   184321 catattttaa tcacactatt cacatttcac acactgcatt ttttaacatc ttattttttt
   184381 attttatgcg tgttctcacc tcttcatctt tttaacaccg gggtaactat cgtaagtcgg
   184441 taggcgtcga tagccctcac cgcctcgtcg tccccttccc ggcgtggggc accagcgtcc
   184501 acagcactgc aggtaacaca ggtagcatag gaaacatacg gtgaaaatac tccaaaatcc
   184561 caaaaatgcc gcgattcccc gagtggccca gggagacatc ccggtgtcta tgtcggccgg
   184621 cggtgctggc gtcaccggta aaaatttcgg cgggtgtggc tgcgaacggt agcagtcgcc
   184681 ggggagccgg taacgctgta tcactgtcca acagcggtcg ggttcctcgt ccggacatgc
   184741 gggtttccag caatcctcgg cgtcggcgcg gccgatatag aagtagttgc gttgaaaacc
   184801 gcggtacatc ccgcagtcgt gattccgtag acgccagggc gtcggcgacc agatctggtc
   184861 tcccagcgag tagcgaccta acgccggcgt gcagcaaggt tcgtcgggcc ggctgagcgt
   184921 ctccagttgc gtcagaatta cgaagcgttg catgatgagg ccgtggctat agttgcgcag
   184981 cacgcattcg tacatgccgg ccgtgtccgt cgatacgttg aaagtcagcg agaatatttg
   185041 gccgagatgc aactgcgaga aattccaagt ggcgtacggc aggcggtatt gaagtccatt
   185101 catcagccta tggcctttga cggcgtccag gatgagctcg tcgctgccgt cgtgggaacg
   185161 acagaaacgt gcgcgaatgg aaaccatggg ccaggagtgt gtcatgaccg tgcaggggat
   185221 ggtaacttgc tctccctcgg cgaccaacac cggcgccggc gacgtggtct catagttctc
   185281 ggcccacatc ttttcggcga tgtcagcggt ggcgaagggg aacgaagagg aagaatattc
   185341 gaggagtcgc gggcagctca acagcaccca gaacagccac ggcagagttc ggagcgactc
   185401 ccggcggcac atgatgattc ttttcttccc tttttcgcag agacgctgcc cgcctgttcc
   185461 tgctccgtgt gtcggccgct caaacgtcgg gccggcgtgg tggtgaccac cgtgcgacgc
   185521 agcttctcgc ccgggatgcc cgcaactgag cgtccggttt ttttacaggt cttttttgct
   185581 gcctctccct cgccgtcgcg gccgacgtgg tggaccagca ccgcgcagga actctcgcgt
   185641 cgccggcggt acgcgacctg tctcattgct acctcggatg tttaagaagg aacgtttatc
   185701 tgcgtcacag ggtctgatga agctgccaag agtcgtggct gtggcgtagc gcgttttgta
   185761 cagcgcgttt caccgctttc tgcatggccg ctaccacatc gggtgggagc ggctccggcg
   185821 gaagctcgat gagcagttgc tgcgaatctc ggcgttcggt gtccgccgtt tcgtcggacg
   185881 tggcgtaaaa aaccgaggtg gtcgcccagt cgtccacgct gtcgacggct tctgtcagtg
   185941 ccgggttgtc aaaaccgcca tcggacgcgg gtgataaaag aacgtacgat gacacgctgt
   186001 tagtacgact ctcgtcgtcg ctttgggaac gacgtgatgg acgacggtag atgacctcgt
   186061 cttgccacgc gtcgaagcgg tcgcagcagc gctggatcca agcgcagcga agcagcttac
   186121 ggaacacgtc gttgttccaa aagtagagca taaagagaaa gaaaagtagc gtaacgatga
   186181 agccgaaaac gacgagggtc ggcagggcac taccgccgct gccgtttttt gcgccgtgcg
   186241 ggtgcacggt ggtagtgccg ttagtctgag cgggggtcat gacaagtctg aagagatgag
   186301 agcgcgggtg ctcatcagga acagttgagg tgtctcccta ccgaagcctt agcctctacg
   186361 gtgttttatg atcaacgtgt ctacgaacgt cattgtgaaa gtgacgtctc aggctttccg
   186421 aaaccgcgtc aagttcaacg ttggtttcgg tttagcctgc gtcaccgagg cggaggtgga
   186481 aatgagccgt cctgtggggg agtgtacgac cctgtagtgc ccatgggtaa cgttgcatcg
   186541 gaagaagtga atgcggcatt ggtgtacgcg tgagtggctt tgctctctga ctcggaggag
   186601 ttgccgcagc agctgcagac tttacgtact agccaaaaac agcaaaggca gcaagtaaat
   186661 atgagaagga gtccagataa tgtccagccg ctagcggcaa gtagcgcgag ctgtggcgcc
   186721 cccaaatcac tgccgttaga agcattaata catgctgtcg atggtgtagt cgtgttagtg
   186781 gtaccagcag aagtagattg actggaatta gagctggtac ctgtagtggt ttcactcgcc
   186841 gatgcggcaa gtgcaaataa aactaatatc cacagcatgt tcgttactat ataattgata
   186901 tacgaacccc tttgtcgtga caatcagcgt tatatacgct gtatcggcat cgttttaccg
   186961 gaaagtttat cgtaatgtaa cccgcgttgt gtacattcgt actgaaaggg aacccccggt
   187021 gatgtgcaca ttatactctt tcattctggg gtttcccaat gacgtaaaaa tttccactac
   187081 acaataaaat tactgactca tgtgaaaagt gtgcttttta ttaacagagc agagggttta
   187141 cagtagatat atgtttgcca gggccaccgt tttctaacac cgatcaccgc caccattacc
   187201 acccgttgaa ctccacaccc gggagccgcc tgatcgccag ggactcctca ccgtccatcg
   187261 tccgaacaag ctcccgtcac cgatgctgcc accatcaccg agagaaagaa ccgcttgctg
   187321 cagatacgct tgggctcgcc tccgtgcgga cgccgtttcg tgcagacgct gagtagatcg
   187381 agcagagaat gtcaaaacga cattaccgcg atccgctccc ctcttttttc tttttctcat
   187441 tcacgtgtat tcttgatgat aatgtaccat ggctacggtg gtgaactgcg tcgcggatcc
   187501 cgtcacgggt ttcaacagat cgacgtcggt cagcggcgcc gtcaccgcca tgtccggcgg
   187561 aggcacgctg tttctctggt tagcgacgtg gaccgacgac gaagacgatg aacccgcgcg
   187621 gcggtctgtt atccgcgacg acgcgtagct gcactgggaa gacacttcct cccaacggac
   187681 caagatctca tcgggtcgtt cggagaaacg gtatcgtctg tccgactccc gccgtacggc
   187741 gccgaggccc agcgacgaca ggtccgcgaa ccggcgctcg tattccccgt acagctcgca
   187801 acagcggatc agccagcggt agctcaaaaa catgcgcacc agtttgaagg tgtcgtgcca
   187861 atggtaagct agatagcaga gaatggccac gatcagcacg agcatcacgc cgatgatggg
   187921 taacccgacg ttcagcggca gatcgtccat ggtgaccgtc ctctgtccgg atctacgtcc
   187981 cagtctctct cttttgtaca gcactcgcgc gggaacggcc ccctcaaccc tcttacgtag
   188041 cgggagatac ggcgttctcc cgcgggccac ttacttgcac ggtcgcttga acggcggctt
   188101 ggaccgccac atgtaccgca tccatccatt ctggcagcag cgcgttcgac gacgtcgtac
   188161 gagtcgcgga tgatgttacc ccgccagcac ctccgccggc aaccgcgtcg tcgttgctat
   188221 cgtcgccggt ttcgggcgat gacagcgccg gcggcgcggg tctcgtctcg tccaccattt
   188281 ccaccgtgtc gaagcgacag ccgctgccgt agtacatggc cccgttcaac ggccggcggg
   188341 ccgggtcgcc gagttccggg tcgggcacat ccatggctcg ccgtctgctt ctctgccgct
   188401 cgtggtgccg acggcacttc tcaggataat gacagccgca aaatagatcg tggagcatgt
   188461 ctcgccaact gtcctggtgg taatatctta agtacgcgat gagcgcgccg atggccataa
   188521 tcataagcgt aagcaaaacg gcacagataa cgtgaaacac cgcggtcatc caagtcgggc
   188581 ggcgtcgggg acgcggtggg tcggtttctc ttacgccggc gtcactcagc caccacaccc
   188641 gtagtcgaca ttcccagaac cggtgaatgc gactcaggac ctttcgacgc cgccatttat
   188701 ttccaacgtc caagtcccac gtcatttctg gcatctccac gcccttgact gacatactct
   188761 ctttctctct cttagctgcg gtgaaaaaga gggaaggcgt gtgctgctat acaactgtac
   188821 aacggacgcg ctcgctgttt cggtctcagg tcatctgcat tgactcggcg tccttcatga
   188881 cgctctgcac cgccttttcc aagagttcct cgatgtccga ccatcgagga ggcggggcta
   188941 actcggaaac cgacacgata ggcagcgtgg tcggctccgt cggcgtgcgg ggtcggggac
   189001 agggacacga gagtcccacc ttcgagagat tctccagccc gacggtgcgc ggcagtctcg
   189061 gattccgcgg tggcttttgt ggcgtcggcg ttttcgggaa gggcctgggc gtcaccggcg
   189121 gtgtccagcc gaccggcttg ggtttcgtgg gcggcggtgt tttcttggtg ggcggcgtgc
   189181 tcaggttctt acgcggcgcg ggtatcggcg tcgggggcct gtgcgacgac agccgcgtgg
   189241 tgggggcccg gaccggcggc gtaggcggcc gcttcttgcg cccgggcggc ggaggtggct
   189301 tccaggatgg cggcggctga tgcagtaccg tgtcgacgct ggccgaggac gacaaagagc
   189361 tcgacgagga gcaatgcgac ggagatcggc cgatgctggt cggcgttccc ggcgtggata
   189421 cgtcggggat ctcgaatcgc gccggaggaa actcgggttt atctatcggc agaccatcct
   189481 ctcctatgta gagcgacgta caccgcggca cctgcggcgt cggcgggtgg gtggccaccc
   189541 gcatgagccc cagttccaga tccagcggct caacgacgtc ttctttcgga attcgatagc
   189601 agcacgcgca ggcaccacgc ttatcagaag cagcacccgg gagccggcct cgcgacgaag
   189661 tctcgtcgga tcgcttgcgg cctcggcgct gggtaaataa ggaaatggcc aggaccaggg
   189721 aagccagtcc ggtaccgccg aggagcccga cgccgagcca cagccacacc atgatcttct
   189781 ctcctgcttg gaatctcaaa ctccgtgtcg ggaagggccg gtgtacggac atttatgcct
   189841 tggatttctg gaaacgtcat tttttggcaa ggaatgtgtt tattgtccaa acactgagga
   189901 aggagatgtg agccaagtcg gaaaattcct tatcacaccg ggggcgggtt acgttccggt
   189961 ctgatgctgc tgctgttgtt gtagagccgc ggccatggcc gcctgcacgg cagcttgtac
   190021 cgcctcggcc acgccgggtg gcatctgcgg catggcgggg ggagacgcgt cgggcggacc
   190081 gccgggcatc gccgtcggct gcgacggtgg ttgtgaactc accgtcggct cgcacggagg
   190141 tttgttcttc ggtctaccct tcggtttgtc tttcgcccta cctttcttcg gtttgggttc
   190201 cgatgtcggt gttggcggtt gcggtgggat gacgggctgg tgggactcct ccgacggcgg
   190261 ggggacgaac accgtcggcg ccgaaaccgg gggactctcg actatctcgc agatcaccct
   190321 gtcaggatcg tcgccgtgtc cgggacgccg tcgatgaccg tattggacca tgtcgtaaat
   190381 catcgtctcc ttgtaacacg ctgaacagca gcggctacag gggcccgaga tgcatttgca
   190441 gctgcactta cagctgcagc tgcagtagcg aacccatcgg caggtaagga ggtcgattac
   190501 ggagtctttg aagaattccc ggtaacggat gagatacgcg cagaggaaaa tcatgaaaac
   190561 agaacagccg actacggctg cgatgccggg tcccgaagag acatccgccg acgatcccgc
   190621 caaacaccaa attcctaaag ccgcgcatgt tatccaggcc acaataatcg tgggaacgcc
   190681 ccattggcat tgccacgaag gatcgtgcac gtcgcaaccc attgctactg cgttctccca
   190741 caaacgccat cgcactattt atctctacag cggctgccga gtcacgtccg ccggcgccca
   190801 tcggccgcgg cgatctccta gtaacactcg tccgacactt ccaccatctc cagctcggcc
   190861 ggcggttcgg cgtcctccac cagcggcgtc gtctcatctt tgccacagca gcggacgcac
   190921 accttctcca ggcagaacgc caccagctgc cgccgaacgt accacaggta cacgtgcaga
   190981 cctgcgaaca ggactacgga ggtcatgacc accacgacac acacgggaat ccagggatca
   191041 aaattgctat cggaactcat ggctatcgcc gccgacgtgc gcgcgtgtgt ctcaccgccg
   191101 ctcgcccgtt gtcgcgcggc ttgttatacg ctagcccgtc gccgcctcgg ggcacggtgc
   191161 cctcctaccc acgtaacttc ctccgtgact taaagtcgcg tgtggtagat ctcctgctcc
   191221 gtggacgaac cgtccggcag gatagcggtt aaggattcgg tgctaaggcc gtgtcgccaa
   191281 cgtcgaatgc tacgttgcaa cagcttcgac ggacggccat cctccctctc atcgcaataa
   191341 taaaacacca gcagcgcgca cgacgcgatc acggtaaccc ccatgactag acccacgcag
   191401 atagccagcc ccgctagcgt atccagcgcc atcccgttcg ctcccgtcgt cgtctcctga
   191461 acaaagcaac aactccgcag tccccgtttt caaccgtttt tgtttccttc tccgcgagca
   191521 aatgttaact cccgcggtct ttccggccgt gctctacctc ctggcgcttg tcgtctgggt
   191581 tgagatgttc tgcctcgtcg ccgtagccgt cgtcgagcgc gagatcgcct gggcgctgct
   191641 gttgcggatg ctggtcgttg gcctgatggt ggaagtcggc gccgccgccg cttggacctt
   191701 cgtgcgttgt ctcgcctatc agcgttcctt ccccgtgctt acagccttcc cctgaaaccc
   191761 acgttaaccg accgtcccga aaacgccggt gttaacacag gaaaaaaaga aaccacgcag
   191821 gaaccgcgca ggaaccacgc ggaacatggg acactatctg gaaatcctgt tcaacgtcat
   191881 cgtcttcact ctgctgctcg gcgtcatggt cagtatcgtc gcttggtact tcacgtgaac
   191941 caccgtcgtc ccggtttaaa aaccatcatc gacggccgtt ataaagccac ccggacacgc
   192001 gccgcggcac ttgcctacgg cgctgctcca gggaaactcc tcttccttct gctcttcctc
   192061 cttcaccgca gggatcgttt ccctcggcca gggacatacc gaagcaacta ccggaacaac
   192121 ctggaggagt cgcggcatga cggcgcccaa gtgtgtcacc accacgacct atctggtcaa
   192181 gaccaaggag cagccctggt ggcccgacaa cgccatcagg agatggtgga tcagcgttgc
   192241 catcgtcatc ttcatcggag tctgtctggt ggccctgatg tactttacgc agcagcaggc
   192301 acgcaacggg agcggcagcg gctagacaag tcccaggcgg ctacagctcc aagcgccgta
   192361 gccggcccgc ctgccgatcg cgacgtcgtg gaccatcgaa cagagagtca cgcgtacgag
   192421 accccgaggt acgccacgcg gtgcctaacg cggtatacca cacccgtacg gtctgcagtg
   192481 cggcgtacaa cgtgtggaaa acgcgttgcg tcgcagagtc cgccacgtcc ctgtcttgtc
   192541 gctccccaat cgtctcccgc acaccccccg cggcacccag agggcgggtg aggcaagtat
   192601 tcttaaggcc gttctccgtt ccatagccca taaattgttg attccggagc tcgttggcgc
   192661 ggaaatagcc ggataagggg agcaacaacc gtcggcgaaa gccgtcccgg tcattcagtc
   192721 cgggtttcgc gtccagtcgg acgtgtgacc gttgggcaac ggaacggcgt ttcactgcca
   192781 aaattgtatc gggtagtgta cgagacgtcg gcggtgcaga atgcgactcg cggcgtagct
   192841 cgccgtcgct atgcggctcg tcgccgtgtg gcgcggcctg gccggctgtc tgcgcccaga
   192901 tctgttggcc ttttggttcc tctggctgct gctgcgtgtg tgctttggca gacgcggtgg
   192961 cagtttgcgg tctgcggtaa gtgaggatgt tgccgagcaa gcgcacttgc ggcgcgtgat
   193021 cggcacgcgt gttattgtag gttcgttgcc agatggcaag tgctgtcaac agcagacgtt
   193081 gtgggcggtc ggtgtatttt tgtgggttgc ggtgagagtc ggcactcggt gttttgtgag
   193141 tgatctcaac agtttgtgtt gcttttagca gcgtccaaaa cagcgacgcg actttgggga
   193201 tggcctcgtg ctcaccgccg cggagagtgt cgccggacct gctcgtcagc agcgagctac
   193261 gcagacggaa tatctggagg agagttacgt gtgtcacagg agagcgcggg tctccggcgg
   193321 taacgacggc ggtgtcgtcg acacgtgtgc ggcctgctgt gctctgcgga aaagcgccgg
   193381 tctcggagac cgtggacgaa aaagagaacg gagcagctac cgctggcggc ggcggcgtta
   193441 atgctgccgt tgatgttaga cgttgtgagt actcggaaac agcggtgagg cagaagctcg
   193501 atccttcagg gaacgacagt cgatgtgtgg tagccgcagc aggtgaggtt ggggcggata
   193561 acgtgttgcg gatcgtggcg agaacgtcgt cctccccttc ttcaccgccc cacccaccct
   193621 cggttggtgt ttcttttttc ttgtgtcctg cagatagttc cacggacagc gacggcaagt
   193681 ccataatcgc cggtgtgcaa gtggtggacc acgacgaaga tatcatcgcg ccgcagagtt
   193741 tgtggtgcac ggcgttcaag gaagccctct gggatgtggc tctgttggaa gtgccgcgtt
   193801 gggcgtggca gggctggaag aggtggcgca acagcgagtc tgggcgtcga tggagtgctg
   193861 ggtctgcgtc ggcttccagc ttgtctgact tggcgggcga ggccgttgga gaattggtgg
   193921 gatcggtcgt cgcgtacgtg atccttgaac gtctgtggtt ggcagccagg ggctgggtgt
   193981 gcgaaaccgg tgtggaagcc gaggaggcta tggcgcggcg gcgacagcgc atgctgtggc
   194041 gtatgttctc tcgtggaggc gacggcgaat gcagcagacg gtgttcgatg gagatggcgt
   194101 gcgaggaaga aagcgccgtg ttgtgagcag acgacgttgg atgcgggacg tcggagcaca
   194161 tgggccatgt gtggtggcag atggcggtgt ccacttgtgc ttgtcgcggc agtgcacaga
   194221 cgaagcaaca tgtcgctgtg aagagataga gtgtgagcat agctgtatgc agcgttgcgt
   194281 gtagaagcgg ggggatgaag acgttaataa agagtagcgg cggttgtgat agggcgaccg
   194341 ctgaggcgag ctgcgtgtgc gtgccgtctg tgttccccgt gtccgccgcg aaaggccccc
   194401 gtccccgtcc ccgccgcaag agtcccccgt ccccgccacg caacagctcg ccatcccgca
   194461 actccccgtc cccgccgcga aatgcccctg tccccgtcct caccaccgtc cccgccgcaa
   194521 gagtcccccg tccccggcac gcaacagccc gccatcccgc gacgccccgt ccccgcacac
   194581 cccccgtccc cgcacacccc ccgtccccgc acaccccccg tccccgcaca ccccccgtcc
   194641 ccggcgcaac ccccgtccct gtccccagcg taactcccgt taccggcgcc ggcgcccagc
   194701 acgcccgaaa acaacgccgt cgccgccccg aaaagcgaag cgctgcgcaa aagctgcgta
   194761 gaaacgccgc acaaacaccg tagaaacacc cgccgccaac ccccgagcgc ccgcaacacc
   194821 ccgtccccgg cgctggtccg cgaaaaaaaa caccgcggga cgccacgcaa cggcagtgcg
   194881 cacaaagcgc cggacacagc acgccgcaaa cgcgctgagg acgccgacgc gcttacttat
   194941 gtcacgcaac actccctcag ccctgtccag tgtcggactg gcggaacgac aagtgctgtg
   195001 gagccacacg caccggcagc gcgcagaaag cgccgtggac agcaagccgc agaagcggcg
   195061 gagcgcttgc ggcgccataa aggcgcttag ccctgtcccg caccggcggc ggtcggggtg
   195121 tgtcgggggc gcggcggggt gggtgtgtgc cgggtgtggc gggtgtgtca gggtgtgccg
   195181 cgggtgtgtc gcgggcgtgt gccgggtgtg tcggggtgtg ttggccgggt gtgtcgcggg
   195241 cgtgtgccgg gtgtgtcggg gtgtgttggc cgggtgtgtc gcgggcgtgt gccgggtgtg
   195301 tcggcggggt gtgtcagggg tgtgtcgggg tgtgttggcg ggccgtgtct gcgtgtgtcc
   195361 tcgacgcggg ttgtgcagtg tgccccgggg cccgcgactc ctcccttgcg cccgcgtctt
   195421 gtctggccgt tgttttgcgt gtgtccccaa ggacccgcgc tgccgtcccc tggggactca
   195481 aacagacaca gacgcgcgtc tgcttttcgc cgtgcgcgcc gcacgtcgct tttattcgcc
   195541 gtcgccgtac ccaccgcagc acacgcaact agtcgccgtc gccgtccaca cacgcaactc
   195601 caaatttcac ccccccgcag aaaacacccc cccgcccctc ggggacccag cacacggccc
   195661 ggaatggatg tcgggcgtcc acctaggagg gtgcgcgctc ggggacccag tccgcggccc
   195721 tgttgcgcgt gttcctccgg gttcctgcct tttccagtcg agtgcgtcgt cggctgccgg
   195781 gtggttttcc acggccttcc agactgcacg gccccaaggc ggcgccagca agcgccatac
   195841 acgtcgctgc ctataaaagc caggtgcgtg tctgccgtgg cacacggacg acggagccgt
   195901 ccgcgtgtgt aaacggcgtg gtcgctgacg cgggtttgct tcctatatag tggacgtcgg
   195961 aggtgtccgg cggccatggc ccagcgcaac ggcatgtcgc cgcgcccccc gcccctcggt
   196021 cgcggccgcg gggccggagg gccttcgggg gttggttcct ctcctccttc ttcttgtgtg
   196081 ccgatgggag cgacgtcaac agcgggcact ggtgcgagtg ctgcgcctac ggcgacgccg
   196141 ggccacggcg tccaccgggt agaaccccgc gggccgccgg gcgcccctcc gagtagcggc
   196201 aacaacagca acttttggca cggcccggag cgcctgttgc tgtctcagat tccggtggag
   196261 cgccaggcgc tgacggagct ggaataccag gccatgggcg ccgtgtggcg cgcggcgttt
   196321 ctggccaaca gcacgggccg cgccatgcgc aagtggtcgc agcgcgacgc gggcacgctg
   196381 ctgccgctcg gacggccgta cggattctac gcgcgggtga cgccgcgcag ccagatgaac
   196441 ggcgtgggcg cgacggacct gcgtcagctg tcgccgcggg acgcgtggat cgtgctggtg
   196501 gcgaccgtgg tgcacgaggt ggaccccgcg gccgacccga cggtgggcga caaggccggc
   196561 catcccgagg gtctgtgcgc gcaggacgga ctgtacctgg cgctgggcgc cgggttccgc
   196621 gtgttcgtct acgacctggc gaacaacacg ctgatcctag cggcgcgcga cgcggacgag
   196681 tggtttcggc acggcgcggg cgaggtggtg cggctgtacc gctgcaaccg gctgggcgtg
   196741 ggcaccccgc gcgcgacgct gctgcctcag ccggcgctcc gacagacgtt gctgcgcgcc
   196801 gaggaggcga cggcgctcgg acgggagctg cgccggcggt gggccggcac gacggtggca
   196861 ctacagacgc cgggaaggcg actgcagccg atggtgctgc tgggcgcgtg gcaggagctg
   196921 gcgcagtacg agccgttcgc gtcggcgccg caccccgcgt cgctgctgac ggccgtgcgt
   196981 cggcacctga accagcgtct gtgctgcggc tggctggcgc tgggcgcggt gctgcccgcg
   197041 cggtggctgg gttgcgcggc ggggccggcg acggggacga cgtcgccgcc agcggcgagc
   197101 ggcacggaga cggaggccgc cggcggggac gcgccgtgcg cgatggcagg agccgtgggg
   197161 tctgctgtga ctatacctcc gcagccgtac ggaggcgccg gcgggagcgc gatttgcgtg
   197221 ccaaacgcgg acgcgcacgc ggtggtcggg gcggacgcga cggcggcggc agcggcagca
   197281 gcggcggcgc cgacggtgat ggtgggtccg acggcgatgg cgggtccggc ggcgtcgggg
   197341 accgtgccgc gcgccatgct ggtggtggtg ctggacgagc tgggcgccgt gttcgggtac
   197401 tgcccgctgg acgggcacgt gtacccgctg gcggcggagc tgtcgcactt tctgcgcgcg
   197461 ggcgtgctgg gcgcgctggc gctggggcgc gagtcggcgc ccgccgccga ggccgcgcgg
   197521 cggctgctgc ccgagctgga ccgcgagcag tgggagcggc cgcgctggga cgcgctgcac
   197581 ctgcacccgc gcgccgcgct gtgggcgcgc gagccgcacg ggcagtggga gttcatgttt
   197641 cgcgaacaac gcggtgaccc catacatgat cccgtcgcat ttcgtctttc ggacgctcga
   197701 actctcggtc tcgacctcac caccgtcatg acagagcgtc aaagtcaatt gcccgaaaag
   197761 tatatcggtt tctatcagat taggaaacct ccttggctca tggaacaacc tccaccccca
   197821 tctcgccaaa ccaaaccgga cgctgcaacg atgcccccac cgctcagtgc tcaggcaagc
   197881 gtcagctatg cgctccgata cgatgatgag tcttggcgcc cgctcagcac agttgacgac
   197941 cacaaagcct ggttggatct cgacgaatca cattgggtcc tcggggacag ccgacccgac
   198001 gatataaaac aacgcagact gctgaaggcc actcaacgac gaggcgccga aatcgacaga
   198061 cccatgcctg tcgtgcctga agaatgttac gaccaacgct tcactaccga aggccaccag
   198121 gtcatcccgt tgtgcgcgtc cgaacccgag gatgacgacg aagatcctac ctacgacgaa
   198181 ttgccgtcgc gcccacccca gaaacataag ccgccagaca aacctccgcg cttatgcaaa
   198241 acgggccccg gcccacctcc gctgccgcca aagcaacggc acggttccac cgacggaaaa
   198301 gtttctgcgc cccgacagtc ggagcatcat aaaagacaga cccgaccgcc aagaccgcca
   198361 ccgcccaaat tcggggatag aaccgcggcc catctctcgc aaaatatgcg agacatgtac
   198421 ctcgatatgt gtacatcttc gggccacagg ccacggccgc cagcacctcc gcggccgaaa
   198481 aaatgtcaaa cacacgcccc tcaccacgtt catcattgaa agtctctcca gtccctatgt
   198541 tgtcaggacg tgctgtcgtt cttcgcttgc tgcgaagccc gttcttccga gtcgtgtcgc
   198601 tgcgtccagc gtcgcgccca agatgggaat ttgggtcttt tcacgcgtag cctcctccac
   198661 cacggctgct gatcgccgtc actaaggacc gacacggagg atgacgagga gcttctcccc
   198721 gactccgcgg tccgcgaccg gctacgtagc gcgtgtccct gccagtctcc gcagttacac
   198781 cacacgtcgt gagcagcgtg cacctgctgc cgccactggg cctcggcgtg ctcaggccac
   198841 ccgccggagc ccggtctgag ctccgacgca ggatgcgcgt actcaacgtg cgccttccag
   198901 tccatacagc aacaccatag gtcgtgtgag tcgtcggcta cccgccgcca ggccagttcc
   198961 cgcatgggaa ggctggacac gccgaccgag aggtcaccga gcccggacgc catctcttct
   199021 tcctctccgt cgctgtcatt aagcagccag gtcacctcct ccgctccgcg gtccgccggt
   199081 ctcgacggac cgcgccgccg tcggcaacac ggaaaacagc acgccagccc gagccgctaa
   199141 ggccgcatgc ccctgccgcc caactgaaca cgcatacccc gctcaactgc gttttgccac
   199201 ccctgccagt gctctcgctc gagcaccacc ccgtatctcc caaccttttt ccaataaacg
   199261 aaaccgacat gacatacgta atgggtgctc gtggctacat ttattgaaac aaaccgcgat
   199321 cccgggcgtc ttagcacacg aaaaaccgca tccacatcat agacaagtta cagtccacag
   199381 tcacatacac gataaacaat accaacaggg taatgtttat ggagtaaaac actattgtcc
   199441 aggccacatg cgtgtatgac ttccgcacca tcccgtactg catgttccac atgtacgcgc
   199501 tagacgtgta atccactcgc agttcgggga cgcaacgcag ccagatcaca tccccttgca
   199561 gtaccagacg cagggctagc gtctcgaaga tcggcatcac atctaagttc cgcacgttcc
   199621 actttaacga ctccccggga acgaactcca cgtcgtcggc gtgtacgtac aggttctctc
   199681 ccacgccgcc ataatcggcc ttcggatcga agacgaaccg actcatgttg cccacgatgc
   199741 tcccccgagc aaacaacttg ccgttgtcaa tgtagcaccg gttgtcctcg atctcaaacc
   199801 aggggtgctt ggccgtggac ttccagggcc ggagcgcgtc ttccccggct ttagtgatgc
   199861 catcgggcag gcggatcaag ggacccatgg aggtccaaag acccacccag gctttccaga
   199921 gattgttcat ggtgaaacag cgtgtggact gtacgctctt tcccaagtta tatcccagag
   199981 tagtgacgtg agcccagcca cctcccagat tcctgacgtt ttggttagct ttcctgccaa
   200041 ttcctcccgt agacttatga ttctcctagc ccattcccga taaaaataca cggagacagt
   200101 agatagagtt acgaataaac cggtttattt attcaagtgt ctcaggagat tattgaacga
   200161 gcgtggatac cacgccatcg tcagttcatg gtggcattga gcagccatag caccagagtc
   200221 ccggcgcccg gtatcagaca tgctgaccta ccgggcgcct ccgagtccat atcccgcggc
   200281 ctgggtgtta gagtccgtac ctggcagccc aggtaggttt caggtaccag ctggttcgta
   200341 cctgttaaat aaatcgcaga cgggcgctca cccctacggt caggagcaca agaacaacca
   200401 gagagaacag atatacgagc agggttctga acagcagacc ccaattgtcg tctctcatgc
   200461 ttcgctgaag gtaccagttg atggtctgag agctatagtc catcctcacc tggggaacac
   200521 acgcggcata tttcttgggg tctccccacc tcgtagacaa cgtgatgtcc accatatcca
   200581 cggtgtgcga caccgggtac ccaccgatgt tccactcgaa ataggctccg cgctcatcat
   200641 ggtggtactg ctcaccggac acttgcaatc tgtccatgta agattgagag acgataccca
   200701 cgttcacaaa gtgtttcttg gtgaagttgc ccgacatcct ccccttgaag tacagcatgc
   200761 ccatatggaa ccagcattgg ttctcctcca cccgaaagtg ggccgatttg atctccgata
   200821 ccaccacatt caggggccgg ggcaccgagt ccgcgagtct caggaacagg acggccagga
   200881 tcgcgagcac caacaccggc ttcatggctc cgaaggtccg ctgctcggct ccgctcaccg
   200941 ctccggtctg gctgcagcag tgcttcgctg agaagtagcg tgtggactgc acggtgtttt
   201001 tgaatatata gcgtttcttg gtgacgttgt ttcccctacg tagtaggcaa ctacgtgcca
   201061 aaagaggcgt tacggtactt tccgtaccgg gatttccaaa ccgcgacttt ccacacggcg
   201121 gtttcaacac cgggactttt cacacggtga tttcggcacc gggactttcc acacggcggt
   201181 ttcgccaccg ctgacgttct catcgccgcc cacgtcaacg gtggcgacac cgtactttcc
   201241 catgcggttt ataaacgtca agagtcacgt cagtcgccca cccccattac acggcgatat
   201301 cccgataggg catgagggga cccgggtgtc gcgacatgtc gacgacaggt gcggattagt
   201361 ggtcgtgtcg cgacatggac gtgcaggggg atgtctgtcg cgatagagtt gatgtgacag
   201421 cccgctacac ctctctgtcg cgacatgcat acacaacggg ccggcttgtc ggcgattgtc
   201481 gcgacatatc gttatcagtt agcgaccgga gttgtctatc gcgacatatc gtcgactatc
   201541 gcgacagaaa aaataccgtt cgtagagaat gccgtgttga aggaacgcgc ttttattgag
   201601 acgataaaac agcatcagga gccacaacgt cgaatcccac gtccagtcga ttcgtatgtt
   201661 atgctgcaca gcaatgctag aataacaacc agcagggtaa tcccgcaaca taaatacaaa
   201721 gtcacagcga agaatccgtg tcgttctatc aagcgaaacg cgttccaaac ggccccgtca
   201781 cagacgcagt tattcataag cgttaacaac cggtggctag gatgaatatc caaatcacag
   201841 ggcagtagcc gacggactcg ttgacaggtc agcctaccct caaggttcct atcgttcgga
   201901 cgggatttgt gcgttttagg cctctttttc gccgcctgca agcattggtg cgcaaagtcc
   201961 tcacccagct gtttccagct atcatctgca tctgtgcagt cccctgtatc gttgtaacaa
   202021 acgggtctgt gcgactttgt tctcggaaca caagcttgtc gcggagacag agagagaagg
   202081 gttttcgggt cacgcgaaga ccgctcaccg ggggtcggca acgcacacat caacagaaaa
   202141 ccgagacgga tcaagaggtc catagtgaag aaggagcgat atcgacgtac ttacgaaacg
   202201 gcgattatat atgttctcaa caataccgcc ctacgttgta tgatgtaacg tgtgacgtga
   202261 gtctgatcca acactgaacg ctttcgtcgt gtttttcatg cagcttttac ggaccatgac
   202321 aagcctgacg agagcgttca tcggggcatg aagtacgcat tacacaaact ccatatattt
   202381 gttacgatag aatacggaac ggaggaggct ttcgccacac ctatcctgaa agcgttgcat
   202441 tctttatgat aggtgtgacg atgtctttac cattcccacg gctgctttgc gtgatgatga
   202501 cattcatcat gtatttccat tcacacatac cttttgtgca tacggtttat atatgaccat
   202561 ccacgcttat aacgaaccta acagtttatt agcccttgac aggataggtc aaaagattat
   202621 atgtaggttt tccggtaaac cgaattgtga tatttctctg caggaaatag aacagcctgg
   202681 tacctataaa acggacaatg cagtactgta gcagcgtaac caagtaggtc cacatgaaca
   202741 cgtacaaaat tatggtaagc catcgttttt cataccacag cctgtagctg tcgtacatga
   202801 atgaggacgg tcgaggaacc cagggtagtt gtaattgggg gcgacattcg tactgtccag
   202861 aagacaattg cacgggtttc agtgagatga gtactttagc gatgtcggcg ggggcgctac
   202921 gtttcaccgt gacggtgaga acttgaccgt cgttttgtac ttcatgaggc acgttataca
   202981 agccactggt atcatgaagg atgacctctg atgcgatgtg aggattaaat tgtccctcaa
   203041 accgccaaac gctggtcatg tttccaccgt caattacgca gctgacggtg tgagatacca
   203101 cgatgttgga cttaggtttg ggggctaatt gcctttttac aaattccctt ctgtattgca
   203161 ggtcctgctg ccactgcttt tccgtgcgga aagtcgccat gtcttccaca cgtgtggcga
   203221 cgatagacgc caccaaggta gataccagaa gcagctggat ccgcatggta ttaccgtatg
   203281 tcaattagaa agttgagcgg acacggttat cgttcctggc ggatataagt atataaacgc
   203341 gagttagcct ttcccgtccg ttttgtacac ccgttcccca cacaaatgac gaatacgacc
   203401 tttttttttt ataaaaataa accacgtgta ttatagaaaa acatttacat agaaaagaga
   203461 cacacggatc aacataagga cttttcacac ttttggggta cacaggcgtg ccaccgcaga
   203521 tagtaagcgc tggatacacg gtatacagtc ctggccagca cgtatcccaa cagcagcacc
   203581 atcgccatct gtatggcgat cacgaccccg agctctaagt gtctgtattc atagtgtagt
   203641 cgtcgcaggt tatccactga attcccgtaa ctgaaataac gtatatggta ccgaggctgg
   203701 caccacatgg gtttgcattt ggtgcacggc accaaatgca gagtgagatg gtccaagtcc
   203761 gtgggcaccc actggcgcaa acggaatacg gcttcggtgg tctccacgag gcactccggg
   203821 gcgtgcagac ggccccactt tcgtccgcga cggcccgacc agccgacccg agccactatc
   203881 cctttctcgg gatagaacgt accctgtaca cgccacacag cgtccaacac gccgtccttg
   203941 acgacgcagc tggcctgata gctggacacg ttgttaagcg gcggaaagcg aaactgacgt
   204001 gccggcggag ccacatagtt cggttcaccg tgttgtcgcg gttcgtcctc cctatagtaa
   204061 tagtagtcgt cgtcctcata ggggttgccg gcgtgagcca gcgttaccca acagcagccc
   204121 aggccgacga ggaggcgcag ccaccgcctc atggcggctt cgccagtcaa tcgtctttag
   204181 cctcttcttc ccgtgaagtc cttccggtgg cgcggtgccg acctcggacc cagggacgta
   204241 tccacctcag gtacacacag caggctacct ggacaccgaa gctgaacaag gctacgtgtt
   204301 tcacaaactg caccagtacc acatagagga atgtcaggta gcgtctctcc gcaaacagcc
   204361 gttccaagtc tgagggcgtt acccgcagcg gcaaccaggg cagcctggac gccggccggc
   204421 aatggagcac gctccggtta caggcactgc aggggtaaac ggttaacatc acgtaagaga
   204481 gtcgtgcgtc cacctgtggg agctcagttt cgtaacgtag agccccgtca ttttccagct
   204541 ggggtgcgcc gaccttgaaa tgggtcgcgc tccgctcgtt accccaggtg ccgtaggctc
   204601 tcggggccgt atcggagaag ttgccacgca caagccaggc ggccacgagt accccgtgct
   204661 ggacgtaaca ttcggacacg gaactggaga cacggtagcc ggacacgtcc ccaaacccgc
   204721 gagggtactg gggcagacga acggacttgc tatttgacaa cggacagata cgagacgacg
   204781 aggacgcaga cgactcgtcg ctggaccacg acaaccggag cgactccttg gagcggctcg
   204841 agagtacact tactgcgatc agacaccagt gccagaagaa ggaacaggtg gacggggacc
   204901 acaggatcat agccgccggc accgcggccg gccgcaggaa gccgcccggc gcgtcgtctg
   204961 tgtgcgggag ccgaaacacc gtgcctcttt atatcgtccc gacgtgacgc gagtattacg
   205021 tgtcagggga aacccccgtc acgacgaacg tgatttgtaa gtgacgcggg gtgctgacgg
   205081 ggttcggccc gagaggtgac ggagcgcctc acgtcagtat gatgtccgat ccgcgtcagc
   205141 cccgacgtgg ttgtggtcac cgaaacccac gtttatatgg acgttgagag cagcgcctga
   205201 ccacatgatt catcatacca tttctcggaa tcgggcccat gccgggaaag cacattcctt
   205261 ttcagtaaac aacaatgaca tcataacaaa tcattttatt cgcgaggtgg ataataaccg
   205321 catatcagga ggagggatcg ggtgatgacg caggccccgc agaacagtcc gaaataaatt
   205381 tttagtattg ccccatagtc gcctagatac cagaggtacg tcaagttcat caaaacgccc
   205441 atcggcgtcc cggaatcgta taccgggcac acgaagcgtt cataacaatc ccgggaggcg
   205501 agtgttaggg tagcagagta gtttcggggt cggtttcctt ccggcgacga cagttccgtg
   205561 ggcagcagaa tgtacagcgc ctcggtagct gtcgcggtgc cttccacgag gatgggctgc
   205621 cggtgccttt cgtgattttc cccgtcgtgt agccaagccg aggcccgcaa agtcttaggc
   205681 gaggggaatt gtccatagag tttcaccgca cccttcagta catggttctg aataacacag
   205741 ccgcacgtga agtaggtagg ttctctcgtc tcctccgtgg ctgccgccac cactcccagc
   205801 caccacaaca ggcagatcgc cagagggttc cggaggcttc cccggcgtag catggttttg
   205861 ggttaaagca aaaagtctgg tgagtcgttt ccgagcgact cgagatgcac tccgcttcag
   205921 tctatatatc accactggtc cgaaaacatc cagggaaaat gtcggtgcag ccaacctttc
   205981 acatacagcc cccaaaacac ttgaatcact gccaccatca tcagcgtata ctgcgccgac
   206041 ttaatcgtga gcgcgtagta cgccattaga cggcgatctt cgaacaatag tcgttcgatg
   206101 tcctctaacg agctccacag gggaacccaa ggcacgaggc accggggttc gcactctaca
   206161 taataagttt ggcattgatg acagggggaa aagtagaaca acacgagttt tgtgcgttgg
   206221 ggaacacgat agtcccggag ccagtagcgt tttgcgacga ggctttcgga gatgtcctcc
   206281 accggcgtcg gcactcgatc cgcgtagccc tccagcgtct ggtagtacac ccggggtgtc
   206341 ggcgtgggca cggacaggtt cccgcgcagg gtccacagag cctccagtcg accgcccgat
   206401 cggagcacgc agcgcgcctc ggaatactct actcggtact ccgaaacatc gggcagaggc
   206461 ggtaacggct ccgtctccac caagggcgga ggttcatcga aaagagtcaa ggataattca
   206521 ggcatactac ccgcgaccgg ggcccagagg gctagaataa gcattacaag attcattctg
   206581 tcttacaagg gaaggctgtt cccctgtcta gactcaaaag ctgtaaggct atcttatagc
   206641 atgtagtctt gcacgtcacg gggaacaggg tggtgatcta gtgacgtcgg gagaacacgg
   206701 tgttttaggg tgcgggggac aaaggacagt acgacagatt aggtgataga aacgtttttt
   206761 tttatttatg aaaaagccag tgtgccgtgc ggcctagggc cccggcgtag tttggatacc
   206821 agatgggggc cgtcaggggt actaccacga gcagaaacat aatgacttgg tccatatata
   206881 gcagcatagc ggtgcgcagc aggtcgccgt ccgtgtagca atttgacggt gagcgataaa
   206941 gcaccgttaa tgtgtcgcgg ataagcacga tcttgaggcc gtagatgaag ctcacagtca
   207001 gtgctaaaat gatgcgttgg tatggttccc aggactgcac ggcgatgaag agccagagta
   207061 tgggaagcat gaaacttagc aaacagagga tggctaaccg tcgttgcatg ttccaggcca
   207121 tgagccaggc taggcccgta caccagacgc agagcatgga tgacaggaca taggcctgga
   207181 ttaccacggt gcgatcgaaa cacagcccga tggtggacac ggatatcgta gtgagggtgg
   207241 tatataccat gaccagcatc agggtcccgg gtcggcgctg acgttccagc cagtacgcgt
   207301 ggcaacgcag agcacagggt agcagtgtgc tccagaaggg cagtgtatcg cgcaggtagg
   207361 gggttgtcac gcgccacggt atgagcatga aaaggatggt agtggctatg gtggcgctgg
   207421 tctggaacac gacggtgccg tagagacgta ccatccagag aaagtgttga acgctccgca
   207481 gggtgtcttc atctttggtg attacggtga ctcgacggat cggcggtggt gacggcggcg
   207541 acacgggtgg gggtttctct ttcttatggc cgagtggctc gccttggtga aactggatct
   207601 gtaccatgac gggtgctcga cgaacagtcg tcggggcttc aggtacccgg caagttttat
   207661 agagaaaggg ggacgatggg tggtggctac gagccaccgc caccttcgca atacgaggat
   207721 ctgaaggcgg caaagacggt cgtccagggc aggcgccaga ggttgggact gagcacgatc
   207781 agcgtgattt taaacatggt caccagtcct acgtagatca gcagcgagcc gcgtaacgtc
   207841 tgagcagccg gcagttcgtc gcggatgtaa cgcgtgccgt agaaagtcac ggtcatcata
   207901 aggaagacga tggcgccgta gccgtagagt agaatacgct gatgatggaa cacggtctgg
   207961 tcgccgataa cccagagcgt gatgaaaaaa acgctggtga gcacccgtga gcatatgagc
   208021 tcccaacgct tagcgcgaaa actgtcccca accatgacag cgccggtgca agctatccac
   208081 agcgtgagga ccagtgtgta gtcgatgagg atggcgggca ggtcggagca ccaggtgtag
   208141 aaaaccgtgg taacggagag gaggcctacg tagcccatgg tcaataccac gtcgtcgggg
   208201 tgcctttcgc cctgtatcaa gaccaaacac cagagaaggg agggggcaaa aaccagcagc
   208261 agaggggaag attcatgttg acatatgttg tgggaatcgg ggatacccag ccaaatcatt
   208321 ccgcagaaag ccgtactgat ggcgatgtga aagaccacta gggcgtagac ccggacgagg
   208381 acagcaaaac ggcgcagcca cataaggccg tggtgcagct gcaggaggga agcccattgc
   208441 ggcgaatgta gcgacggcag cggcgggtcc atgaggcggg tgatgcgccc gagtgaacgg
   208501 gtgagcgtct cggtggagtc ttcttataaa ccagcgggtc tcaagcaacc ctgctctgga
   208561 acgtcgcggt ggtgctgttg aggatgacgc tgagcgtgcc gttgtcaacc cggtaatgat
   208621 gataggtgcc cagcttggcc aggtagctga acatttggtc ccagcgtgcc gaccacacca
   208681 cgggcgtgag catcaggagt gtggtgtgat agatgagtgt ctcggtggcg taaagtacca
   208741 gcgagctgcg gatgatgtgg ctcacgggca ttttggtggc gatgtagcgc acgtcttgga
   208801 aaaggacggc caggatgcag cccacgaaca cggtgtagag acacagcaga gtcttatgca
   208861 accaggtgta agtagaagcc aggacgctga ccatcaccgt caaaagtgtg gaggtgaaaa
   208921 gcgcgtcacg ccacacagag ctgaggcggt gttcccaagc cacgccgttg caggccacga
   208981 acaacgtcca cgttaggatg aggctggaaa cgccgatggg cgctgtggcg cacaggttga
   209041 gcccggcggt ggtgaacgag agaagcgcca catacagtgc aaacaccagg ccgttgctgg
   209101 ggtgtctgtg gtcggtgagc tccagcgcgc ccagaaccaa caccggtgtg cagctaagca
   209161 atagcggcga gggatcgtcg cggcactcgt agcccagtga ggggtaaccc agccaaacca
   209221 gcgcgctaat gagtacgctg aaagcggttt ccagcgtcag caatccgtag acacgcatga
   209281 cgatcgcggt ccgacgtagc caacacaccg catcttcgga agctgtggac gctgtttccg
   209341 aataccggga ggagatcgtg cttccctctt ccaaggatcg gaaagtagcg tccgtcgttt
   209401 ccgcggacgc ggcttccctg gtacgctccg tttccgacga cgcggtttcc cgctgcgtgg
   209461 aaactgtctc catgtcggga ccgcagcgcc cggcggcgta tccgcaaggt ctcgaagcta
   209521 cagcttgtca gaggaaaagt aggtttgcaa aaaggtgcgc agggtcatga ttctcagcac
   209581 catcagcaga gtgaaaacca ggctgagaaa caccttgacg gccgccaaaa gcgcgcgttc
   209641 cagcggcgtc tcgtagcgta cagccagggc cgcttcgtgg aaatgcgaga cggctagaca
   209701 ggtaatgagc acgctgaagg acaagacgat cttaaagcac caggaccaac cacgcctcaa
   209761 gatgaccacc acgattgccg tgaaggtcaa cgtgatcaaa gcatggatga ccacgatctg
   209821 acggcggacg gtacgttcgg gagccaacaa cgctacgccg gtgcagctga gaaaggccag
   209881 taaggtgaac aacgcggccg agatgaccaa cgtaccgtcc aggcagagac atattacgat
   209941 caacggcggc acgtgaagca gcgtgtaaaa gagcagaacg ccgatattgc tgggatgcga
   210001 tgtttcgtaa cagtgaatga agatcaccga cgtgacgggt atgacaaaga cgaggctggg
   210061 cgaggactcc gtgagacaca gacgggaatg gtgaaaccac gtcgcgggcg ccgcgtagca
   210121 gaaggcgctc aacaacgcgg tcaagccggc cagctgccaa cccacggcgc cataggtgtg
   210181 cagcgccacg cggcaacagt cgacccaagc cagactgcgg gtcgccagcc gggtctcttg
   210241 gatcccgggg ggcacgtaga tgaccgtgcc atcggtgggt acttgaaacc ctttttctct
   210301 tctcatggtg cgctgcgttc tctggaaacg gctgctctgt ccgaaaacca gttccgaacg
   210361 aaaatctagg gcgagagggt ggacaacggc gttgacgacg aagcatggga caggtcgttc
   210421 ggcgttaacg tcatcgcgtc ggacgacggt agttctaaga gacgtagatc gctcagcagg
   210481 tcctgacagt tgcggattcg caagatcaga aaaaaaaggg aaatgaacgt aataaagagc
   210541 tgtagcgacg tatgcgccac atcgcgtggc ataagaacgt gacggacgaa aaggacctgc
   210601 tgcgaaaagt ggccggcgaa gataaggccc accgtgctgt agaagcccaa aagcagccgc
   210661 aggggccaag tccagggccg cgtgaagacg atgagaacgt tagccagaaa gaccacgacc
   210721 cagacgccgt tgatgagggc aaattgatcg gacagggtgc agttgtcgcg acagatgaag
   210781 actacttccg cgcagagcaa ggtgatgacc aacgtgagca caaacgacgt caacacctcg
   210841 cggggctcct ggcaggcaca cgtgacacct agcgccggga tgtgcgccag gaggccggcg
   210901 agtaatagca ccagctgtcg gaacggacga cggcagcgcg ggtgccggtt tcgctgagcg
   210961 agaaccggtc gctcatagcg gaaatacacg aagagcgcgg aggccacagg caccaggagg
   211021 agcacctcgg gcgcccagac aacgtgacaa ggaaagcccg gacgcgactt gagagtcgct
   211081 gtagggaaga ccagagagaa gctacccaag acggccaccg ccgtggagat ttggaagagg
   211141 agcaagccgg cgattcggac gacaacctcg aagcgatgca cccagcccag cacggccacc
   211201 acggccgctt catcatagtc gtcgttgttg ccgctgtcga acagccgccg aaacacgatc
   211261 tgtcgctggg tcgcggtggg aaagcgcaga cccatgacag ccggaggcta tatgaccgcg
   211321 cgtctaagac gcgagatccg tggggggact tttagatgtt tgggcggccc gcggttctaa
   211381 caggcttgat tggtggagac ggccggcgcg gcgggtgggg gaaacgacga gtttttccgt
   211441 tacgccatgg ttcgcgtgag gtttctctgt acctcccgca aaaggtcaca gcccgaaatg
   211501 gaggccgcgt tggtggcccc ggtggcgcgt gacgataacc aggtcatcca agcgatgagt
   211561 ttgtctaatg agtcctcggt ggtgaaaagg atgagaatga gcaggtacag gtacaccagg
   211621 ttctcataga gacacaaggt gagcaggtcg gcctcggacc acgcgatctc aaacaggcgc
   211681 gtggtgtcaa agaccgtgac gaccagcatg aagctgagcg ccatggcgta atagcccaaa
   211741 aaaagtttgt gccccaacgg tacgggctgc aggtaaagtg cgatcaagaa cgcgataacg
   211801 ccgatcacaa acagcgtgac gatgacctgc catcgacggt gattatggcc ggctagaccc
   211861 gtgacgcagc tgcagaggct aaaaagcacg caagccaaga ggcccgagaa ggtcaccagc
   211921 gtagaggagg agcaggcgct ggccacgatc accgaaagcg tcgtgagcac gctataaatg
   211981 gtgagcaggc ccgggctcgg cggcgacgtg aacgatcctt catcgcgttt gccgtgcagc
   212041 agggccaaac agatggtggg caccatcaaa ctcaagggcg gcataaagcc ggtgcaacag
   212101 agaaagacgg tgcctttaag atgcggaaaa gccagcacca ggcccagaca gagcaagaag
   212161 gtgcaggtgc cctgcacggc cacggtgctg tagacccgca tacaaagtaa aaagcgacgt
   212221 acgtcgttcg tcgagacgga ggaaatcata atgactccgc gcgagggtcg cgggggtggg
   212281 ggcgcccagg ccgtcccggt ggcctctgag ttcggagaca tgacggcggt ggctatcaaa
   212341 aggcgcgtat gagaaaccgt ttatagagtg taatataatc accgtcattc ccacacggcg
   212401 ttcccccata aagtcacgtc acactcgagt aagcgtgaaa aagctttatt gttgaataaa
   212461 aaacacgagt acaacaccga gttgcggtgt tctgtctgtc tactgggtgg gggaggttca
   212521 tcgtctgtct ctagagggaa ggtggggaac gtctaagcga gcgggagcgt gtcatctccc
   212581 ccatcttttt acaacaagct gaggagactc acgccgtcga tgcgtccgcc gtgtttctcg
   212641 gcgtactgct gcacccagac gtggccgcta aagatggcga cgctcatgtt taggagactc
   212701 atgacgatgg tgtacaacac gacgctgaca cagacgctgt ttttagacaa cgttccacgc
   212761 tggtagatga gatccagggt ctcgtaaata agcacggccg aagcggcggt caccaccagg
   212821 acgtagagtc cgctgtagat cttgctgacc cacagcacgg gcgaaaagta aagcaatagg
   212881 taaaagacga tgacggacca gccgtagcca atcccgatga ctttccagcg cgtgggattg
   212941 ttgccggcca ggtaggtgag accgctgcag agaacgaaaa agaccatcac cagggcaaac
   213001 gacagaccga tgacgcgcct ttctccgcaa aagcccgtgc acacggtgat gccggtgttg
   213061 atcagcaagc acgccactgt gagatgagca aaattggtgg tgtgtgggcg aaactcggcg
   213121 aaaccgcgta gcatagccag cgtggacacg ggtacgatgg aggatagggc tggcactatg
   213181 ccgttggcgc actgtccctg cacatcgggg aaggcgagcc aagccagcaa gcagaccgtg
   213241 agggtacaag ccagctgcca cacgagcccg tgatagacct ccatgagcag cttaaagcgt
   213301 ttcaaccatt ggaagagctg ctgttcggcc accagcgcgt ggctgcgatg gagcggcacg
   213361 atggtgaccg tcggcgactc atggtgttcg gaaaccgagg cggtgtcgcc catgctgccg
   213421 cttacgaccg ctgtcggtct aaggtaggcg tcgatgaaac agtccgtctt atcagcaccc
   213481 ggttaccgcg gatttgattg acgtcacgag tgtggtcaaa ccgtggcggc accctgtatc
   213541 cgacccgtcg tcatgggctc cacaaccaga gcctcagaag atggtacatg ccgatgaata
   213601 aagccacatt ttcgacatag aggcgtagcg agggctgaaa actctccggg aaagaactct
   213661 gacaggtgat cagggacaga tcgtgaatta gcatcagcgt caccgtcaac agcgtcgtcg
   213721 cgtgtaaacc gagaaagaac ggggccgcgg cccgcagcag ccaaagtccc agcgccgtag
   213781 cgcagagcag agacaggacc gacggtagcc acagccgccg gagagacgcg ccaggatcgc
   213841 aacccaaaag cgaggccccc aggcagctga gatctaccgc cagggcgaga agagccgcgc
   213901 cgacaaaggc ctgcggcgac ggctggcaca tcagcaaggt cagaaaggct agcgcgtgcg
   213961 gcaggcagta agccaacagg agtgggagtt tgcggggaca acggtcgatc gacggaccgc
   214021 gtagcagcag gaacaggcag ccgacgggca cgacgaggct gagatgagaa agcgacggtg
   214081 ggtcgtcgtc ccgtccccgc tcgcatagct cggccaccgg tggcggcatg agccaccagc
   214141 tgagcacgct gagggcgacg gtggcggtaa gctggaaggc gacgaggacg gaggcgcgca
   214201 gccataccgc cagcctctct aggtagggga ctacctcctc gacggtccat tctagcggga
   214261 cgacatgaag catggcgaca agcgcggctg ctgtgaaaac gggcgcggtt ttataggcat
   214321 taggacttcc ccgtcgtact ggcggctgtc aaagtcccgt tgtccaaagg cgcgccgtcc
   214381 gaaagactaa tccaacgggg acccgagagc atgagcaaca acgtgagaaa gatggccatg
   214441 ctgtccaggt agagacagac ggcgtgacgg atgcattggt taggtgggca gaaaaagatg
   214501 accatgagac tgtcgtaggc cagaataccc aaaaagaagc tgatagagaa ggcgcacaac
   214561 gtcaccacta tcttctgcag ccaatcggcg tcgcttagca gagcgagcgt gaggaacgaa
   214621 agcagcatca ccacgtagac gcagctgatg catttccagc gacgtcggtc acggccacct
   214681 agaaacgcca gccccgtaaa ggagataaac aacgccaggg tcatcacgta ggaacctact
   214741 agtacgcggc tttcagagca catttggaag atggccgccg tcaggctgtt ggccaacaga
   214801 tagatgaaaa gcaccgtggc gttactaggg tgttcgttgc ccaacgtgta cgtgatgaac
   214861 atgcagacga tgggcacgag cacggtgaga aagaagctgt agttctcgac gcaaaagttg
   214921 cggttttgtg ggaaccccaa ccaaaaaacg cttcccaagc cgaagctgaa agccagctga
   214981 aagatgaaga tggcgtacac gcgcagccat acggtgaact ttttgaacca ctcgagagcc
   215041 tccatgcggg agagcagcag cgcgttagcc tcctgcgcct gcatggtggc gacggtctcg
   215101 gcacaaagcc gctgcggcgc acctaccctt ctcttataca caagcgagcg agtggggcac
   215161 ggtgacgtgg tcacgccgcg gacacgtcga ttaggagacg aactggggcg acgccgctgc
   215221 tgtggcagcg accgtcgcag cgaccgtcgt ctgagcagtg tgggcgctgc cgggctcgga
   215281 aggcatgaag tagagcacgg agacaaagag gtacatgagg tccatgtaca agcagagcgc
   215341 gcccgggata taactctcat actcgatgtc gtgcaggatg tcctgcgtat cgcacaccac
   215401 cgaggtcacg atgacggcca aaccggctat catcaccagg atctcactta ccgcctcggg
   215461 aaaaagagaa aatacggcga atagtaagag aatcagcgtg gatgcgcccg tcaataggga
   215521 acgctgtaat tccacgtcgc gggcaaacag atacgtagcg agcgtgagga aacaaaatag
   215581 cgtcactgtg gccaccatgg cataaatgac tgaacgatga ctaaagtgga agcctgacgc
   215641 cgtgacagcc acgctggtaa gcaacgtgta cgtcagtaag atccatacgt ttttgggaaa
   215701 gttgggctcg gcccaacgca acagacctag gcacacgatg gagatcatta agcaagacag
   215761 cgtcagacgc acgctggaaa agagctgctc cagccggtgc ggcaacacca gccagcaaaa
   215821 ggcgcagacg ctcataagga tgaggcattg cacccagata aggatgtaga tgcgcaacag
   215881 gaagaccgac cgggctatct ggacctgacc gcggagcgac atggcggcaa cgccggcggt
   215941 tatcgccgag attcgtctaa atacacgaag cgaactagaa aacgcacaca cgtgatttgc
   216001 aaaaagaaag cagctgccgg cttattattt tattaaaaat ttatctgtgc agaatcataa
   216061 gtttatgatg aataaaaacg gggaaaggga atctgctttt agggacccgg gtctggtccg
   216121 tcgtctccca tctggtcggg ttcggggatg gggacctgtt tcagcgtgtg tccgcgggcg
   216181 tgcatggctt ttgctcgccg gccgcgctgt aaccaggcct ctttctctgt ggtcggcgag
   216241 tcttccgacg ggtagggagc ctgggagtcc atcgcttcag gcccaccgct cgttccctcg
   216301 accgtcgtgt cgtcctcgtt ttcgctatta cacggggttt ctggagtatc gcctatacgg
   216361 ttggcaattc tccgggggcg gccgctttcg tcctcgtcgc tgctatcgcc gcccggtaat
   216421 tcgacgccgc attcgttgta cggagcgcgg cacatgggcg gcggaaagaa cttgggcatg
   216481 cgaaagcagc gttgtccatc cacggtctgc gtggtttcat cgttatcctc ccataatccc
   216541 ccctgtagcg ccggcagcgt ttcgacgctg tgagagggga aggcccagtt ctggttgtct
   216601 tgcagcgcgc ccgtgggcag taggtccgtg cggccccagg cgctgctgtt gttgggtacc
   216661 ttgtcagtgc cgcgagtagg tcgcagaaac cagtccagag cgctctctag ctgcgagcgt
   216721 gtgatggtgc ccagtgcgcc gtgccagcgc agcacgtctc ttttcagcgt gtggtgacag
   216781 acgggcagct cctccaaccg acactcgccg cgcaatccgc ggtcgaagcg gcagagacca
   216841 cgcagtttaa gcagaccgca cttgagaaac atgtgaaaat tatcggcaat gcgatacagg
   216901 tctgagtcct cgatcttgtg taggtagacc acgccaaact tgtcgagcag caccatgccg
   216961 ctgggcacaa aaggcccgta tgccaggtaa tagcccacga ggccgacgac gtaccactcg
   217021 cagcacaagc gttgacgaat aaagttcaaa agatcgcgaa agtccgcggc cggcatgtgg
   217081 tcaaaaggcc ggcaggcgcg caggccctcg atggagccca gcatgagcaa cggctccacc
   217141 tcggtgcgac ccggcgtgcg gatgaccagg ttgagaccgt tcatttcgcg ggccgtcttg
   217201 gccacggccg cagcgtcagt ggggtcggtg cagaggaatt tttgcacatg atagcgcggt
   217261 tcggtggtgg cgaacggcgt ttgtgggtgc cgatacacat attcgcacca gagtaggccg
   217321 ttcttggaaa aggctttgat atcactggcc acctcgtaga gcccgtcggt ctcccagtcg
   217381 tagacgtaga cggtgccgta atgacttagc atgagcacgc agggcagttc ctgcgcctgc
   217441 ttggtgtttc gtgttagatc gctgtcgggt ggacgtacgg ctagtacacc gacggcttcc
   217501 agggtgtcat cgcagcagag atagtcggcg gccagagaac gtgcgtaaat ctgcgggata
   217561 gcggcctgtt cgcgcatcac taggaaccag ttggcggggt tgcgcagtgc tacggtggtt
   217621 ccctggtggc gctgcacgta ggttctcagc gccggaggat cgtactggcg cagatagagg
   217681 ccttgcagca tcgataacgt cttttgaaag acggtgtttc taaattggaa aacgccgtag
   217741 tcgcagcgga tagcatcttc gcagcgctcg tcgcgctgtc ggagataggt gccccaggct
   217801 tcggcggcgg ctttggtgag tagggacatg ccggcaaagc cgtctcgaca gcgagtcgga
   217861 taaagcgcgc tgcgcgaaag cttaatatag gagcagcgtc agacgaatcg cggctggtgg
   217921 cccagggggt gggacgcgcc gcctacacaa agtgctcccg aaaatcgaaa ctcttgaccc
   217981 actccggaga caaatccgta ttcagattga tgcgtcgcgc ttccacttcg gcttccgaaa
   218041 cctcggcctc cgtccggtag gcgttaacga tacgctgacc caggtgccaa cgttctttct
   218101 ctgccaaacg ccgttgctca aaccattcgt ctacgtcctt gaggtcaaag acagtgtcct
   218161 cctcaaggtc aaagcctagg tcttcccact cgtcgtcatc gctctcgtgg ccggcggcca
   218221 tacgcgcggc aaccgcgtct tcccctcctc ttctatcaac gttgggtacc acgttgtttt
   218281 cttcgggttc cataggttct gcgccactgt cgtcatcatc ctctccctgc tcctcatcgt
   218341 ccgccaaggc gtcgtggatc acctccaggt tctgattgtc gggtacgacg tggttatctt
   218401 cgtcgtcgtc gcgtggcatg ggcggcggcc gacggcggac gaccggcatg gcgcggccgt
   218461 cgtttccttc gtcttcctct tctccgtctc ccagggaacg cggtcgacgg cgttccgcga
   218521 agtcgccgcg gaccacgcgc gcctgccaga tggtaaacgc gtcccaacca tcccagttat
   218581 ttagcatttc ggcgcggaaa cggtcgcctc gacagagcca gcgaaactgc cgcgcgtagt
   218641 cgcggtctac gccgctgtcg aacatggtaa agtgaagacg cgccgcctcg cccatgtgta
   218701 cgcagcctcc gttgcgttcc agcctggccg cgcgccgcag accgtgttcg tagcggcgac
   218761 gcacgtacac cttcatgagg ccggcgcgaa agagttcctc taggctgtcg gccagacggt
   218821 agatttcacc ggctagacgc tgcaggggcg gcgagcggtc caggtgcgac ttgacgatta
   218881 ccacgtaaaa acgacagaaa cggtcgaaga tgatgaggaa tgacgtgtca aaaaaaccac
   218941 cggcgcggta ggagcccacg gcgcccagca ggtaccagcg gcaacgcagt tgcagcgtga
   219001 cgtacatttc gcactcggcc aagcgggcgg ctggcgctac ctcgaagggc cagcagtccg
   219061 tcaagcagcc gaaactggtc aggagtttca acgttttggc atggcgtcca ggtgtatgaa
   219121 agttcacgtc gcgtccgtgg tgttcgccaa cgcaggcggc caacgcgtcg gtgtcatgac
   219181 cgtgacgcag cagcatcgct accacgtcgt gcggtacccg cgtagcaaac ggcgtctgtg
   219241 gctgacggta tacggcttcg gtgtacatca taccgtaacg cgccagttcg tccagatgac
   219301 gcgcgcacag cagcagaatc tcttgcgagg gttcgtagat gtagaggcgc gtaccgccac
   219361 ccatgcagag caccagctcc gtctcttcat agtgatcgtc caccatgatc acgcatttgc
   219421 ctagcacgat aaggcgttcg gggcaacaaa ttacgtcgtc cagcagttgg tcgcgcagct
   219481 ccggcatggt gctgccgggc cgcacctgca ggaaccagtt gtgcggaatg ccgagcgaca
   219541 acacctggtc gacgtggtta cggacccagt cgcgaagcac gtcggcgctg tactggcact
   219601 caaagatgcc ctgaaagtcg cccatgaccc gcagaaaagt ttcgtagcgc gtgtggcaat
   219661 agaggaattc atcgtttcgc gtaaacgtgg gagctccgtc ttcccagcgt gtacgccaca
   219721 tgtcaaaaga ggccgccagc tagacacccc agaaaagaag cagagaaaga gagttctttg
   219781 tgcgacacgt tttattccgc gtcctccgct cgacgctcaa atctggatgt actcgcgcac
   219841 acccgtcagg ctctttaagg gaaaagggtc cgagtacgtc actaaccgcg actgatgcac
   219901 cagggcggta atcacccgct ctgcgccctc gcgcgtcgac gaacgcgtcg tcaccaggca
   219961 gtgcagccgc gggcccgtat cgtcctgatg accagcggcc tcgcgctcgg ctgcttccac
   220021 accgacaatg tcgggatcca acacgtagct ctgcgagttg gtgtcgtagc ggtgtagcac
   220081 caacgtgttg gggtccagac gctcccacgc gccctcgtgc gggtcaaaac gctccgttaa
   220141 acagagccag tcatactgct gctgcagaat acgccgctcg cgctcgcgtc gctcatcggg
   220201 caacgcggcg tcttcgttga agagaatgtc ccgcttgtgg tctacggcac gctcgtggtg
   220261 gtgcgggcac agatgacggt gttccatacg cgtctgacgt tgacgctcgc gctcaaaacg
   220321 ccggtgtcga aagaccattt tcagcaaccc catgcggaaa aactccgtga tggtgttggc
   220381 aacgcgccgc acgtagtggt tggggtcgtc catctggatg gcgtacacgg caccgaacca
   220441 gtccaacagt accagcactt cggccacaaa actgcgtccc ggccgcggac gtcccgtcac
   220501 gcctagcaca taccacggcg tggccagatt agcacggaca gcccaccacc aacgacggct
   220561 ctccacctcg gtgagcgcac aaaagggcca aatgcggtgt aactgctgca ccgttttcat
   220621 cagccgcata atcaccgtgc cgtaacccgg tgtatgcaac ttcacgtcgc aacccaggat
   220681 tcgttcggcc gtggcgtacg agccctcagg cgttgtgtca ttgagaaaca aaacatgcat
   220741 ggtacgcgcg cccttagggt atcgtcgcgg aacaggtacc gtcattctcc gcagagtggt
   220801 gtgaatcacg tcgcgatacg caatctccga acgtgacaca ccgtaacgtg ccagttcgtc
   220861 caggttgtgc gataccaaca ccatgtactt ttcacgagtg tcgtaggcgt agacgcgaga
   220921 aaagcgaccc ataaaaacca cgtacggggt agccaccatg ccatcatggt gatcgcgacg
   220981 tggctcgggc aacaaaataa cagcgtatcc caacggcgtc agcggctcgc ggcaacagat
   221041 gagctttgac gccgcctgtt tggcggcggt aatgattccg tcctccgtac gtaacatcac
   221101 atgccagccc ttggggggac ccaaggacag acagcgtccc tcgttacgat gaacgtaacg
   221161 cgtgatttcc attggctcca ggcaaaagaa cagttcctta aaatcccgca acacttgtcg
   221221 gtataacgcc atgggatcct cagccgccac aggcagcgcg gggagctccg gcggcacaac
   221281 tgcagcgccg tcagggccag aacccgcagc cggatccatc attgcgcgac actctcagcc
   221341 ggacaaccgg cgtcactgac agaagccgag ccaaatacag agaaagcaac gctacaccgt
   221401 caccccgctc ccaagcgccg cggaaagtgc tccgattttt caccgtcgtt cgcgacgttg
   221461 atttgcctcg gtctgagaac cgacctagcg ttcggaccgg tgcgcagaaa cagccggcgg
   221521 tccgagccac tgagcggttc acagccccgg ccgccgatag ttaccggaga gacgttcgag
   221581 ctgcaggtac atcggcgctc cccgctccgc caccccgcgc ccgccccagt ttatactctc
   221641 cgacgccccg tccaacgcgc ctgtggaggg ccaatcggac cgcgggagct ctccaagtgg
   221701 atgacaggca cagccgggtg cccgaccgtg aagagccctc atccacctga acagaccgct
   221761 aaccgaagga ccccgaatcg cgtccgtcgg tcccgacgtc cgtcgccatc tggttccctg
   221821 ctgttggcta cctctcggat ttcaaaaaag agcacgtgcc gatgacggtg cacaggaaag
   221881 agccaaagtg tcacggcgtc tttttttatt tgtgttcctt tcctgttttg tactcgtaaa
   221941 ctgttgacgt tgtttttaca tccaaaaggg caagtaagaa acaggatgag gcatggtagg
   222001 tttgggcgtg gggcggccct ccagcacggc ggcccgggcc gcccggcggg tgagcacccg
   222061 gcgttgcgcc gtatctatct tgtgtttctt ctgtgtcttt ttcctatctt gttccgcgac
   222121 ggcctctttc atcacgttca gcatgcgttc ctcgacgccc tccagggatc ctggggagga
   222181 gggagtccta gtgaggcttc caatgttgtt ttgtggattt tcggtttcct tttcttggtc
   222241 gtcatcgtcg gacgtgtcgt cttcctcttg atcctcttct tcgtccgagt agtagacgca
   222301 tagtccctgg ttcatcaggc tgggattcat caggttctga cggggaatcc gctgttgtag
   222361 acgtttaacc gcccgttcca ggcgagagct catgccgcac cagacgctgt aacgccgcac
   222421 gggcccgtag cgggctgttt gttcgcgtac atgatcgttg agctcttgcc aatattgttt
   222481 ggcacactcc agatcggagg tttgtggata gtcgggtcgg atccgcggat cccaactgac
   222541 atcggcggtg ccagagactt cgtccagact gttacgcata gagcaccagt cgggtcggac
   222601 gataaacctg tccttgcgga ttaaccattt ataacgtagt tcgtgatggc gtgtagaggc
   222661 ccgtacacgc tccacggtcc caaagcggtc ccagaaggga aagttttcgt gagggcagcg
   222721 acccggcact tccagacgtt cggcgtcgtc cacggcgtag tgaaaacgcc ggccggcctg
   222781 gtaaattttg agcagaccca cggttaacaa catatccacg ctgtcagcca accgccagat
   222841 ctcgcgtcga gacacgtcaa aatagaaaaa ttcacaggct cggtcgacca ggatcacgaa
   222901 atcggcgtga aagacgccgg agggtagcga ctcgcccacc acacccatta tcatggtttc
   222961 gcagcataag cggtccacaa agaacttcaa caggtcgttg aattgctccg tctccataca
   223021 gatgaagggc cagacgcctt tgaggttctc ggcctggccg cagagcagca acggacgcgt
   223081 catctcgcct ggagtgcgca gaggcacgca ttcgccgcga taacgacagg tcacacgctg
   223141 cagttcgctg atgctgttgt cgtgcaggcg aaggtcgcag ataatatgat ccggttgcgt
   223201 ggttagcagc ggcgtgcgca tctgctcgcc gtagatggcc tcgcagtgca acagtccgtg
   223261 tcgcgcaaaa tcatccagac tgtgcgccag gtagtaaagc accccgcaat cgcggtctaa
   223321 acaccacacg gtttcgtaac gtcctagcag gagcaccaga cgggcctggc taggtggctc
   223381 aatttcctct acatatacga aaaagtcgtc atcgtccgag tcctcgtcct cagaagagga
   223441 ccgcggcccg tgtactctgg gcaacacggt ggtagagaac tgcaggacgc ccagagactc
   223501 gagcgactct tcgcagcaga tgagctgacc ccagggcgtt tcgggcccgt cggtgacagc
   223561 cgcgctgcca aagatgtcct caaactctac aaaatctaga cgccatccgg gtggcgctga
   223621 aacgggaagg ctaatgttca tatcagcata gctacgaact aagtggcgga tgtcctgccg
   223681 caagtcttgg cagagaatga gctttcgtaa acccttgagg gtcctccgaa caacggcccc
   223741 agacgcgtag cgataggact ggcgcatggt gccgcggcgt ggagcggcac ttggcagcct
   223801 attttatgga gtttcttcag tgacgtggct tgttcacgtc gttcgtgggc tgcggttggc
   223861 agctccggtc tgtaaaccac ccgaaaagac tgacatcgac gtcaaagact cacgtaattt
   223921 ggaacatgtg cgaccgcaaa gtgcgtcaga atagcacgtg gctttaggac ataaaaagta
   223981 ccgtgaggtc tagacgtggt ttttgtgatt gacacttaca ccaggtaagc caagggacgg
   224041 tgaaactgta tgtgaggaac ctgggtgctt agacaactaa cgtgtaatgc tttttacagg
   224101 accgttcaac aggtgatact acctgcaagg taatgactac atctactaca actaccacta
   224161 atatcatgct acaggtgagc aacgtaacga atcacacctt gaatagcacc gaaatttatc
   224221 agttgttcga gtacactcgg ttcggggtat ggttgatgtg catcgtgggc acgtttctga
   224281 acatgctggt gattaccacc atcctgtact accgtcgtaa gaaaaaatct ccgagcgata
   224341 cctacatctg caacctggct gtagccgatc tgttgattgt cgtcggcctg ccgttttttc
   224401 tagaatatgc caagcatcac cccaaactca gccgagaggt ggtttgttcg ggactcaacg
   224461 cttgtttcta catctgtctt tttgccggcg tttgttttct catcaacctg tcgatggatc
   224521 gctattgcgt cattgtctgg ggtgtagaat tgaaccgcgt tcgaaataac aagcgggcta
   224581 cctgttgggt ggtgattttt tggatactgg ccgcgctcat ggggatgcca cactacctga
   224641 tgtacagtca taccaataac gagtgtgttg gtgaatttgc taacgagact tcaggttggt
   224701 tccccgtctt tttgaacacc aaagtcaaca tttgcggcta cctggcgccc atcgtgctga
   224761 tggcgtacac gtacaaccgt atggtgcggt ttatcattaa ctacgtgggt aaatggcaca
   224821 tgcagacgct ccacgttctt ttagttgtgg ttgtatcttt tgccagcttt tggttcccct
   224881 tcaatctggc actattttta gaatccatcc gtcttttatc gggaacgcaa aacgagactc
   224941 tccaaaccgt tattactttc tgtctatacg tcggtcagtt tttggcctac gttcgcgctt
   225001 gtctgaatcc tgggatctac atcctagtag gcactcaaat gaggaaggac atgtggacaa
   225061 ccctaagggt attcgcctgt tgctgcgtga agcaggagat accttaccag gacattgata
   225121 ttgagctaca aaaggacata caaagaaggg ccaaacacac caaacgtacc cattatgaca
   225181 gaaaacatgc acctatggag tccggggagg aggaatttct gttgtaattc gatcctctct
   225241 cacgcgtccg ccgcacatct atttttgcta attgcacgtt tcttcgtggt cacgtcggct
   225301 cgaagaggtt ggtgtgaaaa cgtcatctcg ccgacgtggt gaaccgctca tatagaccaa
   225361 accggacgct gcctcagtct ctcggtgcgt ggaccagacg gcgtccatgc accgagggca
   225421 gaactggtgc tatcatgaca ccgacgacga cgaccgcgga actcacgacg gagtttgact
   225481 acgatgaaga cgcgactcct tgtgttttca ccgacgtgct taatcagtca aagccagtta
   225541 cgttgtttct gtacggcgtt gtctttctct tcggttccat cggcaacttc ttggtgatct
   225601 tcaccatcac ctggcgacgt cggattcaat gctccggcga tgtttacttt atcaacctcg
   225661 cggccgccga tttgcttttc gtttgtacac tacctctgtg gatgcaatac ctcctagatc
   225721 acaactccct agccagcgtg ccgtgtacgt tactcactgc ctgtttctac gtggctatgt
   225781 ttgccagttt gtgttttatc acggagattg cactcgatcg ctactacgct attgtttaca
   225841 tgagatatcg gcctgtaaaa caggcctgcc ttttcagtat tttttggtgg atctttgccg
   225901 tgatcatcgc cattccacac tttatggtgg tgaccaaaaa agacaatcaa tgtatgaccg
   225961 actacgacta cttagaggtc agttacccga tcatcctcaa cgtagaactc atgctcggtg
   226021 ctttcgtgat cccgctcagc gtcatcagct attgctacta ccgcatttcc agaatcgttg
   226081 cggtgtctca atcgcgccac aaaggtcgca ttgtacgggt acttatagcg gtcgtgcttg
   226141 tctttatcat cttttggctg ccgtaccacc tgacgctgtt tgtggacacg ttaaaactcc
   226201 tcaaatggat ctccagcagc tgcgagttcg aaagatcgct caaacgtgcg cttatcttga
   226261 ccgagtcgct cgccttttgt cactgttgtc tcaatccgct gctgtacgtc ttcgtgggca
   226321 ccaagtttcg gcaagaactg cactgtctgc ttgccgagtt tcgccagcga ctcttttccc
   226381 gcgatgtatc ctggtaccac agcatgagct tttcgcgtcg gggctcgccg agtcgaagag
   226441 agacatcttc cgacacgctg tccgacgagg tgtgtcgcgt ctcacaaatt ataccgtaat
   226501 aaaaaagcgc tacctcggcc ttttcataca aaccccgtgt ccgcccctct tttccccgtg
   226561 cccgatatac acgatattaa acccacgacc atttccgtgc gattagcgaa ccggaaaagt
   226621 ttatggggaa aaagacgtag gaaaggatca tgtagaaaaa catgcggtgt ttccgatggt
   226681 ggctctacag tgggtggtgg tggctcacgt ttggatgtgc tcggaccgtg acggtgggtt
   226741 tcgtcgcgcc cacggtccgg gcacaatcaa ccgtggtccg ctctgagccg gctccgccgt
   226801 cggaaacccg acgagacaac aatgacacgt cttacttcag cagcacctct ttccattctt
   226861 ccgtgtcccc tgccacctca gtggaccgtc aatttcgacg gaccacgtac gaccgttggg
   226921 acggtcgacg ttggctgcgt acccgctacg ggaacgccag cgcctgcgtg acgggcaccc
   226981 aatggagcac caactttttt ttctctcagt gtgagcacta tcctagtttc gtgaaactca
   227041 acggggtgca gcgctggaca cctgttcgga gacctatggg cgaggttgcc tactacgggg
   227101 gttgttgtat ggtgggcggg ggtaatcgtg cgtacgtgat actcgtgagc ggttacggga
   227161 ccgccagcta cggcaacgct ttacgcgtgg attttgggcg cggcaactgc acggcgccaa
   227221 aacgcaccta ccctcggcgc ttagaactgc acgatggccg cacagaccct agccgttgcg
   227281 atccctacca agtgtatttc tacggtctac agtgtcctga gcaactggtt atcaccgccc
   227341 acggcggcgt gggtatgcgc cgctgcccta ccggctctcg tcccaccccg tcccggcccc
   227401 accggcatga cttggagaac gagctacatg gtctgtgtgt ggatcttctg gtgtgcgtcc
   227461 ttttattagc tctgctgctg ttggagctcg ttcccatgga agccgtgcgt cacccgctgc
   227521 ttttctggcg acgcgtggcg ttatcgccgt ccacttccaa ggtggatcgc gccgtcaagc
   227581 tgtgtcttcg gcgcatgttg ggtctgccgc cgccaccgtc agtcgcacca cctggggaaa
   227641 agaaggagct accggctcag gcggccttgt cgccgccact gaccacctgg tcactaccgc
   227701 cgtttccgtc cacgcggata cctgacagtc cgccgccacc gtaccagctt cgtcacgcca
   227761 cgtcactagt gacggtaccc acgctgctgt tatatacgtc atccgacatc ggtgacacag
   227821 cttcagaaac aacgtgtgtg gcgcacgcta cttatgggga acccccggag cccgctcgat
   227881 cgacggctac ggttcaggaa tgtaccgttc ttaccgcccc gaattgcggc atcgtcaaca
   227941 acgacggcgc ggtctctgaa ggccaagacc atggagatgc ggttcaccat agcctggatg
   228001 tggtttccca gtgtgctgct gatactgggg ttgttgacac ctccgagtaa cgggtgcacc
   228061 gtcgatgttg gacgaaacgt atccattcga gaacagtgcc gccttcgaaa cggtgcgacg
   228121 ttctccaagg gagacatcga aggtaacttc agtgggcccg tcgtcgtgga gttggactac
   228181 gaagacatcg atattactgg cgaacggcag cgacttcggt tccatctcag cggactcggg
   228241 tgtcctacaa aggaaaatat aagaaaagac aatgaaagcg acgtcaacgg tggaattcgc
   228301 tgggctctat atatacaaac cggcgacgcc aagtacggta ttcgtaacca gcatttgagt
   228361 atacggttaa tgtatcctgg ggaaaaaaat acacaacagc tgttgggttc tgatttcagt
   228421 tgcgaacgtc accggagacc gtccacgccg ttgggaaaga acgccgaagt gcctcccgcg
   228481 acccgcacgt cttctacata cggcgtcctc agcgcttttg tagtgtggat cggatccggc
   228541 ctcaatatca tctggtggac cggcatcgtg cttctggcgg cggacgctct cggacttggc
   228601 gagcgttggc tgaggttggc actgtcccac cgggataaac atcacgcatc gagaaccgcg
   228661 gcgctccagt gtcaacgcga catgttactt cggcaacgtc gacgggctcg gcggctgcac
   228721 gccgtttctg aaggcaaact gcaggaagag aagaaacgac agtctgctct ggtctggaac
   228781 gttgaggcgc gaccctttcc gtccacacat cagctgattg tgctgccccc tcctgtagcg
   228841 tcagctcctc ctgcggttcc ctcgcagccc cccgagtatt cgtctgtgtt tccgcctgta
   228901 taaaaataaa gagacgggag gctgatcgcg gccttcagcg tctcatttgt ctttactctc
   228961 gagtgcggtc ggtgtctcat cggtgagacg aggccgccgc ccgacaagtt cgatctcatg
   229021 tcgctcttgg agcgcgaaga gagttggcgt cgcgtagtcg actactcgca caacctgtgg
   229081 tgtacgtgcg gtaactggca aagccacgtt gagattcagg acgaggagcc caactgcgag
   229141 cagccggagc ccgcacactg gctagaatac gtggcggtcc agtggcaggc ccgggttcgc
   229201 gattctcacg atcgctggtg tctctgcaac gcctggcgtg atcacgcctt gcgcggccgt
   229261 tggggtacgg cgtattcctc gggttcctcg gcctcttcct ccggtttcgt cgcggagagc
   229321 aagttcacct ggtggaaacg actgcgccac agtacccggc gctggttgtt tcgccgccgg
   229381 cgagctcgat acactccgtc taactgtggg gaaagtagca ctagcagcgg ccagagtagc
   229441 ggtgacgaga gtaactgcag tctacgcacc cacggcgtgt acacacgggg tgaacaacac
   229501 taatcgataa gtcgcgtgta ggcgactggc tacatcaacc ggatatctgc ggggatttaa
   229561 aaagacgacc cgttgtcatc cggcttagag caaaccgtcc ttttatcatc ttccgtcgcc
   229621 atggctatgt acacatccga atccgaacgc gactggcgtc gtgtaatcca cgactcgcac
   229681 ggcctgtggt gcgattgcgg cgactggcga gagcacctct attgtgtgta cgacagccat
   229741 tttcagcgac gacccacgac ccgagccgaa cggagggccg ccaattggcg gcgacagatg
   229801 cggcggttac accgtctgtg gtgtttttgt caggactgga agtgtcacgc gttatacgcc
   229861 gagtgggacg gcaaagaatc cgacgacgag tcgtcggcgt cttcctcggg cgaagcgcca
   229921 gagcaacagg tccccgcttg gaagaccgtg cgagccttct cgcgggccta ccaccaccgc
   229981 attaaccggg gtctgcgggg cacgccccca ccgcgcaact tgccgggata cgagcacgct
   230041 tccgagggct ggcggttttg caatcgacgg gaacggcgag aggacgatct tcgcacgcgg
   230101 gctgagccgg accgcgtggt gttccagtta gggggagtac ctcctcgccg tcaccgggaa
   230161 acttacgtgt aagaacacgg cgtgacaata aacaacatag cgtaaatccc cgtgtgatgt
   230221 gtgtgattga cgttcgggaa acatgtcccc atcatcagcg tcacaactga cgtgggttgg
   230281 tcactgacgt gcaggatgtt acgcgagtca gagaatcgca taagaacggg gtggtgagcg
   230341 ggttcccaca ggagtctctg gcgcaaaagc accatgagcc tcaggttccc cgagagggcg
   230401 ggttacgaga aactgggata ccgcccgcat gccaaacgcg tgtgggtgca tgacccgttg
   230461 ggattgacgc ggtttatcat gaggcaactc atgatgtacc cgctggtgtt gccgttcact
   230521 tttccgtttt acgtgccgcg gtcctagcac gtcagtggtg acgctgataa ttgcaacatg
   230581 gcccatgacg aacccgcttg ggacgaacgt caataccacg tcaaaccgcc gtgacttggc
   230641 tgaacgttga aacataaagc caaagcgccg tcggcacttg gcttcagagc agcgcctcgg
   230701 ggcgatgcga cggcgatgaa cttagagcaa ctcatcaacg tccttggtct gctcgtctgg
   230761 attgccgctc gtgctgtcag ccgcgttggt ccgcatggct ccggactcgt ttatcgtgag
   230821 cttcatgatt tctacgggta tctgcagctg gaccttctgg gaccagtggt ggcggggaat
   230881 cgctcagtcc ggacctggag agagcaggcg gaccgagcca gagggacctt cgttcggcgt
   230941 tcaggcctta atactagcca catcttacct gtcggcggcc tgtctggggg ctccggtacc
   231001 ttacccgccg gcctgtatcg tcccgaagaa gaggtgttcc tcctcttgaa ccgctgccat
   231061 gggccactgt caacgccgaa aagcgcttgt ctggctgagg ttggtgtcgc taatgccagt
   231121 tttttatctc gcttcaatgt cggtgatttt cacggagcgt catgggaaaa cggtaccgct
   231181 cccgatggag agcccggggt atgctgaaat tcttcttaaa attacgtaaa cgacgtcgtc
   231241 cagtcgttgt gccgcgattc gtacggttca tcgtctacgt cgttttgttc accgtcgctg
   231301 tgcaacgcgt gaaacaagag cgtgatgcgc accttcggcg gtatgaagaa cgattgcaga
   231361 aaaaccgtgc acggcgtcgg cagagttttc cgtgacttgg ggcggtgggt ccgagctgcg
   231421 gtatgggtca cggcggcgtg cgtcttattg acaaagatgc cgatgtgtga ctaaaaaacg
   231481 tcccagcccc agagcgatgt gtttcaataa aaattatgta gtatcatatt atgcgtgtcc
   231541 tggtttttca ttttttggat gtatttgtcg cataaaaggc ggtgggatgt ggggatgaaa
   231601 tatatccaga tacgcagttt tgttatccta acaaaacccg tgtcatgcta aaaacggtaa
   231661 tgcaggatga aagtcccgtg tggggggggg gggcatatag tagtcgcttt taccgctggg
   231721 catacgctat gcttgtattt gtgactatac tatgtgcagt cgtgtgtcga tgttcctatt
   231781 gggaagggtg tgaatgtagg aggtataaag aatggtggga cgcaggaaga catcgctaga
   231841 cacagctgta ttgtgctagc cccgcttagc gtcatgggta aaacggtgat aaagcgtcaa
   231901 aacaccatgg gggggggggg caggaagctt ggtggcggtg ttcattaaat gcattctgtg
   231961 tatttattgg tacatttgca aatcgccgag tataccggta taatgtggca ataatcgtat
   232021 tgtgtgtact atgcagcgaa gaggacaata tcagtgtaac gtgaagcaag tgtgggaaca
   232081 atgccagtga agaatatata aaagccagaa acatacataa atgaattgct agatacaggg
   232141 ttctttgtgt actagcccaa tcatgtcaat acaatgtgta cagaaaaaag acgcaacaac
   232201 gacggggggg gggggggcgt acgattaatt ctacatatta cagtacaggc taccgcgtgg
   232261 tgttgtgtat gttacgatgc ggtgtgcctg tcggtgtaat tggatgtatg ttacttatcc
   232321 gtggcgttgt gatagtgttg tgaaaaataa ttgtcgtgag cataatgaca gctgcaatat
   232381 aaaatcactt tattaagcat tgtaatgata atgcgtggct acattagaaa acgtgacgcg
   232441 tcgcatgtcg cggcacaatc tggcagcggg gtcggggtag ggtacggtgg gaggcatgta
   232501 cacagatgga acaaaagcag aagtaacgtg agacggagca tatagtccag tatccagcgg
   232561 ttcctgagta gcaccaccca tcaactgaat gccctcatga gtaaaagtct gcgggcggca
   232621 gcccttgggg accgttggca tgggacgatc aatctccaaa ccacagcgta acaccgtttt
   232681 cttccaacgt cgttgataca cgtcgttttt acggttactc cccagaaccc agaaagtctc
   232741 gtccaagtcg taccaggaat cttctccagg gacacgcgac ggtttccaat cctcgtcgtc
   232801 tcgtctcaaa gcacgtccca aactggcttg aggagtcaac ggtggttctg tgggtcgggt
   232861 gtagcgcgag tgctttccct tcatgaccga ttcgtcttcc ttgcctttag gctttttggt
   232921 ctttttgtgt atcatctggc caccggcttc cataaccacc gtggccaagt ccagtcccag
   232981 agcttgagcg tcggcgcggc gtctggcgtc ttgcagatag tcttccacat ttgcacagat
   233041 gaccggatgt ttggtggcta gggtgagcac ctcagcctcg ccgcggcccg gacgtagcaa
   233101 aaaagctaac tgcccgtgcg gctcgcgcgc ccacagcgcg gcgcgcgggt gcaggtgcag
   233161 cgcgtcccag cgcggccgct cccactgctc gcggtccagc tcgggcagca gccgccgcgc
   233221 ggcctcggcg gcgggcgccg actcgcgccc cagcgccagc gcgcccagca cgcccgcgcg
   233281 cagaaagtgc gacagctccg ccgccagcgg gtacacgtgc ccgtccagcg ggcagtaccc
   233341 gaacacggcg cccagctcgt ccagcaccac caccagcatg gcgcgcggca cggtccccga
   233401 cgccgccgga cccgccatcg ccgtcggacc caccatcacc gtcggcgccg ccgctgctgc
   233461 cgctgccgcc gccgtcgcgt ccgccccgac caccgcgtgc gcgtccgcgt ttggcacgca
   233521 aatcgcgctc ccgccggcgc ctccgtacgg ctgcggaggt atagtcacag cagaccccac
   233581 ggctcctgcc atcgcgcacg gcgcgtcccc gccggcggcc tccgtctccg tgccgctcgc
   233641 cgctggcggc gacgtcgtcc ccgtcgccgg ccccgccgcg caacccagcc accgcgcggg
   233701 cagcaccgcg cccagcgcca gccagccgca gcacagacgc tggttcaggt gccgacgcac
   233761 ggccgtcagc agcgacgcgg ggtgcggcgc cgacgcgaac ggctcgtact gcgccagctc
   233821 ctgccacgcg cccagcagca ccatcggctg cagtcgcctt cccggcgtct gtagtgccac
   233881 cgtcgtgccg gcccaccgcc ggcgcagctc ccgtccgagc gccgtcgcct cctcggcgcg
   233941 cagcaacgtc tgtcggagcg ccggctgagg cagcagcgtc gcgcgcgggg tgcccacgcc
   234001 cagccggttg cagcggtaca gccgcaccac ctcgcccgcg ccgtgccgaa accactcgtc
   234061 cgcgtcgcgc gccgctagga tcagcgtgtt gttcgccagg tcgtagacga acacgcggaa
   234121 cccggcgccc agcgccaggt acagtccgtc ctgcgcgcac agaccctcgg gatggccggc
   234181 cttgtcgccc accgtcgggt cggccgcggg gtccacctcg tgcaccacgg tcgccaccag
   234241 cacgatccac gcgtcccgcg gcgacagctg acgcaggtcc gtcgcgccca cgccgttcat
   234301 ctggctgcgc ggcgtcaccc gcgcgtagaa tccgtacggc cgtccgagcg gcagcagcgt
   234361 gcccgcgtcg cgctgcgacc acttgcgcat ggcgcggccc gtgctgttgg ccagaaacgc
   234421 cgcgcgccac acggcgccca tggcctggta ttccagctcc gtcagcgcct ggcgctccac
   234481 cggaatctga gacagcaaca ggcgctccgg gccgtgccaa aagttgctgt tgttgccgct
   234541 actcggaggg gcgcccggcg gcccgcgggg ttctacccgg tggacgccgt ggcccggcgt
   234601 cgccgtaggc gcagcactcg caccagtgcc cgctgttgac gtcgctccca tcggcacaca
   234661 agaagaagga ggagaggaac caacccccga aggccctccg gccccgcggc cgcgaccgag
   234721 gggcgggggg cgcggcgaca tgccgttgcg ctgggccatg gccgccggac acctccgacg
   234781 tccactatat aggaagcaaa cccgcgtcag cgaccacgcc gtttacacac gcggacggct
   234841 ccgtcgtccg tgtgccacgg cagacacgca cctggctttt ataggcagcg acgtgtatgg
   234901 cgcttgctgg cgccgccttg gggccgtgca gtctggaagg ccgtggaaaa ccacccggca
   234961 gccgacgacg cactcgactg gaaaaggcag gaacccggag gaacacgcgc aacagggccg
   235021 cggactgggt ccccgagcgc gcaccctcct aggtggacgc ccgacatcca ttccgggccg
   235081 tgtgctgggt ccccgagggg cgggggggtg ttttctgcgg gggggtgaaa tttggagttg
   235141 cgtgtgtgga cggcgacggc gactagttgc gtgtgctgcg gtgggtacgg cgacggcgaa
   235201 taaaagcgac gtgcggcgcg cacggcgaaa agcagacgcg cgtctgtgtc tgtttgagtc
   235261 cccaggggac ggcagcgcgg gtccttgggg acacacgcaa aacaacggcc agacaagacg
   235321 cgggcgcaag ggaggagtcg cgggccccgg ggcacactgc acaacccgcg tcgaggacac
   235381 acgcagacac ggcccgccaa cacaccccga cacacccctg acacaccccg ccgacacacc
   235441 cggcacacgc ccgcgacaca cccggccaac acaccccgac acacccggca cacgcccgcg
   235501 acacacccgg ccaacacacc ccgacacacc cggcacacgc ccgcgacaca cccgcggcac
   235561 accctgacac acccgccaca cccggcacac acccaccccg ccgcgccccc gacacacccc
   235621 gaccgccgcc ggtgcgggac agggct
//