LOCUS       AY375531              173591 bp    DNA     linear   PHG 25-SEP-2003
DEFINITION  Bacteriophage 44RR2.8t, complete genome.
ACCESSION   AY375531 AF221996
VERSION     AY375531.1
KEYWORDS    .
SOURCE      Aeromonas virus 44RR2
  ORGANISM  Aeromonas virus 44RR2
            Viruses; Caudovirales; Myoviridae; Biquartavirus.
REFERENCE   1  (bases 104802 to 105392)
  AUTHORS   Tetart,F., Desplats,C., Kutateladze,M., Monod,C., Ackermann,H.W.
            and Krisch,H.M.
  TITLE     Phylogeny of the major head and tail genes of the wide-ranging
            T4-type bacteriophages
  JOURNAL   J. Bacteriol. 183 (1), 358-366 (2001)
   PUBMED   11114936
REFERENCE   2  (bases 1 to 173591)
  AUTHORS   Nolan,J.M., Petrov,V., Bertrand,C., Krisch,H.M. and Karam,J.D.
  TITLE     Complete Genome of Aeromonas salmonicida Bacteriophage 44RR2.8t
  JOURNAL   Unpublished
REFERENCE   3  (bases 104802 to 105392)
  AUTHORS   Tetart,F., Desplats,C., Kutateladze,M., Monod,C. and
            Ackermann,H.-W.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JAN-2000) Laboratoire de Microbiologie et Genetique
            Moleculaire, CNRS, UPR 9007, 118 Route de Narbonne, Toulouse 31062
            Cedex, France
REFERENCE   4  (bases 1 to 173591)
  AUTHORS   Nolan,J.M., Petrov,V., Bertrand,C., Krisch,H.M. and Karam,J.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-AUG-2003) Biochemistry, Tulane University Health
            Sciences Center, 1430 Tulane Ave., New Orleans, LA 70112, USA
COMMENT     On Sep 20, 2003 this sequence version replaced AF221996.1.
FEATURES             Location/Qualifiers
     source          1..173591
                     /organism="Aeromonas virus 44RR2"
                     /mol_type="genomic DNA"
                     /host="Aeromonas salmonicida"
                     /db_xref="taxon:115987"
     gene            complement(1..2118)
                     /gene="rIIA"
     CDS             complement(1..2118)
                     /gene="rIIA"
                     /note="similar to T4 accession NP_049616.1; membrane
                     integrity protector"
                     /codon_start=1
                     /transl_table=11
                     /product="rIIA protector from prophage-induced early
                     lysis"
                     /protein_id="AAQ81320.1"
                     /translation="MIMSSNEDDAMFGNAPKKRTGFKITAGKKAFRVLSDKLYKDKAE
                     AVLRELSCNAVDIHCEMGKAHIPFDVTLPTSIYPWFVIRDYGSGLSPEQIDDIFTVYF
                     ASTKDESNDSIGGFGLGCKSPFAYSETGGGFTVKSYQNGTCTVYNMYMDDGEPFSTPM
                     STTATTEADGLEIQVPIPAHEHARWKILAAKVYRAFDRCKPNITNGDIISIQEFPDEE
                     EFFFNDDFGRSGQAFAIIGGVVYPIPERLISSDMVFKYSGRAAYMKFPIGELDIAPSR
                     EELSLDKQTEDYLVERMKKFSQSFANTVKKEFEGITDKRDAAIKTKKYNSYVVNAIAD
                     LEIGGELIGSIVKRYTDMSKLSEIPVYSYRNGSLKRQFTRSGYSWRTSMIDSQSVFGL
                     ERRKVHVLINDTGEGVPNMVKAYHNHINNSIPVVVLDKTHKLKKSEYAAFGKKISAIC
                     EKFEPHERHILKFSEMVDIRKAYTIKKRKDAGPKPVKPNVRRVYIDECDLRQVELLCL
                     STNEIRELEGVGIISYGDTYDRISLKPSGNMNRHAIDSLFAQGVEEVYIIENGKRSAA
                     MKSNLQCGFMWMYEKLMENVEQFDVLDGECPYVNDEDLGTALRLKKFNLFDVEITRVF
                     DKQNDDHLAEIVDWIEGNNPAFQAYHDMKAKIHDINVEYFERFTDAINKIQSKYPLLY
                     AVAMSDIELTPEIMQDIEFIRAR"
     gene            complement(2125..2388)
                     /locus_tag="44RRORF002c"
     CDS             complement(2125..2388)
                     /locus_tag="44RRORF002c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81321.1"
                     /translation="MKIRFKSEDHKAMFARRHDCNQWIADKMGTDWWECEYDAHVYDD
                     EASILILDEDVPLTGKYHAADDEDDDDTAWVLFGERQYFEIVE"
     gene            complement(2404..2670)
                     /locus_tag="44RRORF003c"
     CDS             complement(2404..2670)
                     /locus_tag="44RRORF003c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81322.1"
                     /translation="MTLYEELNNALERVCRINIRFMGDQQHADELTENVSGPLERLRI
                     GQASRRDMGVLCASGIVHEANLFGANIPNVIDEMIEKMKAEVQY"
     repeat_region   complement(2818..2888)
                     /note="44RR; 6 copies of repeated sequence detected in
                     intergenic regions of genome"
                     /rpt_type=direct
     gene            complement(3072..3338)
                     /locus_tag="44RRORF004c"
     CDS             complement(3072..3338)
                     /locus_tag="44RRORF004c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81323.1"
                     /translation="MKAKFKSVEAKRAFIDQGEKEWATNNSDGSNNNWRIAKKFGMVE
                     FDVKPLKGGIFSGWHDIYINGDLFDSISASEAMFFDFRDDRPGV"
     gene            complement(3340..3801)
                     /locus_tag="44RRORF005c"
     CDS             complement(3340..3801)
                     /locus_tag="44RRORF005c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81324.1"
                     /translation="MKYSVQFKPDVSREVFVERFRSINAVIMYLIDYRNVYLVKDQDD
                     GRFYLVDALSHLNLTDHDDDNLCIIESEEKFFDIELMEMKAKIKSGHHYYHFCNRIRG
                     QHCNIDFLDNYYGCEVDVKVENDTYYLERGKSYGVTISREEFETWFNVVGE"
     gene            complement(3874..4125)
                     /locus_tag="44RRORF006c"
     CDS             complement(3874..4125)
                     /locus_tag="44RRORF006c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81325.1"
                     /translation="MTIKRIRFKSEEHRKKFAESEWYNESFSKHMPDEFWAKYDSNKL
                     VGYMLVDANGKKIELPEEEGGGGITFDDEEMFHFFDEVK"
     gene            complement(4246..6069)
                     /gene="60plus39"
     CDS             complement(4246..6069)
                     /gene="60plus39"
                     /note="similar to T4 accessions NP_049618.1; NP_049621.1;
                     in T4 an insertion splits the large topoisomerase II
                     subunit in two parts (gp60 and gp39); gp60plus39"
                     /codon_start=1
                     /transl_table=11
                     /product="topoisomerase II large subunit"
                     /protein_id="AAQ81326.1"
                     /translation="MSDEFKVLTPREHVILRPNMYVGSVAYEPHERFLFGKFQSVSYV
                     PGLVKIIDEIIDNSVDEGIRTDFKFANKIDIRFDLLEGSVTVVDNGRGIPQSMVETPD
                     GEMPKPVAAWTQTMAGSNFDDTNRVSMGMNGVGSSLTNFFSKKFIGETCDGKNFLTVT
                     CSEGASNIDWETKPGKIKGTSVYFIPDEKHFEGRTIDQQIIDIISDRITALSVVFPQI
                     KFTINGQIASMKFADYAKMFGDESLIVESDRFSIAICNSPEGFRQVSYVNGLNIKNGG
                     SHIDYLVDGISEELMPAIKKKHKIEISKARVKECLTMVVVVRGMSNLRFDSQTKERLT
                     NPAGEVKSHFDLDFKKLSKQIMNTDAILQPIIEAALARHLAAEKAAMTKAQKAAAKTN
                     CAKHIKAGEWGRNDIETTLFLTEGESAIGYLLKVKDENLHGGYALRGKVMNTWGMKGS
                     DVLKNNELSDICAITGLDLANPDDISQRKYKNIAIMTDADPDGQGSIYPCLLAFFARW
                     PKLFDEGSVRFVKTPVVILNKGKNTKWFYTLTEFEKEKKDYKGWDLRYIKGLGSLREH
                     EYSDVVNNPNYDIVDLGDDWEELFEMLLGDDAALRKEWMSQ"
     gene            complement(6130..7299)
                     /locus_tag="44RRORF008c"
     CDS             complement(6130..7299)
                     /locus_tag="44RRORF008c"
                     /note="matches Pfam SHMT serine hydroxymethyltransferase;
                     similar to SwissProt Accession O08370, O51547"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81327.1"
                     /translation="MQDKVVQSIIEDEAMRQYCEVCLIASENYVSDDVMKAQGSIFTN
                     KYAEGYPGKRYYGGCVKADEIENLAIERAKELFSCNFANVQPHSGSQANQAVYQALLK
                     PGDSVLAMSLDCGGHLTHGHKANASGKIYDFHHYGVFSDGTININQVVEQIRTIPDLK
                     LVVIGYSAYVGRINEATYAKIADAAHSIGAKLMVDMAHFAGFVAARLHANPLKWGADV
                     VTTTTHKTLRGPRGGLILTNDADIAKKVNSAIFPGIQGGPLLHVIAAKAVCFGEALRE
                     DYVDYMIQVAHNASIMYETFDAAGHKLVGFTENHQVLLNTYESFGLTGREAEQLLEKE
                     GIIVNKNMLPNDTRSPVETSGIRIGSPAMTTRGWVESDFYDITIKIMHILECAKQ"
     gene            complement(7301..7717)
                     /locus_tag="44RRORF009c"
     CDS             complement(7301..7717)
                     /locus_tag="44RRORF009c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81328.1"
                     /translation="MNVITVNIFAIVILFIILLTILTQAKSSYWKSKAREFDDLREWA
                     GSHDVFINWHSSQESPDRRTYVLRRKWVPNDALMMINVDRCKGIKFAELYARFRRIRE
                     LQYDGLSDVGVRDMLSTIAHDSQLERKQPVNFWKGY"
     gene            complement(7719..8096)
                     /locus_tag="44RRORF010c"
     CDS             complement(7719..8096)
                     /locus_tag="44RRORF010c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81329.1"
                     /translation="MFQIIFIAGLVLGLIACCFSTWDSRWRKKARNEQAKINTWLAKY
                     GISMNFKNGVVGAFEKVVFFMPGGDNAIFSECKGINFRKAYKMLEQIRKDDIANPDFD
                     QTGNLMSILYLSQAKIEKTIWDK"
     gene            complement(8084..8629)
                     /locus_tag="44RRORF011c"
     CDS             complement(8084..8629)
                     /locus_tag="44RRORF011c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81330.1"
                     /translation="MIRLKCNDREGLISFINKKSINRIGRRQNRSELIEAINTIEHQS
                     YRQIDGIYHAVTPMSFKIEGDLNVFFDEVIKNVSIDLSSTFTASAVVPTRNMGFVMGK
                     LVEEVGEFAKSINQPERCDERPVGEAADVINCVMDMLYLQYSEDNPGLGKSQIVDLIV
                     KELNLQLNMKAEKWVEKACSK"
     gene            complement(8626..8865)
                     /locus_tag="44RRORF012c"
     CDS             complement(8626..8865)
                     /locus_tag="44RRORF012c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81331.1"
                     /translation="MKIQMKLNVLPEYHAEYCKTQGQRLWASILEGKSKEGDLRVIEV
                     MEDGGWKTNAEFLGYAIGIPVNEQKFFEEQFEVNV"
     gene            complement(8862..9080)
                     /locus_tag="44RRORF013c"
     CDS             complement(8862..9080)
                     /locus_tag="44RRORF013c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81332.1"
                     /translation="MKIRLIDEKGFIDHCRKNIVDYKLARSIVDFTKTRELQIVQRDR
                     GMWTLNVYGPLGKAQICRDQQKFFEVNQ"
     gene            complement(9077..9403)
                     /locus_tag="44RRORF014c"
     CDS             complement(9077..9403)
                     /locus_tag="44RRORF014c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81333.1"
                     /translation="MCRPNYRLLLAEEKSHGVEKELYELYTSMNAVGANNQDTFGKLF
                     KTKAYKLAQTEIAEYNEKIRKVILKNFPTATRYQSELIGLRGIVDVSMKRGQRILIKL
                     SYGELK"
     gene            complement(9403..9618)
                     /gene="cef"
     CDS             complement(9403..9618)
                     /gene="cef"
                     /note="similar to T4 accession NP_049625.1; T4 gene
                     synonyms: comC-alpha.1, M1, mb; Cef"
                     /codon_start=1
                     /transl_table=11
                     /product="modifier of suppressor tRNAs"
                     /protein_id="AAQ81334.1"
                     /translation="MRISKDFFLDVMFTNQFNIVEKSHEEHLVYTTVLYVFDGNTRIA
                     VLERVITKDGSEYKLVEGVYENLKGRL"
     gene            complement(9684..9956)
                     /locus_tag="44RRORF016c"
     CDS             complement(9684..9956)
                     /locus_tag="44RRORF016c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81335.1"
                     /translation="MKKHLRTLPIKEVVYEVITQHPLAEGPIVETDGRMTSVYFSVDI
                     PEVGYVFFDKVYDSKSKNPRYDYCISYDKDCNTQVQKWLDENVLKK"
     gene            complement(10068..10544)
                     /locus_tag="44RRORF017c"
     CDS             complement(10068..10544)
                     /locus_tag="44RRORF017c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81336.1"
                     /translation="MDKQVNEVVVYLDIDGVLNTVSDHEIWRTDRASHLFRTSPYNHG
                     DFVSNHRLSILREWLIRNNAKVVIVSSWVVLNDTGKMICDFLELPYHSEAYNTGGGQG
                     RGTGVLKHAADHGIRRWVVIDDAKCMYDHSEVLLHHLVHIEGGLNESYLEEADFIL"
     gene            complement(10529..10918)
                     /locus_tag="44RRORF018c"
     CDS             complement(10529..10918)
                     /locus_tag="44RRORF018c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81337.1"
                     /translation="MTPEAREFLAFCSLAFKLQPVEQGIYHRGFISYGSFFGSKREIS
                     TPVFCALARAVRKTKPGKVYIDDHHKIRAYIDVRWNLHIGVFADTKKVYSATISMAMQ
                     EQLAMRQQASGFRWIQRTKRGPKWISK"
     gene            complement(10915..11160)
                     /locus_tag="44RRORF019c"
     CDS             complement(10915..11160)
                     /locus_tag="44RRORF019c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81338.1"
                     /translation="MIYEHFDKNSFWGSILIDGMKLNNKLSNIIMLPSTRKKLTEKYE
                     FFAKSVGAMIGELHPTAKTWVAKPNPFRDGVLVEIRE"
     gene            complement(11157..11417)
                     /locus_tag="44RRORF020c"
     CDS             complement(11157..11417)
                     /locus_tag="44RRORF020c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81339.1"
                     /translation="MRIAAFRKGGTNPVLLNFFSMTEGVIQNGYVENGSWEFSRVDGI
                     LCIEGDKEHPMPDFEHIVEVPDEMAGDYNEIISWAEKQLELK"
     gene            complement(11414..12079)
                     /gene="dexA"
     CDS             complement(11414..12079)
                     /gene="dexA"
                     /note="3' to 5' DNA exonuclease activity involved in phage
                     DNA replication and host DNA degradation; similar to T4
                     accession NP_049629.1; DexA"
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease A"
                     /protein_id="AAQ81340.1"
                     /translation="MSNVTDFVLDWETMGNAPEGAVVDLAVLVFEHDPHNLPTFEELC
                     HRGRRFKFDLKSQKGKRIFDQGTMDWWKKQSDEAKLNLKPSDIDVDYLSFYDDFMNFL
                     KAEGFNKKTGQGWCRGQSFDFPILIDVIRQIHGTRETFNLEPCFFWQQRDVRTAVEAT
                     LMVRDMTMCPMPKGALDGFVMHDAIHDCAKAALELLYSKRYALGLEEVPTGDDIDPRS
                     VRK"
     gene            complement(12251..13570)
                     /gene="dda"
     CDS             complement(12251..13570)
                     /gene="dda"
                     /note="DNA-dependent ATPase; DNA helicase; similar to T4
                     accession NP_049632.1; T4 gene synonym: sud"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase"
                     /protein_id="AAQ81341.1"
                     /translation="MLTYDDLTNGQKLAIDGAMDAISTKRHITIRGPAGTGKTTLTKF
                     LLDRLFQTGQQGIVLAAPTHQAKKELSKHALRKAYTIQSLLKINPSTLEENQIFEQKG
                     TPDFSKIRVLICDEVSFYTRKLFNILMKTVPSHCVIIGIGDKAQIRGVSEDNETHELS
                     PFFTDDRFSQVELDEVKRHQGPIIEVATDIRNGKWIYEKLDEHGNGVKQYHSVKDFLG
                     VYFNRTKKPEDLFENRIMAYTNASVDKLNAVIRKKLYGSDVAPFLPGEILVMQEPLMF
                     EIDVGGQTLKEVIFSNGQNVQILNVKPSRKKLVAKNVGEIEVEYIMLECETHDEDEDD
                     YKRAWFSVIADDNTAQAISEFLSIIADKYRSRAVFPAWKDFWAIKNTFTKVRPLGAMT
                     FHKSQGSTFKNAYLFTPCLHSYCRDPDVAQELIYVGNTRARENVGFV"
     gene            complement(13573..13884)
                     /locus_tag="44RRORF023c"
     CDS             complement(13573..13884)
                     /locus_tag="44RRORF023c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81342.1"
                     /translation="MKKYALQWKDPEGFCHFVSGNLHGAFGGVMFHDSWEEADVSLKN
                     AKKSIEEYLKGTTVIKKRLFGPPTIVSVNKPSGHLANMHKRMYDTMHIAEINIMPKQM
                     R"
     gene            complement(13901..14080)
                     /locus_tag="44RRORF024c"
     CDS             complement(13901..14080)
                     /locus_tag="44RRORF024c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81343.1"
                     /translation="MWKELDRDSQVITSAMNTPGGVIIRIAHTFDVSNFKIQFIAGVK
                     VVKDANYNGFELVHG"
     gene            complement(14195..14338)
                     /locus_tag="44RRORF025c"
     CDS             complement(14195..14338)
                     /locus_tag="44RRORF025c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81344.1"
                     /translation="MTNKQSDNTMFALRMKRVKEKEQQTPWYKKPYNSDVMPGCHPWQ
                     GKL"
     gene            complement(14338..14856)
                     /gene="56"
     CDS             complement(14338..14856)
                     /gene="56"
                     /function="removes dCTP,dCDP/dUTP, dUDP from precursor
                     pool"
                     /note="similar to T4 accession NP_049646.1; gp56"
                     /codon_start=1
                     /transl_table=11
                     /product="dCTPase"
                     /protein_id="AAQ81345.1"
                     /translation="MTTPQFNECSQLIDNLHKAQNALEGCLSVHHNPLDRMIDMQRQL
                     QIELAERHPKYNKDPRTLKTCGEILEWCQKQDDYIADEVREHYTSLGGMSNPKPNAIW
                     KPWRAEHGEYRDRLFSDLSAEDQLEAKFELIDQMHFVLNKFIAMGMDGNEIFKLYYLK
                     NAENFDRQERGY"
     gene            complement(14916..15581)
                     /locus_tag="44RRORF027c"
     CDS             complement(14916..15581)
                     /locus_tag="44RRORF027c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81346.1"
                     /translation="MKFLSVIALGLLSSSAMAASFDCNTTGLNSIEKAICKVPELSMM
                     DQQLADAYKVVRHIPEVKADQKTFIKDRNSAPSLGDLKDLMRDRIIELEIIAELEGVE
                     AKPYSERQVKPAKPIGSSSVGQLITQFKNGNTAVYNGQYLDATYRRSDAPSWALGCSA
                     KIVDNDVLPKWAAEASKNKLSSEFADVRWKFDVAMFNATLANLLKNTDQSKTMCDIIN
                     VGM"
     gene            complement(15578..15748)
                     /locus_tag="44RRORF028c"
     CDS             complement(15578..15748)
                     /locus_tag="44RRORF028c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81347.1"
                     /translation="MKSDLYKRGYKWANKAYQDGDTLQDIEDKADNSFDFNDFDRGAL
                     DAVHDLRKENKT"
     gene            complement(15738..16196)
                     /gene="denV"
     CDS             complement(15738..16196)
                     /gene="denV"
                     /function="repair of pyrimidine dimers"
                     /note="bifunctional; similar to T4 accession NP_049733.1;
                     N-glycosylase UV repair enzyme; DenV"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease V"
                     /protein_id="AAQ81348.1"
                     /translation="MTRINLEHPSLLCNAHLVGEWYENPRVASILIKKNGRTGKIPKR
                     FTVRTNKNPDGGRGHVTFFYNKLAWLRDRYLMLMDEMTKRGYSPTDNWKVEIFFPEYT
                     HLFGEWTPTEADISLSRTRIAEMIPEKHKLTNEQLEKLSAIAEYEAFNEK"
     gene            complement(16295..17299)
                     /gene="61"
     CDS             complement(16295..17299)
                     /gene="61"
                     /note="similar to T4 accession NP_049648.1; T4 gene
                     synonym: 58; DNA replication primase; gp61"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase subunit"
                     /protein_id="AAQ81349.1"
                     /translation="MFADFLFAERAMMHLPKFKRKKGKFNSRCPICGDSQTDMNKARF
                     WMYEKKGDWQVHCFNCGYHSNLGGYLKDREEELYREWLLERRKENNVFKPQVKTIAET
                     FTKKMPVIEKLNYCTKLDTLPENHPIVKYVANRKIPKSAYSRLWFTKEWQKLVNSISP
                     ETYTRERSECRLVIPIFDENGDIQSFQGRALCVSPNKYITIKAHEDASKIYGMDTIDG
                     NRMVWLMEGPLDSLFIQNAGAITGGSLALNEVPWKSTRVWVLDNEPFHPDTCKRLSRL
                     IDSGERVVMWDKCPWPSKDINDMIIKDGATPEEIEKYFKDNTVSGLQAKLRFGKWKRA
                     "
     gene            complement(17340..17534)
                     /gene="61.1"
     CDS             complement(17340..17534)
                     /gene="61.1"
                     /note="similar to T4 accession NP_049649.1; gp61.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81350.1"
                     /translation="MKSFLECSGKLVSKGNKDTQVDEDMVAGDSGGNPTDIAAGKTSG
                     AITSPGPETLGKKKNAKPKV"
     gene            complement(17573..18982)
                     /gene="41"
     CDS             complement(17573..18982)
                     /gene="41"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="DNA primase-helicase ATPase, dATPase, GTPase,
                     dGTPase for replication and recombination; similar to T4
                     accession NP_049654.1; Glimmer predicted start chosen to
                     improve alignment of N-term with other T4-like sequences;
                     GeneMarkS predicts start at 18877; gp41"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase-helicase subunit"
                     /protein_id="AAQ81351.1"
                     /translation="MVETILENLLFNNTYFISAYPYLKDEYFDRGPYRELFKLIQKHV
                     NEYNTIPTKTALVIALEKKSVDQLTHDGIKEVLGRLASKPEDHSWLIKETESYCKDQA
                     MYNALSKAIEIQENAAKPFEERNKKLPDVGAIEDLMKNALAISFDGSVGHDWFEDYER
                     RYMLYMSKANKIPFVSHILNKITKGGAEVGTLNVIMAGVNVGKSLGLCSLAADYLQTG
                     KNVVYFSMEMAEHVVAKRIDANLLDVTLDEIDDGQLSFAEYKARMEKLKSRNMGRLII
                     KQYPTSGANANHFNAFLNELKLKKNFKADIVIVDYLGICASTRLGGGTENSYSFVKAI
                     AEELRGLAVQHQVVLWTGAQTNRGAWDSTDIDMSDVAESAGLPATADFMLAVMETEEL
                     AQLGVQLFKQIKSRYGDKNYINKFRMGVRKGNQRWYDLEEEGQSAPKPGAAPARQADH
                     TKGSNNREKLDELAGIMNF"
     gene            complement(18913..19254)
                     /gene="40"
     CDS             complement(18913..19254)
                     /gene="40"
                     /note="similar to T4 accession NP_049655.1;
                     membrane-associated initiator of head vertex assembly;
                     gp40"
                     /codon_start=1
                     /transl_table=11
                     /product="head vertex assembly chaperone"
                     /protein_id="AAQ81352.1"
                     /translation="MSDNKGATAPQSLEDAHSLIKQSMADVKQELLIIDKKGKSHLVY
                     VFDAHYNDGKLHVEYKTVSDSEELHALVHEALQIQIKQIMKDKEDQKWSKQFLKICYS
                     TIRTLFRRTRT"
     gene            complement(19291..19986)
                     /gene="42"
     CDS             complement(19291..19986)
                     /gene="42"
                     /note="produces modified hydroxymethylcytosine in T4 DNA;
                     similar to T4 accession NP_049659.1; gp42"
                     /codon_start=1
                     /transl_table=11
                     /product="dCMP hydroxymethylase"
                     /protein_id="AAQ81353.1"
                     /translation="MLYMNTQNIRDILAQRFAAGEFVTDKTGVKTIEIAPVMFKADEP
                     LIFGKLNNDYIERELAWYLSQSRYVHDIPGKTPVIWEAVSDSEGRINSNYGWAILSDE
                     NGSQFANVLMHLASDPNTRRANMIYTRPTMHEDYKANGMSDFMCTNNVQYQIRDGKLN
                     AVVHMRSNDAIFGYRNDWAWQDYVLKRLVDKLQSREVMVEKGDIYWCVDSIHVYERHF
                     PMIEKYIATGSIE"
     gene            complement(19996..21171)
                     /gene="43B"
     CDS             complement(19996..21171)
                     /gene="43B"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="split gene for core DNA polymerase of phage
                     replisome; gp43B"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase, C-terminal fragment"
                     /protein_id="AAQ81354.1"
                     /translation="MELELFRDFNEEELTYLNTLSTDELQQMIARCEKEEQKRNTNQL
                     NRKILINSLYGALGNNWFRYFDLRNAEAITTYGQLAIRWIERKLNEYINELVKTTGVD
                     YVCYIDTDSVYLNMEAVVNRVGIDKFRDTNHLIDFLDNLGSKKLEPFIDDSYKELEEY
                     MNHDHHLLLMDREAIFGAPLGSDGIGGFWTGKKRYALNVYDMEGTRYAEPHLKIMGLE
                     TQRSSTPLACQKSLKESIRRLLQEGESSLQDYFKEFKDEFKNIPYQDVAAVSSANNIG
                     KNGDALGFPIKGTPYHVKGVLAYNRIAKTDTAIPMISEGEKVMVLPLRDRNPFNEACF
                     AWPSGTPIPPAVEADVLKYLDINKLFDKTFVKPLSSICEATKTDYEFRNNLFDMFDI"
     gene            complement(21221..22717)
                     /gene="43"
     CDS             complement(21221..22717)
                     /gene="43"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="core DNA polymerase of phage replisome, 3'-5'
                     exonuclease; gp43"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase, N-terminal fragment"
                     /protein_id="AAQ81355.1"
                     /translation="MRHYTNIEIIGNNIMERFVDNGKRQTRKVAYQPTLFQHAAPGVQ
                     TKHKDIYGRFCVPKKHENIWEAKQWIKRMEEVGMDAMGMDDYGISYISDTYRGVIDFD
                     RDDVVIDVVDIEVTAPEFPEPKYAKYEIDMISHVRLHNGKKTYYIFDLVKDVGHWDPK
                     KSVLEKYILDNVVYMPFEDEVDLLLNYIQLWKANTPDLVFGWNSEGFDIPYIITRITN
                     ILGEKAANQLSPYGKITSKTITNLYGEKIIYKIHGIALMDYMDVFKKFSFTPMPDYKL
                     GNVGYREVKADKLDYEGPINKFRKADHQRYVDYCVRDTDIILLIDGRRCFIDLILSLS
                     YYAKIRFDDVLGTIKVWDSIIFNSLVESNVVIPAMKASPKQSFPGAYVKEPVPGGYRY
                     GLSFDLTSLYPSILRLLNISPEMIAGMFSPARLEDYINKVAPRPSDQFSCAPNGMMYK
                     KGVVGVLPNETEKVFLQRKSEKKMMLAAIRNQEAIKKILASRGVKLDH"
     gene            complement(22761..23117)
                     /gene="regA"
     CDS             complement(22761..23117)
                     /gene="regA"
                     /function="regulates translation of mRNAs for DNA
                     replication proteins and other early gene products"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="similar to T4 accession NP_049663.1; RegA"
                     /codon_start=1
                     /transl_table=11
                     /product="translational repressor protein"
                     /protein_id="AAQ81356.1"
                     /translation="MIPIDIAHPDDFLKIAETLTRIGIASNKEKKLYQSCHILQKQGK
                     YFIVHFKEMLQLDGLKVDISDEDIGRRNNIAMLLNSWKLCTILEPIDVSSHNNFRVIS
                     HKQKADWTLIAKYKFG"
     gene            complement(23127..23705)
                     /gene="62"
     CDS             complement(23127..23705)
                     /gene="62"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="clamp loader subunit; similar to T4 accession
                     NP_049664.1; gp62"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase accessory protein"
                     /protein_id="AAQ81357.1"
                     /translation="MNNLNFLLGDDEEQLNEHEIAWMSKDWDAVAKLADQFKENAENT
                     AFAFMDDITYNKPERNVANTEYPAWFINNALSMHAETLYPAYVMNLLSGLDGQAQYNY
                     LKASIRKGKVYGKWPKLESSAEENLYVAMVKTANNVDETTACMYIKIMTKRGTMESFL
                     SSYKFLVTPAFVKKVTKTAKEQNQLLKLAKKF"
     gene            complement(23702..24661)
                     /gene="44"
     CDS             complement(23702..24661)
                     /gene="44"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="clamp loader subunit; similar to T4 accession
                     NP_049665.1; gp44"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase accessory protein"
                     /protein_id="AAQ81358.1"
                     /translation="MLTVNHGEFMFENKYRPGNIDECILPEHDKKIFKAIVKSGRIPN
                     IILHSPSPGTGKTTVARALVAEIDAEFLFVNGADAKIDFVRDVMTPFASSKTFCKGGK
                     VIIVDEFDRAGLADSQRHLRSFMEAHSKNCTFIITANDLGGIIPALQSRCRVIQFGKA
                     DQSDKINMMKQMIVRAEEICAAENIEVEDRKVIAALVKKNFPDFRKTVNEMDFYASEG
                     KIDSGILSLVLNTRNDIDQVVEAIKARDIKNLRAMATQYTTDYSGFVSRLANTLYPLV
                     NGPSKIRMYEIIGENNQLYGQAANIEIHVQYMFVQLSVEMVFA"
     gene            complement(24733..25404)
                     /gene="45"
     CDS             complement(24733..25404)
                     /gene="45"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="sliding clamp; required for synthesis of late RNA;
                     similar to T4 accession NP_049666.1; gp45"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase accessory protein"
                     /protein_id="AAQ81359.1"
                     /translation="MKLSKETLSIMKNFAAINPSLRLVPGDFIMTKSINGVAYAEATI
                     ADEIDSELNIYDLPNFLSILGQLGDGSEITLSNGDIVIHNGRAKVNLPDAEGNAIIVP
                     KQRLRMPPPDVEFDLKAEDLAEILKISRAVGADRMAITNRDDHIVVDTFSEADGDNPR
                     TRYSVQLCAYEGTNNFSFVINLDNVSVVIADYKINISSKGAAQFQGINSSYVFVLETS
                     SKHDF"
     gene            complement(25462..25815)
                     /gene="rpbA"
     CDS             complement(25462..25815)
                     /gene="rpbA"
                     /note="similar to T4 accession NP_049667.1; T4 gene
                     synonym: 45.1; RpbA"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase binding protein"
                     /protein_id="AAQ81360.1"
                     /translation="MRNQAIVVVPADIRPLSDNIYETSVKIRKAWVANISDVRANQLQ
                     AIEQSVRFELYAEIDNLVRDMYVDLLQRRRAMILANGGYHVKGMNDKPVFAKQFQYDT
                     DELIITAAEMVMADY"
     gene            complement(25874..26062)
                     /gene="45.2"
     CDS             complement(25874..26062)
                     /gene="45.2"
                     /note="similar to T4 accession NP_049668.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81361.1"
                     /translation="MFYNLPQTTPEIRSYELTDETGHLRVVVTDEDLKSAFSEADIRK
                     LRSNRHSYYNLTEIFPDQ"
     gene            complement(26052..27764)
                     /gene="46"
     CDS             complement(26052..27764)
                     /gene="46"
                     /note="gp46/gp47 subunit required for recombination and
                     host-DNA degradation; similar to T4 accession NP_049669.1;
                     gp46"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination endonuclease subunit"
                     /protein_id="AAQ81362.1"
                     /translation="MIDIKKKQLDFIRVRYKNIMSVGDEPIDLTLNEYAKTLCTGKNG
                     AGKSTMLEAIYFALFGKPFRDITKNQLINENTGKNMLVELWLEYEEKVYHITRGIKPN
                     KFAITCDGAQVDAAASIKDFQAYFEEMIGMNATSFKQIVVLGTAGYTPFMQLKAPERR
                     KLVEDLLEVSVLAQMDKLNKARIKELNQEIASVDVTINHINTQLKTYHDHQNNSNASN
                     DAAVADHQAVFEEARDKAKQIKSIIDSLTEQLTNFEMPESPANDLGKFTMARAKAAAQ
                     KEQFAGIAHMHEDGGVCPTCMQQFDDPDLLTKLHDKMSVIQGQLDKADDRIEELNQQM
                     VEYNEATVRFRDVQTQLNNEKQSISLYVNQAKAAKAAIERLQAARPDYTGEITKLNDE
                     LVAKINTKSEIEREKHQRSMISDLLKDSGIKAVIMARYIPYFNNRIAHYLEIMEADFG
                     FTLDAEFKEVIKSAGRSTFSYNSFSQGEKARIDMAVMFAWRDLASEVSGVDVNALFMD
                     EVFDGPSDTDAQGAVFSIIDKMKANVLIISHGDHDPQNFDRHVKMSKLGRTSVMEEVI
                     FNVL"
     gene            complement(27761..28828)
                     /gene="47"
     CDS             complement(27761..28828)
                     /gene="47"
                     /note="gp46/gp47 subunit required for recombination and
                     host-DNA degradation; similar to T4 accession NP_049672.1;
                     gp47"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination endonuclease subunit"
                     /protein_id="AAQ81363.1"
                     /translation="MKILHLGDLHNGVKDDDPWHEDIVEHAFVQAIDYSKANGITQWL
                     QSGDFFDVRKAVSQRTMNFVRTRLTPKLKEAGITCFVIVGNHDMQKKDRIHPNSVTEI
                     LGKDDTYVVIDEPTTVNFEGLDYDLIPWMCKENASDIFEFVKKSDSPWCLGHWELSGF
                     YFYKNIPSSGYSADFLKKYEKVVSGHFHTQSDGGNIHYIGTPYTITAGDEDEPRGFWI
                     LDTETRDFEFVPNAKTWHKRLTYPGVTPEEIRSCSGCSVRLIANEVDAGLTKVEFLLS
                     RVVHDLRTINKAVKVEVDSSTDISDDGETIDVQAASISEGPKTIMGLFAETVKNSAID
                     TDHKDAIIMMANELYAEASTL"
     gene            complement(28879..29271)
                     /gene="a-gt.4"
     CDS             complement(28879..29271)
                     /gene="a-gt.4"
                     /note="similar to T4 accession NP_049677.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81364.1"
                     /translation="MSPDYEVDLSTGEEELSSSFDQELLEMQDRIEKQAEKQAAKHLK
                     THGREIKRLKKHAERALFANNKEQYVYAIDKLRTLYKQKLLPKHAMITMFETSRAQIV
                     DMAKSLSTAPTIQSDVEYHQQTVPVCSL"
     gene            complement(29261..29485)
                     /gene="a-gt.5"
     CDS             complement(29261..29485)
                     /gene="a-gt.5"
                     /note="similar to T4 accession NP_049678.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81365.1"
                     /translation="MKTNLKLDLESLFDSVCGEVDLMSYFVKLQMRDYKIPVEINPMN
                     ISWQPFEVTSGQLDWHIDAETMTMEIEYVA"
     gene            complement(29463..29981)
                     /gene="55"
     CDS             complement(29463..29981)
                     /gene="55"
                     /note="associates with host RNAP; similar to T4 accession
                     NP_049679.1; gp55"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma factor for T4 late transcription"
                     /protein_id="AAQ81366.1"
                     /translation="MNYVDNKALYQNICKWKQDMREAGHHIKMPDSIGIDILKIAKGF
                     TGYWKFTGYTQNWKDGMVADAVESVIKGLVNFDEHNYKNPHAYITQACFNAFIGYIKS
                     EKREMATKYRYFLTNVYDEHDSDMSRIADEGFIQDIHDKLVVYEASIKSKKKDKPELP
                     NLDNFYEDEPET"
     repeat_region   complement(30052..30163)
                     /note="44RR; 6 copies of repeated sequence detected in
                     intergenic regions of genome"
                     /rpt_type=direct
     gene            complement(30272..31711)
                     /locus_tag="44RRORF048c"
     CDS             complement(30272..31711)
                     /locus_tag="44RRORF048c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81367.1"
                     /translation="MKLYTLSAIPAAGKTAAILNHIFETNEKAIIASISRQLSKQSFE
                     YFIGLGGDGELVDTDNRQGQKSVHDAVLKAAESNDVIFITHAALLGLRNIDSLKDFNL
                     YIDEVPELTSFERFTFTTSVESHILELCKIDESGLLELREEYRKAVNKMALDGYRGTD
                     DIYSTLFPLYKALLTGVPVRLSVEGGVTQCYYVNDASSDDWSKFKSITVCSANFEQTF
                     TGMVMKHFNGWEFEESPLKNRLAFHVYPKTARVKINVMFDDDWSRYKADKEVDGISNY
                     TRIENMLDTLINGEFIYTRNSYRPRMPKGIEVPYNPHGLNNYSDHTNVVVLFSYNPAP
                     WQVPILKELSSVVGLDENALVDAYIVSKYLEPAFQLCARCDIRNEHSLKPINLYVPDM
                     KLAKYMLRYLPDAEICVGDSIANHKQIKRNRESFQALYQMTEKERFSYKYLLRKLGRI
                     LDINSPEDQELVQDWIIKIREKARKKASK"
     gene            complement(31708..32271)
                     /locus_tag="44RRORF049c"
     CDS             complement(31708..32271)
                     /locus_tag="44RRORF049c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81368.1"
                     /translation="MAFYTGIGSRETPEHICRLMKDIAAVAAVRGYTGRSGGADGADD
                     AFEQGFLAIAPELKPDNHAEFDVYIPWKRFNGRFAPKHERHNIITGGDSWKAFEIMKT
                     IHPVYKKGGSLSRGAEQLHTRNVFQVLGYNLKTPSDFLVCYSIPTADGVSGGTNTAWQ
                     LALRHGVECYNLYNQFDIERLKEFLDL"
     gene            complement(32271..32525)
                     /locus_tag="44RRORF050c"
     CDS             complement(32271..32525)
                     /locus_tag="44RRORF050c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81369.1"
                     /translation="MEFKIIVKSSAKGPVDQYIANLKNAGRVGPGESEMHILRNFEGV
                     DIVFHAEGYNPDLYAELKRHVCYIVNTVKTPTGASVIGWF"
     gene            complement(32525..32992)
                     /locus_tag="44RRORF051c"
     CDS             complement(32525..32992)
                     /locus_tag="44RRORF051c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81370.1"
                     /translation="MRNKCFSYAYADVEFDFSEIDYLGSSISVVTDAFMLCGTYPYKK
                     FQFAMMPESGNGFVSQNIAFISADVGETDQYLAEAFTFKELRKIVEHTPARDYLEIRI
                     SSKKLLVNDLARILSNVVSELASIEAEMAQLPKRDYNKVVSNALRKITLTPEI"
     gene            complement(32992..33348)
                     /locus_tag="44RRORF052c"
     CDS             complement(32992..33348)
                     /locus_tag="44RRORF052c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81371.1"
                     /translation="MNIFNINLNLNVMHEYNIVIAPQIKVLRDKGVLSNVEELSTANS
                     FRPGNLVMLYKCQEVDEEVKAAMEQITHLADAFWHSGCIHKFTHDAYVTNGNSVFAVL
                     KCLRCGESFSKNLREI"
     gene            complement(33349..33711)
                     /locus_tag="44RRORF053c"
     CDS             complement(33349..33711)
                     /locus_tag="44RRORF053c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81372.1"
                     /translation="MNVTIYECEFTGVVPGRMIKSYYEHADVPTLKTLGFKVEWSVVH
                     LAGGAVYRARIYKGRSDRFDRSTSFPIVRKIFKDCDATNVFMCDHTPSHMQYMKVGQD
                     VYEICKCHDCGASFKFEV"
     gene            complement(33708..34046)
                     /gene="55.2"
     CDS             complement(33708..34046)
                     /gene="55.2"
                     /note="similar to T4 accession NP_049681.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81373.1"
                     /translation="MSNQFIAVRNFTVHTCAAKFATDNILGNRISEEQINAVENEVWE
                     AATAAGVTGIGRQAIRSVIVQYISEEFGTQALGHTPTHIGPKTMAEDAYKKYQGKARK
                     IRQEIYGSKK"
     gene            complement(34114..34902)
                     /locus_tag="44RRORF055c"
     CDS             complement(34114..34902)
                     /locus_tag="44RRORF055c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81374.1"
                     /translation="MIVRLNPEEGEIFEKPGNMNYPGIVHYDAARMNYYYVKDGIRHT
                     AASSRNLRKGIHVEKTLEKIYNPYVPTQKVKVEKMAQVSSQLQYEDLNCDVRVVSSEY
                     ANANARDLAKYSKLSSIADIVEVSSQGINTDESYWKTSSSGYKALLSIPPVVCFEDPG
                     AATKFCELVKSMYPNSCAKQFLELEFGRLSMNDVPSNVTKHMTWPESRGAFYIITVVH
                     IGNGVEFGVRSVTGRDVSKIFNSTTSAGRVELFVDYCRRTASKK"
     gene            complement(34944..35531)
                     /gene="e.6"
     CDS             complement(34944..35531)
                     /gene="e.6"
                     /note="similar to T4 accession NP_049742.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81375.1"
                     /translation="MSFKKLAQFIRTKVSVFVTKNVSIEDQYTQAADQVITEITKLEK
                     VFVKSEKEEARLRKIASEKEIEAIRKDDEIRRLITKNIPVDTHAKLAILYRRTGLALI
                     NKADELVKMRDEIKHAVVSLDNQRQDLAVKLEYIRETRNAESLGISCADDVVELAALT
                     KIDVNDVMMRIETFNGDKRTEVTSSEVEDYINSLK"
     gene            complement(35541..35891)
                     /locus_tag="44RRORF057c"
     CDS             complement(35541..35891)
                     /locus_tag="44RRORF057c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81376.1"
                     /translation="MLDVKNVIDDMDKMFSLIGYKPNNGKAWTGYVDAEGKGRQPITW
                     QTAKMVGINIWSDMCQHYKLFGIVATDEQIRNIRAFAKNNQRTVGYSNMLAYSKKRGE
                     IKTMRILSIPMSTK"
     gene            complement(35991..36266)
                     /gene="nrdH"
     CDS             complement(35991..36266)
                     /gene="nrdH"
                     /note="related to T4 thioredoxin but has glutaredoxin
                     activity; similar to T4 accession NP_049686.1; NrdH"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="AAQ81377.1"
                     /translation="MIEIYGIVSETSRCPACDVITKRLDEDDIDYTIKTVLRDAETEL
                     GFEYDRAVINELRDRINQPKGALSLPKVFVNGAFIGGAQALLDYLDN"
     gene            complement(36263..36571)
                     /locus_tag="44RRORF059c"
     CDS             complement(36263..36571)
                     /locus_tag="44RRORF059c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81378.1"
                     /translation="MMFTEAKCIVNRPRPVFNGLEYEGTSVGQMLKLIHVLHGPGDSY
                     DVEYREMVENGHVKTRVGLASYEWILARAFTPGVELTKVKPSKVTMSRWCSMDQWRHQ
                     "
     gene            complement(36568..36879)
                     /gene="nrdC.2"
     CDS             complement(36568..36879)
                     /gene="nrdC.2"
                     /note="similar to T4 accession NP_049700.1; NrdC.2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81379.1"
                     /translation="MDIELHNEAQKQIRDMEWAIRSANIAKFRELRISEKSVSDAISN
                     YHLSNEYDEILARRKAVADQHFKCPLCDTEQIQLVSWQHKVVDLRCRRCKHKFIWESP
                     V"
     gene            complement(36941..37039)
                     /locus_tag="44RRORF061c"
     CDS             complement(36941..37039)
                     /locus_tag="44RRORF061c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81380.1"
                     /translation="MEGYIVKNKFVRTDEESQSKEVEKENPKEAEE"
     gene            complement(37073..37975)
                     /locus_tag="44RRORF062c"
     CDS             complement(37073..37975)
                     /locus_tag="44RRORF062c"
                     /note="similar to RB69ORF134c hypothetical protein
                     accession NP_861824.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81381.1"
                     /translation="MIIIGSRAMQHHFHPEVAPTTQMDHDFISTADEWAEYQARMDGR
                     PVTVKNPNVKAFVVGDGKSRCCYHETYIVRPGSSDEMIYELMGNPQGTVYATPEILLA
                     IKMAHRFKKNTRNFIKTMVDIHVMRDNGVVMGPVEQRIFELREAESLNYGHPKLNVNK
                     GAFFKDDIYTYDHDSIHEAVAVNGIPAYKSYMADGAEVMTSKSKFFSCDEETRILGVY
                     EESCVLALERCLIPFPGKVDPTEAFMMALEKVCTSITSGWFREYAWENYHPVMMVYLR
                     KRRTDEAYQNLFNKNKHLLRPHHK"
     gene            complement(38020..38238)
                     /locus_tag="44RRORF063c"
     CDS             complement(38020..38238)
                     /locus_tag="44RRORF063c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81382.1"
                     /translation="MARSDVLVEKAKELQKLLIEVNDLASENNYGVQINSDNSIEFDD
                     WLSSSCYGEGDEAFNIESDGSVWMSSSC"
     gene            complement(38252..38572)
                     /locus_tag="44RRORF064c"
     CDS             complement(38252..38572)
                     /locus_tag="44RRORF064c"
                     /note="similar to RB69ORF139c hypothetical protein
                     accession NP_861829.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81383.1"
                     /translation="MLILKELQKLQAKIARIEDSICDFVEGDTSDKAKAREITREVMS
                     ISDSAEQLAETIADVAVITLSTGDYGYGRTYYPKGHSSWEESTASEKGDDENGYWLSS
                     SDNC"
     gene            complement(38653..40479)
                     /gene="nrdD"
     CDS             complement(38653..40479)
                     /gene="nrdD"
                     /function="converts rNTPs to dNTPs"
                     /note="similar to T4 accession NP_049690.1; T4 gene
                     synonym: sunY; NrdD"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic NTP reductase large subunit"
                     /protein_id="AAQ81384.1"
                     /translation="MTIRTQVKELVRGQSESHNENANKNADVIPTMRDMMASIASKDF
                     SASILPIHLLQAHKSGDIHIHDMDYAFTIPMTNCCLVNLGGMLSRGFKMGDAHIEQPK
                     SFGVACAIMAQITAQVSSHQYGGTTLANIDQVLAKYAVKSWEKHLAMARRFGLPNNDA
                     GIYADELTQKEIYDGIQAFEYEVNTMFTTNGQTPFVTITFGMGTNWFEREIQKAILNV
                     RIKGLGKNGITPVFPKLVMFMEDGLNLCKGDPNYEIKQLAMECATKRMYPDIISAKNN
                     RSITGSQVPVSPMGCRSFLAGIESGELNGRNNLGVVSINIPRIAIESNGNVDTFYELL
                     KSRFAISYEASMERIKWLKGAKAKVAPILYTEGAFGLYLDPEEEFLPHLKPRASISIG
                     YIGLYEAALHMTGESTAASPRARKFAEDVAALMHNMCVDAKNESGWSFSLYSTPSESL
                     CDRLQRLDREKYGVIPGVTDKDWYTNSFHVPVEAELNPYDKIDFEKNFHWIASGGHIS
                     YVELPNMRRNIEALEQIWDYAMENLSYFGTNTPVDKCYDCGYDGEFKCTSKGFSCPAC
                     GNHDSSKMSVIRRVCGYLGAPLARGFNKGKQSEVAHRVKHVK"
     gene            complement(40476..40949)
                     /gene="49"
     CDS             complement(40476..40949)
                     /gene="49"
                     /note="similar to T4 accession NP_049692.1; gp49"
                     /codon_start=1
                     /transl_table=11
                     /product="EndoVII packaging and recombination endonuclease
                     VII"
                     /protein_id="AAQ81385.1"
                     /translation="MLLNSKSSDELKQKLFHAQGGCCKLCKNEFDGPYNKQHLDHDHA
                     LEGRNAGKVRGLLCARCNMLEGMIKHKFIRSGLRGRDVDYIEWMRELIEYVDSDYSDN
                     PVHSQYLGDMVKQFSKKSLPDMRLDMQERGFDYNDKDVKAELIKKFRKQFKKAIQ"
     gene            complement(40979..41386)
                     /locus_tag="44RRORF067c"
     CDS             complement(40979..41386)
                     /locus_tag="44RRORF067c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81386.1"
                     /translation="MQRLTLKFTPFEPKDDRNTFMVKMHFSDKFSDATLEYEIPAIDA
                     DRTKAEIVRLITFMDKCKAEYPRGKGGQADFNHIPDYYRYFGEEAEGVELWEEYGVEG
                     LCWPCHECDYPKNFKGYEIIYTGPDGNKFKVTR"
     gene            complement(41352..41621)
                     /locus_tag="44RRORF068c"
     CDS             complement(41352..41621)
                     /locus_tag="44RRORF068c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81387.1"
                     /translation="MNMDINDYAKEFTREIGRNIHVNLLSTDPEQVKSTIFWTFPGIT
                     EVRIGSSTYFAQNGKIYNATIDYNAKRVIMAGEANAETNTEIYTV"
     gene            complement(41618..41824)
                     /locus_tag="44RRORF069c"
     CDS             complement(41618..41824)
                     /locus_tag="44RRORF069c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81388.1"
                     /translation="MQIKLTKEDWESAKYQNDQNEYPVELELFDQLKTVFSIPQIKYV
                     YLSYEEFNSIMPFIPRRSGFSHVR"
     gene            complement(41809..42084)
                     /locus_tag="44RRORF070c"
     CDS             complement(41809..42084)
                     /locus_tag="44RRORF070c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81389.1"
                     /translation="MNRIKELFDKAVKWYEQEWYYGKWIVSGNADSYLVKYLTFDGEF
                     GLVPSFYSQYYDGHKLNRLRLFVVSIEWGHVVYSKNQWEKEMKCKSN"
     gene            complement(42081..42260)
                     /locus_tag="44RRORF071c"
     CDS             complement(42081..42260)
                     /locus_tag="44RRORF071c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81390.1"
                     /translation="MKIVLDVCKAQKRLQWADLDEPMKHEKRCMIERIMKLNCEYVPR
                     IQLDLSEYDLIKGWL"
     gene            complement(42299..43753)
                     /locus_tag="44RRORF072c"
     CDS             complement(42299..43753)
                     /locus_tag="44RRORF072c"
                     /note="matches Pfam NAPRTase nicotinate
                     phosphoribosyltransferase; similar to P43490 Pre-B cell
                     enhancing factor precursor"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81391.1"
                     /translation="MKRIPLIAMTDSYKITHWNQMPDGTDEVVFYVEARGGKFDNIVI
                     GGIEYMMTKLQEIITNEDVAEMHEMSKAHFGQDVFNRKGWDEVVAYQQKHGCLPIQID
                     AVPEGTVVPVKNVVLTVRCKAPYTWVAGWFEPVILRAVWYTSTVATLSRECIAMIRKH
                     LIDTTDLVVDSPEFNFVLMTRLHDFGSRGVSSGESAALGGMAHLYNSMGTDTFESLYL
                     AKHLYGAKMAGISVPAREHSTVTSWGAERETEAYMNSVRLFGTGAYSVVYDSTDFKRA
                     VREIEGYKDEVIAKGGTLIVRPDSGDMFDNITYALETLGEIFGYETNSKGFKVLNKHC
                     RIIQGDGIDGPEIIDEVLTMMADNGWAAENIAFGMGGGLLQMVNRDTCKWAMKMSAIK
                     INGVWYDVFKCPKGAEWKASKKGQLGLRKLDDGGFYTDSKLADGSQMLYNVKLSQGFV
                     ELMSESALVNYHHPLKGVQYNSSLAQVRSRTSIK"
     gene            complement(43756..44406)
                     /locus_tag="44RRORF073c"
     CDS             complement(43756..44406)
                     /locus_tag="44RRORF073c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81392.1"
                     /translation="MTKHKDLNRFLKNTHDTTGNKYRKSRDLNSRFADKHHFMRLLNN
                     LLPSEMKWSSFGSRFGIAKISPNHINLAAVGTHSVCGTIWVNTSFESDCVTNRLQTLE
                     AYGVFVEVARRTNGSNHVVTFSVDLPNGDKAPVKNVETKTEVVSTVDYTEPAKEPDGQ
                     NIFFAPETMQAVQLVRGVFHFASVRISEIDEEIKELQARRKEIEDNIKSIKNAIGA"
     gene            complement(44403..44549)
                     /locus_tag="44RRORF074c"
     CDS             complement(44403..44549)
                     /locus_tag="44RRORF074c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81393.1"
                     /translation="MSTKNIVINAGYIASFGLFYAMYKGDAYFVLGCAAAVIGSTIIA
                     RLIK"
     gene            complement(44623..45324)
                     /locus_tag="44RRORF075c"
     CDS             complement(44623..45324)
                     /locus_tag="44RRORF075c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81394.1"
                     /translation="MSSGKAIARTIKKHERRRFNDIAAIRNVLNSMTDPRLDCIHTRT
                     VLRIMGVSGEKTQWPTHQFGSRFLPVWFWTKVDRVMKETLLHPRGSVVETEYHYHAAK
                     ATVREIKLSLNDDAVKIARLLGIEIFSTNWAHYHNLAVLTRTRRIETIEKKTRVRPAK
                     PKAVEMHASTERIDQVERSHTGENLEGLTDQLKQISELTIKLEALSDEACDVKHKILN
                     LRAEVKRRLSEDFGI"
     gene            complement(45303..45599)
                     /locus_tag="44RRORF076c"
     CDS             complement(45303..45599)
                     /locus_tag="44RRORF076c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81395.1"
                     /translation="MELEIIKVYLESKIQLESLFGNSVGEVEIFKSHWMIRDGFVFIG
                     DPPIDPNLCVVFEKVRYIHKSNEIHAIMVDDYVSETHKIICLFPEKKICQVEKQ"
     gene            complement(45599..45919)
                     /locus_tag="44RRORF077c"
     CDS             complement(45599..45919)
                     /locus_tag="44RRORF077c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81396.1"
                     /translation="MEIDDHKSWVWISSEGYPHVVIGCSEHPIEEIVENEHFESHTGF
                     ENVKQRLLDNYGHHDVKMLEEELPWVTTALNHAAAGRTLSYIGLCDRSGMNIINSFFV
                     IGCS"
     gene            complement(45919..46230)
                     /locus_tag="44RRORF078c"
     CDS             complement(45919..46230)
                     /locus_tag="44RRORF078c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81397.1"
                     /translation="MIHASEMRKIIKVHSQCLIDDVACHFDDFFNEHVKPRLVEMNGD
                     TAVDTSGFLNYVRGKIKFNYLHDGDVIERFISELRETGYVAESRTSPMNPDFITIKVP
                     K"
     gene            complement(46227..46472)
                     /locus_tag="44RRORF079c"
     CDS             complement(46227..46472)
                     /locus_tag="44RRORF079c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81398.1"
                     /translation="MKITKATNLQSIDFAKRQSAKEIANKPVTRIDAITGTFATTMIG
                     VGAAMCAVGETAMAIKTFGATIVFSLVVIAITRGLNK"
     gene            complement(46547..47521)
                     /gene="nrdC.11"
     CDS             complement(46547..47521)
                     /gene="nrdC.11"
                     /note="similar to T4 accession NP_049709.1; T4 gene
                     synonym: tk.-11"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81399.1"
                     /translation="MQKVIFEGLHGSHLYGLNTPESDLDMKGIFIPDPKDILLSQVKS
                     SYSITTGNDKSKNSKDDIDIEMFTLKQFIHECVKGETAALDMLHTPTDKIVSDSAIWQ
                     FIQSQRSSFYTTNMTSYMSYVMKQAAKYGVKGSRLAALRQVKDFMDALQIHENPRLRE
                     LKIPLPSNEFCFWTVDREKPETNSYYTMMGRKYMAGVKIAEFAGAVDKLWNEYGERAR
                     KAEANEGIDWKALSHAMRGGLQLLEIYQTGDLKYPLANAEEIKLVKAGELPFKEVQAR
                     LEQIVDDVDAAAKEAGRNGMPSAVNVEPWNQFVLDVYSDAMLEYLKNR"
     gene            complement(47531..48034)
                     /locus_tag="44RRORF081c"
     CDS             complement(47531..48034)
                     /locus_tag="44RRORF081c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81400.1"
                     /translation="MKDICIRKKVKSTKQKRIAPADVFKYKDGRWECITVNSNSTENP
                     VLVIRKKMTRIVMIIELRLLNGICCFDFKEVSPDGIRCWSDICANSEINITGGNFTIA
                     DEIEETVSVPIEVGDTFNHKWDVKYVVKFIADDGSLIAWDEERRKSIFVNRNDRDQLK
                     AYGMTLN"
     gene            complement(48034..48378)
                     /locus_tag="44RRORF082c"
     CDS             complement(48034..48378)
                     /locus_tag="44RRORF082c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81401.1"
                     /translation="MQFYKFKDDSELIEEFINGTGVNKVIHRILGKWIFGLVNTGNKN
                     HFIAIDRNGQRINSGYDYEFNASEVSKYLEITDAPLIESGDLIEWVKNHNLGELPFDK
                     VLKMYEIAVGEI"
     gene            complement(48451..49509)
                     /locus_tag="44RRORF083c"
     CDS             complement(48451..49509)
                     /locus_tag="44RRORF083c"
                     /note="matches Pfam NUDIX domain; similar to sp Q55928 NMN
                     adenylyltransferase/NUDIX hydrolase and phage Aeh1ORF282c,
                     accession: AAQ17949.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81402.1"
                     /translation="MTYDYDRAVVIGRFSSFFHRGHEMLIYKALQTAENVAVVFGSSH
                     CYPNTINPLPTLVRVRMFKEWMSENLTPYEQKRVTFGNVPDYRYNEDRWQAEVREQAG
                     EKAGEKVAMVAYDKDADSYWIRSFGWDHIQCMGVQNHGADISNTPMRDEFLRTGVING
                     AFPINPTVRSFLSVYWNTEGRELRDRLMEERKMWDNELAKFENYPYREALNCNTADAV
                     VTCNNHILLIERKHAPGKDALALPGGHKNANETFQQCAVRELFEEVKIEVKEKDIIGS
                     IKAHEVFDHPKRTAEFCKPTVAYYIVLSPGPNGELPAVNADDDAKAAFWMPMHIYKKN
                     RARMFDDHAEIISRFTGI"
     gene            complement(49514..49756)
                     /locus_tag="44RRORF084c"
     CDS             complement(49514..49756)
                     /locus_tag="44RRORF084c"
                     /note="matches Pfam TM2 domain E=6.7e-15"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81403.1"
                     /translation="MKSTAIAYVLWFFLGFLGIHRFYTGNIATGIIWLFTGGLFGIGW
                     FIDLFLTAGLVQSSNVRWRLEQAEMNFAINSYKNRG"
     gene            complement(49753..50121)
                     /locus_tag="44RRORF085c"
     CDS             complement(49753..50121)
                     /locus_tag="44RRORF085c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81404.1"
                     /translation="MRIERYAFADAEAIADFTAVVGSVETNTQIADIVGLRPFYIVFD
                     GYDSAIEIRETKGGLSLASDYDPVFFPNEIEQYLKRLPDVADINDELTHAELLEKLED
                     VQKRLAAVEDRLKQLEGVAK"
     gene            complement(50163..50546)
                     /locus_tag="44RRORF086c"
     CDS             complement(50163..50546)
                     /locus_tag="44RRORF086c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81405.1"
                     /translation="MKLILRTANAGKTQEAIKSAFEAAQHHEVMFVSDEMPYTEILRR
                     LTAFSSENPAMQNRYIISTALAQAKPEMFDDLEAFDQYGTIVLDVNYAMSRAPWIKVI
                     SRLEEAGFNVVATQMLVKPVAPTFH"
     gene            complement(50748..51065)
                     /locus_tag="44RRORF087c"
     CDS             complement(50748..51065)
                     /locus_tag="44RRORF087c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81406.1"
                     /translation="MNIQKEIQEIEKRLGVEASEFKMPSVWKVARKPDWSYGAVFEQE
                     FTAYEHKELGCFVAVYSERHRAQFVNTEGEDVIGHTERVVSVQHVEPYKTRLGTSWRV
                     VNA"
     gene            complement(51067..51267)
                     /locus_tag="44RRORF088c"
     CDS             complement(51067..51267)
                     /locus_tag="44RRORF088c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81407.1"
                     /translation="MKTKFKMPTSGQFVATWIHNHKPWADTFKWCHGVLKVANEHGDF
                     YETVDLSDYRDVFKNAKFLMVK"
     gene            complement(51382..51762)
                     /gene="rI.-1"
     CDS             complement(51382..51762)
                     /gene="rI.-1"
                     /note="similar to T4 accession NP_049716.1; T4 gene
                     synonyms: tk.-3 and tk.-4, mobD.6; MobD.6"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81408.1"
                     /translation="MEIKFSDVVKSPTNIFDEFIGACLVSSVMAHSAHFETKSYEKHV
                     AFEYFYDEMPDKIDTFAETYMASGFNYSPTLKIPNVDFTGFVKRLAELAEEVATKSPN
                     GVLKNAADDIQQLCRLTLYKLSLS"
     gene            complement(51743..52027)
                     /gene="rI"
     CDS             complement(51743..52027)
                     /gene="rI"
                     /function="acts in concert with phage t holin protein for
                     lysis timing"
                     /note="similar to T4 accession NP_049717.1; T4 gene
                     synonyms: mobD.8, tk.-2; rI"
                     /codon_start=1
                     /transl_table=11
                     /product="lysis inhibition regulator membrane protein"
                     /protein_id="AAQ81409.1"
                     /translation="MPKIIAAVALLVATVHLVSANPEVGSYDEFMQGAMIVYTNDITH
                     SKDNSVQFLEYLDTKWGSAGCSDTCFQLGYQEAKLFVAYNTEVQNGNKIQ"
     gene            complement(52181..52495)
                     /locus_tag="44RRORF091c"
     CDS             complement(52181..52495)
                     /locus_tag="44RRORF091c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81410.1"
                     /translation="MQVTSEMVEELEFAAQEVLMDLNSWQSNPSTVMGFAYGQGHPVA
                     KAMQKNIDTYGRYTEQIDSSLFESPEAYHAFIAALCNSIPAYFTRFMKCWKEQGPRKA
                     SK"
     gene            complement(52479..52691)
                     /locus_tag="44RRORF092c"
     CDS             complement(52479..52691)
                     /locus_tag="44RRORF092c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81411.1"
                     /translation="MEYPRYIIGRPETLRPAVAALFEDFCLNGLIHLAETEIPAVFNH
                     EFGIETQQVSIIVKDIMKELGFASHI"
     gene            complement(52691..53881)
                     /locus_tag="44RRORF093c"
     CDS             complement(52691..53881)
                     /locus_tag="44RRORF093c"
                     /note="matches Pfam GSP_synth glutathionylspermidine
                     synthase domain; similar to sp P24196 hypothetical protein
                     ygiC, P33222 hypothetical protein yjfC"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81412.1"
                     /translation="MKRLSIEARKDWLPQLTSEGVLWTTTEEGPYWSEAMAKPVYYSF
                     TKAEQQELELAANTLHGMCIDTLRWFFEEASFAQRLRVWDMFNIPENARQMIIDSWSA
                     DEWGFYGRFDFIMTKDGPKMLEYNADTPTILIESSISQWNWFTQNNFPNHYQFNEIHE
                     SLVNHWADMKKLNGLNGCLNIVATSQVDDFATIAYIGETAAEAGIPVNVFDISEIQMS
                     DAGRFYDQQDRLMEYCFKLYPWEWMMEDEFGAYAHKSGTRFIEPAWKMMLSNKALLVL
                     LYERYPNCKWLVPAYEEDDFDRLNLFTFENPKWVSKPLLSREGSNVHIFEYGGESEST
                     DGNYAEEPRIVQEYIEWQEFDGCYPMIGVWMVGDDAVGLGIREDDGRITGNNSRFIPH
                     VVEN"
     gene            complement(53881..54111)
                     /locus_tag="44RRORF094c"
     CDS             complement(53881..54111)
                     /locus_tag="44RRORF094c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81413.1"
                     /translation="MIYIGQKYRITKPINKCHIAKVGDIIEISKIGRYGAHSMDISID
                     DNGNPYNGILMFEGPYTLQEYWEKVEMCLEAV"
     gene            complement(54121..54309)
                     /locus_tag="44RRORF095c"
     CDS             complement(54121..54309)
                     /locus_tag="44RRORF095c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81414.1"
                     /translation="MIFEIDSEKGIEAKAKFLENLKWCADDLDRKTTFRMLSNVIGYE
                     EARRYANGHGLHNSYYFS"
     gene            complement(54384..54992)
                     /locus_tag="44RRORF096c"
     CDS             complement(54384..54992)
                     /locus_tag="44RRORF096c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81415.1"
                     /translation="MQKQLKMGIMAAFVSAALSGCGQANTDDTFTYNGLGGEATPTVT
                     AVSAQQCAELGGGSLEQCQSAFDKAKMEHIDSAPKFNDQASCESGTEAICNRTQIQNS
                     DGSFSDVFVPAMVGMIVGQMMSNNSRPMPVYAPARPEDRKNGFVTSGGAYVPPAKGSV
                     GANTFSAPKTPGSFSKPSPSSKPSFSSKGGFGKSGSFGSSGG"
     gene            complement(54997..55215)
                     /locus_tag="44RRORF097c"
     CDS             complement(54997..55215)
                     /locus_tag="44RRORF097c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81416.1"
                     /translation="MKGFTLIELMIVVVIIAILAAIAIPAFSSNEIYNPVERACPNGM
                     ATALTPAGEEVLVCRKTPVNAGSFKIED"
     gene            complement(55269..56192)
                     /locus_tag="44RRORF098c"
     CDS             complement(55269..56192)
                     /locus_tag="44RRORF098c"
                     /note="matches Pfam Band_7 SPFH domain E=9.3e-06"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81417.1"
                     /translation="MRNQSKMPKLTKKQTLIGAAVAGAIIIAANVFAVVDDGSVATTT
                     FLGKVSPNIMQPGLNVINPLASVDTYSTRDLKMEFTNVQVPSQDKLKTSVDITLMLRF
                     DGDKAQAVRINGGTERQAIDKYVAKKFESTVRESGKNIKKAQDLFGDATTQSMLQELI
                     KSEVNEYSKPFGYEVVEVFLQEITLPKLIQDQVEQTKIREEAVNQAQADLDKAEKVAQ
                     QQVKTAEAAREAREQNAVANERDADAKLYAAGKEAEANSLLQKTITPEMIKWRQLEVE
                     MIRANKYQGGVPQTVVGAGYDGQMLMDMRSK"
     gene            complement(56208..56471)
                     /locus_tag="44RRORF099c"
     CDS             complement(56208..56471)
                     /locus_tag="44RRORF099c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81418.1"
                     /translation="MKSSDVYAQVLMAQQFATEELKRKLAPVGKFVADEMIRQRSFKI
                     SFDVAKFPAIMPKDIVDYLRSLGYDAKSDSFRNESVITVTAKP"
     gene            complement(56544..57119)
                     /gene="tk"
     CDS             complement(56544..57119)
                     /gene="tk"
                     /note="similar to T4 accession NP_049719.1; Tk"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidine kinase"
                     /protein_id="AAQ81419.1"
                     /translation="MAKLHFHYAAMNSGKSTHLLQVAYNYMERNMKPLILKPAIDTRD
                     GDNVSSRIGISQKAHMISQDDNLKAFCEKLIELDGIDCILVDEAQFLTVDQVHQLGDV
                     VDYINVPVMCYGLLSDSNGHLFPASAELLVLAERKVEHETICWCGKKATMTMRMNEHG
                     EKIWGPRVSIGGNDRFISVCRRHWKEGKIQK"
     gene            complement(57119..57592)
                     /locus_tag="44RRORF101c"
     CDS             complement(57119..57592)
                     /locus_tag="44RRORF101c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81420.1"
                     /translation="MALEIERKWVVPVFPFKKNVTYRKQDIAQFYHKGARYRSVMEAG
                     CEEVFIKTVKTGLGLIREEIETFISRDEAWEIHRMAGYPECIVKQRWFIPTGYSHHII
                     ELDILKTGEIYAEIEFKSEYDALNFTAIPTWFGPEVTEDIFHTNYEIYKRLNGVF"
     gene            complement(57582..57914)
                     /locus_tag="44RRORF102c"
     CDS             complement(57582..57914)
                     /locus_tag="44RRORF102c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81421.1"
                     /translation="MKFPKHLLRELIGEKFEIVPGEGVPSDFCGSYETLVNDIIDQGR
                     WTVEYDFVFSFEKDMIKRNFRAPYRTGATECQDEMPWENEGEFVEAEEVEQYEVVTVG
                     YRRKHNGA"
     gene            complement(57911..58108)
                     /locus_tag="44RRORF103c"
     CDS             complement(57911..58108)
                     /locus_tag="44RRORF103c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81422.1"
                     /translation="MAANKWQKPGPVMNRVFEEAFIGLLGDGCENIIVHSFKDDGDEV
                     IVNFELVVGGKLIINQTRLIA"
     gene            complement(58095..58583)
                     /gene="tk.4"
     CDS             complement(58095..58583)
                     /gene="tk.4"
                     /note="similar to T4 accession NP_049723.1; Tk.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81423.1"
                     /translation="MIVQYVKGNAISLFLEGKYDIFGHGCNIFNRMGSGIAKEVRERL
                     PQLYVMDLKTVSGDRNKLGTIQAALINVEGRTSCGVNMYTQATFWDPTDMLSYDAVRS
                     TFTMLNDSVAETSVGGSNMTMCIPMIGAGLARGDWSKISAIIDEVTPNIDITVVEFDG
                     SK"
     gene            complement(58580..59020)
                     /locus_tag="44RRORF105c"
     CDS             complement(58580..59020)
                     /locus_tag="44RRORF105c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81424.1"
                     /translation="MKKSIATLIAIGMYGCSAVAPVTANVNEMFHFPQKSGVIQEFTD
                     ENGTYESALSASCDREVREQYDNCLGIVFNSDYWLIDGARDDKNILVGTERVMISLNG
                     IVQNVDYIRSGSAIVIRRMDNPTFNPIGDVLSITTSSGKGEFTL"
     gene            complement(59044..59271)
                     /locus_tag="44RRORF106c"
     CDS             complement(59044..59271)
                     /locus_tag="44RRORF106c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81425.1"
                     /translation="MKVRFKSKISRGEFIAIRPANKVIAEFLGMNWWPSENRLNDGTI
                     EIVDSNKNCIEVEGFYIMIFMSERKFFEIIV"
     gene            complement(59336..59887)
                     /gene="vs.1"
     CDS             complement(59336..59887)
                     /gene="vs.1"
                     /note="similar to T4 accession NP_049725.1; T4 gene
                     synonym: vs.2; Vs.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81426.1"
                     /translation="MRFLTILILLFTSHVFAGPSAPDFTDTQKTNLSYAYYYGKGYDL
                     MGNQRDVDHPNFLNQRHLGTLFAAIAWEESSAGLNTGRSKKGHHAYGMFQNLYKTVVK
                     KMDQRGIPFRHWYLKKDLETRSGSAEWAMDELHYWLTVRKGNIRLALASYNAGWNYKA
                     GLGYADRVLSKNQRLKSMEFIYK"
     gene            complement(59884..60333)
                     /gene="regB"
     CDS             complement(59884..60333)
                     /gene="regB"
                     /function="cleaves a subset of T4 mRNAs at GGAG using
                     r-protein S1 for recognition"
                     /note="similar to T4 accession NP_049726.1; RegB"
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific RNA endonuclease"
                     /protein_id="AAQ81427.1"
                     /translation="MNRYKLRRVLEDKFKEINSRIEASRNTRQGSHKFHLEYTYHFID
                     DLIIRKIDVDYVLQLVNRIDDHLDAIDEHMSLPYPPTLDLKRDDQVQYRPIRLEITDG
                     NLWIGLTTSKIPPSGEYSSAITCRMAIVNSRRLSSNVTTRVIKVEGL"
     gene            complement(60432..60659)
                     /locus_tag="44RRORF109c"
     CDS             complement(60432..60659)
                     /locus_tag="44RRORF109c"
                     /note="similar to sp P06544, P12243 Thioredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81428.1"
                     /translation="MIYLFGAEWCANCKMVKPMLANVEYTYVDVDTDEGVELTAKHHI
                     RSLPTLVNTSTLDRFTGVPRNVANLKEKLGI"
     gene            complement(60879..62591)
                     /locus_tag="44RRORF110C"
     CDS             complement(60879..62591)
                     /locus_tag="44RRORF110C"
                     /note="similar to eukaryotic NDP reductases and T4 nrdA
                     accession NP_049845.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81429.1"
                     /translation="MKAQSKFESVSAERKYLQSIGEIPEFYTTQGWSMFKKNYQYKGE
                     TVRGAFRRVASTLAKHDIRPEAEERYFDLLWSGKLAMATPVFCNTGTDRGMPVSCAGS
                     YVGDSVLDFYEGQTEVAMLAKNGFGTASYLGDIRPRGSDISTSHNKADGLVPVFDNFV
                     NTKTKVAAAGRRGEWAGYVDFSHGDFWELQGYVLKNPASAHVGWVFEKEDYEKLKARD
                     PEYMARWNELMYMRARTGKGYMWKNWIANELAPQAIKNSGIPIRSSQLCTEIALPSDD
                     MHTFTCILSSLNVSLWDEITADDIKWSVRFLDSVCSEFLAKAKELSYDTLHKAIRFTE
                     KARALGLGTLGFHTYLQMNDIAFESGAAHILNNQLYAEIKKAAEEGSRELAEEYGEPE
                     WCKGTGMRNATLITIAPNMSSALLAGGVSQGVEPLVCNSFIQQSNAGDFVRSNPVLAK
                     VLKDRLTDKEIQELMEDIATYHNGSVQHLDILTDHEKSVFKTAYEIDQHAIIRLASAR
                     QRHIDQAQSINLFFSADEKESVIASVHRAFMDDPRLKSLYYLRSERGVKASSGKSDCL
                     ACEG"
     gene            complement(62644..63615)
                     /locus_tag="44RRORF111c"
     CDS             complement(62644..63615)
                     /locus_tag="44RRORF111c"
                     /note="matches Pfam ribonuc_red_sm ribonucleotide
                     reductase, small chain E=1.5e-08; similar to sp O83092,
                     P17424 Ribonucleoside-diphosphate reductase 2 beta chain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81430.1"
                     /translation="MYQDQEGWIIRYPEFAALADEQMHAFWPWDEPVVDNDAQDLRTK
                     LTPGELNGITTVLKLFTIYERKVGEDYWTGRIARTFGRPEINRMATLFSAVEGNSHAP
                     FYNKVNEVLYLDDEAFYTSWKESEELSRRIQFVGKSVSDPDDAKSFAAFTFIEGAVLY
                     SSFAFLKHFQAQECGKDLMRNICRGVDLSVADEHHHSIGGAMLFRTLCREMMEHHKVD
                     VREKLKDDIIAMAHQVYDHESGIIDLVFAEPIDGITADELRIFVKSRINLCLENLGYD
                     PIFEIESNPIASWFYRTINAKKFHDFFTGSGSEYNINWDRAGFSDCW"
     gene            complement(63652..64113)
                     /locus_tag="44RRORF112c"
     CDS             complement(63652..64113)
                     /locus_tag="44RRORF112c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81431.1"
                     /translation="MNNVVCQCCNQIKPKIVTIKDDNFFESVTVVNAHDTIATTVKLH
                     KLSYDQLPGGALIVADRDIITSIRRAGGNKPRMLDAMSFCRDKMHFELLGRPPVIIFN
                     TQTPLTDIRIALYSKTGFSKSTEFTAYYVRYKESTMRNLVNRFKNIFKNTI"
     gene            complement(64159..64332)
                     /locus_tag="44RRORF113c"
     CDS             complement(64159..64332)
                     /locus_tag="44RRORF113c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81432.1"
                     /translation="MSNVTHLVNFGHGELAVKKVASYFHVLKSADPMLPVGTEFPIKD
                     TVTLDADVIQLNA"
     gene            complement(64418..64873)
                     /locus_tag="44RRORF114c"
     CDS             complement(64418..64873)
                     /locus_tag="44RRORF114c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81433.1"
                     /translation="MSIVKERFFNYKTFFIDAINRSYANKPSGCIQEMSQSKSSFLRE
                     HRTIHLNLGRMTGKTTGLLHLANEVSAQGGARIITMNSANKRHVQDMVSYQWRGDIRI
                     STISELTDRCPKVKFLMIDESEYTLTSRHQRQEIYDWAGTHGVEFVIMT"
     gene            complement(64938..65141)
                     /locus_tag="44RRORF115c"
     CDS             complement(64938..65141)
                     /locus_tag="44RRORF115c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81434.1"
                     /translation="MSHIDRMQVELRDLTDKIVALDSFIGGSPIFPQLEFAQQELMVQ
                     QLDAMKAYQLILSARIDLAIETE"
     gene            complement(65152..65361)
                     /locus_tag="44RRORF116c"
     CDS             complement(65152..65361)
                     /locus_tag="44RRORF116c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81435.1"
                     /translation="MAMMHEKSHAREGRGGANGNNANWYNSPLWDSTGPKKKVGVVKE
                     QIPEEELTEEQKLKRKQQALLRALY"
     tRNA            complement(65379..65455)
                     /product="tRNA-Arg"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="UCU-anticodon predicted by tRNAscan-SE-1.21"
     gene            complement(65473..65922)
                     /gene="30.3"
     CDS             complement(65473..65922)
                     /gene="30.3"
                     /note="similar to T4 accession NP_049816.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81436.1"
                     /translation="MDIGSGASWPSCALSNFAPHEFYIDGVRCASIEGFLQSLKFKSP
                     EMQEHVCSLVGKAAKFKGKKKNWWRDQTLYWRGKPMHRQSDAYSELISRAYDEVSKNS
                     GFKRAILATRNSSLTHSMGKNKKNETVLTEQEFCSNLYRVRDSLQAG"
     gene            complement(65939..66307)
                     /gene="vs.6"
     CDS             complement(65939..66307)
                     /gene="vs.6"
                     /note="similar to T4 accession NP_049730.1; conserved
                     matches Pfam Gly_radical formate acetyltransferase domain
                     E=1.1e-19"
                     /codon_start=1
                     /transl_table=11
                     /product="Vs.6"
                     /protein_id="AAQ81437.1"
                     /translation="MLIGFQLLDGSNDHGSIFLVDDQTNNAKVIASKTYEIDTIVEDS
                     VIRGRPGRFFDVQPEPTVEGGQHLNVNVLDRNTLEDAIVNPEKYPQLTIRVSGYAVRF
                     NALTPEQQRDVITRTFTQSL"
     tRNA            complement(66424..66498)
                     /product="tRNA-Ile"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to tRNA-Ile from T4 phage, Escherichia coli
                     and Pseudomonas aeruginosa, which contain tRNA-Ile
                     identity elements and CAU anticodons, and are
                     isoleucine-specific when modified"
     tRNA            complement(66706..66782)
                     /product="tRNA-Met"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="CAU-anticodon predicted by tRNAscan-SE-1.21"
     tRNA            complement(66805..66877)
                     /product="tRNA-Asp"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="GUC-anticodon predicted by tRNAscan-SE-1.21"
     tRNA            complement(66951..67038)
                     /product="tRNA-Ser"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="GCU-anticodon predicted by tRNAscan-SE-1.21"
     tRNA            complement(67046..67121)
                     /product="tRNA-Ile"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="GAU-anticodon predicted by tRNAscan-SE-1.21"
     tRNA            complement(67124..67199)
                     /product="tRNA-Trp"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="CCA-anticodon predicted by tRNAscan-SE-1.21"
     tRNA            complement(67545..67620)
                     /product="tRNA-Thr"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="UGU-anticodon predicted by tRNAscan-SE-1.21"
     gene            complement(67622..67981)
                     /locus_tag="44RRORF119c"
     CDS             complement(67622..67981)
                     /locus_tag="44RRORF119c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81438.1"
                     /translation="MKIVNITTTRPDVCCGQDKFIGLHEYCFGPCGAGDGWIGKCVVC
                     QKEWEIDSDSIAEVKRDWKKHDCGEITLPFGITVADLIYILSKFNAHTPIGFIHLTGS
                     ENAVRAYSDEDGLTILE"
     tRNA            complement(68260..68336)
                     /product="tRNA-Pro"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="UGG-anticodon predicted by tRNAscan-SE-1.21"
     gene            complement(68581..68820)
                     /locus_tag="44RRORF120c"
     CDS             complement(68581..68820)
                     /locus_tag="44RRORF120c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81439.1"
                     /translation="MLRSTDIVHTKFDENELRALTKSRIKSFKTACYKSMGTRFGGWC
                     CDDKCEWVERERDTPEYAMAKANMDLINKVYSEMS"
     tRNA            complement(68842..68917)
                     /product="tRNA-Gly"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="UCC-anticodon predicted by tRNAscan-SE-1.21"
     tRNA            complement(68932..69004)
                     /product="tRNA-His"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="GUG-anticodon predicted by tRNAscan-SE-1.21"
     tRNA            complement(69125..69200)
                     /product="tRNA-Lys"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="UUU-anticodon predicted by tRNAscan-SE-1.21"
     gene            complement(69174..69728)
                     /locus_tag="44RRORF121c"
     CDS             complement(69174..69728)
                     /locus_tag="44RRORF121c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81440.1"
                     /translation="MNDVIARYSTYLELECACYDFEITDDLVKRIFFNHIYRTTKLPF
                     LRKNSSYIKSVCSQLNYVRRSLLNVKYNRLGKASSIREGYVYVLTNPAWPGHFKIGST
                     ISVYDRLATYQSYSPFRDYKIQTYFFTHDRFKTEKQLHFMFGANGEWVDNTSTQLDDV
                     LRIFNTERNKDRQFLRASLTQLAE"
     tRNA            complement(69804..69886)
                     /product="tRNA-Tyr"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="GUA-anticodon predicted by tRNAscan-SE-1.21"
     tRNA            complement(69900..69985)
                     /product="tRNA-Asn"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="GUU-anticodon predicted by tRNAscan-SE-1.21"
     tRNA            complement(70066..70149)
                     /product="tRNA-Phe"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="GAA-anticodon predicted by tRNAscan-SE-1.21"
     tRNA            complement(70222..70315)
                     /product="tRNA-Ser"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="UGA-anticodon predicted by tRNAscan-SE-1.21"
     tRNA            complement(70506..70589)
                     /product="tRNA-Leu"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="UAA-anticodon predicted by tRNAscan-SE-1.21"
     gene            complement(70912..71352)
                     /locus_tag="44RRORF122c"
     CDS             complement(70912..71352)
                     /locus_tag="44RRORF122c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81441.1"
                     /translation="MKKFEHAGKTYEVDDEFTNYAVDADGELWVYSERPSTNVSDRND
                     YFDAPNSIRQLVDKTSGGLEGPYEIADDSIVTIKVPPELKGFFISMMSCCLEQTLMEC
                     YAGHDSQIPGTGLTFEYPHFARCRGEKPDEKCDIVMRLYDNDES"
     gene            complement(71353..71598)
                     /locus_tag="44RRORF123c"
     CDS             complement(71353..71598)
                     /locus_tag="44RRORF123c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81442.1"
                     /translation="MKTISPTGKEKTFKSWESLREWLDERFDSWDDDILSIPFKSTVY
                     WDLCPYAQDIHNGQENLVWNTDKDELEKQLELIAEEI"
     gene            complement(71595..72014)
                     /locus_tag="44RRORF124c"
     CDS             complement(71595..72014)
                     /locus_tag="44RRORF124c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81443.1"
                     /translation="MIYDLCEKGYPFQISMNISGLSDKVNEHTLAVEVLEATQIYYPG
                     SYNNWFRPRGVVALRSIDPDHEFKFVRILIDRDNARTIEAIFSKELNHVDVLNAMVHI
                     AFDYCHDIGHCIAAGFVSDGRYYGRSESIGIDCEGNE"
     gene            complement(72027..72239)
                     /locus_tag="44RRORF125c"
     CDS             complement(72027..72239)
                     /locus_tag="44RRORF125c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81444.1"
                     /translation="MKIYHPQHIAKVNGITKVDMIRGHYRFGISCWIMFKNDQVIDCT
                     FKNDTAQFRSMEKAARQVAAKHQYTL"
     gene            complement(72304..72564)
                     /locus_tag="44RRORF126c"
     CDS             complement(72304..72564)
                     /locus_tag="44RRORF126c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81445.1"
                     /translation="MNLLFELFILSVQYSIIAVMVYVLIHGFAFFDEWRQKRPDYKMP
                     ARSLCAVQVYGMIAGAWLPLAIYLVCKLCEFTYIKVTEKIKK"
     gene            complement(72564..73061)
                     /locus_tag="44RRORF127c"
     CDS             complement(72564..73061)
                     /locus_tag="44RRORF127c"
                     /note="similar to RB69ORF151c accession NP_861841.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81446.1"
                     /translation="MQNFKFTPGTIIPAGYVIAIETWENDGDDYKTHFHFGCSEADTT
                     FFALVKPLFESRHSKGNHYGNSSWSESIAVELVEILIDNPGLEPQFKKFLDLSADVYD
                     KETEEFDSGFDIDDLRDNVIDHISNYAVGYGSDFIRVVETIEVYYNPTEYVVPKLPLT
                     FVEAF"
     gene            complement(73068..73334)
                     /locus_tag="44RRORF128c"
     CDS             complement(73068..73334)
                     /locus_tag="44RRORF128c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81447.1"
                     /translation="MTDQQELVMQFRPSSTIKIWCEYDISGQFGGNNNEEVVSITFPE
                     HVQENERNGYIEDVVLTYVQKMTYEDADSLEGLYGWEHIDIVNL"
     gene            complement(73585..73806)
                     /locus_tag="44RRORF129c"
     CDS             complement(73585..73806)
                     /locus_tag="44RRORF129c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81448.1"
                     /translation="MQKQIVLTTGEVLSTTARHVDVTSINVAASQGFYQLTKGEGEKR
                     VLVAEVPFDCVSFVVHEPKLLDGGFVEAE"
     gene            complement(73835..74089)
                     /locus_tag="44RRORF130c"
     CDS             complement(73835..74089)
                     /locus_tag="44RRORF130c"
                     /note="matches Pfam zf_dskA_traR prokaryotic dksA/traR
                     C4-type zinc finger; similar to sp P41039 Hypothetical
                     protein ybiI"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81449.1"
                     /translation="MAVGFGPENGLHMTINAGLDNALDFIRSTQYKGDTPEFCEECDE
                     PIPEARRMAISTAYCVQCQTVHDNIVHTNWLRVARPKTMR"
     gene            complement(74185..74613)
                     /gene="57B"
     CDS             complement(74185..74613)
                     /gene="57B"
                     /note="similar to T4 accession NP_049750.1; gp57B"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81450.1"
                     /translation="METPVGTYVACRFSEETLDAIQKIQEALPIFNPVPRDELHSTII
                     YSREEIPFIPSDMPTLLANSAELRVFETPTKNVLVLAFESSHMNKRFAQGMLLGASYD
                     FDEYIPHITIAKDVGSSSFMGSYEFPIVSSHEYMEALDAD"
     gene            complement(74613..74849)
                     /gene="57A"
     CDS             complement(74613..74849)
                     /gene="57A"
                     /note="similar to T4 accession NP_049751.1; gp57A"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone for both short and long tail
                     fibers"
                     /protein_id="AAQ81451.1"
                     /translation="MSQEMQQAQQLIASLKIRLFDAGEHLANTQAQAKEFSETLTKIV
                     QIVGVQPAEGAESIELSTIVSAVEALVPAKEETK"
     gene            complement(74863..75537)
                     /gene="1"
     CDS             complement(74863..75537)
                     /gene="1"
                     /function="converts dTMP, dGMP and HMdCMP to diphosphates,
                     not active on dAMP or dCMP"
                     /note="similar to T4 accession NP_049752.1; gp1"
                     /codon_start=1
                     /transl_table=11
                     /product="dNMP kinase"
                     /protein_id="AAQ81452.1"
                     /translation="MIIALSAKKRCGKDTVGDILVSNGFTKYALAEPIKRFLYLSIHE
                     DSKLPMFVQDFNMDDFNGLGYDREAGLPISNSDVFRIMRSAWMLVSDDQGFDFTYAHT
                     GKIAEVVLGNKEAWSIRRLMQTFGTDIGCAINKRIWMKYLTDFIPTHKNIVVTDCRQD
                     HEMEEMRSLGAHVVHILRDNQEIRVDMHSTEQGLPIQSGDHVINNDGSIDDLRQVVNN
                     LINYIK"
     gene            complement(75539..76066)
                     /gene="3"
     CDS             complement(75539..76066)
                     /gene="3"
                     /note="tail sheath stabilizer terminator; similar to T4
                     accession NP_049753.1; gp3"
                     /codon_start=1
                     /transl_table=11
                     /product="tail completion and sheath stabilizer protein"
                     /protein_id="AAQ81453.1"
                     /translation="MALNNQSNITNFLLDIPASAGIKVALMNVQQASIPGFRIPPTEL
                     PLGEQGTARQNIPSTTTEFDPLIVRILLDEDYDAYFEIYRWMLSINDYARQTPTMWGT
                     TSQPPGVTLHVLSNSKHDIVASFNYQGAWPSEIGEIEYSYTEEGDVSAYFTVTFFFKY
                     FEIERKGQLVRPIRG"
     repeat_region   76089..76200
                     /note="44RR; 6 copies of repeated sequence detected in
                     intergenic regions"
                     /rpt_type=direct
     gene            complement(76252..77058)
                     /gene="2"
     CDS             complement(76252..77058)
                     /gene="2"
                     /note="similar to T4 accession NP_049754.1; T4 gene
                     synonym: 64; gp2"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA end protector protein"
                     /protein_id="AAQ81454.1"
                     /translation="MIFDYIDEAPVKKTRNQWVDLGVKWRNAKAKGVSGRDFAKANGL
                     NFDTFRRTMLKFAKQIDLAIEVESLKNKAKLNSREKALAMINDFRSQMRARAADSGAA
                     NNNKSQKWFDDTIRKSIRGHMVAKPKPGRIYTFAYDAKHKDTLEYWDKFPLIVFLGIG
                     SSGSGPLLYGLNLHYIPPKARQSFLEELLKNYASTERLSNKTTLKINWSNVRGMSGSD
                     VMIKAYLPGHIKGSMMEIKPSDWVNVIYMPLQQFVSKGKRYSARKVWAKA"
     gene            complement(77058..77510)
                     /gene="4"
     CDS             complement(77058..77510)
                     /gene="4"
                     /note="similar to T4 accession NP_049755.1; T4 gene
                     synonyms: 65, 50; gp4"
                     /codon_start=1
                     /transl_table=11
                     /product="head completion protein"
                     /protein_id="AAQ81455.1"
                     /translation="MAYSGKFRPKNLSKYNGDPNKITYRSSWEAWLMKWCDQSASVIS
                     WSSEEVIIPYFSNADGKRRRYFMDFYVKMVTGDVFLFEVKPEKECRPPVMPSTNTAKA
                     KKNFISEMYTWQVNTDKWKAAQALCESKGWNFKIITEVTLKSHFGWRG"
     gene            complement(77510..78004)
                     /gene="5.1"
     CDS             complement(77510..78004)
                     /gene="5.1"
                     /note="similar to T4 accession NP_049760.1; gp5.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81456.1"
                     /translation="MSDILPASTILPVTRENTPVSQTFTANLTEAGASLVSITVTQVT
                     PNEGIIAAGSSFSGEYTGVFSLNGGLKYRLKTGERLTASKWEELPSPLIADLYSFEAP
                     QSLEKTFTYSVVMIYDVVVPVEPGLPVNPPVRHTMQKTYSQKVVGTWTIWANNLRDYV
                     NRGR"
     gene            complement(78008..79810)
                     /gene="5"
     CDS             complement(78008..79810)
                     /gene="5"
                     /function="tail lysozyme for penetration during infection
                     and lysis from without"
                     /note="similar to T4 accession NP_049757.1; gp5"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate hub subunit and tail lysozyme"
                     /protein_id="AAQ81457.1"
                     /translation="MLNGVDRFFTGVVEDRFDPFMLGRVRVRVHGIHPEQKVKAENYG
                     MATDDLLWMTIGTSTTSASISGVGQSPTGIVEGTHVYGFYLDDFYQSGLIMGTYPGIY
                     PEMPNFNKGFTDPNRQFPRYVGSDVNILARGGKEIKIAPGQIAQTEEIVPATVEDQDL
                     NRDWAAEPNRTPNDEIKPNPNPDVTIEDMLRYDEGIRVVVYWDSEGYPTVGIGHLIIH
                     EKTKNMSRINSLLSQQVGRQVQGRITEEDCSTLFARDLNGVYSDISRSATVGPVYSML
                     DDTRKMAIINMTFQMGIGGVANFQKMLAYLALGQYDKAADEALDSLWARQTPNRARRV
                     TDVIRNGNLVAYGGSQGSVVRSITRAVAMPLIATRSITRKAKTATAQTVSFKEPASAY
                     SAVYPYNKVFESESGHIQEFDDTPGHERIHTRHKAGTFEEIHPDGTKVQKIIGDDFYI
                     VKNNQNVHVGGNLKFIVDGNAVVFVQGDAETTISGNANQFIRGDSIERVEGNVNQHVT
                     GSVNQYVKGNVDSQIDGNMAATVNQNANIKVVGDCFNTIDGNYVLKVGGNFSTEVGGT
                     RNDQVGGNWDRSASTVNDIAQGTFSINGSRINLG"
     gene            complement(79816..80355)
                     /gene="53"
     CDS             complement(79816..80355)
                     /gene="53"
                     /note="similar to T4 accession NP_049756.1; gp53"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate wedge subunit"
                     /protein_id="AAQ81458.1"
                     /translation="MIFSFFDPISYQGKETTDIFKNYRAYFNRVVVKYKPEVYWLSGS
                     PRPEAVAHELYGNQQLYWVLLMLNNTYDPFYDWLTSQDAAYQYAEQQYPVNQIAYHID
                     ANGEKYWNLVEDPDFPQNWYDKGDKARMHVQYVGPLRAVDTLEAQVSLNESRRRIMII
                     NPADINAFLSDMIREMEKV"
     gene            80425..80718
                     /gene="5.4"
     CDS             80425..80718
                     /gene="5.4"
                     /note="similar to T4 accession NP_049763.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81459.1"
                     /translation="MPGLTYDMAWTTGHDTYPPTRIRATQGKVFVDGIRVVVAGDTIV
                     PHTNTVEPYDTHSGYVIPTTSKIYVGGKPAASIGDPTSDGDTIAQSSSKVFIK"
     gene            80715..82598
                     /gene="6"
     CDS             80715..82598
                     /gene="6"
                     /note="similar to T4 accession NP_049764.1; baseplate
                     wedge; gp6"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate wedge subunit"
                     /protein_id="AAQ81460.1"
                     /translation="MKLKTNIPDIFNGATFDEIKRDLINWLRNQDEFKDYDFQGSRLN
                     VLTDLLAYTTLYIQQFSNAALFESFIRTAVLRSSVVQHAQDMGYMPDSKTGSSTTLLL
                     KATNPLNPTSIRIPRGTKFVGTVERTDNFPFVTLDDVVIIRGQNNTYESLVNVYQGRI
                     VRTETTFDGTSQILLRDPNIDRSQVRVWVDGSPWADWTNNSIVDITGSSNIFYMRETI
                     DGTTEIFFGEGETSVQIAGGALEANYIGGLKPNIGARVVVEYLSTQGEAANGSKDFAY
                     TDTLQNIIITDLVENPTDDRDYVGTQGGGNVEDIERIRELAPVMRETQRRCVTASDYE
                     TFVSSKFGSVVQAVQCFTDKEKRGYAFIAIKPKQGLRLTTVQKEDIENYLAQYNMATI
                     TPAVIDPNYMYVKSKIKVTYNLSELYNSEEWLRGQIIGSIDRYYIDEVEVFNKNFSSS
                     KMLTRVDATDDSIIGSSADISLVREVDNFFKTPMAGISFQNGMKKGSINSSPINFTKD
                     SSSYEVSYVSTTQSGKVLIGPFKTGDIALAEYSGTDFNKVTIEGRDKYYDVGSVDYVL
                     NTISFDLGVLPVPSTAFTGAYIEIEALPTEDTIFARDGSLIVFENDLRPQYTEIILEA
                     IAQ"
     gene            82630..85689
                     /gene="7"
     CDS             82630..85689
                     /gene="7"
                     /note="similar to T4 accession NP_049765.1; C-terminus
                     contains predicted integral membrane domain; gp7"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate wedge initiator"
                     /protein_id="AAQ81461.1"
                     /translation="MVIKAPSVTSLKIKILSANQVYITWDDVGSNFYYIVELARTRDS
                     SVINWTTLGITPNEEWFEDKVIQSDTHYKMRVRVSGKGFEMSDWVETEEFQTFNTNAY
                     YVSSMREFTPAATFINEKFTKNNKSYVDFNDDVIMASLMGEDFVFSPQFSNATNIADK
                     IVTDENYHEIQGYIEGVCADIDRTMLAEIDDVLYLFERFQPMAKVSNDKGQNWKYYKA
                     FNGRIGNPITRTVTYQTSTTTYVLGYENIYYGRRANDVRWSADDVRFSSDTVTFAKTG
                     DELNLGFDVELFNSYARLPGDMYRKAEAIAADDDWIYVAARNNMRRIRTSNAPIETDP
                     GSPNFGEKLFDPVAYMVTNDPSAIVKKMDTFNGKLYALVTGKVKSQWLDPTVPANIVS
                     TDAIGVYMFDGATWTRVFGNTADERRWFSHEYTNMSTNGDELFISQVNFKFPGTLPDL
                     ELPEKNSQVIEAVKYQLLPGYNSDITIHMGTFRINQDDDVWKLGPQQYYNEAAYTWMA
                     RSGTRCWITNDNRALVVYPKIVYSKSIDDAGFADDSRVNKETHNKGTITLYANNVRFN
                     GFKRYANGILFHKNTGEIIGYYEFPYRVRDEAYVFWKPNFVMLVAELRNQERETPWTP
                     APNYGLKDPDLRPLVTKMMPESYLDEDSNFGAFAKYYLQYLSDGNGTYYNKLLNLIKN
                     KYPREQYAYEYLWSEVLKRNIYLDEAKRDSVARFFEARSFDFYSTKGVEQSYKFLFKL
                     LYNEDVEIDIESKHGIEYDIVVYSTNISQDIVGRTIYTPTGRANVTYIEREYNEGKLR
                     WRITIHNMIGKFFEGQEIKSETTGFKGDVIVGVRGKELLSDSIDYINRGRSYYTMTIK
                     SVLPASRYSQDVLRFVHPVGFGFVGITLLTMFINSGLSMKHVETIIDNLKTYRWDAGY
                     PLEQYDRVAKLDVDGNIETDPVTGEAVYLVGPNAGQPFDVPPEYDTEESSWHGKLPSE
                     RRFKMSPLFDQSAVTFSNFRRLVEQRLKDDAGNPRDPKVPTQVKIDE"
     gene            85682..86668
                     /gene="8"
     CDS             85682..86668
                     /gene="8"
                     /note="similar to T4 accession NP_049766.1; gp8"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate wedge subunit"
                     /protein_id="AAQ81462.1"
                     /translation="MSNFYRAIVTSKFRTKNLLNFYDMVGDEPTKNTIYASFGRDTPW
                     SSNETDPGFAPPYPNDSIDGIVDMWTNMLGMVKIDKSLLDAIIPRKDWGDIRYDNPKT
                     FFIDDIVVVNSAVYNRTDSSTGWMIYRCVDVPNIGSCSIDGIDDKIECITIGGKWTAT
                     HESVEPPRGTAMAIDMGDGYIWEYLYTIPPDVSINRCTNEHIVVPFPDELVADPARWG
                     YENTILWYPDDIDLVYRVKVDTLRFRAYMDSIYFPEASLPGNTGFRQMSVILNPLVKK
                     NQPADTDVKATEVAYKPEQLEKDSGEMVYMENRQPITRALDQTEEINIIFSF"
     gene            86678..87535
                     /gene="9"
     CDS             86678..87535
                     /gene="9"
                     /note="similar to T4 accession NP_049767.1; tail fiber
                     connector and trigger for tail sheath contraction; gp9"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate wedge tail fiber connector"
                     /protein_id="AAQ81463.1"
                     /translation="MLQDTKKRVDVGVIGNPSTGDILYDGGVKLNTVIDALYNTFGDY
                     RLYSSASEGADSQILHATGFYQKLSRQYYAGNPVDIGSMHDADTTSGALTMTLPNAKL
                     GEGCIFINSNGSISPANPLIIRPQSGETILGTSGNLTITSPYSRIVVWCTKADGNQKY
                     WEYGITPLFGDSMMPVEKTILATATPTNIRIAGKNEYVAIKLLIAAKNNAGTAFKTAE
                     TFIAIDTITNEVINTEYAVLKNTDSELYDIRFFIGAGDNVYAEVKSLNGQLRFSIKAI
                     DTVKIGATS"
     gene            87535..89349
                     /gene="10"
     CDS             87535..89349
                     /gene="10"
                     /note="similar to T4 accession NP_049768.1; gp10"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate wedge subunit and tail pin"
                     /protein_id="AAQ81464.1"
                     /translation="MELIKIGQVVDDGQGDYLRRGGQKVNDNFTELFTQLGDGDRPFA
                     AGAWKNHTVGVLTPKFGESWAINTSSGAISVNLPKGSVTDYNKAIKLRDVWSTWANQN
                     VTLYAATGDTLKGSPLPRRLDKNLMDVELVYCAPGRWEYVENKRVDRITTSDLSTVAK
                     REILVETDGQTDFPDVFGSSNYNIGNIEVYLRGNLLYYGSELSSNSNYGSIDPASPTG
                     IIPLDGRSIRIRGIEILAGDTITFVTYMDGIASYRSSYNTRSVQVFSTTDSAKTSVAG
                     EIWVGDIATKNSFSIEEIGIEMNNRINPNSLEVLINGILMSRAGDGDLPMFVCEGADG
                     ENQTDCQANGGNWVPSAIDYAMVLDDSGNVSQINFGNPFESGDMVTFRWFNNDIGTLL
                     DWDGINGIKEKADQVYLNAEQQVTIQNGIEYTDFDNPSQKTAEVVPGVFTGRLDTIQM
                     FFDSIYPIGTIYENANNPANPRDYMGLGVWKRYAEGKIVAGWTSNQADIEFSMNNNDL
                     DSGGNPSHTAGGTYGAKSVELAPLNIPEISSTDKVLVSHPDGNIIIGGCLIDPDASGP
                     GYTKYIESVLAVNKGNLSPANISILPPIITAYKWVRVG"
     gene            89349..90011
                     /gene="11"
     CDS             89349..90011
                     /gene="11"
                     /note="similar to T4 accession NP_049769.1; interface
                     protein between baseplate wedge and gp12 short tail
                     fibers; gp11"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate wedge subunit and tail pin"
                     /protein_id="AAQ81465.1"
                     /translation="MITKARGGAMNTSRHATHIEYLTKPGTDVMGARNIGGPTVDSLI
                     AGVDYHNVQSAIDELQTLASFPINGLYISDVKASPEGVRQAELLTFSGVVTDSEEGKS
                     IIHVYGIPFTVDAGTNADVICNQVLAKFEDMRDNGILFFSVNRQSGTTTPVLEVQFLD
                     SATHVNIENFVSNGITVAREVSVPGVPGFGTWDYLGEETKTLTGGTLADPVRLYYFKR
                     IG"
     gene            90011..91411
                     /gene="12"
     CDS             90011..91411
                     /gene="12"
                     /function="irreversible adsorption to host cells"
                     /note="similar to T4 accession NP_049770.1; gp12"
                     /codon_start=1
                     /transl_table=11
                     /product="short tail fibers"
                     /protein_id="AAQ81466.1"
                     /translation="MVANNIKNHISDSAESVNYTGDNWPAIVTTVADALDRVAPWAII
                     DNGLPLATTQIAGIIRIATTAEMQAGTSANTAITPALLKLAMETPQASETIVGNTRYA
                     TNAEALALTLNTAAITPANLGYVFANKAATESARGTMRISTQAQATSGTDDATTMTPL
                     KTKLAIQALSQAWGTATESARGVVQMATVAQALQGTLRDGFAISPYTLSKMAGTESAA
                     GMFKIASNSQILALADNTVVVTPAKLDILKATASQLGLVKLSGVSTAAANTALAASAP
                     VLYTSGGIITGDVTFTGNMQGIQWSRNTDMAHIVFKNDSNADSNSFMQFCVGDDNNEY
                     FRWVNRFSGSDNIMATLRPGGHMWLAGNIDVNDFYIRSDRRLKHGFKPIENALDKIDL
                     LNPGTYHKQYSLTDDRIVGLEAGIFAQDFQKAMPEGVRSLEDGTLTVSPMGAIAFLIQ
                     CNKELKARLEKLEGIK"
     gene            91408..93171
                     /gene="wac"
     CDS             91408..93171
                     /gene="wac"
                     /function="long tail fiber attachment"
                     /note="similar to T4 accession NP_049771.1; Wac"
                     /codon_start=1
                     /transl_table=11
                     /product="whisker fibers at base of head"
                     /protein_id="AAQ81467.1"
                     /translation="MIEHLTKGSLPYVDGAPEVGQARIDWIKNGERLCGASTKTSNDG
                     TYNRPTLNVQKNVEAADGEQVKTVEKVNEIVDTVNIIVENLGNIGNTDLIEQVNENTA
                     DIVVLKQHVVDATAQDAIFTNDIAEINLSVGQRLPADNTTRDVYNDLFWIKTELGAYN
                     GFDINGGSAIGSIGSGLKYRFGELNTLVGNNSRRITTLEDNWNASDVGQLTSDLEDMR
                     LEIGRSQLATGIPIYTRLRILEDGAGGEQDDVEAIKLKIDFSNETTIAARTTLLESTT
                     SSLANTINRPDTGLLPRLTVVENQIGSTSEPYTMMYDINQNAMAIVNINQILGSNGSS
                     GIQGEIALINAAIGPNNESGSINGRISVLQQEVSQITLTLADIDGKIGDENSGLVGAN
                     IIMSTDLYGDASSIDPFTNAGIKKTTKDLFDTVPGKLDRPAETGRWYFENGAWKKASS
                     IMVAVEKSAFDVDATEAEVDIPFIDFEQTIANGCVFNNGVITFSDNGLVEAKIDVEVE
                     GVGETDNYEVAISHDVGGVVTRIVLQEFAHRPIGKRLYTRDWLYTISSGDKVSVTIKA
                     LDSSSVKTVNITDMSIMIVPV"
     repeat_region   complement(93213..93314)
                     /note="44RR; 6 copies of repeated sequence detected in
                     intergenic regions of genome"
                     /rpt_type=direct
     gene            93332..94255
                     /gene="13"
     CDS             93332..94255
                     /gene="13"
                     /note="similar to T4 accession NP_049772.1; neck or collar
                     protein; gp13"
                     /codon_start=1
                     /transl_table=11
                     /product="neck protein"
                     /protein_id="AAQ81468.1"
                     /translation="MSYTCNNPLELKDAILRRLGAPIVHVEVTEEQVFDCISRALELY
                     GEYHYDGFHRTYATVVLTEQQAKTGIIDMKGGNVFAVTQVLRTNVGSIITMDGTAVYP
                     WFTDFVMGMTGASIGGQCKWYGPNAFGGDLGYFTQLMSYRSMMGDLLSPLPDFYYNSS
                     SEMMKIAGQFKAGDLIVFEVYCKSYANVDTMLAGTSAGYGFAMSCDGDEPSQSQLYGN
                     PNLAGGAIYAGGSNGMLKDGAYNNRWVKDMSTAYVKELNGQVLAKHQGMQLPGGITID
                     GVRLIEEARIDIDKLRNELELLDAPPPIIMG"
     gene            94262..95020
                     /gene="14"
     CDS             94262..95020
                     /gene="14"
                     /note="similar to T4 accession NP_049773.1; neck or collar
                     protein; gp14"
                     /codon_start=1
                     /transl_table=11
                     /product="neck protein"
                     /protein_id="AAQ81469.1"
                     /translation="MMDKSLFATLENRGGYMRTNEKNILNPYVKFNKHEGTQALQDTL
                     VAESIQMRGIEFYYLEREFTDLDLLFGEDVNSRFEKAWKFAAWLNSFESYEGQQSFFS
                     KFGHTQNDEIRISINPGLFKYQVNGKEPALGDLIYMPMDNSLFEITWVEPYSPFYQNG
                     KNPIRVIVAQKFIYSGEKITPVVQEKPEIEDMYNGLDLAPLLNLDGMIDQKIDQFAEN
                     IAVQQKVKQYAEPFDPISTNSFGNFDSPFGKHEA"
     gene            95023..95841
                     /gene="15"
     CDS             95023..95841
                     /gene="15"
                     /note="similar to T4 accession NP_049774.1; connector
                     protein to gp3 and/or gp19; gp15"
                     /codon_start=1
                     /transl_table=11
                     /product="tail sheath stabilizer and completion protein"
                     /protein_id="AAQ81470.1"
                     /translation="MFGNHFYNNSIRRYIMLLMELFGHIQVARQRDGKPYFQDVPITY
                     ASKEKFIMALGDVTMPTSEAQIAKVESILPRMNLHLIDAQYNAQVKTGAAQKRWVNKS
                     DGKGLAQFNPVPYTFMFELGIHTRHEDDLFQIIEQILPYFQPHFPCTITELYDNEIII
                     KGRDINIVIVSNTPDEQIEGPGEQRRRLEWSMMLSFTGWLYPNTKNIAGEIRTIYIDF
                     FGNEREINKETHFESVDHQVVPKNVPKQEWTGESIEVWSDNTSQGEPPRPSSGE"
     gene            95845..96309
                     /gene="16"
     CDS             95845..96309
                     /gene="16"
                     /note="similar to T4 accession NP_049775.1; gp16"
                     /codon_start=1
                     /transl_table=11
                     /product="terminase DNA packaging enzyme small subunit"
                     /protein_id="AAQ81471.1"
                     /translation="MNDVLDFTQLKDLNGIEGIHGEDVQVYAPLVLRDPVSNPNNRKI
                     DQDDDYELVRRNMHYQSQMLLDMAKIALENAKNADSPRHVEVFAQLMGQMTTTNKEML
                     KMHKEMKDLAGAATVAIDGQVQKDADGEFIEFEGSPDELLDLELADEDIGDD"
     gene            96309..98150
                     /gene="17"
     CDS             96309..98150
                     /gene="17"
                     /note="DNA packaging enzyme, nuclease and ATPase activity;
                     binds ssDNA, gp16 and gp20; similar to T4 accession
                     NP_049776.1; T4 gene synonym: q; gp17"
                     /codon_start=1
                     /transl_table=11
                     /product="terminase DNA packaging enzyme large subunit"
                     /protein_id="AAQ81472.1"
                     /translation="MAAVYTDDHPLGMPHPSTLKREMREDGEWVLSNHDDKWYPSTFD
                     RYMKLQGVKRVKIQSDDPSMFRTFKDKTNKRTRYLGLPNLKRANIKIKWTKEMLAERK
                     RCKEDIVYFAENYCCIEHIDYGIIRVQLRDYQKDMLRIMAGNRLMAANLSRQLGKTTV
                     VAIFLAHFVCFNSAKNVGILAHKASMSAEVLHRTKQALELLPDFLQPGIVEWNKGSIT
                     LGNGCAIGAFSSSPDAVRGNSFALIYVDEVAFIPNFTDAWMAIQPVISSGRRSKILMT
                     TTPNGLNHWYDIWTAAITPNSSGDGSKSGFVPYTATWSSVKERLYSDGKELSGSDSYF
                     DDGYSWSSKTIAGSALDAFQQEHNTAFQGTSGTLINGTKLSKLNWIDIPPQDNFTMFE
                     EPKEGRKYIATLDSAEGRGQDYHAMHIFDITEFPYKQVAVYHSNTTSHLILPDVLLKY
                     LNMYFQPYIYIELNSTGVSIAKSLYSELDYENVICDSYQDLGLKQTKRSKAIGCSTLK
                     DLIEKDKLILNHKKSIMELRTFSEKGVSWAAEEGFHDDLVMSLVIFAWLTTQERFSDF
                     TENDDMRLANEVFRKEMEELNDDYMPMVIVDDGEDTFEVTHKGMSFV"
     gene            98210..100201
                     /gene="18"
     CDS             98210..100201
                     /gene="18"
                     /note="similar to T4 accession NP_049780.1; outer
                     contractile sheath protein of phage tail; gp18"
                     /codon_start=1
                     /transl_table=11
                     /product="tail sheath protein"
                     /protein_id="AAQ81473.1"
                     /translation="MALLSPGIEMKETSINSTVVRSATGRAAIVGKFAWGPAYEVRQV
                     TNEVELVDMFGSPDNVTAPYFMSAMNFLQYGNDLRLVRVIDMEKAKNASPLVNQVSVT
                     ITTEGQGYTVGDAITVKYNNATITEAGKVTAVDSDGKIKSLFVPTAEIIAKTRQLGTY
                     PTLGDNWRIDVSGASGGSAAALALGNIVVDSGVTFGNSEDAPAVMTSPAVMEKYAKFG
                     MPLVSAVYPGEIGSTVEVEIVSKTAFNSGAQQTIYPFGGTRTSNARGVIQYGPMTDDQ
                     FAIIVRRDGIVVESTVLSTRKGDRDVYGSNIFMDDYFRNGGSNFIFASSEGWPAGFTG
                     IIQLGGGTSANADVGADELIKGWDLFSDREALHVNLMIAGACGSDGAEIASTVQKYVV
                     SLADDRQDCVAIVNPPAELMVGIPTSTAVKNIVEWRNGMTGSGEVVDNNMNISSTYAF
                     IIGNYKYQYDKYNDINRWVPLAADIAGLCAYTDQVSHPWMSPAGYRRGQIRNCIKLAI
                     EPKQSMRDTMYQVAINPVTGFAGGDGFVLFGDKMATQVPSPFDRINVRRLFNMLKKNI
                     GDTSKYELFENNDAFTRQSFRMETSQYLDGIRSLGGCYDFRVVCDTTNNTPNVIDRNE
                     FVGTIYVKPPRSINYITLNMVATSTGANFDELIGPMQLA"
     gene            100255..100743
                     /gene="19"
     CDS             100255..100743
                     /gene="19"
                     /note="similar to T4 accession NP_049781.1; inner tube
                     protein of phage tail; gp19"
                     /codon_start=1
                     /transl_table=11
                     /product="tail tube protein"
                     /protein_id="AAQ81474.1"
                     /translation="MDVTDVLRAFESGDFARPNLFEVEIPFLGQNFKFKCKAGTMPAA
                     TVEKIPVGYMNRKLNIAGDRIYDDWTVTIYNDSAHITRQAIVDWNAMTHGMGNTITGD
                     IPEAYKKPGVVRQKDRNGESTKEYAIIGLFPTNVGEVTLDWDDNNTVSTFEVTFALDW
                     WE"
     gene            100787..102337
                     /gene="20"
     CDS             100787..102337
                     /gene="20"
                     /note="head initiation complex; connects head to neck;
                     similar to T4 accession NP_049782.1; gp20"
                     /codon_start=1
                     /transl_table=11
                     /product="portal vertex protein of head"
                     /protein_id="AAQ81475.1"
                     /translation="MKFLDLFKFWDRVDQNEYDERLKLGHESIATPKKDDGATEIETR
                     EGEATYNAVMQQFFGIDNNISGTKDLINTYRQLINNPEVERAVANIVNEAIVYERGHK
                     VVSLDLDDTDFGSNVKEKILEEFDEVCRLLDASRKLDTLFRRWYVDSRIFFHKIMPNP
                     KKGIAELRRLDPRFMEYYREIVTSDIGGTTIVKGYREFFIYTTGNEGYSYNGRIFEPN
                     TRIKIPRSAVVYASSGLMDCSDRGIIGYLHNAVKPANQLKLLEDAMVIYRITRAPERR
                     VFYIDVGNMNNRKATEYVNGIMQSLKNRVVYDSNTGTVKNQKRNLSMTEDYWLMRRDG
                     KSVTEVSSLPGAQTMGDMDDVRWFNKKLYEALRIPLSRIPRDDGGMVIGGQDTAITRD
                     ELDFRKFVVQLQHDFEEIFLDPLKTNLIYKRIITEDEWDEQINNIKVNFHQDSYYTEL
                     KDIETLRLRVDALSQIEPYVGKYVSHDYVMKNILQMTEEQIAQEEKQIEQEAGIKRFQ
                     NPENEDDF"
     gene            102338..102547
                     /gene="67"
     CDS             102338..102547
                     /gene="67"
                     /note="precursor to internal peptides; similar to T4
                     accession NP_049783.1; T4 gene synonym: pip; gp67"
                     /codon_start=1
                     /transl_table=11
                     /product="prohead core protein"
                     /protein_id="AAQ81476.1"
                     /translation="MEKLMEAIKSGDLVEAKREFAARMEIVKESTLKQEKIAIARSIV
                     TEGEEPKGKDGEDEDEDEDEDEEDE"
     gene            102548..102970
                     /gene="68"
     CDS             102548..102970
                     /gene="68"
                     /note="similar to T4 accession NP_049784.1; gp68"
                     /codon_start=1
                     /transl_table=11
                     /product="prohead core protein"
                     /protein_id="AAQ81477.1"
                     /translation="MLIPSDYIAEAVKIEAVMADATFRVNHLVESGFATDEIVGVISR
                     VAASEPDMAIAMISVVESTSIDEAIVKHVNSRGEITRTKDRATRKRNAFATTGLTAST
                     RRQIARRAAKTKRANPSISVKAQRKTKRALKRRKALGL"
     gene            102970..103602
                     /gene="21"
     CDS             102970..103602
                     /gene="21"
                     /note="similar to T4 accession NP_049785.1; gp21"
                     /codon_start=1
                     /transl_table=11
                     /product="prohead core scaffold protein and protease"
                     /protein_id="AAQ81478.1"
                     /translation="MEDELLIEVWGLPGDTPSELVVESIDQGRGALYIEGIFMQSNVK
                     NRNGRFYPKSILAKAVEDYTQTQINTKQSLGETNHPTRPIPDPNLASIIVEKLWWEGD
                     NVMGRARVIEGDFGPGDKLAANIRAGWIPGVSSRGLGQVKGGVVQEGYRLTVAVDVVW
                     GPSAPQAYVKPIREQTEEETGKPADAINNHVTTLNEAFSQLAKNMASMLN"
     gene            103612..104436
                     /gene="22"
     CDS             103612..104436
                     /gene="22"
                     /note="similar to T4 accession NP_049786.1; head
                     scaffolding protein; gp22"
                     /codon_start=1
                     /transl_table=11
                     /product="prohead core scaffold protein"
                     /protein_id="AAQ81479.1"
                     /translation="MSLKDKLLAESSEKLGAVAVELDSIFESVQLDDSVKANVSTAFE
                     QSVRSAAIKLAESHINDMASSAETQLAEAVETARVASETKLYEDADKFLTHLGKTWLA
                     ENKQAVQTSIKAELFESMTIGLKELFIENNISVPDEQVNVVAELNTDLDEATAEVKSL
                     FDKNLALEEQVASLQKEKALSEATMDLTMSQKEKVLNLVEGLEFGDKFAGKLSAIVEM
                     VTASNQKTQEELQEQALNIDESAAAVNFEPEAINEQKEKQANDPMAAYLAAASRMS"
     gene            104458..106047
                     /gene="23"
     CDS             104458..106047
                     /gene="23"
                     /note="similar to T4 accession NP_049787.1; structural
                     head protein; gp23"
                     /codon_start=1
                     /transl_table=11
                     /product="major capsid protein"
                     /protein_id="AAF61693.2"
                     /translation="MSLKNKEILNKWTPLLEGEGLPEIAGKNKQALVAQILEAQEKDS
                     KSDPVYRDDKLIEAFGQSLMEAEVAGDHGYDPTNIAAGQSSGAITNIGPAVIGMVRRA
                     IPSLIAFDIAGVQPMTGPTGQVFALRSVYGKDPLAAGAKEAFHPMYAPDAWHSSLATK
                     GATTTTDGTPFAKLTAGQAIAEGDIVGHFFYESGTAFLQNVSGASVTVGTNETGEALD
                     KLINAAIGEGKLAEIAEGMATSIAELRQGFNGSNDNPWNEMSFRIDKQTVEAKSRQLK
                     AQYSIELAQDLRAVHGMDADSELNGILANEVMLEINREVIDWINYTAQVGKSGWTKTD
                     GSASGVFDFQDPIDVRGARWAGESYKALLIQIDKEANEIARQTGRGAGNFIIASRNVV
                     SALALIDTNISPAAQGMASGLNADTTKGVFAGILGGRYKVYIDQYARQDYFTMGYRGA
                     NNLDAGIYYCPYVALTPLRGSDPKNFQPVMGFKTRYAIGVNPFAESRTQAPQGRITSG
                     MPGVNSVGKNAYFRRVWVKGL"
     gene            106126..106413
                     /locus_tag="44RRORF162w"
     CDS             106126..106413
                     /locus_tag="44RRORF162w"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81480.1"
                     /translation="MILIKSSAPVISKTYEAANMSAMTCQLVIDGGDTGKVEIDGSLD
                     GKSWINIAKLSAALNADGIATDGGIASTSWNFYRANLTETSGLATVIVSIS"
     gene            106424..107290
                     /locus_tag="44RRORF163w"
     CDS             106424..107290
                     /locus_tag="44RRORF163w"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81481.1"
                     /translation="MILNPKAVLNNTSSGSSGVSSFNGRIGPVDPESGDYTADMVNAI
                     EKAPTDSQRRVLIGTTPTVEELIDPITVVDNLTSDSSTSALSAKQGKLLQDGKQPTIT
                     GAASTIASVDLTPVRIAATDSNGKMTTSLVSVSDLDLIKDRTTRVKSELEWTGLNIDV
                     TGTALNLVGALKAITPVYGSWAPMFDIINDKMVAAKNDDRTLLYKIAITGTFDNTSST
                     NALTLTTTIGSNIDVSSAVRLPNQNPQNINYISLISVDKNGNFATNGASLTLRSTTSD
                     FTITRVRLIAEQ"
     gene            107302..108534
                     /gene="24"
     CDS             107302..108534
                     /gene="24"
                     /note="similar to T4 accession NP_049789.1; T4 gene
                     synonym: os; pentameric vertex protein; gp24"
                     /codon_start=1
                     /transl_table=11
                     /product="head vertex protein"
                     /protein_id="AAQ81482.1"
                     /translation="MSRITDLINESTTTAANSQSRPALAGLTRAVNNLIFTEMVAIQE
                     TNMPSSTLYGVKYLNPAGNQSFASAATYMGDVGYRDGIPLAVLNSPMTEGFVFKDSLD
                     VVYTVIKPLTLMSATSDVNDAINDAVLLGDIRIKSEAALAEKFEGAESFVETDFQFDR
                     WTVPVRSRKLKTNISVELLQDLEANKLDAVGIIDDVLSTMISEDINKDIIQSMVTVSR
                     RYKVEGISPNGIIDLTSSIDAPIIGRTLYQQACEMKNQMLRNTSYEATYVLCTTRVSA
                     MLEASGWMEANDDPLSAGTLKNGLLVFVDTVSSFDYLITGCKHNVNDIEHVGSLFYSP
                     FIEADDLGAYKIINDPSSLQPAVGILIRYGLSVNPYTTSIGRNGDRDVVGDDWSKLAG
                     ESDMSYLLGVKLPKIMPV"
     gene            complement(108583..108951)
                     /locus_tag="44RRORF165c"
     CDS             complement(108583..108951)
                     /locus_tag="44RRORF165c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81483.1"
                     /translation="MNCMKRFSSAILEDKYLVTMNDWTREAEFADKVISKFNDNTSNY
                     PGISVPPMKGKPTMGYLGEMTRLFFIQRYNKENNKDWRKWCRENPGKILVIEVVGDAK
                     SEKPCQLEMQYEKGFWLRLM"
     gene            complement(108948..109472)
                     /locus_tag="44RRORF166c"
     CDS             complement(108948..109472)
                     /locus_tag="44RRORF166c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81484.1"
                     /translation="MSTRSEMLARYASIASASVKAPEPPKKHHFEVLRDEQIKRREEQ
                     VKAEREEVARQIEMMNFISKNKRYLHAYQVKVTGCQERGLEWRITFPQFVELMHTESC
                     AYTGTIFPKDSGRSIERVNPKEGYTMENVVIVTSRANSQKAQLDQFVHDNHIPTEMKI
                     KLMRKAIYQMEKNQ"
     gene            complement(109540..109848)
                     /locus_tag="44RRORF167c"
     CDS             complement(109540..109848)
                     /locus_tag="44RRORF167c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81485.1"
                     /translation="MRKFTELSNAEKVQIHFMFREMKQGYVQIGRMYDIRAVDVPDIV
                     AYVDGAKLDFETREPVVFRKHYVNPKRGKARPHTDSRFKVTPATGESLEALLNKFNKK
                     "
     gene            complement(109848..110315)
                     /locus_tag="44RRORF168c"
     CDS             complement(109848..110315)
                     /locus_tag="44RRORF168c"
                     /note="similar to O32419, O34098; GTP pyrophosphokinase
                     ((ppGpp)ase)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81486.1"
                     /translation="MKYTQQHLAEAIQYATNRHAGQFDKGGAPYILHPLQLMHWARRD
                     REALDVQILCVLHDVVEDCYDDREEGLRDINTLFGSSMAQLVDNVTKRDGESYECYLI
                     RVNSDIRSVKCKRYDLRNNADLRRLKGVTPKDTERAVKYMTAYYNMGEKWGLK"
     gene            complement(110315..110554)
                     /gene="30.6"
     CDS             complement(110315..110554)
                     /gene="30.6"
                     /note="similar to T4 accession NP_049820.1; gp30.6"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81487.1"
                     /translation="MKFTTTYFNFKTNRPDHIISGAMVPKTKEEIIEGIKAYVDSICP
                     LEDRTDENGNDTLKIEEGARFPFMMRPQQISMRYS"
     gene            complement(110560..110898)
                     /locus_tag="44RRORF170c"
     CDS             complement(110560..110898)
                     /locus_tag="44RRORF170c"
                     /note="similar to RB69ORF040c accession NP_861730.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81488.1"
                     /translation="MRTIHCKDEYVEFYHGSCTLGLKGDMLLPPEATDTISEKGRKKN
                     LDRVFFTKDRGLAKVYARRAARSIGGEPTLFRVVAPVDTVFMSETPGATVYHAAWAFV
                     EQIPFGKLSD"
     gene            complement(110958..111719)
                     /locus_tag="44RRORF171c"
     CDS             complement(110958..111719)
                     /locus_tag="44RRORF171c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81489.1"
                     /translation="MLKSTLENMILENSQAIKDKVLVADAKKMFTDPNSPIRHIIKHR
                     DERFQTPFHDLLYTATTYPVVFDGPIWESSYSLMYPMILRDHFGDFNLNGHSLRDVID
                     ALIELRREFKKKMALAHLAKLRDYPDDGIDYNKAQWYAKAILCFMYGRFVDDREFDVS
                     KFVKIAKSEYDRAAISIISSGGILLNAQVDTFVYAAEAPITFSETQHNDKYSKIVIFE
                     HGYIADPGKMRRVRLCTEKIKTRLLKNQRQQFIKE"
     gene            complement(111906..112448)
                     /gene="hoc"
     CDS             complement(111906..112448)
                     /gene="hoc"
                     /note="highly immunogenic supplemental capsid protein at
                     the center of each capsomere; similar to T4 accession
                     NP_049793.1; T4 gene synonym: eph; Hoc"
                     /codon_start=1
                     /transl_table=11
                     /product="head outer capsid protein"
                     /protein_id="AAQ81490.1"
                     /translation="MAITLTVAPLSQTVAVGTDVEFTATFTGDDTVKEIVSYAWLLND
                     SVLSGETSDTIAELFDTEGDFEVKCRVVYALVADDGAAPVTITSTASTITVEEIPVIP
                     EGHWFVNPLEFKNSSFTWLPYWIHDWMKANPAWRDDPVNSPWPKVTYAIDKAVTDYGD
                     CLMQESRNGYIYKASQFVKS"
     gene            complement(112488..113222)
                     /gene="inh"
     CDS             complement(112488..113222)
                     /gene="inh"
                     /note="similar to T4 accession NP_049794.1; T4 gene
                     synonyms: lip, hoc.1; Inh"
                     /codon_start=1
                     /transl_table=11
                     /product="inhibitor of prohead protease gp21"
                     /protein_id="AAQ81491.1"
                     /translation="MKQKLFVRSELETKFGSLSASESKKKLADYAMKHYDVKLSRQKS
                     FVNMMNDLEEAVSATFEDARKMAGDAIEEINLEERVDFSDSVELDPDLMDKEEIFTED
                     DELIIDQVEHKPVVQDVGAISINDIPKEDKDKIVEGIKSGVIKIEAPLGVFSGEIIPE
                     KITELVLTFPEGYQPKYKLVGPEGRAFVNVPYWIYDWMQGRNWRADITECPYDKDMLK
                     SLAFYIERDGSVAIRESRNSKFIVIS"
     gene            113277..114758
                     /gene="uvsW"
     CDS             113277..114758
                     /gene="uvsW"
                     /note="similar to N-term of T4 accession NP_049796.1; T4
                     gene synonym: dar; UV repair and recombination protein;
                     UvsW"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-DNA and DNA-DNA helicase ATPase"
                     /protein_id="AAQ81492.1"
                     /translation="MIDIVLENYSFVRVECEDSIFFEMREYFSFKADGYQFSPKFKCG
                     VWSGDIFLLGYDRLLPFGLVSQAIKFAEQNDYKITVDPAIRQRENLSRADFDAWIQSK
                     EIYSGSTRITPHWYQSDAVYEGICARRKILNLPTSAGKSLIQALLSLWYLENYKGKVL
                     VIVPTTSLVTQMIDDFVDYRLFPREAMLGIKSGTAKDSNAVIYVSTWQTAVKQKREWF
                     NQFGCVMNDECHLSTGTSIKKIIESVDHIPFKYGLSGSLRDGKANILQYVGMFGDIFR
                     PVTTKQLMDEGQVTDLNIKVVQLGYSDEDRNAVRKYNYDEEIKFITSHAKRNRKVCSI
                     AKGLAEKGENVFMMFRLTAHGKALYETLIKMGVKAHYISGETETEVRDQMKVLAEGGT
                     GHVFVASYGVFSTGISIKNLHHIIFAHPVKSKVTVLQTIGRVLRKHKSKAIATVWDIC
                     DDLGILNAFGKYTRQNYALKHAVERVERYVSEKFEYTMHKLKL"
     gene            114768..114998
                     /gene="uvsW.1"
     CDS             114768..114998
                     /gene="uvsW.1"
                     /note="similar to C-term of T4 accession NP_049796.1;
                     UvsW.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81493.1"
                     /translation="MLSFKSYLHEAMIDSFMGKIASCQTLEGLEELEKYYDKRVKEVD
                     LKSSDDISIRDALAGKRTEFEGGDEEEQEEEF"
     gene            complement(115033..115209)
                     /gene="uvsY.-2"
     CDS             complement(115033..115209)
                     /gene="uvsY.-2"
                     /note="similar to T4 accession NP_049797.1; UvsY.-2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81494.1"
                     /translation="MQLPQGTTLCPACKMPVEKVLAVDTPYGPAHPGPCAHHLEALPL
                     SESESILEETQLLM"
     gene            complement(115212..115682)
                     /locus_tag="44RRORF177c"
     CDS             complement(115212..115682)
                     /locus_tag="44RRORF177c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81495.1"
                     /translation="MTLFEQITESRSQARREHGNKAVQLLGLVIGEVNQSRATDDESV
                     RKVILSLMKGINDRIENKYTSEDLVEALKEKEMLSKFLPQEITVDQFNSIVNGKELMD
                     IHRLVGPNINVLAGKLMGRISAGVKDGRWTVAKPKEMKKEIESYVIAALETIGV"
     repeat_region   complement(115779..115845)
                     /note="6 copies of repeated sequence detected in
                     intergenic regions of genome"
                     /rpt_type=direct
     gene            complement(115991..116374)
                     /gene="25"
     CDS             complement(115991..116374)
                     /gene="25"
                     /note="similar to T4 accession NP_049800.1; gp25"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate wedge subunit"
                     /protein_id="AAQ81496.1"
                     /translation="MNINMLYSDLDPNFGKSWDNDVLMTKGSRAVKNSIIGIVSTPIG
                     SRAFNPYFGCDLPDQLFENITPLVIDTVERNIKTAIRNFEPRVYNLTVDSIGNFDNNE
                     LIVTIRFSIVDNPALIDEIKMRLSN"
     gene            complement(116371..116985)
                     /gene="26"
     CDS             complement(116371..116985)
                     /gene="26"
                     /note="similar to T4 accession NP_049801.1; gp26"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate hub subunit"
                     /protein_id="AAQ81497.1"
                     /translation="MQIKMTIGGKAVETDMLTVSEYLGLVNSYSINSPEEAVNQTIES
                     RFGELPKHLAEQAFVKLVALSKRKQIKMKTKCTCGNEHSFVVSPDAISVTSDDALTHH
                     AGGVIINLRHPKMFEDRDPFEMVDRCLVSFEHDGQVISWDNASDLEKDLLFKQLHIDD
                     IRQIVGKLSANKIYAVVPLSCECGNQWPAVIEGPGAILGALGVK"
     gene            117032..117778
                     /gene="51"
     CDS             117032..117778
                     /gene="51"
                     /note="similar to T4 accession NP_049802.1; gp51"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate hub assembly catalyst"
                     /protein_id="AAQ81498.1"
                     /translation="MNIIRVKLPGGTKRFKPFTVSEYRDLLLVRNEMRSNPKERQEIL
                     DELLAEMFPEYTPFEREYIFLNVYIGSMGKALVDATFKCPKCGSTHRIRLKLTQEPMK
                     APELTVNNITFKFKMPEKSEAPDVLFNKTIDKISDGENEYNWSDLVDQRDELIDMISY
                     EEFVELSKSFRSIKVSQKIQCCVEHDLSFDNMLELFEVLLNPDEIFNFYKINRALVKY
                     DYSLDDVMSMMPVERSIVLSLVEKELKEKK"
     gene            117778..118893
                     /gene="27"
     CDS             117778..118893
                     /gene="27"
                     /note="similar to T4 accession NP_049803.1; gp27"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate hub subunit"
                     /protein_id="AAQ81499.1"
                     /translation="MLQRAGYPNVSIKLYQNYDAWLENRFIELAATFVTLTMRDGLMN
                     GINEGLLQIYDANNLQTKLTGDEIIQTSLKTANTEITYNRLYGIKHIGASVDMKGDNI
                     ITFQLGSMHYVKNLKFSRMFTNNAVVSVQEMMDYIYNDQVKLMPPFQSVNTRVPMTNW
                     VLGINDYFNFIRKFGQTVEREHIPLVWEDMEGLHISDFAEMQSKEPISYIVTEPRLLG
                     ETISMIDHKVCFDFEWLTKANGYTRNPYKNMSFYAHSFIDKRQTRVVTGEGLNATSIS
                     RSGAYYDQIDRSGSEEYNRMLTFSQYDAYCSAKTYGEFGLTPGKKLEFYDKKNQFLGE
                     YFVDEVIHEISREQSITSMFMFNNSVKITNHEERQIS"
     gene            118890..119417
                     /gene="28"
     CDS             118890..119417
                     /gene="28"
                     /note="similar to T4 accession NP_049804.2; gp28"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate hub distal subunit"
                     /protein_id="AAQ81500.1"
                     /translation="MKPRLNIIPAVKIINVNGKEIKIPKLGFRQMKLMKDMQGVDDCM
                     VGLLDSIRPGLTAAEADMVILHLLAFNKRIQTVQLVGGVEIDIDKAYMCAVYDFDFDG
                     KTIHFKAPAVTDRFVSKIDILEKQFDRDKTGFDFDFREAPAFVLDWADEIIATIALDT
                     PVGTIYGGSSIVGTI"
     gene            119427..121127
                     /gene="29"
     CDS             119427..121127
                     /gene="29"
                     /note="tail length determinator; similar to T4 accession
                     NP_049805.1; gp29"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate hub subunit"
                     /protein_id="AAQ81501.1"
                     /translation="MTTSLRDLRRQKQQNDATKNLASDVQKAVNQPPNGDSLAAQELI
                     AETVEQGNNELRQIKANTASLHDTAAATELGAESTEMSNTILREISETGKQTFSKLSE
                     FAERLKGSFSADDVEQTPIRAASSSDQAIQIINEENPEPENPLVGYLRTISEDIKFLR
                     ENKNEPSDPKDPDVVPDDKDDLKTMIDRIGDQIVKSVDSGFKRTVNIADSISSTLFKY
                     TITAALNFAKMAALVLSLIIAFDVLSRHFSHWTQMFQEQYAEFKETLGSFGTPFENLT
                     GIVTDLVNYFKSDEYLKMFVRLAEGAADQMIYIVNMMMVGLAKLGAAILRALGADDKA
                     DTLEASAISVATKTVGYTPSEEEEATIGRVRKRQAQEEAEQSEASWWEKKKREWDGKP
                     IETDEEKAVRERKKSIAENTTAEQFGKHDALSQKIQHVGVTAEKNETSNELLGKHREL
                     LEKRASDVEQAKQSGEITTESYKQLKVEIEKQREFLDAHEQKLLKPKASIKPAPEPEI
                     GVVGSIAKEEKRVEASQTAKQEAASNYNTNANIVKNNNQTLVQAPRTSSPGPGIGNHL
                     "
     gene            121124..122152
                     /gene="48"
     CDS             121124..122152
                     /gene="48"
                     /note="similar to T4 accession NP_049806.1; tail tube
                     accessory protein; gp48"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate tail tube cap"
                     /protein_id="AAQ81502.1"
                     /translation="MKVTELIDGGVQDVVKGILKGENPAGGSTPRQPLSKITIAQFPA
                     ERNAANDSTQDFNVNDLYKNGLLLSAFNYSGRQTGDLRSFRTDQNNIGDYRKGVVKEA
                     IANILMPKGQTDIDTINHKFNDVQQSLVERGNGSITGALSSMASHAVYGGLESITQGA
                     FADRGEQVYIASRAMYAGAENRTKTYTWQLTPRNVYDLVEIIKIYEMLSYYSYGSVEK
                     SNTANDIRKSVDAAYKETIINPLTPEATHGQTTMFERITSFLSNVNVVSNPIIWTIRN
                     FGQSSSFDSRSDIFGPAQIQSIRFDKSPDGHFGGLAVAPNLPSSFVLEVTFREILALN
                     RSDLYSED"
     gene            122154..123011
                     /gene="54"
     CDS             122154..123011
                     /gene="54"
                     /note="similar to T4 accession NP_049807.1; gp54"
                     /codon_start=1
                     /transl_table=11
                     /product="baseplate tail tube initiator"
                     /protein_id="AAQ81503.1"
                     /translation="MYRLDEFQQELNKDFQRSNMFSVVFATTPSSKTTELLDGFGGFL
                     YNNLPFGKDFAGLTQGMISSSLNKIIVQGTQSVMRSSGVSKYLIGAMTSRTVQSILGQ
                     FEVGTYLLDFFNAGNTHTGLTVYSVQMPENRLGYEMDKFHNAPNIKLMGREYDPLVIS
                     FRMDHQASNYRAMQDWVNAVEDPVTGLRSLPADVEADIQINLHARDGIPHTVTMFGGC
                     IPVAVSSPELSYEDNNTITTFNVTFAYRVMSVGAVNMAMVDDWLKGDLLPALGSQAGG
                     WLSKFGPFS"
     gene            complement(123039..124967)
                     /gene="alt"
     CDS             complement(123039..124967)
                     /gene="alt"
                     /note="similar to T4 accession NP_049811.1; Alt"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase ADP-ribosylase"
                     /protein_id="AAQ81504.1"
                     /translation="MLLTEVFDAAGKYDVVNLTPKAKVPHMLMIKAPGAENLVIRFCN
                     YAAKGDAVKQVKTGDKFMQIQVMQLSPKGNLQVLKTGLGNDPIGAMNVICDEILNVMV
                     KYRLDGALLRFPTKSLHGQSKTIGRIASRLLKTRGGGRFIVLPELLEHAGKYTYIMMY
                     RKSVGITGVAGLEIDPELYTITNTKVGDIVTDTKTGQTVTKTEAIAKSIEKKEDKRPM
                     NSATHFKISRAEIIKTFNAANNIDKFDATSYFEPVENIINSEGRNIESYNVAAQTFMA
                     PDRDFIQAFGDKIELEQTEIDAIIIASDNKSINGIEALNAFTQIISDVYIEDEYDKTL
                     ERLDHISDDHPGKEKMVMDMARRRADPRIKQALHNYQLLIESKFNRQYKDRVEYSLSE
                     APVASRKAVEMYCAEGYININGTLTGNMRHLDPDTKRDIEAIDTAFKKAGLRIPKGMT
                     LYRGQRSDSWVSKAAMENKAFYFSNFVSTSAKPIMYSGQLGSSSDISLNREEVDPTNI
                     EVADKMDEAIYFGFVITETKVPAIFPGYWSEHNDECEFILPRGTVFKFNKTYKAGGTG
                     GRTNVIVECEAVGLNMLEESEVIYDGDHLLETGEVKPMGFSNFVKSRNEPKLTKAESF
                     SVLANAMSFDGVSPKFFE"
     gene            complement(124997..126916)
                     /locus_tag="44RRORF187c"
     CDS             complement(124997..126916)
                     /locus_tag="44RRORF187c"
                     /note="similar to alt, T4 accession NP_049811.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81505.1"
                     /translation="MVIDNAMDGQLNEVFDSAMKFNVANLTPKAKVPHMMAIAAAGKE
                     NLVVRFCNYAAKGDAVKQVKPGDKFMQVQIMQMSDKGNLQVLKGGLGSDPIDAMNAIC
                     DTTIDVMKLIHADACLIRFPIKQLQGQSKTLARIAERIVNKRGKGMFQYVPGMAKFEN
                     KYMYILVARKSKQLADIKGLGIDPELYEIVPAAVGEVVIDKKTGEKVTKVEAVEGTLA
                     AKENKRSPRSVLTGAHLDKKAFLDASRALTSDKFANSLEIHGDRFENPDEITALGGKT
                     SPESEAIGVIVNSPRYGNGDLGQVDLPYEVVKKYEVVNAKNMASLAYDISEYLSPRFD
                     ELTNKSESLTREKYIENHMVDMMRAVNDSQRKKMSQVISFADVYNEKHMTNEVSTAVK
                     QYTGVYYEDINDVFVLNMKPGEREERWIKGLDKGFKNIGMKLPEGMSVYRGMKVASEL
                     ANISLANKMFYFSNYVSCSFTPNIFGSGIGGNKNISKAMISSEETQVAEQKKTFFGFA
                     VHDVQVPVIIPGNTSKHPHENEVILPRGTTFKFTAVSKAEIIDPDYSFSSQTTVWAEC
                     IAVSASSLNESDVVYDGDHLMETGELKIIQGFSSFLSESVVADEAQKLNKAQVGRNIL
                     ASIISDEDMSPKFYN"
     gene            complement(126948..127907)
                     /locus_tag="44RRORF188c"
     CDS             complement(126948..127907)
                     /locus_tag="44RRORF188c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81506.1"
                     /translation="MFELDNIIKVEISDCVYQHKKSPSIGKLSEEAEPDYSNFTIDTI
                     NQPITLKEFIWAWSKCGSGAWLLGHMPWMNLELGSYEQVRMIFDYHSDSQYHDTCVNI
                     IHSCNRVLEERYSESRSTVGSIEFDDHIHNYCDEGFASVAAGLRSGTFDSGSAGIFAK
                     QCVEVMDRYMDDSIEFRGSVWRGMSMPVASYEQFRNNGSILFKNFVSTSIAPIMYNHG
                     IVECRNLHINKPTAVVRYNPDFPNRQIKINMHIDCSGIKHIVPAKITGYPEECEIILD
                     RNTVIVIDEVFEYLDHPNSSTAKCLIRAKALPLSQFNGPTLVV"
     gene            complement(127950..128216)
                     /locus_tag="44RRORF189c"
     CDS             complement(127950..128216)
                     /locus_tag="44RRORF189c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81507.1"
                     /translation="MNLHVRYDGKEFKFVVANDLAAVTAIAHLVKDGFGQAPHHPDGE
                     EWSIFVKPMQVFRDSGWHPAQVYRGYKNGVGCDDYAITVFFRID"
     gene            complement(128319..129824)
                     /gene="30"
     CDS             complement(128319..129824)
                     /gene="30"
                     /note="similar to T4 accession NP_049813.1; T4 gene
                     synonym: lig; ATP-dependent DNA ligase; gp30"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA ligase"
                     /protein_id="AAQ81508.1"
                     /translation="MTHILDILNSLAATDSTKEKEKILGQHKGNALLETVFKLAYNKR
                     LTYGITPKGLRFIGSVGPMSLEQFCDELVSKYSTRNLTGNAGFNYMQQMLDSMTSASC
                     EVARRILARDLECGASVALGNKTWPGIIPEQPCFLAESFSLKALAKIIFPAFAQLKAD
                     GSRSMAIISVDGEEINIVSRGGNEYIGLVDIKAQLKEIAGALNGKLGDFVVDGELVHN
                     PHRKPVKTPKQHTLDDLFGLEEITEEPGQESDRNKSNGLGNKSLNGTLTAEEQSEMLF
                     NVWDIVPADVYFGKRKCFMECEDRFNLLKELVGDTGSMKYSNIELIECEEVENYEEAL
                     EIYRRNVQRDREGIILKNKHGMWVDARTADQIKFKEEIEIDLLIVDVYPHKKHPNKVG
                     GITVQDASGNIQVNCGSGFKDTTHRKINGKKVEIPLSERHEYDRELLMTQIDQLKGSI
                     AQLKCNGLQTRKGRKPHEPKYKLFLPIFQLIRHDKKVANHIHDVFPDAILD"
     gene            complement(129821..130525)
                     /gene="30.2"
     CDS             complement(129821..130525)
                     /gene="30.2"
                     /note="similar to T4 accession NP_049815.1; gp30.2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81509.1"
                     /translation="MQIEKPIILTDVDGVLVQWTSGLPYFAQKNGIRTDEILKTLVDE
                     RFRTGEELFGVNGRIADILMREYNNSDFIKYLAGYVDAIDVVNRLKEHYDFIAITALG
                     DSNQALMNRCCNLNTLFPGAFKDILCVDIGETKMPHYISVKQKYKDRLVCFVDDLVSN
                     LQDCHDAMSQLPQIHMLRTENAREVKHDIAKYHTAKNWYDIEKLLVNLNPKPIKMDLS
                     HLSTWEDKPVTIEAKA"
     gene            complement(130594..131304)
                     /locus_tag="44RRORF192c"
     CDS             complement(130594..131304)
                     /locus_tag="44RRORF192c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81510.1"
                     /translation="MNAIKAHYVATMRYNEFDVNPSKEKLVNRLASRLAWQTAMSSEH
                     RTRLSDRDVYRECVNFCQNMTQWHGTNNDEGYGARAKPMVEDVKNAVVEELQNRGFYT
                     QLFTRENQKGSIECRIPTALLNRWFMNKDVSNAAYPEAVDIAVEEQTFNSDYYLMNGS
                     KVLFLENGRPAQHTLPKLVQGEDGNWRICDRPIKNTPDDAIFKLEKFAREQDGRCWTE
                     YALKLVPGHPMDVINTLK"
     gene            complement(131375..131566)
                     /gene="30.9"
     CDS             complement(131375..131566)
                     /gene="30.9"
                     /note="similar to T4 accession NP_049823.1; T4 gene
                     synonym: 31.-2; gp30.9"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81511.1"
                     /translation="MAKQMKAVEKKVEAPKTGRTGYKRSKNARIDQVGNKLVARVNRQ
                     VAHINMFGQPKHEGRKRQK"
     gene            complement(131597..131935)
                     /gene="31"
     CDS             complement(131597..131935)
                     /gene="31"
                     /note="replaces GroES as cochaperone with GroEL for head
                     (gp23) assembly and also affects topoisomerase; similar to
                     T4 accession NP_049825.1; gp31"
                     /codon_start=1
                     /transl_table=11
                     /product="head assembly cochaperone with GroEL"
                     /protein_id="AAQ81512.1"
                     /translation="MSKFDNALPIAQFESIIIESKQLASAGDEIMSSTIPGFVVGKRD
                     LPEIPLTAEVISVGPEVPDHIKPGMVILVPNGRLDNVPDPRYLRGEIDVKQSRKMSVT
                     HWKNIQVIYA"
     gene            complement(131997..132521)
                     /gene="31.1"
     CDS             complement(131997..132521)
                     /gene="31.1"
                     /note="similar to T4 accession NP_049826.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81513.1"
                     /translation="MSKQYVLQQLLFSVLNDGQHELIFKKADDTHRVMRATRDPILVE
                     VSERGSNAFKPADSQEVEKKERKESNVLNVVVYDIDAKGWRSFRIDRLVSINGTGIGT
                     LAGLINSRPEYLNMGFTYDRYVEVAPKAVYFDVHAQDKSYIDDLVENASRFELISDKY
                     GVKTWLVDEAVNEF"
     gene            complement(132531..133091)
                     /locus_tag="44RRORF196c"
     CDS             complement(132531..133091)
                     /locus_tag="44RRORF196c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81514.1"
                     /translation="MKIQLDTKAIEALFPEGSEARVELQNAVIANFAKKMQEKHLEGV
                     TREQIQKAVRDAGVSMDSYSIVRDMLNKTITNNGWDASNAQLKDTSSLAHAVRNYARQ
                     QDLKLMQGMEAWANEMVSKELGKREEAGKHFIEMYISRAETAIAKSKAQALSEIESRL
                     VAACKQNMPEIIRREMANYLNKESQL"
     gene            complement(133088..133402)
                     /locus_tag="44RRORF197c"
     CDS             complement(133088..133402)
                     /locus_tag="44RRORF197c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81515.1"
                     /translation="MIIPVGEGVIAEEVRYFNVDTHEGCINVGIDPDWLQPENLTGTI
                     EVDKDHVLCEHYNRLIGRVYGHKSFAEGECVRTSSIQAIVHYKGDTYVLTTNSVYKVI
                     AK"
     gene            complement(133460..133978)
                     /gene="cd"
     CDS             complement(133460..133978)
                     /gene="cd"
                     /note="allosteric enzyme activated by HM-dCTP and dCTP for
                     dUMP synthesis; similar to T4 accession NP_049828.1; Cd"
                     /codon_start=1
                     /transl_table=11
                     /product="dCMP deaminase"
                     /protein_id="AAQ81516.1"
                     /translation="MKVSSVLQHAYIVAQESHCVSWKVGAIITKDGRIISTGYNGTPA
                     GGHENCDDHAKAAGWLDPETGKLKAMYRQAHNEWSSCNEIHAELNAILYAAKSGQSID
                     GAEMYVTVSPCRECAKAIAQSGIKKVFYNELYDRNTPGWDEILVKSGIKVIHNKVPLN
                     LLKKEFTVSNQN"
     gene            complement(133978..134208)
                     /locus_tag="44RRORF199c"
     CDS             complement(133978..134208)
                     /locus_tag="44RRORF199c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81517.1"
                     /translation="MTNVSADEMITAQQLIAEKCVLFEEKCKAIDPGVRVEYTPTGFG
                     EFQLTTINSEGTRVDYAFTISIDGQINIARII"
     gene            complement(134317..135204)
                     /gene="pseT"
     CDS             complement(134317..135204)
                     /gene="pseT"
                     /note="similar to T4 accession NP_049834.1; PseT"
                     /codon_start=1
                     /transl_table=11
                     /product="polynucleotide 5'-kinase and 3'-phosphatase"
                     /protein_id="AAQ81518.1"
                     /translation="MSSQRVICTVGPTSSGKTTWAEEMVRSAPTKYVNLNRDDYRFSL
                     FGCRTWSDYKFNKHSEALVTKAIKAAATEAINMSKTVIVSDTNMAESVQHEWKEFADS
                     MVTDFELKFFAPGSLETLLERNRYKGPRGLPEHVVKRQYDQYMKAYGGVRQYRQDYNL
                     PKCVIFDLDGTLFDNSQRGPFQWNRVLEDAPRPSIVELFSMYKDRGYSCLTVSGRDGV
                     SEADSLEALRRIGCYPDAHFQRAAGDSRPDDIVKEEIFWEKIAPAWNVFRAIDDRTKV
                     VDMWRRIGLECWQVQPGDF"
     gene            complement(135201..135449)
                     /gene="pseT.2"
     CDS             complement(135201..135449)
                     /gene="pseT.2"
                     /note="similar to T4 accession NP_049836.2; PseT.2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81519.1"
                     /translation="MTSMKHIGIVLLSLLVMSCAAKPKELPTPQPVHKLEVTWKATTE
                     GATLSFEDYNRLGVWLEDVNRYIKDQKAIIQICEGRIR"
     gene            complement(135446..135763)
                     /gene="pseT.3"
     CDS             complement(135446..135763)
                     /gene="pseT.3"
                     /note="similar to T4 accession NP_049837.1; PseT.3"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical predicted membrane
                     protein"
                     /protein_id="AAQ81520.1"
                     /translation="MLPSLSSTISWLRNNVLYMIIIGLLGWTIKNQSEQIDNLETKIE
                     TIQKFQVSSVENAKPVQEAMLKAPKATRQMEKIAEKKPQLLEKHMNTGFRQLTDKIQE
                     TTK"
     gene            complement(135720..136256)
                     /gene="alc"
     CDS             complement(135720..136256)
                     /gene="alc"
                     /function="attenuates elongation of transcription on
                     cytosine-containing DNA, blocks transcription of host and
                     other phages"
                     /note="similar to T4 accession NP_049838.1; T4 gene
                     synonym: unf; Alc"
                     /codon_start=1
                     /transl_table=11
                     /product="inhibitor of host transcription"
                     /protein_id="AAQ81521.1"
                     /translation="MFTTQDIINEFAEGGYSDGIQIFAKNGREVGYITDLRQQMMKDA
                     KKKEYSRTYAADRYNRLKDDIGPLAQDVLKELKNVFANVPAKVFINETMPNVHFMGAK
                     FYFILSPLTQKVRVNIIHKNACRMKYVFPKSAKLEIRRGGMDIMIDGLERDAGIALVE
                     GFARHVAEFEFNNQLAKK"
     gene            complement(136334..137485)
                     /gene="rnlA"
     CDS             complement(136334..137485)
                     /gene="rnlA"
                     /function="tail fiber attachment and RNA ligase for repair
                     of tRNA in restrictive prr hosts, in conjunction with
                     PseT"
                     /note="similar to T4 accession NP_049839.1; T4 gene
                     synonym: 63; RnlA"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA ligase 1 and tail fiber attachment catalyst"
                     /protein_id="AAQ81522.1"
                     /translation="MTNITELYDNLMNVVNSSEKGNFFFKDVTTSMGTKARIFSYFIA
                     SYSDWLIPGALESRGIMFEITEEGKPVRIMARPMQKFFNLKENPFTMNLDLTKMVGLM
                     EKADGSLISSYHDQGYIFLKSKAAIHSDQANKAMALLNSPAYEKLRERIADSGPGYTF
                     NMEYVGPSNRIVLPYEDEELIVLNVRHNETGEYVNISTLMNDPATRSRMVGVYPSPDW
                     EKITPAEWEAGVRAETDIEGVIGIMDDGQLFKLKTDWYSALHRTKDSINNNKALIQSI
                     KERATDDLRGLFADDAVSIAKIEDFEELYISTISRYHELCFSVYQSLQGKDRRSFAIE
                     AQAKLSDHRYLFSIVMRQYARDWDSEEVIGAIEEHMVKNYDKYTPAKYR"
     gene            complement(137482..137898)
                     /gene="denA"
     CDS             complement(137482..137898)
                     /gene="denA"
                     /note="similar to T4 accession NP_049840.1; site-specific
                     endonuclease II (EndoII) initiating degradation of
                     cytosine-containing DNA; DenA"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease II"
                     /protein_id="AAQ81523.1"
                     /translation="MTLEQHGFTQIAQLFIGENDRIDRTFAKNPDFKHLIYAFKVGDT
                     VAYIGQTKNLHKRMDSYSNGKYWNNTNQSHIEKSELLEEAVRNGVPVTVWIKHCFKIV
                     ITTPFGSSVIANLDDEERKYIEIFDPPLNSKLKVKK"
     misc_feature    complement(137896..138195)
                     /note="potential ORF with similarity to T4 nrdA.1; not
                     predicted by GeneMarkS or Glimmer"
     gene            complement(138191..139030)
                     /gene="td"
     CDS             complement(138191..139030)
                     /gene="td"
                     /note="similar to T4 accession NP_049848.1; Td"
                     /codon_start=1
                     /transl_table=11
                     /product="dTMP (thymidylate) synthase"
                     /protein_id="AAQ81524.1"
                     /translation="MIQYKDLVEDVIANGRRKTDRTGVGTRSVFGRMLRFDLSKGFPA
                     VTCKQLAWKSVVGELLWFISGSTNVDHLRRITHGPNSDKRTIWDANYEEQAINLGYSD
                     GYLGPVYGKQWRQFGNKNPVDQLQKVIDQIKSNPDSRRLLVVAWNPEDIDAMALPPCH
                     FAFQFEVYEGKLSLMWSQRSVDVGLGLPFNIASYALLVHIIAGICGLEVGELVFSGAD
                     VHVYENHVDDLVEIFWRDPRPLPKLAYYDVANLAELRTMTVDDYVLTEYDPHPPIKMP
                     MAV"
     gene            complement(139027..139581)
                     /gene="frd"
     CDS             complement(139027..139581)
                     /gene="frd"
                     /note="methyl donor used by dTMP synthase; similar to T4
                     accession NP_049850.1; Frd"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="AAQ81525.1"
                     /translation="MIKAVFALGVPSDFHMNGMFAFGKDNDLPWEKIPKDFTLFREKT
                     MGCICVMGAKTFQSLPFNLPGRVMVVIGDINRSCRNKSGELPALHVNINDHDWMSTVE
                     SLYPDQDIAIIGGLGMIINNLHLCDEIHINFLMLTAEYDTINPSIYISEKSLNRYLGG
                     KQLNSNRYSVDLPHCRSIREGVWK"
     gene            complement(139578..139811)
                     /locus_tag="44RRORF208c"
     CDS             complement(139578..139811)
                     /locus_tag="44RRORF208c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81526.1"
                     /translation="MTEINKGLECPFSLAQLKEHYSFWPLTYETYHSIKHDISRLSWY
                     NIEQGFLNGTDDEYACRAYASDLYRLVKYGGPE"
     gene            complement(139813..140913)
                     /locus_tag="44RRORF209c"
     CDS             complement(139813..140913)
                     /locus_tag="44RRORF209c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81527.1"
                     /translation="MIINDERQLASMRKIADLQPIPGADAIEVATIDGWEVVVKKGEF
                     RVGSDCVYFEIDSLLPTDHPAFRFLETRAKIYDGKMRARIKTIKLRGQISQGIALPTG
                     AFTVGELLGGQEMDKTIDQMLDIIKYEPPQDGTGCNPGGTFPIFIPKTDEERCQNIFN
                     RYKEKYADVKFAKSLKLDGSSITMAWVTDPELFLDLGTEEEPYAHDYDDAQFIVASRN
                     QVLRYNADSKWWKGVENYQIVDRLKELRMSVAIQGELMGPGIQKNRENFDKYRIFAFR
                     AFFIDEQRFATDEEFQDLCRTLGMEICPQLGYSYPFQEFTNVKDMLAAADIPSIEHKI
                     AEGVVYKSVELVDGRMVHFKAINNKFLLKCED"
     gene            complement(140924..141082)
                     /locus_tag="44RRORF210c"
     CDS             complement(140924..141082)
                     /locus_tag="44RRORF210c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81528.1"
                     /translation="MTYDEWLDKNREHVTKFISENVWIDITEIRRDQHEVAIHLGDDI
                     IAKDTIYV"
     gene            complement(141085..141324)
                     /locus_tag="44RRORF211c"
     CDS             complement(141085..141324)
                     /locus_tag="44RRORF211c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81529.1"
                     /translation="MPLREELCNQSESQETKAYQAWLAQNAEFLSRWVAEHMQVDVEL
                     ENTDYTSSNDIKVKVHISVGNETISGYDYISLSKE"
     gene            complement(141368..141757)
                     /locus_tag="44RRORF212c"
     CDS             complement(141368..141757)
                     /locus_tag="44RRORF212c"
                     /note="similar to RB69ORF104c accession NP_861794.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81530.1"
                     /translation="MKISTKSWHYRLLNTMDMSIPRSLCPYFWKVVFTIGFIGVITTF
                     LAIIFHGVGAKALWNWFDYDANFVYATLFGFTLVVSVLAAVIGVFFGFFYASEKELFT
                     IKTENIVINYIRAKKSKICPTLEFDYE"
     gene            complement(141754..142002)
                     /locus_tag="44RRORF213c"
     CDS             complement(141754..142002)
                     /locus_tag="44RRORF213c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81531.1"
                     /translation="MKNILDYPENTRASGLPKELLDLHEERGAKTVEALGGQEAFFML
                     IKSKPAGDWILDYKEKFEEVNGTKFSQQHHFWNIRKIS"
     gene            complement(142117..143004)
                     /gene="32"
     CDS             complement(142117..143004)
                     /gene="32"
                     /note="similar to T4 accession NP_049854.1; DNA
                     replication, recombination and repair protein,
                     helix-destabilizing; gp32"
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA binding protein"
                     /protein_id="AAQ81532.1"
                     /translation="MFKRSNPSQLQAQLAALKGNQGGFGGDKNEWRLKTDASGNGQAV
                     IRFLPGKGDEGLPFVKLINHGFKKNNKWYIENCSSTHGDFDNCPVCQHLSRNDSYNTN
                     KEEYSLLKRKTSYWANILVIKDPATPENEGKVMKMRFGMKIMEKITSMINVDPEMGET
                     PVDVTCVFEGANFVYKTKKVGGFTNYDDCKFLSCSEIPKINDPEFQKFLDAGMEDISK
                     LVAPSEFKSLDDLEKKFKQIMGTSLAAGKAASAAGSLNAELNEFDAELTSFESDTPAN
                     AFEQTGGTDLDDDLDSLLG"
     gene            complement(143075..143734)
                     /gene="59"
     CDS             complement(143075..143734)
                     /gene="59"
                     /function="DNA replication and recombination protein for
                     loading gp41 on ssDNA with gp31 and UvsX"
                     /note="similar to T4 accession NP_049856.1; gp59"
                     /codon_start=1
                     /transl_table=11
                     /product="loader of gp41 DNA helicase"
                     /protein_id="AAQ81533.1"
                     /translation="MIALRYPPRPDRFISAKGAFMLYLMIKQHMAGKYDVIKYSWGMK
                     VTDATFNKRKDKYFFEKLSNKFHLKDMVEIYLATFIENPSGWAGDLVSDEAMTAHREL
                     LGRHLRFPNIYREDIKNIVYFAEKLDVPLGKIMEYNTDKMTSPIFKLLQSGMISIETF
                     LVIDSFLGILDKHDAMMSGDIIWQNWHTKLSGYRKLVVINKDTAKRKFIEHVKAFKDQ
                     V"
     gene            complement(143743..144000)
                     /gene="33"
     CDS             complement(143743..144000)
                     /gene="33"
                     /note="similar to T4 accession NP_049857.1; connector
                     protein between gp45 of replisome and gp55 late sigma
                     factor; gp33"
                     /codon_start=1
                     /transl_table=11
                     /product="late promoter transcription accessory protein"
                     /protein_id="AAQ81534.1"
                     /translation="MSNPNNLSDKTSNGLEIEALVVKEGLTYMEACIQWLEENSLEIS
                     NCQKYIPRALIDKLSQECIESDMLRPSIVRSMTRNTLDFLM"
     gene            complement(144000..144287)
                     /gene="dsbA"
     CDS             complement(144000..144287)
                     /gene="dsbA"
                     /function="facilitates transcription from some late
                     promoters"
                     /note="late transcription; similar to T4 accession
                     NP_049858.1; DsbA"
                     /codon_start=1
                     /transl_table=11
                     /product="dsDNA binding protein"
                     /protein_id="AAQ81535.1"
                     /translation="MENVEKKKKEKVEFNPSVHGDRLQQLIVEASNLKIQQEKYGEMV
                     KEQKDIAKRECGVEGKLFNQLLRIYHRQEREQFEDAADEVTSAYDQIFKGN"
     gene            complement(144297..145220)
                     /gene="rnh"
     CDS             complement(144297..145220)
                     /gene="rnh"
                     /function="DNA replication enzyme for processing of
                     Okazaki fragment RNA primers"
                     /note="similar to T4 accession NP_049859.1; T4 gene
                     synonym: das; Rnh"
                     /codon_start=1
                     /transl_table=11
                     /product="RNaseH ribonuclease"
                     /protein_id="AAQ81536.1"
                     /translation="MNLDSFMGEAEKTGGPDVNIIDASQLIIATVMANFEPDEVNEAM
                     LRHLIFDTMRNNVKKFKAEYPETIIAFDDSKDGYWRRDLAWYYKKNRSISKEESKWDW
                     DALFGFINKIVDEMLTVYPGVKMIKIGKTEADDIIAILTKLFTDQGRCVMISSSDSDF
                     TQLHKFKGVKQYSPAQKKSVKPKNGSPKHDLFYKIIKGDGKDGVAGIKCRSTYVIDRV
                     EGERAPPCSAKWIESLVQSEDPRAALENEEWQKRWDENVKLLDLSQIPDHVAEKILTS
                     YNNCTVNPRGKLYSYFVKNRLTKLLTKVNQF"
     gene            145295..148963
                     /gene="34"
     CDS             145295..148963
                     /gene="34"
                     /note="similar to T4 accession NP_049860.1; gp34"
                     /codon_start=1
                     /transl_table=11
                     /product="long tail fiber proximal subunit"
                     /protein_id="AAQ81537.1"
                     /translation="MLGQHFRATSGLDAAGEKLINVAIADKATLSDGVNVDFFHKYNT
                     IYQYDPLRGYDAKHAIIYQRRIYFAKADIASPAGEFQPTLWTGLRVDPTWQFVNSVAT
                     AMQLVSGQYISADNRFNNLVFNLPTDPIDGDTIVIKDIGGMPGINDLVFSTIGAAIIE
                     YNGQTRGSSFRGTIPFCEYVFMYKAAGNRWQLDICASTEQSYFVAPSTQGFQLQSGMV
                     TWRQTAQGQIRLILPKHANHGDVITTHDIDGLNAINHSTLEIYPGSGHSINENGVTLI
                     ESRTSGYGSFVFDSGAKVWEVWDGDQRTRIRVTKADTSVLPFEHILVTGDGTGASQVV
                     TLTLPEDVAIGDRVQITLDYLRRGQTCTIQVKPNSGEVMVGSKAQMQFQRRSEYPATN
                     GWELVSSVSIVANTDYVPYIELMYAELDPALVGVTPARYGWMIGQVAPKVERVDANQR
                     DRLGVAALAAQSEVDKNHEQNPNDETIVTPLTLSRKTSNETRRGILRIGTTAEVNQVT
                     TASYLDDVAITPKKLNERSATETRRGLAEIATQAEANGATDDITIVTPKKLHNRIAAE
                     NQTGILAIVQKLGTAGTARNLAGTGIYNRADHLRAVTPATLDEFAATETAKGVGYIAT
                     QAEVDGGSSDANGPLLVTAERLAARRASETNHGLIEIATQAETNAGTDDVRAITPKKL
                     NDRTATESRTGIARLATQTEVDAGTSALTLLTPLKLKTRFDNLSRVEVDADAGLTRTG
                     TIWDTVSIGVKLSTEVQRGTLRVATQVEANGSTDDATVITPKKLDGRKSTRTLDGIIR
                     VATTAETRTGTSQTLAVCPQDLIYMAQTEPTWSGNETRRGYVKTATMESTFVGNDTVG
                     STQVYTSYANDGLAVSPRGLNYALQNFLPLKATAQNSLALGGVNSADWVRRTIAQTVT
                     GAMNFTAAMTAANITSNVTSVSSLRVRDGNLGAVEIGTQGVSVLGTGILMHSADGAGA
                     ANDWFMYSGGRSSVLGVNEIGFVSTNADNTSLTKQFSVSRDGDSTTNRHIRSTNGHVV
                     LENSGARIYVGGGIATTNQLAQSITGGFIFGNINSAMSVVTNGDDNFKINGSVVINVA
                     NAQTKLDPVYLRRDGGNTQTGKVLAAMTGDVKYSTFRNDNRYISSRGNDFVFGNTDTV
                     NGRVCLDTNKNPIVKIGNFEYEIYHKGNKPTAEDVGAVDITGSSANNLTIRDWIKIGN
                     VKIIANNLLKTVEFVWEE"
     gene            148973..150106
                     /gene="35"
     CDS             148973..150106
                     /gene="35"
                     /note="similar to T4 accession NP_049861.1; gp35"
                     /codon_start=1
                     /transl_table=11
                     /product="hinge connector of long tail fiber proximal
                     connector"
                     /protein_id="AAQ81538.1"
                     /translation="MATQFMAHLGPSYVETSHLSENNAIKYKLEALGSNADSTVKVPF
                     IKLNGASRLSSYSRGITAVTISPTGVASNQATFDLYTRPEHFDTLRSYLMSAPSNNIV
                     VLVSYDAMKSTEAFDEFMYQYGSRSWPGVPYLNKVLPDSRLYRSSYVAIFNTSLKRFC
                     YENFVGNDYTATSDTSAYLEVVFDTVEDIGACGTPERKVDDINEYFSRPDDYAFIRYF
                     PTENITNWEAIYHVKCELYNDQVLKDANGHARLYLWTQNSGGTWFSQMILSNVDGVVG
                     QWNTYEGYFKLPAAGGGATLWGCQAYRWPSSAKVGLAGARNVIVTRVTRDDDDKVENA
                     AFGVNGMRANTLSDNGNFSNPVMQLLNLKPKNVVTSNELRERT"
     repeat_region   complement(150158..150269)
                     /note="6 copies of repeated sequence detected in
                     intergenic regions of genome"
                     /rpt_type=direct
     gene            150395..154657
                     /gene="36"
     CDS             150395..154657
                     /gene="36"
                     /note="similar to T4 accession NP_049862.1; possible
                     gp36-gp37 fusion"
                     /codon_start=1
                     /transl_table=11
                     /product="hinge connector of long tail fiber distal
                     connector"
                     /protein_id="AAQ81539.1"
                     /translation="MADLKVGTTIGGSPAWNQGNLPLVPSGDRILYKGARVYSESDKP
                     SADELSVLSINGGRLKGQLQIDSASDNIFDLNSTDSGAVFMRYMHNNSNKAYTGIDAS
                     GNFYVRMADGASRAGIAFQIDNVSQDITFGANLKGPAGRAFSINKGDQPFIRDHGNGN
                     VTISALSKVDGNPGDLYLGYNSAGMVTNTVRLESPLFWKGARQLVDSNGFILRSAMDN
                     NYYNQSEADARFIRLNNNTTTDGFILSKTAEYTDAGRNMGYSGFYRHNGVDGFSGLTM
                     HVAHPSYSNGAYSRGITFAYGSSSYGLYTYGYDSAGVRLANQKIYTEADKPTPQELGA
                     LAAEANAVSASKLQTPRRISLSSGASGSVLFDGSGDVVIPVTIANDSHTHNIYVKKSG
                     DIMSGNLVVNAAVDANELRAGDATTKARIALSSDTVFFQGGPIGTTGLHKIAMSGYMG
                     KGIDALTYWMTNGVTPVVRWGSVDNKMFHEGYRPFDVQSTSLASKSCNDALESGFYSI
                     FGTTADTPYGTGPSGSTMVVSRWSGTGVSQTFYTYNSDRVFVRRLVGTTWNAWFELYS
                     TSKIPTPAEVGALAVNANAVSATRLQTARLISGVPFDGTSNITITATNVGALPITGGD
                     INGNLLVKGTLTNEGQLISYDSSTRGYGFRSTYSTGWLYTQTGKVDRDVNDQKHNLSG
                     WYGTPLSALRFTMAEGTSPHVLWGSTSHDVLHIGKSYGVGIRQGNGASNGHIYTEDGS
                     RDFDKLITAGRYSVDGQWLNGRAGAAAATYVGTAEVEVRAWGSGPAYIQTFTQLEGGL
                     PSRYNRVGTGTYPNIVWASWESGTKEWEYQAGYRMMISRSGEGVYPYMTIHKADLPPT
                     GTESVIGAWQSKIGAPPTANNPDSAQLATIVASVVDTTNRYATLRLSARDITTNGILS
                     IVDIGKDGLVVTNGGKKVELTAGVARAEKFIASDPYAFVSSTSNTHGVYLGNSAADKR
                     LILGGGNNTAGAVHVRPQGISTETGETVFNTNGTISNGTTPSAPGHLTNKVYVDNLIA
                     QQVSKSGDIMTGQLTIHTANNAPLELKSTTAGVVTPQYIIGNDSTGAQRWYVGQASPN
                     SPDVLLYSTANGTYLRLEANQISFNKNPISTALQGAAAGSLVRRDFLQTSLSSQTPNN
                     PVYIGASANLNNYQTPGYYYQDSNANAGSGSNYPTQQAGALVVTKAAGIIQEYTVYGT
                     GARYVRAFYTNVWSAWALVYDSTRPPGATAVGALPIAGGTLTGGYLQLQSATNSILEF
                     HQPGRHAAMIFLSNGTGQLRFSTSNGAAGETNVRMTLDANGALATTGSINGGAGVYDV
                     GQRVYSPNNPQPSLTPTQIGNALASMAYDAVGQYAMLLVAVDVGTWLVPGTVLPGSQL
                     RYSTAEGKDPSNSPPGNWRLHGRINQGGQWGAWNVSLWQRVS"
     gene            154694..155386
                     /locus_tag="44RRORF222w"
     CDS             154694..155386
                     /locus_tag="44RRORF222w"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81540.1"
                     /translation="MSQRHGRFWSIGFNAVGYTGSLPAPNWGTQIRRFAGLNPVGNGL
                     DPALSEFYFGQGAQPAGRWMSQYFNRGRTPSRCFMWSGSRYPYNSWSGFDWGGELTQI
                     ANATIKIGWIGTGRASHRGGDMGYINLRWKWDNDLWQETRIFTTPDTYVSDWYGNRVM
                     NLNRPGGGRGTLTFKIVGNVGDFDQHDVGDRGPNASWSPVVDMSVAGSGYQGELFKSF
                     QGHQTRQYNENN"
     gene            155396..155890
                     /gene="e"
     CDS             155396..155890
                     /gene="e"
                     /function="intracellular N-acetyl muramidase; lysis from
                     within"
                     /note="similar to T4 accession NP_049736.1; e"
                     /codon_start=1
                     /transl_table=11
                     /product="lysozyme murein hydrolase"
                     /protein_id="AAQ81541.1"
                     /translation="MTLEDMLVYDEGRKLKVYWDHLGYPTVGIGHLIVLRETKDMGVI
                     NHMLGEQLGHRVDGVISDEDCSKLFESDVKSVKREIGRYPAIKSAFDACDETRQKAIY
                     NMMFQMGGPRLSGFKKSLGLIAARNWTAAYAELLNSSWARQTPNRAQRVAQVILTGTM
                     DAYR"
     gene            155962..156627
                     /gene="t"
     CDS             155962..156627
                     /gene="t"
                     /function="pore protein for T4 e lysozyme, controlling
                     lysis timing and lysis inhibition, functions with rI
                     protein"
                     /note="similar to T4 accession NP_049865.1; T4 gene
                     synonyms: rV, stII; t"
                     /codon_start=1
                     /transl_table=11
                     /product="holin lysis mediator"
                     /protein_id="AAQ81542.1"
                     /translation="MSNQPTKTENQTGGRAGVLMDILDRLFKDAVTGEIVFYRAILLT
                     LVFLMGFSWYSKEEIFALYKETRFENYQEILQAERDRKFEMAAQEQLQIAHVSSRADF
                     SVVFSFRPRNMNYFVDMMATEGKTPTDLIGREKGGYPINKTSNEYMVHMSGRHFSNYK
                     EFAYLPAGHEDFEYMYSCPITNLDNIYAGSVSMFWKKKPVINENKLFVICNQAERLLS
                     RAR"
     gene            complement(156671..156931)
                     /locus_tag="44RRORF225c"
     CDS             complement(156671..156931)
                     /locus_tag="44RRORF225c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81543.1"
                     /translation="MQIEIGKKYRVTDAERFMAEHGITNGTEFTVTNIDDDGDLYTYD
                     ISWNGRDGKSAFAPSEGWALLLNGRNGNTDEKADYTGSIEEV"
     gene            complement(156941..157213)
                     /gene="asiA"
     CDS             complement(156941..157213)
                     /gene="asiA"
                     /function="activation of phage middle promoters"
                     /note="binds RNAP sigma 70 subunit, functions in
                     conjunction with MotA; similar to T4 accession
                     NP_049866.1; AsiA"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma 70 protein"
                     /protein_id="AAQ81544.1"
                     /translation="MNYSENIKDIIATASLLIKFGCEDILNKQETFVSFLNELGFRSP
                     TGEEFTRAGFRQMMKRLPIEQREELIEMFNQGHRDVNHQMMMYSNN"
     gene            complement(157292..157570)
                     /locus_tag="44RRORF227c"
     CDS             complement(157292..157570)
                     /locus_tag="44RRORF227c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81545.1"
                     /translation="MFEFVISSYWLGVSIAIIFVAISLTLMILTMMNCRAPTQKTIHQ
                     IQCWLSLLESGKPLFGKYAVPVTIAFLAITISLLTILWPIVLVYQIVK"
     gene            complement(157690..157881)
                     /locus_tag="44RRORF228c"
     CDS             complement(157690..157881)
                     /locus_tag="44RRORF228c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81546.1"
                     /translation="MNIDAVLTQHIVYGIFAVAGCGLMWQIRKDINQEKRIKRHNQKL
                     EQQARDWMSKNKPQPPNKP"
     gene            complement(157933..158265)
                     /locus_tag="44RRORF229c"
     CDS             complement(157933..158265)
                     /locus_tag="44RRORF229c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81547.1"
                     /translation="MNDKSWNLIKMFQMKKTKIEPTVTPLPISDLKVEAFELFKKIEE
                     RIAHDQTRLEELAKSRENELRRHEAAIRLAMDSHSIKMDDLSLQEALISDSLKGGKYL
                     KNIVAQAC"
     gene            complement(158407..159384)
                     /gene="nrdC.10"
     CDS             complement(158407..159384)
                     /gene="nrdC.10"
                     /note="similar to T4 accession NP_049708.1; NrdC.10"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81548.1"
                     /translation="MQVILKNALYFGNEYTGTFETNGTTWWDANPHDPREGKVNAIIK
                     GKSRMVWVNRDDFEFIYEDGDVAGTVKNVEESAEEMRERIAKRFMVMDKMSVGLVKGT
                     IRSLIISGAPGIGKTFTLERKLKHAHEVGEIDFSSIKGKCSAIGLYIHLWENREDDCV
                     VLLDDVDVFSNEDTLNVLKAALDTGEERIVSWGTASNYLAERDIPNNFEFKGSVVFIT
                     NADIDAEVARGSKLAPHLDALQSRSIYLDLGVHTSREIMIRVEDVITKTDMLQKRGLT
                     EAQTVNALEWMKEHTDRLRSVSLRTALYLADFINTDSDWADVAEVTLLK"
     gene            complement(159484..159873)
                     /locus_tag="44RRORF231c"
     CDS             complement(159484..159873)
                     /locus_tag="44RRORF231c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81549.1"
                     /translation="MFELYGDVKDFKLFKFKSPEHFVEWLRIKPDVENYYGDMDPEQP
                     FVGSMTIWYGHEEAIFDICDYSGRPPEDDCPTIAFTQDQINEFLDLVSDNPEEECEEC
                     RLRLIEDKLIRIEKLQKEVEFLKKQLN"
     gene            complement(159883..160320)
                     /locus_tag="44RRORF232c"
     CDS             complement(159883..160320)
                     /locus_tag="44RRORF232c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81550.1"
                     /translation="MIRYFKFKSQTAFNTWKKQWFRRRWSFPSEMEALVDCKPRLCVI
                     SPSQRKCVWEILDKDGQAIDTGRIAILENEMHLIELGEIIESDTPEGSAFDTDGYVVS
                     IDNLIESYKEAQANLEEAKLVLMKATDSANPKQLDEIKKVLGH"
     gene            complement(160422..162809)
                     /locus_tag="44RRORF233c"
     CDS             complement(160422..162809)
                     /locus_tag="44RRORF233c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81551.1"
                     /translation="MKQIITMPFNAVPGKLNSHKGAWAFLWKQIIEEETGHPCEVAVG
                     GHDFSDHDRVYVYHGMEFKGGLNLFGGPDAKSALHISKFLDFKGEIVSLDVDMPLYGE
                     MCRDRIYDKKGEVNPKVPAEWKDADWVAIDQRLQKSSRLAMIDLPREDVVFGDSHSFS
                     AWQPGYKALRHDGQTLRGALKKGIGSFLPVAVRNLTVYLGNIDIRFHFGRQEDPFADI
                     DAKIKELAKQLITLRNQGRITGEIELVTLLPIEDESRAIPGTGQFLKQNFFGTQAERT
                     AWMTHFNEKLFKLTKLPGFKVFAWPEQWYVDTAADPLSFFDKMEKPRSVHLSREFYRW
                     TKPMPVMEKPVKVKKVKEEKAPKADKPPKKKGGATADFLALSNEEVLALADKDVKEKL
                     GNFIKEFNKREWSVRIGQTHRDFVDYQLNGYVHKPEFGYGFCVENKPVPYFHPNRSFH
                     DEIIWLNEHLYFRTDVSFEDKLINSAIVKFYGPSRTLDIITGSADDIPYLVNTGSRYI
                     HFDKMETDPEYKYTLMKNIEVAFSKGQKIWGTTELRTSLQTASRNFARQNPSPIDVRG
                     VICPVNKTVLIAPNLDTSERKMRASDMIHWLHALAYGRAPGQSQGWIDFYKAKPTMSE
                     SYWFLNQLRGMGPYYCYHFSSNLCRMPGVGDAGLIEAEFKAEFDRLGVTHGKMDENAD
                     FVMAGPGACATLERLWPGVPINAETTTKMLLAIRDNQEDFYEIKEAEDKRYHKEATEM
                     GYFTTFGCEIACCQFNVFTRLSENWQAAVGRANAPISMEVGGKSKMCSLDGLFAI"
     gene            complement(162879..164402)
                     /locus_tag="44RRORF234c"
     CDS             complement(162879..164402)
                     /locus_tag="44RRORF234c"
                     /note="matches Pfam SSF sodium:solute symporter family
                     E=1.6e-34; similar to sp P13866, P96169 sodium/glucose
                     cotransporter"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81552.1"
                     /translation="MQLLDMVIFAGYIGCIVMAGLVIGWKKSGTTKSYFMADRSLPWW
                     ILGCAILAANISAEHLIGTTGSAYAMGIAIGAFELTGALALVVAAWLAIPYFVKNQIT
                     TMPQFLAMKYDNRVRSMFATFWIVVYTLVNLTAVSYMGALAFTSIGIPLEVGVWALIG
                     FAVLYSAVGGLSSLVWTDFIQVGILLTAGIACTWFTLDAYGVHVGSTSIAGSMVSLYK
                     ELPNHFQLVLEPGHPAYENIPGILGVVGVFLGSLSYFAFNQFIVQGALAAKSVKEAQK
                     GMVFAAFLKLLMPLVVIIPGIMAYSMTNGSLTPSDKAYPWLIDNFMPAGFHGLVMAAL
                     FAAIISTLAAILNSISTMFTLDIVKVHKPELSDKTLMKVARTVVVVCGAIGASLAIPF
                     LGNLDQAYHFIQEFVGFVTPAMLVIFFAALYWKTNSNAAIAVTVFSVAANAIVKFTVP
                     ELAWLDRFLMVLVGCGVLYSLFSGKQVEDAHIAPSKTLVIGGSIVAIIFFATYITFA"
     gene            complement(164469..165122)
                     /gene="motA"
     CDS             complement(164469..165122)
                     /gene="motA"
                     /function="activator of middle period transcription"
                     /note="acts with AsiA; similar to T4 accession
                     NP_049873.1; T4 gene synonym: sip; MotA"
                     /codon_start=1
                     /transl_table=11
                     /product="binds Mot boxes at phage middle promoters"
                     /protein_id="AAQ81553.1"
                     /translation="MTMTKIEAIAKVLNNASISDNATQIFIQVAKKAFITVSEIAESV
                     EMNKNAVYSNIGVMIKKELIEKSGDGYITTEAGDAILVEAAEMWKAAQPVEEVKVEKK
                     KGTRKSREITAEMTGLMEKISALVEENIGLKAVEIYRQNYQIIFSKRTAEGYRKFEVL
                     NNGKFRIFGYKVAEDKLEAFRQVGAEIKVGGSNTYIDIEQNEVNIAKVMQIAVGFSI"
     gene            complement(165213..165464)
                     /locus_tag="44RRORF236c"
     CDS             complement(165213..165464)
                     /locus_tag="44RRORF236c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81554.1"
                     /translation="MKIQFKSEQAFNEYCDQGGLYPGNAKIVDFMPDGWDSIIIVDRI
                     DVIIHEDNFFWDIAVDPADGMALHTIAYDEVHLFNIIEK"
     gene            complement(165461..165769)
                     /locus_tag="44RRORF237c"
     CDS             complement(165461..165769)
                     /locus_tag="44RRORF237c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81555.1"
                     /translation="MKFTKNVIVNRTYELSAEEFVNHHLRELRIYRNGGKVEYDCFVQ
                     CGVQPQFITHAISLPHIDFDVNDFDRYARTEEEKARHQSACKRLIKLIEVQFEKEEKS
                     "
     gene            complement(165779..166357)
                     /locus_tag="44RRORF238c"
     CDS             complement(165779..166357)
                     /locus_tag="44RRORF238c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81556.1"
                     /translation="MLSAALKAKIREYYEERVKHIRDNNIVNVTTPTYKLVFTKHKGY
                     VGQCHYAKREIRISELLNRSATWECIKDTINHELAHWATPGHSHDVVWQQMAIRLGAM
                     PQTRVAIGDLQRPFIIECRGEVVGYSDVLRTGEDAAGRYIKRRKRETFGNLVYKPNPD
                     YIDNSNWCEPDVDQKKPVKKTNKIIEDFLSDI"
     gene            complement(166398..166667)
                     /locus_tag="44RRORF239c"
     CDS             complement(166398..166667)
                     /locus_tag="44RRORF239c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81557.1"
                     /translation="MKITNDKARIQASIDSMISLFAQNWLYEFIKQNQGAKYFDMIKH
                     VREMKLEHTHGITLNLKELGSEGMIYREGRSIFCLKIVYNDKLIE"
     gene            complement(166798..167064)
                     /locus_tag="44RRORF240c"
     CDS             complement(166798..167064)
                     /locus_tag="44RRORF240c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81558.1"
                     /translation="MATIKLAPAPCFAINRYGEVVDNNHCGPRHLIECKCRMMDVPAG
                     EAAPSLLSVVNTIALTEDVENVYILAVIAGFNSIKVRYGTHPDF"
     gene            complement(167065..168732)
                     /gene="52"
     CDS             complement(167065..168732)
                     /gene="52"
                     /note="similar to T4 accession NP_049875.1; gp52"
                     /codon_start=1
                     /transl_table=11
                     /product="topoisomerase II medium subunit"
                     /protein_id="AAQ81559.1"
                     /translation="MNFSLDAFFDEEPASPAQKQTSNPETPPWDVEVDLTLGAKEDVW
                     FAPAGYQRGLIEVEPGDTGEIEVIEPMEHPTEDEVISEQIRQCEDALAQEIPAWKRTI
                     LSNHLTELHNRSLQSIINHEALEFAMYTVEERAIPSLIDGLKPVQRFFMYRALEYAKQ
                     NRSKFNKVAALAGGVSEAGYHHGEGSAAGAGQLIANTWNNNIPILEGDGNFGSRMVQQ
                     AAAPRYVFCRVHQNFWDIYRDIELAPVHPEPEHLPPRYYLPVIPMVLANGVKGIATGY
                     ATNIFPHSYKSLIKCTKAAIEGKPIPRLEVQFPEFSGVIRRVSAKTIEVEGLYELSGQ
                     TKLTITELPVKFDRLSYVILLDKLKDQGKIVSYKEQHKNGFRFDVTLKRQDKFGEQLQ
                     NNPEATHEKIIKMFGLRQVLTQNITVLNPEGKLAEYECAEDVIRDFVEHRRKFTAERV
                     EYERQKSEHARDLAWAKFKFINMVIDDKITIKGKQKAELVKEIASNPDFKGFENELVG
                     MSIYRMTEDETYKLQDEAIKQGKLFDYWLGTTPEAEYINDLNSLKGK"
     gene            complement(168742..169179)
                     /gene="ndd"
     CDS             complement(168742..169179)
                     /gene="ndd"
                     /function="binds host HU protein and host DNA to the
                     membrane prior to degradation"
                     /note="similar to T4 accession NP_049879.1; T4 gene
                     synonym: D2b; Ndd"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoid disruption protein"
                     /protein_id="AAQ81560.1"
                     /translation="MSKQNLNVQRIISAGAQRLGHFENGNFKFVTGKSKDDARGKGFY
                     FIVSAGVVKARTFVGDQETNRGFNETIYRVCHGFQPLTDEIWSKSYSLNQVVYFMPLH
                     LVPSLLKSPAQLELFGENMAKAQTLTTVSRQLFKVYNFEYQKR"
     gene            complement(169193..169453)
                     /locus_tag="44RRORF243c"
     CDS             complement(169193..169453)
                     /locus_tag="44RRORF243c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81561.1"
                     /translation="MFAIQHKESGKCIRSIEYSSSGYIGISFVDCDDMQDGTKVHVFD
                     TIADAKDCMNGKIQVSHDFFEFEVSHYHPDDYQVVCLTATVI"
     gene            complement(169453..169710)
                     /locus_tag="44RRORF244c"
     CDS             complement(169453..169710)
                     /locus_tag="44RRORF244c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81562.1"
                     /translation="MKLFAFKHRNNGTLAELYHLVDEIYLVEYGCEAPVFVASSIEEM
                     HAIIKHEHDYVINDIDIIDEYDIIEFEAKPKLIEGNCIGTP"
     gene            complement(169769..169984)
                     /locus_tag="44RRORF245c"
     CDS             complement(169769..169984)
                     /locus_tag="44RRORF245c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81563.1"
                     /translation="MKLYVLEHIETGKPASFIKDSFDDIVAIDYNEFEPVLAHSSYQD
                     MVAILENNHVFLCSRLNKTKYVVKEIG"
     gene            complement(169981..170214)
                     /locus_tag="44RRORF246c"
     CDS             complement(169981..170214)
                     /locus_tag="44RRORF246c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81564.1"
                     /translation="MLYRFVSEEQFNAWSSQNYAKEFAKHFKKWDDVFATEDLSCEGM
                     TDWAEINGQYICSSHWYPFVSDDLGSRLVEVEA"
     gene            complement(170214..170900)
                     /locus_tag="44RRORF247c"
     CDS             complement(170214..170900)
                     /locus_tag="44RRORF247c"
                     /note="similar to RB69ORF132c accession NP_861822.1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81565.1"
                     /translation="MNSSKIFNSQFKLHGKFAESVSNDDIKNETMFFNCDLAFAIMHG
                     GPITRSFIANLPKEWQYDDVVFDSRVHMLMPGWYPAIPGYHHDDVPRPDIPAGQHFIT
                     AGQPDYDNPRYRSNHILGLVNADVCPTHFAIGESEFSQIPDGELIYRQWHQEVMAKLG
                     SGELSKHIAPDRTIVEFDWQTWHTGSKSVGTGWRWFGRVSRNTDRVKKITNEIRRNAQ
                     VYMEFPMEGW"
     gene            complement(170967..171191)
                     /locus_tag="44RRORF248c"
     CDS             complement(170967..171191)
                     /locus_tag="44RRORF248c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81566.1"
                     /translation="MKMYTFDDVMESIGYVKVNSVSDLHNTLVGIECLAPGIKKHMSD
                     FPCWAKRIGHFYDSELDANWVFFDFVPLSD"
     gene            complement(171188..171394)
                     /locus_tag="44RRORF249c"
     CDS             complement(171188..171394)
                     /locus_tag="44RRORF249c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81567.1"
                     /translation="MQTYEFIKRRARPGCGQQKKELMAEHKMLRAMVDHHTIMCYDRE
                     PSPELLKARSDKERIENLLLEITS"
     gene            complement(171447..172100)
                     /locus_tag="44RRORF250c"
     CDS             complement(171447..172100)
                     /locus_tag="44RRORF250c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81568.1"
                     /translation="MIPMAVRERIFTQLRHMQSFTIELIMHQIHSRLAKEPREWTSFF
                     DRRMARIDSTVDYAIKEHAKAGGTLSKAEIAERTGRSLDAELGIAYILGGLTGVMVWL
                     DNDDITFDVPTPDFNLEIKTSFNRWPTMHTAGAEPYGRADGLCLYAGYKGNADVFLVL
                     HMENVDGQTYFNPNYFFTKRAMEKYPYEIATRRMVDGAYINRNHDRYVHFYKKWCTL"
     gene            complement(172097..172387)
                     /locus_tag="44RRORF251c"
     CDS             complement(172097..172387)
                     /locus_tag="44RRORF251c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="AAQ81569.1"
                     /translation="MSSPFTVEFYNDRNEKVDVRYGNHGWVSPSNIRYAENIINVVNG
                     ARFGEENKPVAEWFYFISSGRVYFKEDYDKMATIVGLIKTFDPYEFSMELKQ"
     gene            complement(172433..173566)
                     /gene="rIIB"
     CDS             complement(172433..173566)
                     /gene="rIIB"
                     /function="membrane integrity protector"
                     /note="similar to T4 accession NP_049889.1; rIIB"
                     /codon_start=1
                     /transl_table=11
                     /product="protector from prophage-induced early lysis"
                     /protein_id="AAQ81570.1"
                     /translation="MAKLKIVKCFDDVTKLQIFKKYEAGNISQGYLASEHGVSVDTIA
                     RVLKEVRTWPIAASQVVPENPTDEEIAAHFYSSTENTFEDTGRHFGITGLEAHNAVTR
                     RNQEITKAQEKAKGLIAQADVAIKHLDEVIEADKELECTWMANSKFLSVTIGSETYNA
                     SGDHPQFMEIIGLLRAEKYDEAMELLNIKRGLERYISGDLVIEGGTLRYKDLVIDSGL
                     TRRIVSRMQSGEPFLPLIAFFENLMDNPSRRAVYQLYDFLEHNDIEITDDGHFIAWKR
                     VNHSFKDMYTGKFDNSPGTVVKINRFQVDEDPNTTCSHGLHVAAKSYIPHYGGGSGKV
                     IACKVNPADVVAIPTDYQNAKMRCAGYEVLYEVTEDFKEMKHY"
BASE COUNT        47149 a        38769 c        37404 g        50269 t
ORIGIN      
        1 ttaacgagcc cggataaatt caatatcttg catgatttca ggagttaatt ctatatcgct
       61 catcgcaaca gcgtacaaaa gaggatattt tgattgaatc ttgttgatag catcggtaaa
      121 gcgttcaaaa tattcaacgt tgatatcatg aatcttcgct ttcatatcgt ggtatgcctg
      181 gaatgcaggg ttattacctt cgatccaatc aacgatttca gccagatgat cgtcattctg
      241 cttatcaaaa actctggtaa tttcaacgtc gaaaagattg aactttttca gacgcaaggc
      301 tgttccgagg tcttcgtcgt ttacatatgg gcattcgcca tccaaaacat caaattgctc
      361 gacattttcc atcagctttt catacatcca catgaaacca cattgcagat ttgatttcat
      421 agcagcagaa cgttttccgt tctcaatgat gtatacttct tcaacaccct gggcaaaaag
      481 agaatcaata gcatgtcgat tcatattacc cgacggttta agagaaatcc tgtcgtaggt
      541 gtcaccgtat gaaataatgc caacaccttc aagttcgcga atttcattcg tgctcaaaca
      601 aagcagctcg acttggcgca gatcgcattc atcaatatag acacgacgaa cattcggctt
      661 taccggtttc ggaccagcgt ctttgcgctt tttgatcgtg taagccttgc gaatatcgac
      721 catttcgctg aacttcaata tgtgccgttc atgtggttcg aacttctcgc atattgctga
      781 aatctttttg ccgaaagctg catattcaga ttttttcagt ttatgcgttt tgtcgagaac
      841 aacgaccgga atcgagttat tgatatggtt gtggtatgct ttaaccatat tcggaacacc
      901 ttcaccagta tcatttatca gcacatgtac tttgcgacgt tcaaggccaa agacgctttg
      961 gctgtcgatc atggaagttc tccatgaata gccagatcga gtaaattgcc ttttgagcga
     1021 accgttgcga tagctataaa ccgggatttc agaaagcttc gacatatcag tgtaacgctt
     1081 gacaatgctt ccgataagct cgccaccaat ttcgaggtcc gcaatagcgt taacgacgta
     1141 tgagttgtat ttcttcgtct ttatcgccgc atcgcgttta tcggtaatac cttcaaattc
     1201 tttcttgact gtattggcaa acgattgtga aaactttttc attcgctcga ccaaataatc
     1261 ttcagtttgt ttatcgagcg agagttcttc acgagatgga gcaatatcga gttcgccgat
     1321 tgggaacttc atataagccg ctcggccaga atacttgaaa accatgtcac tgctgatcaa
     1381 acgctctgga attgggtaaa ctacgccgcc aataatagca aatgcttggc cagaacgacc
     1441 gaagtcatca ttgaagaaga attcttcttc gtccgggaat tcctggattg agatgatatc
     1501 gccgttggtg atattcggct tgcaacggtc gaaagcccga tatactttag ctgcgagaat
     1561 cttccaacga gcgtgttcat gagctggaat cggaacttga atctctaagc catcagcttc
     1621 agtcgttgca gtagttgaca tcggagttga gaaaggttcg ccatcgtcca tatacatatt
     1681 gtagacggtg caggtgccat tctgatagct cttaacggtg aaaccaccgc cagtttcgct
     1741 atatgcgaac ggagatttac aaccaagacc aaagcctcca attgaatcgt ttgactcatc
     1801 tttcgttgac gcgaaataaa cggtgaaaat gtcatcaatt tgctcaggac tcagcccaga
     1861 gccataatcg cggataacaa accatggata aattgaggtt ggcagtgtca cgtcaaaagg
     1921 aatatgggct tttcccatct cgcaatggat atctaccgcg ttacacgaaa gctctcgcaa
     1981 taccgcttca gctttatcct tgtacaattt gtctgataaa acccgaaaag cttttttacc
     2041 ggcggtgatc ttgaaaccag ttcgcttttt cggcgcatta ccaaacattg catcatcttc
     2101 attactagac attatcattt agtgtcactc cacaatttca aaatactggc gctctccaaa
     2161 cagaacccag gcggtatcat cgtcgtcttc gtcatcggca gcatgatatt tcccagtcaa
     2221 aggaacatct tcgtcaagga tgagtatact tgcttcatcg tcatagacat gagcatcgta
     2281 ttcgcattcc caccagtcag ttcccatttt atcagcgatc cattggttgc aatcgtgacg
     2341 tcgggcaaac atggctttgt gatcttcaga cttaaaacgg attttcataa tatatcacct
     2401 tattcaatat tgaacttcag ctttcatttt ttcgatcatt tcatcgataa cgttcgggat
     2461 atttgcaccg aaaaggtttg cttcatgaac gatcccgctt gcgcacaata cgcccatatc
     2521 tctacggctt gcttgaccaa tgcgtaagcg ttcaagcggc ccagatacgt tttcagtcag
     2581 ttcgtcagcg tgttgctgat cacccatgaa gcgaatgttg atgcgacaaa cgcgttcgag
     2641 tgcattgttt agttcttcat acagggtcat atgacctcca cagttagttc atgcctataa
     2701 taacatgaaa gaacattata gtaaacagtc attttgaata tttttggatt aaccagatga
     2761 attctggtta ataggggaca ctcgtttgaa tgtatcattg aacaactatc tggactccca
     2821 ggtttggctc tgccaaacta gcattttatc ctttaaggcc taatagatta tataacctaa
     2881 gggataaatt cgagcaaagc tcgaaggcga agccaatatg ttgttataca aaaatgccgg
     2941 actcgaggtc cggccaatat gcaactgttg aactagttaa cgagcgagct cgtcggccga
     3001 gggccgttct ttcttgttca agtttcttat tctcagtcaa cttgtaaaat caacggaccg
     3061 ggtaccggta tttatactcc cggtcggtca tcccggaaat cgaagaacat ggcttcagat
     3121 gcagaaatcg aatcgaacag atcgccgttg atatagatgt catgccaacc gctgaagatc
     3181 ccacccttaa gtggcttaac atcgaactcg accatgccga atttcttggc aatacgccag
     3241 ttgttgttgc tgccgtcgct gttattggta gcccattcct tctcgccttg atcgatgaac
     3301 gcacgctttg cttctacgga tttgaatttt gctttcattt tattctccta caacgttaaa
     3361 ccaggtttca aattcttcgc gagaaatagt aacaccatag ctttttccgc gttcgaggta
     3421 ataggtgtca ttctcgacct tgacatcgac ttcacaacca taatagttgt caaggaaatc
     3481 tatgttgcaa tgttggccgc gaatacgatt acagaagtgg tagtaatggt gaccactttt
     3541 gattttggct ttcatttcca taagctcgat gtcgaagaat ttctcttcac tttcgataat
     3601 gcacaagtta tcgtcatcat gatcggtaag attcaggtgg ctcaaagcat cgaccagata
     3661 aaaacgacca tcatcctggt ctttgacaag ataaacgttg cgatagtcga tcagatacat
     3721 gatgacagca ttgatactgc ggaaacgttc tacaaagact tctcgcgaca catcaggctt
     3781 aaattggaca ctgtatttca tagcaactcc gttttgttta acttgaggct atagtaaacc
     3841 atagccccaa gaatgtaaaa tgttttcttc gacttatttc acttcatcga aaaagtggaa
     3901 catttcttca tcatcgaatg tgataccgcc gccaccttct tcttccggca attcgatctt
     3961 tttaccgtta gcgtcgacca gcatgtaacc aaccaacttg ttgctgtcat attttgccca
     4021 aaattcgtct ggcatgtgct tcgagaaact ctcattgtac cactcgcttt cggcgaattt
     4081 tttacgatgc tcttcagatt tgaagcgaat acgtttgatt gtcatgatta accctctgct
     4141 ttaagtattt gatggattca ttctatacat ttcgatggtg gtgtaaactg ttttgtgaaa
     4201 aagatttcaa taaaaacaac aaaggcctcc gaagaggcct tttcgtcatt gagacatcca
     4261 ttctttacgg agagctgcgt catcacccag cagcatctcg aacaactctt cccaatcatc
     4321 accaaggtcg acgatatcat agttggggtt gttgaccaca tcagagtatt catgctctcg
     4381 aagtgaaccc agacctttga tgtatcgcaa atcccaacct ttgtaatcct tcttttcttt
     4441 ttcgaattca gttagtgtgt agaaccattt ggtgttctta cctttgttga ggataacaac
     4501 tggcgttttg acgaatcgaa ccgaaccttc atcaaacagc tttggccatc gagcgaagaa
     4561 agcaagcaaa caggggtaaa tagaaccttg accatccggg tcagcatccg tcatgattgc
     4621 aatgttctta tacttgcgct ggctgatgtc gtctgggttc gccaaatcga gacctgtgat
     4681 agcgcaaata tccgacaatt cattgttctt cagaacatcc gaacctttca taccccacgt
     4741 gttcatgacc ttgccgcgca atgcgtaacc accatggagg ttttcgtctt tgaccttcaa
     4801 taggtaacca atcgccgatt caccttcagt caggaacaat gtggtctcaa tatcgttccg
     4861 gccccattca ccagctttaa tgtgcttagc gcagttggtt tttgctgctg ctttctgggc
     4921 ttttgtcatt gcagcttttt cggctgccag atgtcgtgca agagcggctt caatgatcgg
     4981 ttgcaagatt gcatcagtgt tcattatctg tttggataat ttcttaaagt caaggtcaaa
     5041 gtgcgatttg acttcacctg ccggattagt gaggcgctct ttggtttgcg aatcgaatcg
     5101 gaggtttgac attccgcgaa cgactacaac cattgttaag cattctttaa cacgagcttt
     5161 gctgatttcg atcttatgct ttttcttgat cgctggcata agttcttcag aaatcccatc
     5221 aaccagataa tcgatatgcg aaccaccgtt cttgatgttc agaccgttaa cataactaac
     5281 ctgacggaat ccttcaggag aattacagat tgcaatactg aatctatcac tttcgacgat
     5341 gagcgactca tcaccaaaca tctttgcata atcagcaaat ttcatcgacg cgatttggcc
     5401 gttgattgtg aatttgattt gcgggaatac gacagacaat gcggtaatac ggtcggaaat
     5461 gatatcgatt atttgttggt cgattgttcg gccttcaaag tgcttttcat cagggatgaa
     5521 atataccgac gttcctttga ttttacctgg ctttgtttcc caatcaatat tactcgcacc
     5581 ttcagagcaa gtgacggtga gaaaattctt gccatcgcaa gtttctccaa taaatttctt
     5641 cgagaagaag ttggtgagag atgaaccaac accattcata cccatagaca cacgattggt
     5701 gtcgtcgaag tttgaaccag ccatcgtctg agtccatgcc gcgacaggtt ttggcatctc
     5761 gccatctggt gtttcgacca ttgactgtgg aatgccgcga ccgttatcta ctacggttac
     5821 agaaccctca agcaaatcaa agcgaatatc aatcttattt gcaaatttaa aatcagtacg
     5881 aatgccttcg tcaacagagt tgtcaataat ttcatcgatg atttttacca gacctggcac
     5941 ataagaaact gattggaatt tgccgaaaag gaatcgctca tgcggttcgt aagcaactga
     6001 accaacatac atattcggac ggaggattac atgctctcgt ggtgttagta ctttgaattc
     6061 atcagacatc atatttcctc ataataatgg gtagtgacat tatatcacta cctgtcatac
     6121 agttaacaat tactgctttg cgcactcaag aatatgcatg atttttatcg tgatgtcgta
     6181 aaaatccgat tcaacccatc cacgagtagt cattgccgga gaaccgatcc ggatgcctga
     6241 agtttcaaca ggtgatcggg tgtcgttggg aagcatattt ttgttaacga ttatgccttc
     6301 tttttccaac agctgttcag cttctcgacc agtcaagccg aagctctcgt aggtgtttaa
     6361 caagacctgg tggttctcgg taaagccaac tagcttatga ccagcagcgt caaaagtctc
     6421 atacattatg gatgcattat gggccacttg aatcatgtaa tcgacatagt cttcgcggag
     6481 agcttcacca aaacaaactg ctttcgctgc gataacatga agaagcgggc cgccttgaat
     6541 acccgggaag atagcagaat ttactttctt ggcgatatca gcatcgttag taagaatgag
     6601 gccaccacga gggccgcgca aagttttatg agttgtagta gtaacaacgt cggcacccca
     6661 tttgagtgga ttagcgtgaa gacgagcagc aacaaagcca gcaaaatggg ccatatcgac
     6721 catcaatttg gctccaattg aatgagctgc atcagcgatt ttcgcatagg tggcttcatt
     6781 gattcggcca acataagctg aatacccgat tacgacaagc ttgaggtccg ggatggttcg
     6841 aatctgctca accacttggt taatgttgat cgtaccatcg ctgaatactc cataatgatg
     6901 gaaatcgtat atcttgcccg aagcattcgc tttgtgcccg tgagtgagat ggccgccgca
     6961 gtccaaggac atagcgagaa ccgaatcacc cggcttcagg agtgcttggt aaactgcctg
     7021 gtttgcttgt gaaccggaat gaggttgaac gtttgcgaaa ttgcaactaa acagttcttt
     7081 agcacgctca attgccaggt tctcgatttc atcggctttt acgcagccgc cataataccg
     7141 tttgcccgga tatccctcag catacttgtt ggtaaaaata gaaccctgtg ctttcataac
     7201 atcgtctgac acatagtttt cggacgcaat caagcaaact tcgcagtatt gacgcattgc
     7261 ttcatcttcg ataatagatt gcacaacttt atcttgcatt ttaatatcct ttccagaaat
     7321 ttacaggttg ttttcgctct aattgggaat catgagcaat ggttgaaagc atatcacgga
     7381 cgcccacatc gcttaatccg tcatattgta actcgcgtat tcttctgaaa cgtgcgtaaa
     7441 gctcagcaaa tttaatgcct ttgcaacgat caacgttaat catcatcaat gcgtcattcg
     7501 gcacccattt gcgtctcagg acataggttc tccgatcagg agattcttgc gagctatgcc
     7561 aattaatgaa aacatcatgc gatccggccc actcgcgaag atcgtcgaac tcacgtgctt
     7621 ttgatttcca atatgaactt ttcgcttgcg ttaaaatggt aagcaagatg ataaaaagaa
     7681 tcactattgc gaatatgttg accgtgatca cgttcatgtc atttgtccca gatagttttt
     7741 tctattttgg cttgagatag gtaaagaatt gacataagat tgccggtttg gtcgaaatct
     7801 ggattcgcga tatcatcttt gcgaatctgc tctaacattt tataggcttt acgaaaattg
     7861 atgcctttgc attcggaaaa tattgcattg tctccaccgg gcatgaaaaa tacaaccttt
     7921 tcaaaagcac ccactacgcc attcttgaaa ttcatggata taccatattt cgcaagccat
     7981 gtgttaatct ttgcttgctc atttcgggct tttttccgcc aacggctatc ccatgttgaa
     8041 aagcagcagg ctataagccc cagcactagc ccagcgataa aaattatttg gaacatgctt
     8101 tttccaccca tttttcagct ttcatattca gttgaagatt cagctctttt acgatgaggt
     8161 caacaatttg gcttttgccc aacccggggt tatcttcaga gtattgaaga taaagcatgt
     8221 ccatcacgca gttgatgaca tctgcagctt caccgactgg tcgctcatca caacgctcag
     8281 gctggttgat cgatttagcg aattcgccaa cttcctcaac caacttgccc atcacaaagc
     8341 ccatattgcg tgtcgggaca acagcgctgg ctgtaaaggt gctcgacaaa tcgatcgaaa
     8401 cgttctttat aacttcgtcg aaaaacacgt tgaggtctcc ttcgattttg aatgacattg
     8461 gagttactgc atggtagatt ccatcgattt ggcgatagct ctgatgctca atggtattga
     8521 tcgcttcgat caattccgaa cgattttgcc ggcgccctat ccggtttatg gattttttgt
     8581 tgatgaacga tatcaaacct tcgcggtcat tacacttcaa acgaatcata catttacctc
     8641 aaactgttct tcgaaaaatt tctgttcgtt gactggaata ccgatggcat aacccaggaa
     8701 ttcagcatta gttttccagc cgccgtcttc cataacttcg attacacgga gatctccttc
     8761 tttggatttg ccctcgagta tgcttgccca caggcgttga ccttgggttt tgcagtattc
     8821 tgcgtggtat tctggcagaa cattgagttt catctggatt ttcattgatt gacctcgaaa
     8881 aatttctgtt gatcgcgaca aatttgggct ttgccgagtg gcccgtaaac attaagagtc
     8941 cacataccgc gatcgcgttg cacgatttgc aattcgcgag tttttgtgaa atctacgatt
     9001 gagcgcgcca gcttatagtc cacaatgttt ttgcggcagt ggtcgataaa acctttttcg
     9061 tcaatgagtc tgattttcat ttcagttctc catagctcag tttgatgagt atgcgttggc
     9121 cacgtttcat cgacacatcg actattccgc gaagcccgat aagttcgctt tgatagcgcg
     9181 tcgcggtcgg aaagttcttt aaaatgacct tgcggatctt ttcgttatac tcagcaattt
     9241 cagtttgcgc tagtttgtaa gctttggttt tgaaaagctt tccaaaagtg tcctggttgt
     9301 tggcgccgac ggcattcatg ctggtgtaaa gttcgtagag ttccttctca acgccatgac
     9361 ttttctcttc cgccaacaaa agcctgtaat taggccggca catcacagac gacctttgag
     9421 attttcgtaa acaccttcaa ccaacttgta ctcgctgccg tctttggtga ttacccgctc
     9481 caatactgcg atgcgagtgt tgccgtcgaa gacataaaga acagttgtgt aaacgaggtg
     9541 ctcttcgtgg cttttctcca caatgttgaa ctggttggtg aacataacat ccaggaaaaa
     9601 atctttagag atacgcattt tcattactcc gtgtttatcg atttgatgtg attatcttaa
     9661 catgagttga aatcaatgta aactcatttt ttcaaaacat tttcgtccaa ccatttttga
     9721 acttgagtat tgcaatcttt gtcatagctt atgcaatagt cgtaacgagg atttttcgat
     9781 tttgagtcat acactttatc aaagaagaca taaccgactt cagggatatc gacactgaaa
     9841 taaactgacg tcattcggcc atcagtttcg acaatcggac cttcagccaa aggatgttga
     9901 gtaatcactt cgtaaacaac ttctttgata ggcaaagtcc gcaaatgctt tttcattatg
     9961 acctccatga tttgatggga caattttata ccgataaacg gacaatgtaa actgttttgt
    10021 gaaaagattt caataaaaac aacaaagggc ccgaaggccc tcagagttta caggatgaag
    10081 tcagcttctt ccaaatatga ttcattgaga ccaccctcga tgtgcaccaa gtgatgaagg
    10141 agaacttcgc tgtgatcata catgcactta gcgtcgtcga taactaccca acggcgaatt
    10201 ccatgatcgg ccgcatgctt tagtacacct gtgccacgac cctggccacc acctgtgtta
    10261 taagcttcgg aatgatatgg aagctccagg aagtcacata tcattttgcc tgtgtcattc
    10321 aacacgaccc atgagctaac gattacaact tttgcattat tgcgaataag ccattcgcgc
    10381 agaatgctta gacggtggtt tgagacgaaa tcaccatggt tgtatggcga ggtccggaaa
    10441 agatgcgatg ccctgtcagt tctccaaatt tcatggtcac taactgtatt gagaacacca
    10501 tcaatatcga gataaactac aacttcgttt acttgcttat ccattttgga cctcgtttag
    10561 ttcgctgaat ccatcggaaa cctgatgcct gttgcctcat ggcgagttgt tcttgcattg
    10621 ccattgaaat ggttgcgcta taaacctttt tggtatctgc gaaaacgccg atatgcaaat
    10681 tccatctaac atcaatataa gctcgtattt tgtgatgatc gtcgatgtac actttgccag
    10741 gtttggtctt gcgaacagct ctcgctagtg cacaaaatac cggagttgat atttcacgct
    10801 tgctgccgaa gaagcttcca tacgaaataa acccgcggtg ataaattcct tgctcgactg
    10861 gttgaagctt aaacgccaat gagcaaaatg ctaaaaactc tcttgcttca ggggtcattc
    10921 tcttatctcc accagcacac catctcggaa cggattcggc ttagctaccc acgtctttgc
    10981 ggttgggtgc agttcgccta tcatggcacc aactgattta gcgaaaaatt catacttttc
    11041 cgttagcttt ttgcgtgtcg atggaagcat aatgatgttt gacaatttgt tgttgagctt
    11101 catcccatcg attaatatgc ttccccaaaa actatttttg tcaaaatgtt cgtatatcat
    11161 tttagctcca actgtttttc agcccatgaa atgatttcat tataatcgcc tgccatttca
    11221 tcgggaactt cgactatatg ctcgaaatcc ggcataggat gttctttgtc tccctcgatg
    11281 catagtatgc catcaacgcg cgagaattcc catgagccat tttcaacata accattttgg
    11341 ataactcctt cagtcatact gaagaaatta agcagcaccg gattggtgcc gccttttcta
    11401 aatgcagcaa ttctcatttg cgaacacttc gcgggtcgat gtcgtcacca gtcgggactt
    11461 cctcgaggcc gagagcataa cgcttggaat agagaagttc cagcgcggct ttagcacaat
    11521 cgtggatagc atcatgcata acgaatccat ccaatgcacc ttttggcatt gggcacatgg
    11581 tcatatcgcg aaccatcaaa gtcgcttcaa cggctgtacg aacatcgcgt tgttgccaga
    11641 agaagcatgg ctccagattg aacgtttcac gagtgccatg aatttgacgg ataacgtcga
    11701 tcagaattgg gaagtcgaaa ctttgaccgc ggcaccagcc ttgaccagtt ttcttattga
    11761 atccttcggc tttcaggaaa ttcatgaagt catcatagaa gctgagataa tcaacgtcga
    11821 tatctgatgg cttcaggttc aacttggctt cgtcagactg cttcttccac caatccatag
    11881 tgccttggtc gaagatacgt ttaccttttt gggacttcaa atcgaatttg aatcggcgac
    11941 cgcgatggca gagttcttca aaggttggca gattgtgtgg gtcatgttca aataccaaaa
    12001 cagccaggtc aacaacggca ccttccggag cattacccat tgtttcccaa tccagcacaa
    12061 aatcagttac attgctcata aaattcttct ctccacttgg tttggattga ttattactag
    12121 accttcgaaa tcgcaacatt cgattcgata acatccgaat ttgtattgta tcacggttcc
    12181 agagtagcga tatccatttt tgataaaata gaccggttga cccggtctga aaatattctt
    12241 atcagggtac ttatacgaaa ccaacgtttt cgcgagctcg ggtattaccg acataaatta
    12301 gctcctgcgc gacatctgga tcgcgacaat atgaatgcag acatggcgta aacaaatatg
    12361 cgtttttgaa tgttgaacct tggctcttgt gaaacgtcat tgcaccgagt ggccggactt
    12421 tggtgaatgt gtttttaata gcccaaaaat ctttccatgc cggaaataca gcgcggcttc
    12481 gatatttgtc agcaatgatt gacaagaact cgcttatcgc ctgcgccgtg ttatcgtctg
    12541 cgattacgct aaaccatgct cgcttgtaat cgtcttcatc ttcgtcgtgg gtttcacatt
    12601 ccaacatgat gtattcgact tcgatttcac cgacgttttt agcaaccaat ttcttccttg
    12661 atggcttaac gttgagaatt tgaacgtttt ggccattgct gaaaattact tccttcagcg
    12721 tttgacctcc gacgtcaatc tcaaacatca acggttcttg cataaccaga atttcacctg
    12781 gtaagaaagg tgcgacgtcg ctaccgtaaa gtttcttacg gatgacggca ttcaatttgt
    12841 caacagaagc attcgtgtaa gccatgattc gattttcaaa caaatcttca ggctttttag
    12901 tcctgttgaa gtaaactccc aggaaatctt taacggagtg atactgcttc acaccattac
    12961 catgctcgtc aagcttttcg tatatccact tgccgttgcg aatatcggtt gcaacttcga
    13021 tgatcggacc ttggtggcgt ttgacttcgt caagttcaac ttgactgaac cgatcatcag
    13081 tgaagaatgg gctcaactcg tgagtctcgt tatcctccga aacacctcga atttgcgcct
    13141 tgtcgccaat gccaataatg acacaatgcg acggaacagt cttcatcagg atattgaaca
    13201 gcttacgagt gtaaaacgat acttcgtcgc agataagcac acgaatcttc gagaaatctg
    13261 gagttccttt ctgctcgaaa atctggttct cttccagcgt gcttgggttg attttgagaa
    13321 gcgattgtat ggtatacgct tttcgcaagg cgtgttttga caattccttt ttagcctggt
    13381 gggtaggagc cgccagtact attccttgtt gaccggtttg aaacaaccgg tctaacagaa
    13441 atttggttaa agtcgtttta ccggtaccag caggtccacg gatagtaatg tgccgtttgg
    13501 tcgaaatagc atccatcgct ccatcgattg ctaatttctg tccattggtc aaatcatcat
    13561 aagttagcat tttcacctca tttgtttagg catgatgttt atctcagcga tgtgcattgt
    13621 atcatacata cgcttatgca tattagccaa atgccctgac ggtttattca cactaacgat
    13681 tgtcggcggc ccaaacaggc gtttcttgat aaccgttgtg ccctttagat attcctcaat
    13741 agacttcttt gcatttttaa gactaacgtc agcttcctcc cacgaatcat gaaacatgac
    13801 tccgccaaag gcaccatgca aattgccact gacaaagtgg cagaaccctt ccgggtcctt
    13861 ccactgcaac gcatattttt tcatatcacc tcagctatgt ttagccgtgc accagctcaa
    13921 atccgttgta attggcgtcc ttgacaacct ttacaccagc gatgaactgg attttgaagt
    13981 ttgacacatc aaacgtgtgt gcgattcgta tgataacacc gccaggggtg ttcatagcag
    14041 atgttatgac ttgagaatca cggtcgagtt ctttccacat ttccaggtcc tgttataatc
    14101 attggaatgt atgggcaata gaataccgca tgcccatcaa cacaatcaag caacctttgg
    14161 cggttaattg cgttgatttg ttcaggagtc aactttacag ctttccttgc caagggtggc
    14221 atcctggcat aacgtcgctg ttgtaaggct ttttgtacca tggggtttgt tgctctttct
    14281 cttttacacg cttcatacga agggcgaaca tcgtgttatc agactgttta tttgtcatta
    14341 gtagcctcgc tcttgacggt caaagttttc tgcatttttc aggtaataca gtttgaagat
    14401 ttcgttgcca tccatgccca tcgcgataaa tttgttcaga acaaagtgca tttggtcgat
    14461 caattcgaat tttgcttcaa gctgatcttc agcggataaa tcagaaaaca ggcgatcacg
    14521 atattcgcca tgctcagcac gccacggttt ccaaatagca tttggcttgg gattgctcat
    14581 accaccaagc gaagtatagt gctcgcggac ttcgtcggca atatagtcgt cttgcttttg
    14641 gcaccattcc agaatttcgc cgcatgtttt cagggtacgc ggatctttgt tgtattttgg
    14701 atgacgttca gccagctcga tttgcaattg gcgctgcatg tcgatcattc gatcaagcgg
    14761 gttatgatga acactcaaac agccttcgag agcattttga gctttatgca gattgtcgat
    14821 aagttgtgag cattcattaa attgaggtgt agtcattgtt attctccttt tgtttcgtct
    14881 attgtatcac tctcaggaca cacagcacga ttttgtcaca tacctacgtt gataatgtca
    14941 cacattgttt ttgattgatc agtgttttta agaagatttg caagcgtcgc gttaaacatc
    15001 gcaacgtcaa atttccaacg gacatcggcg aattcggaag acagcttatt cttagatgct
    15061 tcagcagccc actttggcaa aacgtcgtta tcgacgatct tcgcggaaca gcccaacgcc
    15121 catgacggag cgtccgaacg acggtaagtt gcgtccaggt attgcccgtt ataaacggca
    15181 gtattaccat tcttgaattg tgtgatcaat tggccaactg acgaagaacc aatcggcttc
    15241 gccggcttta cctggcgttc ggagtatggt ttcgcttcga ctccttcgag ctcagcgata
    15301 atttcgagct caatgatacg gtcccgcatc aaatctttca ggtcacccag tgaaggtgcg
    15361 ctattgcggt ctttgatgaa cgtcttctgg tcggctttta cttccggaat atggcgaaca
    15421 actttgtagg cgtcagccaa ttgttgatcc atcatcgaaa gctcaggaac tttacaaatc
    15481 gctttctcga tgctattcag cccggtagtg ttacaatcga agcttgctgc catcgcggat
    15541 gatgataata ggccgagggc gatcactgat aaaaatttca tgttttgttc tcctttctta
    15601 agtcatgcac cgcatcgaga gctccgcggt cgaaatcgtt gaaatcaaat gagttgtctg
    15661 ctttgtcttc gatgtcttgc aatgtgtcac catcttggta tgctttattt gcccatttat
    15721 aaccgcgttt gtacaaatca cttttcatta aaagcctcgt attcagcaat ggcagacaat
    15781 ttttcaagtt gttcgttggt caatttatgc ttttcgggaa tcatctcagc aatacgagta
    15841 cggctgagag aaatgtcggc ttcggttgga gtccattcgc caaacaaatg cgtgtattct
    15901 ggaaagaaaa tttcgacttt ccagttgtca gttggagagt atccgcgctt cgtcatttca
    15961 tccatcaaca taagatagcg atcgcgaagc cacgccaatt tattgtagaa gaatgtcaca
    16021 tgaccacggc caccgtcggg gtttttgttc gtacgaacag tgaatcgttt cgggatttta
    16081 ccagtgcgac catttttctt gataagaatg ctggcaacac gaggattttc gtaccattcg
    16141 cctacgagat gcgcattgca aagtagcgaa ggatgctcga gattgatgcg ggtcataact
    16201 tactccgttg ttgtcgttta acttgtggct atcttaacac gatatctttt gattgtaaac
    16261 agcttttcaa acaaaaagac cctccgaaga gggtctatgc gcgtttccat ttgccaaagc
    16321 gcagtttggc ttgtaatcct gaaacggtgt tatccttgaa gtacttttca atctcttcag
    16381 gagttgcccc gtctttgata atcatgtcat ttatatcttt tgatggccat gggcacttgt
    16441 cccacatcac gacccgctcg cctgaatcta taagacgcga tagacgttta cacgtatctg
    16501 gatgaaatgg ctcgttatca agcacccaca cacgggtgct tttccacggc acttcattta
    16561 aagcaagact accgccagtg atagctccag cattctgaat gaaaagggag tcgagtggtc
    16621 cttccataag ccaaaccatt cggttgccat caattgtatc cattccgtaa atttttgatg
    16681 catcttcgtg tgccttaatg gtgatgtact tgttcgggct cacgcataga gctcgaccct
    16741 ggaatgactg gatgtctcca ttttcatcga aaatgggtat aactaaccga cactcagaac
    16801 gttcacgggt atacgtttct ggtgatatgg agttaaccag cttttgccac tcctttgtga
    16861 accacaaacg tgaatacgcg gattttggta tttttcgatt tgcgacgtat tttacaattg
    16921 ggtgattttc aggcaaagtg tcaagctttg tgcaataatt tagcttttcg ataaccggca
    16981 tctttttagt gaatgtttca gctatcgttt taacttgtgg tttgaagaca ttattttctt
    17041 tacgccgctc aagcaaccat tcgcgataca gctcttcttc acgatcttta agatatccgc
    17101 ctagattgct atgataacca cagttgaagc aatgtacttg ccaatcgcct tttttctcat
    17161 acatccaaaa tcgagctttg ttcatatccg tttgtgagtc accacatata ggacatctcg
    17221 aattaaactt acccttcttt cgtttgaact ttggcaagtg catcatcgcg cgttcagcga
    17281 ataaaaaatc tgcaaacata aaatcactcc aattgttggg gtctatcgac cccatattat
    17341 cacactttcg gtttcgcgtt ctttttctta ccgagcgtct caggcccagg agaagtaatc
    17401 gcgccggatg tttttccagc agcaatgtcg gtaggattac ctcctgaatc gccagcgacc
    17461 atgtcttcat caacctgtgt gtctttattg cctttgctca ctaatttacc tgagcattcc
    17521 agaaacgatt tcatacaata ttccttaagg tagagccctt tcgggctctt gattaaaagt
    17581 tcatgatacc cgcaagctca tcaagctttt cacgattgtt tgaacctttt gtgtgatcgg
    17641 cttgtctggc tggtgcggcg cctggtttag gtgctgattg accttcttct tcaaggtcat
    17701 accatcgctg atttccctta cgaacaccca ttctgaactt gttgatatag tttttgtcgc
    17761 cgtatcgaga ctttatctgt ttaaacagtt ggacaccaag ttgtgctaat tcctcagttt
    17821 ccattaccgc caacataaag tctgcagttg ccggtagacc agccgattca gcgacatcag
    17881 acatatctat atcggtagaa tcccaagctc ctcggtttgt ctgagcacca gtccacaaaa
    17941 caacttgatg ctgaactgcc aaaccgcgca attcttctgc aatggcctta acgaacgagt
    18001 atgagttttc ggtgcctcca cccagacgag tagatgcgca aatacccaga tagtcgacga
    18061 taacaatatc ggctttgaag ttctttttca acttcaactc attcaaaaac gcattgaaat
    18121 ggttagcatt tgcaccagat gttggatatt gtttgatgat caaacgaccc atgtttctgg
    18181 atttaagctt ttccattcgc gctttatact cggcgaatga caactggccg tcatcaattt
    18241 cgtcaagcgt tacatcaaga aggttggcgt caatacgttt agcaacaacg tgttccgcca
    18301 tttccatgga gaaatataca acgttcttac cggtttgcaa atagtctgcg gcaagagagc
    18361 acaaacccag tgatttaccg acgttaacac cagccattat aacgttgagg gtaccgactt
    18421 cggctccgcc tttcgtgatt ttattcagga tatgcgaaac gaatgggatt ttgtttgcct
    18481 tagacatgta aagcatgtat cggcgttcat aatcctcaaa ccaatcatga ccaactgagc
    18541 catcgaatga aattgccaaa gcgtttttca tcaaatcttc gatagcacct acgtcaggca
    18601 gctttttatt acgttcttcg aatggttttg ctgcgttttc ctgaatctcg attgcttttg
    18661 acaaagcatt gtacattgct tggtctttgc agtacgactc agtttctttg atcaaccatg
    18721 aatggtcttc gggttttgac gccaaacgac cgagaacttc ttttatccca tcgtgcgtta
    18781 gttgatcgac agatttcttt tctagtgcga taaccaatgc cgttttagtt ggaattgtat
    18841 tgtattcatt aacgtgcttt tggattagtt tgaacaattc ccgatatggg cctcgatcaa
    18901 agtattcatc ctttaagtac gggtacgccg aaataaagta cgtattgttg aatagcagat
    18961 tttcaagaat tgtttcgacc acttttgatc ctctttatct ttcataattt gtttgatctg
    19021 aatttgcaaa gcttcatgaa ccaaagcatg caattcttca ctatcactca cggttttata
    19081 ttcgacatgt aatttgccgt cattataatg agcatcaaaa acatagacaa gatgggattt
    19141 acctttcttg tcgataataa gcaattcctg cttaacatca gccatcgact gtttgataag
    19201 actgtgcgcg tcttcaagtg attgaggggc cgtagcccct ttgttatctg acatgtttat
    19261 ctccgttgat gagagaatta tatcacaagt ttactcaatg gaaccagttg cgatatattt
    19321 ttcgatcatt gggaaatggc gttcatacac gtggatcgaa tcaacacacc aataaatgtc
    19381 acctttctca accataactt cgcgagattg caatttatca accaaacgct tgagcacata
    19441 gtcttgccat gcccagtcat tacgataacc gaaaatcgcg tcgtttgacc tcatatggac
    19501 aacagcgttc agtttgccat cgcgaatttg gtattggacg ttgttggtgc acataaaatc
    19561 agacatgccg tttgctttat aatcctcatg catagttgga cgagtgtaaa tcatattcgc
    19621 ccgccgggta ttcggatcac tggccaggtg catgagaacg ttggcaaact gtgaaccatt
    19681 ctcatcacta agaatcgccc atccataatt tgagttaata cgcccttcag aatccgatac
    19741 ggcttcccaa atgactggag ttttaccagg aatatcgtga acatatcggg attggctcag
    19801 gtaccatgcg agctctcgtt caatataatc attgttgagc ttgccgaaga tcagaggttc
    19861 atcggctttg aacatgaccg gcgcaatttc gatggtttta acgcccgttt tgtcggttac
    19921 aaattcgcct gcggcgaagc gttgagctag aatgtcacgg atattttggg tgttcatata
    19981 cagcatagaa tgtccttaga tgtcaaacat gtcaaaaaga ttattgcgga attcgtaatc
    20041 ggtttttgtg gcttcacata ttgaagaaag cggtttgacg aaggtcttgt caaacagttt
    20101 attgatgtca agatatttta aaacgtcggc ttcaacagct ggtggaatgg gtgttcctga
    20161 cggccaagca aaacatgctt cattaaatgg attccgatca cgtagcggta aaaccattac
    20221 cttttcgcct tcggatatca tcgggatagc agtatcagtt ttcgcgatac ggttgtaagc
    20281 caaaacacct ttaacgtgat atggagtacc tttgatcggg aaaccaagtg catcaccgtt
    20341 tttaccgata ttgttcgcag acgatacagc agcaacatcc tgatatggga tatttttgaa
    20401 ctcatctttg aactctttga agtaatcttg caaagatgat tcaccttctt gcaaaagacg
    20461 acggatagat tccttcaaag acttttggca tgcgagaggt gtagatgacc gttgggtttc
    20521 aagacccatg attttaaggt gaggttcggc ataacgcgta ccttccatgt cgtaaacgtt
    20581 aagagcataa cgttttttac ctgtccagaa cccgccgata ccatcagaac caagaggtgc
    20641 accaaaaata gcttcacggt ccataagcaa taggtgatga tcatggttca tgtactcttc
    20701 gagttctttg tatgaatcgt caatgaacgg ttcaagcttt ttgctaccga gattatcgag
    20761 gaaatcgatc aaatggtttg tatcgcggaa cttgtcgata ccaacacgat taactacagc
    20821 ttccatattc agataaacgg aatctgtgtc gatatagcaa acatagtcaa caccagtggt
    20881 tttaaccagc tcgttgatat attcgttcag tttgcgttca atccagcgaa tcgccaattg
    20941 cccgtaggtt gtgatagctt cggcatttcg aaggtcaaaa taacggaacc agttattacc
    21001 gagagctcca taaagagagt tgatcaaaat ctttcggttt aattggtttg tatttcgttt
    21061 ctgttcttct ttttcgcaac gtgcgatcat ctgttgcaat tcatcagttg acaaagtgtt
    21121 cagatatgtg agttcttctt cgttaaaatc acgaaataat tcgagttcca tattatttcc
    21181 tcttttgatg gggctattat aacatagccc cggagttgca tcaatgatcg agcttaacgc
    21241 cgcgggatgc cagtattttc ttgatggctt cctgatttcg gatggctgca agcatcattt
    21301 tcttctcaga cttacgctgg aggaatactt tctcagtttc atttggaaga acgccaacta
    21361 cacctttctt gtacatcatg ccgtttggag cacagctgaa ttgatcggat ggtcgtggag
    21421 caaccttatt gatatagtct tcaaggcgtg caggagaaaa catgccagca atcatctcgg
    21481 gactgatatt caacagacgg agaatagatg gatacagtga tgtcaagtcg aagctcaaac
    21541 cataacggta gccaccgggt acaggttctt taacatatgc gcctgggaaa ctctgcttcg
    21601 ggcttgcctt catcgctgga ataacaacat tgctttcaac aagagagttg aagatgattg
    21661 aatcccatac tttgatcgtg ccaagaacat catcgaaacg aatttttgca taataggaca
    21721 aagacagaat caggtcaatg aagcaacgac gaccatcaat aagcaggata atatcagtat
    21781 ctcgaacgca gtagtccaca tagcgttgat gatctgcttt tctgaatttg ttgatcggcc
    21841 cttcataatc cagtttatcc gccttaactt cacggtaacc cacgtttcca agcttgtagt
    21901 caggcatcgg ggtgaaactg aacttcttga acacatccat gtaatccatg agcgcaatgc
    21961 cgtgaatttt gtagatgatt ttttcaccat acaagttggt gatggttttt gaggtaattt
    22021 tgccatatgg actcaactga ttcgcagctt tttcaccaag gatgttggtt atccgcgtta
    22081 tgatgtatgg aatatcgaag ccttccgagt tccagccgaa aaccaggtca ggggtgtttg
    22141 ctttccacag ttgaatgtag ttcaaaagga gatcgacttc gtcttcgaat ggcatataaa
    22201 cgacgttgtc aagaatatac ttttcgagaa ctgacttttt cgggtcccaa tggccaacat
    22261 ctttgactaa atcgaagatg taataggtct ttttgccatt atgcaaacga acatgagata
    22321 tcatgtcgat ttcatatttg gcatactttg gttctgggaa ttcgggagca gtgacttcga
    22381 tatccacaac gtcaataacg acatcgtctc ggtcaaaatc aattacacct cggtaggtgt
    22441 cagagatata agatatgcca tagtcatcca tacccatggc gtccatacca acttcttcca
    22501 tccgtttaat ccactgcttg gcttcccaga tgttttcatg ttttttcggc acacagaatc
    22561 tgccgtagat atctttatgc ttggtttgaa cgcctggcgc agcgtgttgg aagagtgttg
    22621 gctggtatgc gacttttcgc gtttgacgtt tgccgttatc gacaaaacgt tccataatat
    22681 tgttgccaat gatttcgata ttggtgtaat gacgcattgt atatcctttt gaaaaatggc
    22741 ccgaaggcca ttgttaactt ttagccaaat ttgtattttg ctatcaaagt ccaatcagct
    22801 ttctgtttgt gactaataac tctgaagttg ttatggcttg atacatcgat cggttcaagt
    22861 attgtacaca atttccaact gttaagcaac attgcaatgt tatttcttcg gccgatatcc
    22921 tcgtcgctga tatcaacttt caaaccgtca agttgcaaca tttctttaaa gtgcacgata
    22981 aaatacttac cttgcttctg tagaatatgg caactttgat agagtttctt ctctttgttg
    23041 gaggcaatcc cgatgcgggt cagagtctct gcgattttca gaaaatcatc aggatgtgcg
    23101 atgtcaatag gtatcattgt tagtccttag aatttcttgg ccaacttcag gagttggttc
    23161 tgttcttttg cggtttttgt aaccttctta acgaaggctg gcgtaactag gaatttatag
    23221 cttgagagaa aactttccat tgttccacgt ttggtcatga ttttaatata catgcatgcg
    23281 gtcgtttcgt ccacgttgtt tgcggttttt accatcgcaa catacaaatt ttcttctgct
    23341 gacgattcaa gctttggcca tttaccgtaa actttgccct tgcgaataga ggctttaagg
    23401 tagttgtatt gggcttgacc atctaagcct gaaagcagat tcatgacata cgctggatac
    23461 aaagtctcgg cgtgcataga aagagcgtta ttgatgaacc aggccggata ttcggtattc
    23521 gctacgtttc gctcgggttt gttgtaggtg atgtcgtcca taaaagcgaa cgcggtattc
    23581 tccgcgttct ctttaaactg atcagccaat ttagcaacag catcccaatc cttagacatc
    23641 catgctattt catgctcatt tagttgttct tcatcatcac ctagcaggaa gtttaagttg
    23701 ttcatgcaaa taccatctcc acagagagct ggacgaacat atattgaaca tggatttcaa
    23761 tatttgctgc ttgcccatac aattggttgt tttcaccgat aatttcatac attctgattt
    23821 ttgaaggacc attcaccagc ggataaagag tgtttgccag acgacttaca aaaccggaat
    23881 agtcggtggt atattgggta gccatcgcgc gaagattttt gatatctctt gctttgatag
    23941 cttcaacgac ttggtcgata tcgtttcgag tgttaagaac gaggctcaaa atacccgagt
    24001 cgattttgcc ttcagacgcg tagaaatcca tctcattcac ggttttacgg aagtctggga
    24061 agttcttttt caccagggca gcaataacct tacgatcttc gacttcgata ttttcagctg
    24121 cacatatttc ttcagcccga acaatcatct gtttcatcat gttgattttg tcagattgat
    24181 ctgctttacc gaactggata acacggcaac gagattgcag agcgggaata attccaccca
    24241 ggtcgttagc ggtgataatg aaagtacagt tctttgagtg tgcttccatg aaagaacgca
    24301 ggtgacgctg agaatcggca agaccagcac ggtcgaattc atcaacgata attaccttac
    24361 cacctttgca gaaggttttt gaactggcaa acggcgtcat tacgtcacga acaaagtcga
    24421 ttttcgcgtc agctccgtta acaaagagga attcggcatc aatttcggct actagagctc
    24481 gggcaacagt tgttttgcca gtaccaggag aaggggagtg caggataata ttcggaatac
    24541 gtccagattt tacgatcgct ttgaaaatct ttttatcgtg ctccggcagg atgcactcat
    24601 caatattgcc gggacgatat ttgttttcaa acatgaattc gccgtgatta acagtcagca
    24661 tattaaaatt cctcattcaa attaaaaagt gggcttttac acccactaca gtatcacact
    24721 aggagtattc gattaaaagt cgtgctttga actggtttcc agtacgaaga cgtaggagga
    24781 attgattcct tggaactgag cagctccttt ggaagagatg ttgatcttgt aatcagcgat
    24841 aacaacactg acgttgtcca ggttgattac gaaactgaag ttgtttgtac cttcataagc
    24901 gcacagttga acagaataac gagtccgagg attgtcacca tcagcttcgg agaaggtatc
    24961 aaccacaata tggtcatctc ggttggtaat tgccatgcga tctgcaccaa ctgcacggga
    25021 gattttcaga atctcagcaa ggtcttcggc tttcagatcg aattcaacat ccggaggtgg
    25081 catacgcagc cgttgcttag gtacgataat tgcattacct tcggcatcag gcaggtttac
    25141 tttggcacga ccattgtgga taacgatatc gccgttggac agagtgattt cagaaccatc
    25201 acccagttgg cccaggatgg acaggaaatt gggcagatcg tagatattca gttcagaatc
    25261 gatctcatcg gcgatggttg cttcggcata agctacgccg ttaatggatt tggtcatgat
    25321 gaaatcacca ggtaccagtc gcagggacgg gttaatggct gcgaagtttt tcatgatgct
    25381 cagagtttct ttggacagtt tcatatcaat ttcctttatc gtttagatga ttattctata
    25441 tcaattattt gaatggcgaa cttaatagtc cgccattacc atttcagctg cagtaataat
    25501 cagctcgtca gtgtcgtact ggaattgctt ggcaaaaacc ggtttatcgt tcatgccctt
    25561 gacatgatat ccgccgttag ccagaatcat cgctcggcga cgttggagaa gatcgacata
    25621 catatcgcga accaggttat cgatttcagc ataaagctcg aaacgaacac tttgttcaat
    25681 cgcttgcaat tgatttgctc tgacatcgga gatattcgcg acccaggctt tacggatttt
    25741 cacggaggtt tcatagatgt tgtcggacag cggacggata tcggcaggta ctacgacaat
    25801 agcttggtta cgcataattt ttcctcattc attatttgga gtgtgtattt taacacgtta
    25861 tttcaattgc aaatcattga tctggaaata tttcggtcaa attgtaatac gaatgcctat
    25921 ttgaccgaag ttttcgaata tctgcctccg aaaaggcaga tttcagatct tcatcagtaa
    25981 cgacaactcg aaggtgcccg gtctcatcgg ttaattcata acttcgaatt tccggtgtgg
    26041 tttgtggcaa attataaaac attgaatatt acctcctcca taacgcttgt tcttccgagc
    26101 ttcgacattt taacatgccg gtcgaaattc tgcggatcat ggtcaccatg cgaaataatt
    26161 aaaacattgg ctttcatttt atcgatgatg gagaatacag cgccttgggc atctgtatcg
    26221 gaagggccgt caaatacttc atccataaac aaagcattaa catcaacgcc tgaaacttcg
    26281 gatgcgagat cgcgccaggc gaacataaca gccatatcga ttcgagcttt ttcgccttga
    26341 gagaagctgt tgtatgagaa tgtacttcgt ccagcagatt ttatcacttc tttgaattca
    26401 gcgtccaaag taaatccaaa atcagcttcc atgatttcga gataatgggc aattcgattg
    26461 ttgaaatatg gaatataacg ggccattatc acagccttta ttccagagtc tttcaaaaga
    26521 tcgctgatca tgctccgctg gtgtttctcg cgctcaattt ctgatttggt gttaatcttt
    26581 gcaaccaatt cgtcgttaag tttggtgatt tcgccggtgt aatcggggcg agcagcttgc
    26641 aggcgctcga tggcagcttt tgcggctttc gcctggttaa catacaatga aatagattgt
    26701 ttttcattgt taagctgtgt ttgaacatca cggaatcgaa cagttgcttc attatactcg
    26761 accatctgtt ggttgagctc ttcaatccga tcatcagctt tatctagttg accttggatg
    26821 actgacatct tatcatgtaa ttttgtcagc agatcaggat catcaaattg ttgcatgcac
    26881 gttgggcaaa caccgccatc ttcatgcatg tgggcgatac cggcaaattg ttctttctgg
    26941 gcagctgctt tcgctctggc catagtgaat ttgccgaggt cattggccgg cgactcgggc
    27001 atctcgaagt ttgttaattg ctctgtcaga gagtcaataa tcgatttgat ttgtttcgct
    27061 ttgtctcttg cttcttcgaa taccgcctga tgatcagcta cagcagcgtc gttggaagca
    27121 ttcgagttgt tctggtgatc gtggtaggtt ttcagctggg tgttaatatg atttattgtc
    27181 acatctacac tggcgatctc ctggttgagc tccttaatcc tggccttatt gagcttgtcc
    27241 atctgagcca gaaccgaaac ttccagcaaa tcttcaacca acttgcggcg ttcaggtgct
    27301 ttcaattgca tgaacggtgt atagccggca gttccgagta caacgatctg cttaaaactg
    27361 gtagcattca tcccgatcat ttcttcgaag tacgcttgga agtcttttat cgaggctgct
    27421 gcatctacct gagcgccgtc acaagtgatg gcgaatttat ttggcttaat gccgcgggtg
    27481 atgtggtaga ccttttcttc atactccaac caaagttcaa ccaacatgtt tttaccggta
    27541 ttctcgttta tcagttggtt tttggtgata tcgcgaaacg gtttgccgaa tagagcaaag
    27601 taaattgctt ctaacatggt tgacttacca gctccgtttt taccggtgca aagtgtcttg
    27661 gcgtattcgt ttagagtaag atcgatcggc tcatcgccga ccgacataat gttcttatag
    27721 cgaacccgaa taaaatcaag ttgcttcttt ttgatatcga tcataatgta cttgcctccg
    27781 catacagttc attagccatc attataattg catctttgtg atcggtatca atcgctgaat
    27841 tttttaccgt ttcagcaaac aagcccataa tcgttttagg tccttctgag atagaagcag
    27901 cctggacgtc tatggtttcg ccgtcatcag agatatcagt cgaagaatca acttcaacct
    27961 taacagcttt attaatcgtt ctcagatcat gaacgacccg tgaaagaagg aattcaacct
    28021 tggttaaacc ggcatctact tcatttgcga taagtcggac tgagcatcca ctgcaagagc
    28081 gaatttcttc cggcgttaca cccggataag taagtcgctt atgccaagtc ttggcgtttg
    28141 gaacaaactc gaaatcgcgc gtctcggtgt cgagaatcca gaatcctcgt ggttcatcct
    28201 catcaccagc agtgattgtg tatggtgtcc caatatagtg aatattgcca ccatctgatt
    28261 gtgtgtggaa gtggccagac acaaccttct catatttctt caaaaaatca gcgctgtaac
    28321 cagagcttgg tatgtttttg tagaaataga aaccacttag ttcccagtgg ccgagacacc
    28381 acggtgaatc gcttttcttg acgaactcga aaatatcaga agcgttttct ttgcacatcc
    28441 acggaataag gtcgtagtcc aaaccttcaa agttgacggt agttggctca tcgataacaa
    28501 cgtaggtgtc gtctttgccg agaatttctg ttacgctgtt tggatgaatc cgatcttttt
    28561 tctgcatatc atggtttccc acgataacaa agcaggtgat tccagcttct ttcaactttg
    28621 gagtaagccg tgtccgaaca aagttcatag tgcgttgtga aacagccttg cggacatcaa
    28681 agaagtcgcc tgattgaagc cattgggtta tgccattagc tttcgaataa tcgatggcct
    28741 gcacgaacgc atgttcgacg atatcttcat gccacgggtc atcatctttg acaccattat
    28801 gaaggtcgcc cagatgcaga attttcataa tttcctcaca ttgttataca aaaataggct
    28861 ccgtagagcc tattataatc acagggaaca aactggaaca gtctgctgat gatattctac
    28921 atcagattga attgttggtg cagtcgacag ggattttgcc atatcaacga tctgcgctcg
    28981 gcttgtttca aacatggtaa tcattgcgtg ctttggcagg agtttctgct tatacagagt
    29041 ccggagtttg tcaatagcat agacatattg ttctttgtta ttcgcaaaca atgctcgctc
    29101 tgcatgcttt ttcagacgct taatttcgcg gccgtgagtt ttgagatgct ttgcagcctg
    29161 tttttcggct tgtttctcga ttcgatcttg catttcaagg agttcttggt cgaaagaact
    29221 gctcaattct tcttcaccgg tgctaagatc tacttcgtaa tcaggcgaca tattctatct
    29281 ccattgtcat agtttctgcg tcgatatgcc agtcaagttg accggatgtt acttcaaatg
    29341 gttgccacga aatattcatg ggatttattt ctacaggtat tttataatcc cgcatttgta
    29401 gcttaacaaa atatgacatc aaatcaactt ctccgcacac ggagtcaaaa agagattcaa
    29461 gatcaagttt caggttcgtc ttcataaaaa ttatccaggt tggggagctc cggtttgtcc
    29521 ttcttttttg acttaatcga agcttcgtat acgacaagtt tatcgtggat atcttgaatg
    29581 aaaccttcat cagctatccg cgacatatcg gagtcgtgtt cgtcataaac gttagtgagg
    29641 aagtagcgat actttgttgc catttcccgt ttttcgcttt tgatatatcc gataaaagcg
    29701 ttaaaacaag cctgggtgat atacgcgtgc ggatttttgt agttgtgttc atcaaagttg
    29761 actagaccct taatgactga ttcaacggcg tctgcgacca ttccgtcttt ccagttttgg
    29821 gtatagccgg taaatttcca ataacccgta aagcctttcg cgattttcaa aatgtcgata
    29881 ccgatcgaat caggcatctt aatgtgatgt ccggcttctc tcatatcttg tttccattta
    29941 caaatatttt ggtaaagggc tttgttgtca acatagttca tagggtgttc ctcctatgaa
    30001 tgattatatc atacctgtag gcttgctgaa cttatttaag tctgcctggc ttccaggttt
    30061 ggctctgcca aactagcatt tttatccttt aaggcctaat agattatata acctaaagga
    30121 taaaaaggat aaattcgagc gaagctcgaa ctggcgaagc caggtatttt cggtttaacc
    30181 aggtttgaac aagctagcaa gccaatagat tagtaatgtg attattcagg tgattgctgg
    30241 taaatcagca gttcaatata cgacaaaggc ctcacttgga ggccttcttc cttgcttttt
    30301 ctctaatttt gattatccaa tcttgaacca gctcttgatc ttccggcgaa ttgatgtcta
    30361 gaattcggcc cagtttacgc agaagatatt tgtaagagaa ccgttctttt tcggtcattt
    30421 gataaagcgc ctgaaatgac tcgcggtttc gttttatttg cttatggttg gctatcgaat
    30481 caccgacaca tatctccgcg tctggcaaat atctcaacat gtatttcgcc aatttcatat
    30541 ctggcacata caaatttatc ggtttgagag aatgctcatt gcgaatatca caacgggcgc
    30601 acagttgaaa cgccggttct agatacttcg aaacaatata agcgtccact agtgcatttt
    30661 catccaatcc aacgacactt gataactcct ttagaatcgg aacttgccaa ggtgcagggt
    30721 tgtacgaaaa aagaaccaca acattcgtat gatcggaata gttgtttaac ccgtgtgggt
    30781 tataaggaac ttcaattcct ttcggcatcc tcggacgata tgagtttcgg gtgtaaatga
    30841 actcgccatt tatcaatgtg tccaacatgt tttcgattct ggtgtagttt gatataccgt
    30901 cgacttcttt atcggctttg tatctcgacc aatcgtcgtc aaacattaca ttgatcttta
    30961 cccgcgccgt tttcggatat acatggaacg ccagtcgatt tttcaacgga gactcttcaa
    31021 attcccatcc gttaaaatgc ttcataacca tgccggtaaa agtttgttcg aagtttgctg
    31081 agcacacagt tattgatttg aactttgacc aatcatcgct ggaggcatcg ttcacatagt
    31141 agcattgggt aacaccacct tcaaccgaca atcgcactgg caccccggtc aaaagcgcct
    31201 tgtataatgg gaaaagagtc gaataaatgt catcggttcc gcgatagcca tccaaagcca
    31261 ttttgtttac tgcttttcta tattcctcac gaagctccag caatccggat tcatctattt
    31321 tgcacaactc aagtatatgg ctctcgactg atgtcgtgaa tgtgaatcgt tcaaagctcg
    31381 ttaactctgg aacttcgtca atatacagat taaaatcttt aagcgaatca atattgcgta
    31441 atcctaaaag tgcagcgtgc gttatgaaaa tgacatcatt tgactccgcc gccttcaaca
    31501 ccgcatcatg gacagatttt tgaccctgtc gattatcggt gtcaaccagt tcaccatctc
    31561 cgcctaagcc aatgaaatat tcaaacgact gctttgaaag ctgccgagat atgctggcga
    31621 tgatagcttt ttcgttggtt tcaaagatgt ggttaagaat agcggcagtt ttgcctgccg
    31681 ctggaatggc ggagagggtg tatagtttca caggtccaaa aattccttta gacgttcaat
    31741 atcgaattgg ttgtagagat tataacactc aaccccatgt cgaagcgcca gttgccaagc
    31801 agtatttgtt ccacctgaaa caccatccgc cgttggaatc gaatagcaaa ccaagaaatc
    31861 cgacggcgtt ttcaggttgt aaccaagaac ttggaagaca ttgcgagtat gcaattgctc
    31921 ggcacctcga ctgagcgacc cacctttctt atacaccggg tgaatcgttt tcatgatttc
    31981 gaaagctttc cagctatcgc cgccggttat gatgttatgg cgttcatgct tcggggcaaa
    32041 tcgaccgtta aagcgtttcc atggaatata gacatcaaat tcagcatggt tgtcgggttt
    32101 gagctcgggc gctatcgcca aaaatccttg ctcgaacgca tcgtcagctc catcagcccc
    32161 accagagcgg ccagtataac cgcgaacagc cgcaaccgcg gcaatgtctt tcataagccg
    32221 acaaatatgt tcgggagtct ctcgactccc tattccggta taaaatgcca tcagaaccaa
    32281 cctataacag atgcaccagt gggcgtttta actgtgttga cgatataaca aacatggcgt
    32341 ttgagctcgg catacagatc aggattgtat ccttcagcat ggaaaacgat atcaacacct
    32401 tcaaaatttc tgaggatgtg catttccgac tcgcctgggc ctacgcgacc cgcgttcttt
    32461 aggtttgcaa tgtactgatc gactgggcct ttagcactgc ttttaacaat tattttgaat
    32521 tccattagat ttccggggtc agagtgattt tacgaagtgc gtttgaaaca actttgttgt
    32581 aatcgcgttt aggtaactgc gccatttcag cctcaataga tgcgagttct gaaacaacgt
    32641 ttgacagaat tcgtgccaag tcattaacca acaacttttt agacgatatt cgtatttcca
    32701 gatagtctcg tgctggtgta tgctcaacaa ttttgcgaag ctctttgaat gtgaaagcct
    32761 cagccaaata ttgatcggtt tcgccgacgt cggctgaaat aaatgcaatg ttttgtgaaa
    32821 caaagccatt gccggattca ggcatcatag caaactgaaa ctttttgtat gggtaagtac
    32881 cacaaagcat aaatgcgtca gttactactg aaatagatga gccgaggtaa tcgatttctg
    32941 aaaaatcaaa ttcaacgtcg gcataagcat atgaaaagca tttattgcgc attatatttc
    33001 tctcaaattt ttggaaaatg actctccaca ccggaggcat ttcaaaacag cgaaaacgga
    33061 attgccatta gtcacataag cgtcatgcgt gaatttatgt atgcacccgg agtgccagaa
    33121 cgcatcggcc agatgcgtaa tttgttccat tgccgcttta acttcttcgt cgacttcttg
    33181 gcacttgtaa agcattacaa ggttgcctgg gcgaaatgaa tttgctgttg aaagctcttc
    33241 aacattcgat agtacgcctt tatcacgtag taccttgatc tgtggcgcaa tgacgatatt
    33301 gtattcatgc ataacgttta gattcaaatt aatgttgaaa atattcattt aaacctcaaa
    33361 tttaaaagaa gcaccgcaat catggcattt gcaaatttca taaacgtctt ggccgacttt
    33421 catgtattgc atatggctag gagtatgatc gcacatgaaa acgttggtgg catcgcaatc
    33481 tttgaaaatt ttccggacaa tcgggaaaga tgtgcttcgg tcaaatcggt ccgaccttcc
    33541 cttgtagatt cgtgcgcggt aaactgcacc acctgcaaga tgtacaacac tccattcaac
    33601 cttgaacccg agcgttttta gggttggcac gtcagcgtgt tcgtaatagc ttttgatcat
    33661 gcgcccaggt acaacaccgg taaattcgca ttcataaatc gttacgttca ttttttgctc
    33721 ccgtaaattt cctggcggat tttgcgagct ttaccttgat actttttgta agcatcttca
    33781 gccatagttt tcggcccgat atgggtaggc gtgtgaccta gcgcttgtgt accaaattct
    33841 tctgaaatat actgaacaat gacagaacga atagcctggc gaccgatgcc cgttactcca
    33901 gcagcagtag ccgcttccca aacctcgttt tcaacggcgt taatttgctc ttcagaaata
    33961 cgattaccga ggatattgtc agttgcgaat ttggccgcgc aggtgtggac ggtaaaatta
    34021 cgtacggcaa tgaattggtt agacataaat taatccttag ttgatttgat gggaatattt
    34081 tatcacactc tgatgtcatt gtaaactgtt ttgttatttc ttagaagcag ttctccggca
    34141 gtaatctacg aaaagttcga cacggccagc cgatgttgtt gagttaaaga ttttcgaaac
    34201 gtcccgaccg gtaacagacc gaactccaaa ctctacacca ttaccgatat gcacgactgt
    34261 gataatgtag aaagctccac gtgattctgg ccaggtcata tgctttgtga cattacttgg
    34321 cacgtcattc attgaaagcc ggccgaattc tagctccaga aactgcttgg cgcatgagtt
    34381 aggatacatt gactttacca gttcgcagaa tttagtggcc gcgcccgggt cttcaaaaca
    34441 aacgactggt ggaatcgaca aaagcgcctt atatcctgaa gaagaagttt tccaataaga
    34501 ctcatcagtg ttaatgccct ggctgctcac ctcgacaata tcagctatgc tagagagttt
    34561 gctgtatttt gcgagatcgc gggcattggc gtttgcgtat tcggacgata caactcgaac
    34621 atcacaattc agatcttcat attgcagctg actgctaact tgtgccattt tttcaacctt
    34681 caccttttgg gtagggacat aaggattgta aattttttcc agtgtctttt cgacatgaat
    34741 tccttttcgg agatttctag aactggcagc ggtatgccta attccatctt tgacgtaata
    34801 ataattcatt cgagccgcgt catagtggac tatacccgga taattcatat taccaggttt
    34861 ctcgaagatt tcaccttctt ctgggttgag tcgtacaatc ataataaact ccaaatgtgg
    34921 gcctccggag aggcccgttt tgattacttg agggagttga tatagtcttc aacttcgctc
    34981 gaggtaactt cggtgcgctt gtcgccattg aaggtttcaa tgcgcatcat cacatcgttg
    35041 acatcgattt tggtcagagc agccagctcg actacatcat cagcgcagct aatgcccagg
    35101 gattcggcat tgcgagtttc gcggatgtat tccagcttca cagccaaatc ttgacgttgg
    35161 ttatccagtg agacaacggc gtgcttgatt tcatcacgca ttttgaccag ctcatcggct
    35221 ttgttgatca gcgccagacc tgtgcgacgg tacagaatag ccagtttggc gtgggtgtca
    35281 accggaatat tttttgtgat caaacggcga atctcatcgt ccttgcggat agcttcgatt
    35341 tctttttcac ttgcgatttt gcgaagccgc gcctcttctt tttcggattt cacgaaaacc
    35401 ttttccaact tggtgatttc agtgataacc tggtcggcag cctgggtgta ttggtcttcg
    35461 atagacacgt tcttggtaac gaaaacggag actttggtgc gaataaattg agccagtttc
    35521 ttaaaggaca tattttaacc ttacttagtt gacattggga ttgacagaat acgcattgtt
    35581 ttgatttctc cgcgtttctt cgaataagcc agcatgtttg aataacctac ggtacgctgg
    35641 ttgtttttcg caaaagctcg aatattgcga atttgctcat ctgttgcaac gataccaaac
    35701 aacttgtagt gttggcacat gtcggaccag atgtttatac ctaccatttt ggccgtttgc
    35761 caagtgatcg gctgccttcc ttttccttca gcatcgacat aacctgtcca tgctttacca
    35821 ttattcggct tataaccgat gagactgaac attttgtcca tatcatcgat aacattttta
    35881 acatctaaca ttatgaactc cttgtcgttt aacttgtgac tatcctaaca cgttgaaatg
    35941 gcattgtaaa ctgtttttca aataaaaaca acaaaagggc ccgaaggccc ttagttatcc
    36001 agataatcca ggagtgcttg cgctcctcct atgaatgcac cattgacaaa aactttcgga
    36061 agactcagag cacctttcgg ttgattgatt ctgtccctca gttcgtttat gacagcacgg
    36121 tcgtactcga aacctagctc ggtctcggcg tctcttagaa cagttttgat tgtgtagtca
    36181 atgtcgtcct catcgagacg tttagttatg acgtcacacg ccgggcatcg gctcgtctcg
    36241 cttactatcc cgtagatctc gatcattgat gcctccattg gtccatgctg caccagcgcg
    36301 acattgttac tttcgaaggt tttaccttgg tcaattcaac gcctggggtg aaagcacggg
    36361 caagtatcca ttcataactc gctaaaccaa ctcgagtctt gacgtgaccg ttttcgacca
    36421 tttccctgta ttcgacatcg tacgaatcac ctggcccgtg aagaacgtgt atcagtttta
    36481 gcatttgacc aaccgatgtt ccttcgtatt cgagaccatt gaaaaccggc cttggcctat
    36541 tgacaatgca cttcgcttca gtaaacatca taccggagac tcccatataa atttgtgctt
    36601 gcaacgtcgg caccgcaaat ctacaacttt atgctgccat gagacgagtt gtatttgctc
    36661 agtgtcgcat aatgggcact taaaatgttg atcggccact gcttttcgcc tggctaatat
    36721 ttcgtcatat tcgtttgaca aatggtaatt gctgatagcg tctgaaactg atttttcaga
    36781 tatccgcaat tccctgaact tggcaatatt cgccgaccgg atcgcccact ccatgtcgcg
    36841 aatttgtttt tgtgcttcat tatgcaattc aatgtccaca cttctctcca attacaaaaa
    36901 tgcccagggt cattataaca cctgggcgac gataaagcaa ttactcttct gcttctttcg
    36961 ggttttcttt ttccacttct ttgctttgac tttcttcgtc tgtcctgacg aatttatttt
    37021 taacgatata gccttccatg ttttgctcct tactgcctgg aaaaacccat acttatttat
    37081 ggtgtgggcg cagcaagtgt ttgtttttat tgaacaaatt ttgatatgct tcgtcggtgc
    37141 ggcgttttcg caggtaaacc atcatcaccg ggtgatagtt ttcccacgca tattctcgaa
    37201 accagccgga ggtaatcgat gtacatactt tttccaacgc catcatgaat gcttctgtcg
    37261 gatctacttt tcctgggaaa ggaataaggc accgctcaag agccaatacg cacgattctt
    37321 cataaactcc aagaatccgc gtttcttcgt cacaactgaa gaatttcgat tttgacgtca
    37381 ttacttcagc gccgtccgcc atgtaagact tgtaagccgg aattccatta actgccactg
    37441 cttcatgaat tgaatcgtgg tcataggtgt aaatgtcatc tttgaaaaat gcacctttat
    37501 taacattcaa tttagggtgg ccgtaattga gcgattcagc ttcgcgaagt tcgaaaatac
    37561 gctgttcaac cggacccatt acaacaccat tgtcgcgcat cacgtggatg tcaaccatag
    37621 ttttgatgaa attgcgggtg ttcttcttga accggtgagc catcttaata gcgagaagga
    37681 tttcaggagt cgcgtaaact gttccttgag gatttcccat caattcgtaa atcatctcat
    37741 ccgaagaacc cggtctaacg atatatgtct catgatagca gcaacgagat ttgccgtcgc
    37801 cgacaacgaa cgctttaaca ttcgggtttt tcacggtaac cggcctgcca tccatacgtg
    37861 cctgatactc ggcccactcg tcagctgttg aaatgaaatc atggtccatt tgggtggttg
    37921 gagctacttc cggatgaaag tggtgttgca ttgcacgaga gccaataata atcataacga
    37981 attcctcata aaaggccccg aagggcctat tcaaaacatt tagcagctgc tggacatcca
    38041 aaccgaaccg tctgattcga tgttgaaggc ttcatcacct tcaccgtagc atgaactcga
    38101 cagccagtcg tcaaactcga tagagttgtc actgttgatt tgaacgccat agttgttttc
    38161 gctcgcgagg tcattgactt cgatgagcag tttttgcaat tcttttgctt tttctaccaa
    38221 tacgtcagaa cgtgccattt ttattttttc cttagcagtt gtcggaggag ctgagccagt
    38281 aaccgttttc atcatcgcct ttttcagagg cagtagattc ttcccaggag ctatgacctt
    38341 tagggtaata agtacggcca tagccataat caccagtgct gagcgtgata acagcgacgt
    38401 cggcaatagt ttcagccaac tgctccgccg aatcgctgat actcataact tctcgagtaa
    38461 tttcacgagc tttggcttta tcgcttgtgt cgccttctac gaaatcgcat atggaatctt
    38521 caatgcgggc aatcttggct tgcagttttt gcagttcttt cagaatcaac atcatttttt
    38581 tcctatttca ttgttgttta atgacatgaa cataataaat cacattcatg tcattgtaaa
    38641 caagtttttt gattatttta catgcttgac ccggtgtgca acttcggatt gcttaccttt
    38701 gttgaaccct cttgccagag gtgcgcctag atatccgcaa acacgccgaa ttaccgacat
    38761 cttcgaagaa tcatggtttc cacatgctgg gcaactaaag ccttttgatg tgcacttgaa
    38821 ttcgccatcg taaccgcaat catagcattt atctacgggc gtgtttgtgc cgaaataaga
    38881 aagattttcc atcgcgtaat cccatatctg ctcaagagct tcaatgtttc tacgcatgtt
    38941 gggcagctca acgtaactga tatggccgcc ggaagctatc caatggaagt tcttttcgaa
    39001 gtcgattttg tcgtacgggt taagttcggc ttcaacaggc acgtggaagc tattggtata
    39061 ccaatcttta tccgtaacac ctgggataac accgtatttc tcacggtcca atcgttggag
    39121 tcgatcgcat agggattccg acggtgtaga atacaggcta aagctccagc cagattcatt
    39181 tttagcgtca acacacatat tatgcattag cgcggcaaca tcttcagcaa atttccttgc
    39241 ccttggtgaa gccgctgttg attctccagt catatgaagt gcagcttcat atagcccgat
    39301 gtatccgatc gatatcgagg ctctcggctt cagatgaggc agaaattctt cttccggatc
    39361 aaggtaaagg ccgaatgcgc cttcggtata aaggattgga gctacttttg ctttcgcacc
    39421 tttaagccat ttgattcgtt ccatcgatgc ttcatatgag atagcgaatc gagatttcag
    39481 caattcgtaa aatgtgtcaa cgtttccatt tgattctatg gcaattcttg gaatgttgat
    39541 agagaccaca cctaagttgt tgcggccatt caattcacct gattctatac cagccagaaa
    39601 agaccggcaa cccattggac taacaggcac ctgactacca gtgatggatc ggttgttttt
    39661 cgcgctgata atgtcagggt acatgcgctt ggttgcacat tccatagcaa gctgtttaat
    39721 ttcatagttt ggatctcctt tacataaatt caggccatct tccataaaca tgacgagttt
    39781 tgggaaaaca ggcgtaattc cgtttttgcc taaaccttta atgcgaacat tgagaatcgc
    39841 cttctggatt tcgcgctcga accagttagt tcccatgcca aatgttatcg tcacgaatgg
    39901 agtttgtccg ttcgtggtga acattgtgtt gacttcatat tcgaaagcct gaatgccgtc
    39961 gtaaatttct ttttgcgtta gctcgtctgc gtatatgcct gcatcgttgt taggcaaacc
    40021 aaatcgacgg gccatggcta aatgtttttc ccatgatttc acagcatact tcgccaacac
    40081 ttggtcaata ttcgccaaag tcgttccgcc atactggtga gaagagacct gagcagttat
    40141 ttgagccata atggcacacg caacaccaaa cgattttggt tgctcgatat gggcatcgcc
    40201 cattttgaat ccacgagaaa gcataccgcc taagttaact aggcaacagt ttgtcattgg
    40261 tattgtgaat gcataatcca tatcgtggat gtggatatcg ccgctcttgt gcgcttgtag
    40321 gaggtggatc gggagtatgc tggcggaaaa gtcttttgat gcgattgatg ccatcatatc
    40381 gcgcatggtg ggaatcacgt cagcgttttt attcgcgttt tcgttgtggg attcagattg
    40441 gccccttact aactctttga cctgggttct tattgtcatt ggatcgcctt cttaaattgc
    40501 tttctgaact ttttgataag ttctgcctta acgtccttgt cattataatc aaaaccacgt
    40561 tcctgcatat caaggcgcat atcgggtaaa ctctttttgg agaattgttt aaccatatca
    40621 ccgagatatt gtgagtgaac gggattatcc gagtaatcag agtcaacgta ttcgataagc
    40681 tcccgcatcc attcgatata gtcgacatca cggccacgaa ggccacttcg aatgaattta
    40741 tgctttatca tcccttccag catattgcaa cgagcgcata aaagccctcg aactttgccg
    40801 gcattccgac cttcgagggc atgatcatga tcaagatgtt gtttgttgta aggcccgtca
    40861 aactcatttt tgcagagttt gcaacacccg ccttgagcgt ggaacagttt ttgcttcagt
    40921 tcatctgaag atttcgagtt taagagcata agaattcctc catatgctct tatttaactc
    40981 atcgtgttac tttgaactta ttgccatctg gcccggtata gatgatctca tatcctttga
    41041 aattcttcgg ataatcgcac tcatgacatg gccaacataa tccttcgacc ccatactctt
    41101 cccagagttc aacaccttca gcttcttcgc cgaaatatcg ataatagtct gggatgtggt
    41161 taaaatctgc ttgacctcct ttaccgcgtg gatattcggc tttgcattta tccataaacg
    41221 tgatcaatcg aacgatttca gctttagttc ggtcggcatc gatagctgga atttcatatt
    41281 ccagtgtcgc gtcgctaaat ttatccgaga aatgcatttt aaccataaat gtatttctgt
    41341 cgtccttcgg ttcaaacggt gtaaatttca gtgttagtct ctgcattagc ctctcctgcc
    41401 attataacgc gcttagcatt ataatcgatt gttgcattat aaattttgcc attttgcgca
    41461 aaatatgttg acgaacctat acgaacttca gttataccag gaaatgtcca gaatatcgtg
    41521 ctcttgactt gctctgggtc agtcgacaat aaattgacgt gaatgtttct gcctatttcc
    41581 ctggtaaact ccttggcgta gtcattgata tccatattca tctcacgtgt gaaaaacctg
    41641 accttctcgg tataaacggc ataattgaat tgaattcttc gtaggacaaa taaacatact
    41701 ttatttgcgg tatgctaaaa actgttttta gctggtcaaa caattccaat tcgacaggat
    41761 attcgttctg atcgttttga tacttggcgg attcccagtc ttcttttgtt agtttgattt
    41821 gcatttcatc tccttttccc actgattttt cgagtaaacg acatgacccc actcgattga
    41881 aacaacaaat aaacggagtc tgtttaactt gtggccatca taatactgag agtagaaaga
    41941 tggaacaagt ccaaactcgc catcaaaagt tagatatttc acaagatatg aatcagcatt
    42001 tccagagaca atccacttgc cgtaatacca ttcttgctca taccatttaa cagctttatc
    42061 gaacaattct ttgattcgat tcataaccag ccttttatca agtcgtattc tgacaggtcg
    42121 agttgaatcc tgggcacgta ttcgcagttt aatttcatga tacgctcaat catacaccgc
    42181 ttttcatgct tcattggttc gtcaagatca gcccattgta gccgtttttg cgccttacag
    42241 acgtctaaaa ctattttcac atatcctccg aaagccctcc gaagagggct ttatcatttt
    42301 atttgatcga tgtgcgactg cgaacttgag caaggctgct attgtattga acgcctttca
    42361 aagggtgatg atagttgacc aacgctgatt cagacataag ttcaacaaaa ccttggctca
    42421 gtttcacgtt gtaaagcatt tgcgaaccgt cagccaattt gctgtcggtg tagaagccac
    42481 cgtcatccag cttgcgaaga cccagttgac ctttcttcga tgccttccat tcagcgcctt
    42541 tcgggcactt gaacacatca taccagacac cgttaatttt aattgcagac atcttcattg
    42601 cccatttgca agtatcacgg ttaaccatct ggagcaaccc gccgcccata ccgaatgcaa
    42661 tgttctcagc agcccaacca ttatcagcca tcatggtcag aacttcatcg ataatttccg
    42721 ggccatcgat gccgtcgcct tggataatgc ggcaatgctt gttcaggacc ttgaagcctt
    42781 ttgagttggt ttcataaccg aagatttcac caagagtctc gagggcataa gtgatattgt
    42841 cgaacatatc accagagtcc ggtcgaacaa tcagagtacc acctttcgca attacttcat
    42901 ctttgtagcc ttcaatttcg cgaacggcac gtttgaagtc ggtagaatcg tagacaacag
    42961 agtaagcgcc agtgccgaac aaacgaacag agttcatata agcttcggtt tcgcgttctg
    43021 caccccagga tgtaacagta gagtgctcac gagccggtac agaaatacct gccatcttag
    43081 cgccatacag atgcttcgcg agataaagcg attcaaaggt atcggtaccc atagagttgt
    43141 agaggtgggc catgccgcca agagcagcag attcaccaga acttacgccg cgtgaaccaa
    43201 aatcatgcaa acgggtcatc agaacaaagt tgaattccgg agaatcgacg accaaatcag
    43261 ttgtgtcgat caaatgcttg cggatcattg caatgcattc gcgacttagg gtggcgaccg
    43321 tcgaggtgta ccagacagct cgcagaataa ccggctcgaa ccaaccagca acccaggtgt
    43381 aaggtgcttt acagcgaacg gtcagaacga cgttcttgac cggcacaacg gtaccttcag
    43441 gtactgcgtc gatttggata ggcaggcaac cgtgtttttg ctggtatgcg actacttcat
    43501 cccaaccttt gcggttgaat acatcttgac cgaagtgagc tttgctcatc tcatgcattt
    43561 cagcaacatc ttcgttggtg ataatttcct gcagtttcgt catcatgtac tcgatgccgc
    43621 cgataacgat gttatcgaat tttccgccac gagcttcgac gtagaagacc acttcatcgg
    43681 tgccgtcggg catttggttc caatgggtga ttttgtagga gtcagtcatt gcgatcaaag
    43741 gaatacgttt cattgttatg ctccaattgc atttttgata gatttgatgt tgtcttcaat
    43801 ttctttacga cgtgcttgca attctttgat ttcttcgtca atttcggaaa tccgaaccga
    43861 agcaaagtgg aaaacaccgc gaaccaattg aactgcttgc atagtctcag gtgcgaaaaa
    43921 gatattctgg ccatccggtt cttttgcggg ttctgtgtaa tccacagtag atactacttc
    43981 ggtttttgtt tcgacgtttt taacgggagc tttatcgccg ttaggcaaat caacgctgaa
    44041 tgtcactacg tgattcgacc cattggtgcg gcgagcaact tcgacaaaaa caccatatgc
    44101 ttcaagcgtt tgaagacgat tagtaacaca gtcgctttca aaggacgtat ttacccagat
    44161 agttccgcaa acactgtgag taccaacagc cgccaaattg atatgatttg ggctgatttt
    44221 agctattccg aatcggctgc caaagcttga ccacttcatt tcactcggga gcagattatt
    44281 caacaaccgc ataaagtggt gtttgtctgc aaaccgagaa ttgagatcac gagacttccg
    44341 atacttattt ccggttgtgt cgtgggtgtt tttcagaaaa cgattaaggt ccttgtgttt
    44401 ggtcatttta tcaatctcgc gattatggtg gagccgatta ctgcggcagc gcaaccaaga
    44461 acaaaatagg catcaccttt gtacatagcg taaaacaaac cgaatgaagc gatataacca
    44521 gcattgatta cgatattttt ggtggacatt taaattactc cttggtagat ttgatgggac
    44581 tataataatc catagtccca tcattgtaaa ctactttttc acttaaattc caaaatcttc
    44641 tgacagacgt cttttcactt cggcgcgcag gttcagaatt ttatgcttta catcgcaagc
    44701 ttcatcacta agtgcttcca acttaatagt cagctcggaa atttgtttga gttgatcggt
    44761 caaaccttcc aagttttcgc ctgtatgaga acgctcaacc tggtcgatgc gctcggtgga
    44821 agcgtgcatt tcaactgctt tcggcttcgc cggacgaact cgagttttct tttcaatagt
    44881 ctcgattcga cgagtccggg tcaaaaccgc caaattatga taatgagccc agttagtgct
    44941 gaaaatttcg atgccaagca gtctggcgat tttcacagcg tcatcgttta atgacaactt
    45001 gatttcgcga acagttgctt tcgctgcatg atagtgatat tcggtttcga caaccgaacc
    45061 gcgagggtga agcagtgttt ccttcataac ccgatcaacc ttggtccaaa accaaacagg
    45121 cagaaatctt gaaccaaatt gatgcgtagg ccactgtgtt ttttcgccag agacgcccat
    45181 gatacgcagg acagtacgcg tatgaatgca atcaagtcgc ggatcggtca tactgttcaa
    45241 cacgttccga attgcggcaa tatcgttgaa tcggcgccgt tcgtgctttt tgatggttcg
    45301 tgctattgct tttccacttg acatatcttt ttctccggaa acaaacaaat tattttgtgg
    45361 gtttctgaca catagtcgtc aaccattatt gcgtgtattt catttgattt gtgtatgtat
    45421 cgaacttttt cgaacacaac acataaatta gggtcaatcg gtgggtcgcc aataaaaaca
    45481 aatccatcac gtatcatcca gtggcttttg aagatttcaa cttctccgac agaatttccg
    45541 aaaagtgact caagctggat tttgctttcg aggtaaactt tgatgatttc gagttccatc
    45601 atgagcatcc tataacgaag aatgaattga tgatattcat gccgctacga tcgcacaaac
    45661 cgatataact gagcgtccgg cccgctgcag cgtgattgag cgctgttgta acccacggca
    45721 attcttcttc gagcatttta acatcgtgat gcccgtagtt gtcaagaagc cgctgtttga
    45781 cgttttcaaa acccgtgtgc gattcgaaat gctcattctc gacgatctct tcgatcggat
    45841 gctcggagca tccgataact acatgcgggt agccctcgct agaaatccac acccatgatt
    45901 tgtggtcatc aatttccatc atttcggcac cttaatggta atgaaatccg ggttcatcgg
    45961 ggatgtgcgg ctttcagcaa cgtatcctgt ttcgcgaagt tcgctgataa aacgctcaat
    46021 aacatcaccg tcgtgcaggt agttgaattt gattttgcca cgaacataat tcagaaaacc
    46081 actggtatca acagctgtat cgccgttcat ttcaacaagt cttggtttga catgttcgtt
    46141 gaaaaaatcg tcgaaatgac atgcgacatc atcgattaag cattgtgagt gaacttttat
    46201 gattttacgc atttcgcttg catgaatcat ttgtttaatc ctcgtgtaat tgcaataaca
    46261 accaaactga atacgatcgt tgcaccaaat gtttttattg ccatagcagt ttcacctaca
    46321 gcacacattg cagcgccaac accgatcatg gttgttgcaa aagtgccagt gatagcatca
    46381 attcttgtta ctggtttatt tgcgatttct tttgcacttt gtcgctttgc gaaatcaatc
    46441 gattgcagat tggttgcctt tgtgattttc atttaaagta ctccgtgtgt agcttgattt
    46501 gatgggacta tagtaatcca tagtcccatc attgtaaaca gtctttttaa cgatttttta
    46561 gatattcaag catcgcatca ctatagacgt caagaacgaa ctggttccat ggttccacgt
    46621 taaccgctga tggcatgccg tttcggccag cttcttttgc agcagcgtca acatcgtcaa
    46681 cgatctgttc aaggcgagct tgcacttctt tgaatggcaa ttcaccagct ttaaccagtt
    46741 tgatttcttc ggcattggcc aatggatact tcaaatcgcc agtctggtag atttcgagca
    46801 actgtagacc gcctcgcatc gcatgactca aagctttcca gtcgatacct tcgttggctt
    46861 cagctttacg ggctcgttcg ccgtactcgt tccagagctt gtcgacagca ccagcaaact
    46921 cagcaatttt aacaccggcc atatacttac gacccatcat tgtgtagtac gagttagtct
    46981 ctggtttttc gcgatcgacc gtccagaagc aaaattcatt tgatggcaga ggtattttga
    47041 gttcacgcag acgagggttt tcatgaatct gaagcgcatc catgaagtcc ttaacctgtc
    47101 gcaaagcggc cagtcgagaa cctttcacac catatttcgc cgcctgcttc atgacatagc
    47161 tcatataaga tgtcatgttt gttgtataga aactcgagcg ttgactttgg ataaactgcc
    47221 aaatcgcgga gtcagaaacg attttgtcgg ttggtgtgtg aagcatatcg agagcagcag
    47281 tttcgccttt gacgcactca tgaatgaatt gcttaagcgt aaacatttcg atatcgatat
    47341 catccttgct gtttttggat ttatcgttgc cggttgtgat ggaataactt gatttaactt
    47401 gtgatagcaa gatatctttc ggatcaggta tgaaaatgcc tttcatatcc aggtcagatt
    47461 cgggtgtgtt cagaccgtaa aggtgagagc cgtgcagacc ctcgaaaata actttttgca
    47521 tcatttcacc ttagttcagt gtcataccat acgctttcaa ttgatcacga tcgtttcgat
    47581 ttacaaagat tgatttcctg cgttcttcgt cccaagcgat gagtgaccca tcgtcggcga
    47641 taaatttgac aacgtatttg acatcccatt tatgattgaa cgtgtcgcct acttcaatcg
    47701 ggacagatac tgtttcttcg atttcgtcag cgattgtaaa attaccaccg gtgatgttga
    47761 tttcgctgtt tgcgcatata tctgaccagc atcggatacc gtcaggcgat acctccttaa
    47821 aatcaaagca acatatgccg ttcaacaggc gcaattcgat gatcataaca atacgggtca
    47881 ttttcttgcg aataaccaac acagggtttt cggtagaatt gctgttcacc gtgatgcatt
    47941 cccaccggcc gtctttatac ttgaagacat ccgcgggtgc aattcgcttt tgttttgttg
    48001 atttgacttt cttacgaatg catatgtcct tcatcatatt tctccaacag caatttcgta
    48061 cattttaaga actttgtcaa aaggcaattc gccgagattg tggtttttaa cccattcgat
    48121 taaatcgccg gactcgatta gcggtgcatc agttatttcg agatatttgc taacttcaga
    48181 agcgttaaat tcatagtcgt atcctgaatt gattcgctgg ccattacgat caattgctat
    48241 gaaatggttt ttgttgccgg tgttgacaag gccaaaaatc cattttccca agatgcggtg
    48301 tattactttg ttcacaccgg tgccattaat gaattcctcg atcaactcag agtcatcttt
    48361 aaatttatag aattgcataa ttttatcctc ataatctggg tgtgaccatt ttatcacacc
    48421 catcgtgttt agtaaacgat tttctacaaa ttaaatgcca gtgaaacgag atataatttc
    48481 agcgtgatca tcgaacatac gcgctctgtt ctttttgtag atgtgcatag gcatccagaa
    48541 cgcagctttg gcatcgtcgt cagcattaac agccggcaat tcaccgtttg ggccaggact
    48601 gagaacaatg taatacgcaa cagttggctt gcagaattcc gcggtgcgct tcgggtgatc
    48661 gaaaacttcg tgcgctttga tagaaccgat gatatctttt tctttgacct cgatcttgac
    48721 ttcctcaaaa agttcacgaa cagcacattg ttggaaggtc tcgttcgcgt tcttatggcc
    48781 accgggaagg gctaaagcgt ctttgccagg agcatgcttc cgctcaatga gcaaaatgtg
    48841 gttattgcag gttaccacag catcagcagt attgcaattc agagcttcgc gatatgggta
    48901 attctcgaac ttcgcgagtt cgttatccca cattttgcgc tcttccatca agcggtcgcg
    48961 gagttcgcga ccttcagtgt tccaatatac ggaaaggaaa gatcgcactg ttgggttaat
    49021 cgggaatgcg ccgttgatta cgccagttcg aagaaactcg tcgcgcattg gggtgtttga
    49081 aatatccgcc ccgtggtttt gaacacccat acattgaata tgatcccagc cgaaagagcg
    49141 aatccaataa gaatcagcat ctttatcata agccaccatt gcgacttttt cgccagcctt
    49201 ttcgccagcc tgttcgcgaa cttccgcctg ccaacgatct tcgttgtacc ggtaatccgg
    49261 tacgttgccg aaagttacgc gtttttgctc atatggagtc aagttctcag acatccattc
    49321 cttgaacatt ctaacgcgaa ccagcgtagg caatgggtta attgtgtttg ggtagcaatg
    49381 agatgagcca aaaacaacag ctacgttttc ggctgtctgc aatgctttgt agataagcat
    49441 ttcatgacca cgatggaaaa agctggaaaa acgaccaatt actacagcac gatcataatc
    49501 ataagtcata tcattaaccc cgatttttgt aactgttgat tgcaaaattc atttcggctt
    49561 gttcaagacg ccatctgacg tttgatgatt gaacaaggcc ggcagtcaag aaaagatcga
    49621 taaaccaacc aataccaaac agaccacctg taaatagcca gatgattcct gttgctatgt
    49681 tgccagtgta aaagcggtgg attccgagaa acccgaggaa aaaccacaaa acatatgcaa
    49741 ttgctgttga tttcatttgg caactccctc aagctgtttg aggcgatctt cgactgcggc
    49801 caagcgtttt tgaacgtctt cgagcttttc gagtagttcg gcgtgtgtta attcatcatt
    49861 gatgtcggca acatcaggca gccgtttgag atattgttcg atttcgtttg gaaagaaaac
    49921 cgggtcataa tcggaagcca ggcttaggcc gcctttggtt tcacggattt caatcgcgct
    49981 atcatacccg tcaaacacga tgtaaaaagg acgcaaacca acaatatcag caatttgcgt
    50041 atttgtctcg acgctgccta caaccgctgt gaaatcggcg atagcttcgg catcagcgaa
    50101 cgcgtaacgt tctattctca ttgtaatctc caaagtaagg gctccgaaga gccctatcgg
    50161 aattagtgaa aggtcggggc aactggttta accagcatct gggtagcaac aacgttgaaa
    50221 ccagcttctt cgagacggga aataaccttg atccaaggag ctcggctcat agcgtagttg
    50281 acgtccaaaa cgatagtgcc gtattggtcg aatgcctcca ggtcgtcaaa catttcaggt
    50341 tttgcttgtg cgagcgcagt tgaaatgatg tagcgattct gcatggccgg attttctgaa
    50401 ctgaaagccg tcagacgacg aagaatttcg gtatacggca tttcgtcaga aacgaacata
    50461 acttcgtgat gttgtgcagc ctcgaatgcg gacttgatag cttcttgagt tttgccagcg
    50521 tttgcagtac gaagaatgag tttcattgtt atttcctttg gtttatttga tgaggctatt
    50581 ctaattcaat atgtcgttgt tgtaaacttg tttttgaaaa ataatttaaa agaaacagat
    50641 tgtcgcttcg cgactcgggc aagcccgaaa tctttctttc tccaatctat ttctcttctt
    50701 tttctgtctc tcaaccattg taacagaatt ctatcacacc ggcggtgtta agcatttaca
    50761 acgcgccagc tagttcctag gcgagttttg taaggctcaa catgttgaac cgatacaacc
    50821 ctttctgtat ggccgatgac gtcttcgcct tccgtgttaa caaattgggc gcgatgacgc
    50881 tcagaataaa ccgcaacaaa acaacccaac tctttgtgct catacgcagt aaattcttgt
    50941 tcgaaaaccg cgccataact ccaatctggc ttgcgggcga ccttccacac tgacggcatt
    51001 ttgaactctg aagcttcaac gcccagacgt ttttcgattt cttggatttc tttttggata
    51061 ttcatgttat ttcaccatca agaatttagc atttttaaag acatcgcgat agtcactgag
    51121 gtcgacggtt tcgtaaaaat caccgtgctc atttgcaacc ttcagcacac cgtggcacca
    51181 tttaaaagta tcggcccacg gtttgtgatt gtgaatccat gtagcaacaa actggccaga
    51241 agtaggcatt ttgaatttag ttttcatttt ttaacactct gttgtttgaa catgcgacta
    51301 tcctatcacg agtcgtcgtc attgtaaaca ttcttttcaa taaaaacaaa aatagccagc
    51361 acaatgctgg ctatcgttcg ttcaagataa tgagagttta tacaacgtca atcgacatag
    51421 ttgctggata tcatccgctg cgttcttgag caccccatta ggtgatttgg ttgcaacttc
    51481 ttcagccagc tcagcaagtc gtttaacgaa gccggtgaag tcaacgtttg gtatttttag
    51541 cgtgggagag tagttgaaac cggacgccat gtaagtttcg gcaaatgtat cgattttgtc
    51601 aggcatttcg tcatagaagt actcaaacgc tacatgcttt tcatacgact tagtctcaaa
    51661 atgagctgag tgcgccataa cgcttgaaac tagacaggcg ccgataaatt cgtcaaagat
    51721 attagtcggg ctttttacta cgtcactgaa ttttatttcc attttgtacc tcggtgttgt
    51781 acgcgacaaa tagttttgct tcttgataac ctaactgaaa gcatgtgtct gaacaccccg
    51841 cggaacccca cttggtatcg agatattcga gaaattggac agagttatct ttcgaatgcg
    51901 tgatatcatt cgtataaact atcattgctc cttgcataaa ttcgtcgtat gacccaacct
    51961 cagggttggc gctaacaagg tgaactgttg ctacaagcaa agctacggct gcgattattt
    52021 ttggcatatg cgaaaagggc cacagggccc ctccttatca gattgaacat aggctttcgc
    52081 cggttaaaga tgcctatgtc caaggctttt ttgctccaga agttttatcc ggactatcct
    52141 gacaaggcat cacaccatcc ttggtgcatt attcctatct ttatttagat gctttccgag
    52201 gaccctgttc tttccaacac ttcataaatc gcgtgaaata tgccgggata ctattacaca
    52261 aagccgcgat aaatgcatga taagcctctg gtgattcaaa aagactagag tcgatttgct
    52321 cagtgtatcg cccatacgtg tcgatgtttt tctgcatagc cttagcgact ggatgtcctt
    52381 ggccatacgc gaaacccata acagtcgatg gattgctttg ccagctattt aggtccataa
    52441 gaacctcttg ggcggcaaat tccaattcct ctaccatttc agatgtgact tgcaaatcct
    52501 agctccttca ttatgtcttt gacaattatc gacacttgtt gtgtttcaat gccgaattcg
    52561 tggttaaaaa ccgccggaat ttcggtttcg gctaaatgaa ttagaccgtt taaacagaaa
    52621 tcttcaaata gtgcggccac tgcgggccgc aaagtttctg gtctacctat gatataacga
    52681 gggtattcca tcagttttcc accacatgcg gaataaatcg ggagttattg ccagtgattc
    52741 gaccatcgtc ttcacgaata cccaaaccaa cagcatcatc gcctaccatc caaacaccga
    52801 tcattgggta gcaaccatca aattcctgcc actcaatgta ctcttgaaca atccgaggct
    52861 cttccgcgta attgccatct gttgattcgc tttctccacc atattcgaaa atatggacat
    52921 tactaccttc gcgagaaagg agtggttttg atacccattt cggattttcg aatgtaaaca
    52981 gattcagtcg gtcgaaatca tcttcttcat atgcagggac caaccatttg caattaggat
    53041 aacgctcata aagcagaacc aagagtgctt tattggacag catcattttc caggccggtt
    53101 cgatgaaccg tgtaccagat ttatgagcat atgctccgaa ttcgtcttcc atcatccatt
    53161 cccaaggata aagcttgaag caatattcca tcaggcgatc ttgttgatcg taaaaacggc
    53221 cggcgtccga catttgaatt tcgctgatgt caaaaacgtt taccggaata cctgcttcag
    53281 ctgcggtctc accgatatag gcgatagtcg cgaaatcatc tacttgtgag gtggcaacaa
    53341 tgttaaggca cccgttcaac ccgttcaact tcttcatgtc agcccaatga ttcaccaatg
    53401 actcatgtat ctcattgaac tggtagtggt tcgggaaatt attttgagtg aaccagttcc
    53461 actgtgaaat tgaagactcg atgagaatag tcggcgtatc agcattgtac tcgagcattt
    53521 tcgggccgtc tttagtcatg atgaaatcga agcgaccata gaaaccccat tcgtcagcac
    53581 tccaggaatc gattatcatc tgtcgggcat tttcgggaat gttgaacata tcccaaaccc
    53641 gaagccgctg agcaaatgat gcttcttcaa agaaccaacg aagtgtgtcg atacacatgc
    53701 cgtggagggt atttgcggcc aactccagct cttgttgttc ggccttggtg aatgaataat
    53761 aaaccggctt cgccattgcc tcggaccaat atggaccttc ttcggtggtg gtccacaaga
    53821 cgccttcaga tgtcaattgc ggcaaccaat ctttacgtgc ttcgatagat aaacgtttca
    53881 ttacactgcc tccaggcaca tttcaacttt ttcccagtat tcttgtaagg tatatggacc
    53941 ttcgaacata agaattccgt tatatgggtt tccattatcg tcaattgaaa tatccatgga
    54001 atgagcaccg tatcgaccga ttttggatat ttcaataatg tcaccaactt tggcgatatg
    54061 acatttattt atcggtttgg tgattcgata tttttgcccg atataaatca tgatatttcc
    54121 ttacgaaaaa taatacgagt tgtgcaaacc atgtccgttc gcatatcgac gtgcttcttc
    54181 atagccgata acatttgaaa gcatacggaa agttgttttg cgatcgaggt catcggcaca
    54241 ccatttcagg ttttcaagaa acttagcttt cgcctcgata cctttttcgc tatcaatttc
    54301 aaaaatcata aattactcct tggcagattt gatgggacca tagtaaacca tagtcccatc
    54361 gttgtaaact actttttcaa aaattaaccg ccagatgaac cgaaactgcc ggatttacca
    54421 aaaccacctt tggaagaaaa tgatggttta cttgacggag atggcttgga aaagcttccc
    54481 ggtgttttcg gcgctgagaa ggtgttggca ccaactgaac ccttggcggg aggaacgtaa
    54541 gcgccgccag aagtaacgaa cccgtttttg cgatcttcgg gacgagcagg tgcatatact
    54601 ggcatcgggc gactgttgtt tgacatcatt tgaccaacga tcatgccaac catagctgga
    54661 acaaaaacat cactgaaact gccgtcactg ttttggatct gtgtgcgatt gcaaattgct
    54721 tcggtgccag attcacagga tgcttgatcg ttgaactttg gggcactgtc aatatgttcc
    54781 attttagcct tgtcgaaggc tgactggcat tgttccagtg aaccgccgcc cagttctgcg
    54841 cattgttgag ccgaaacagc agttacagtt ggggttgctt caccgccgag accattgtag
    54901 gtgaaggtat catccgtatt tgcttggccg caaccggaaa gagctgctga tacgaatgct
    54961 gccattatac ccattttaag ttgtttttgc atttaattaa tcctcgattt taaaagaacc
    55021 agcattcact ggagttttac gacaaaccag aacttcttca ccagctggag taagcgcagt
    55081 tgccatgccg ttagggcaag cgcgttcgac tggattgtat atctcattgc tcgaaaaagc
    55141 aggaatcgcg atcgcagcga gtatagcaat aatcacaaca acgatcataa gttcgatcag
    55201 tgtaaaacct ttcataatat gtttcctatc agattactaa atgggctccc gaaggagccc
    55261 aggttggatt acttggaacg catgtccatc agcatctggc catcgtaacc agcacctacg
    55321 acagtctgcg gtacaccacc ttgatacttg ttggcgcgaa tcatttcaac ttccagctga
    55381 cgccatttga tcatttcagg ggtgatagtt ttctgcaaca gggagttagc ttcggcttct
    55441 ttaccagcag cgtacagctt ggcatcagca tctcgctcgt tggctacagc gttctgttcg
    55501 cgagcttctc gtgcggcctc ggcagtctta acttgttgct gggcaacctt ttcagccttg
    55561 tccaggtcag cttgcgcttg gtttaccgct tcttcacgga ttttggtttg ctcaacttga
    55621 tcttggatca gcttaggcag agtgatttcc tgcaggaaaa cttcaacgac ttcgtaacca
    55681 aacggcttgg aatattcgtt aacctcggat ttgatcagct cttgaagcat ggattgtgtg
    55741 gttgcatcac cgaacagatc ttgagctttc ttgatgtttt tgccggattc gcggacagta
    55801 ctttcaaatt tctttgcaac gtacttgtcg atagcttgtc gctcggtacc gccattgata
    55861 cggacagcct gcgccttgtc accgtcgaat cgcaacatca gggtgatatc tactgaagtt
    55921 ttcagtttat cctgagaagg aacttgaacg ttggtgaatt ccatcttcag atcgcgagtt
    55981 gaataagtat caacagaagc cagagggttg atgacgttca aaccaggttg catgatgttc
    56041 ggacttactt tacccaggaa agtggttgtt gcgacagagc cgtcatcaac taccgcgaaa
    56101 acgtttgctg cgatgatgat tgcaccggct acggcagcgc cgatcagggt ttgtttcttg
    56161 gtcagtttcg gcattttgga ttggttacgc atagtatttt ccttaaatta tggcttggca
    56221 gttacggtga ttacggattc atttcggaat gagtcagatt tggcatcata accgaggctt
    56281 cgtagataat ctacaatatc ttttggcatt atggccggga atttggcaac gtcgaaagat
    56341 attttaaacg atcgttggcg tatcatctcg tcggcgacaa atttgccaac gggagcgagt
    56401 ttgcgtttaa gttcttcggt ggcaaattgc tgggccatga gtacttgtgc ataaacatct
    56461 gaacttttca taatgttttt ctcatttggt ttaacatgag gctattctat acaaaacagc
    56521 ctcattgtaa acaacttttt aatttatttt tgaattttgc cttctttcca atggcgacga
    56581 cagaccgata tgaaacggtc attgcctccg attgaaacac gaggacccca aatcttttca
    56641 ccatgttcat tcattcgcat ggtcattgtt gctttcttac cacaccaaca gatagtctca
    56701 tgctcaactt ttcgttcggc caatactaaa agctccgctg atgcagggaa aagatgccca
    56761 tttgagtcag acaataagcc gtagcacata acaggcacat tgatgtagtc tacaacatca
    56821 cctaactgat gaacctgatc aaccgtgagg aactgagctt catcaacgag aatgcagtca
    56881 attccatcta gctcgatcag tttttcgcaa aaggctttaa ggttatcgtc ttggctgatc
    56941 atatgcgctt tttgcgatat gccgatacgc gaagaaacat tatcgccgtc acgggtatca
    57001 atcgctggct taagaataag cggcttcatg ttccgctcca tgtagttgta cgctacctga
    57061 agcaagtgag ttgatttacc tgaattcata gcagcataat ggaagtgcaa tttcgccatc
    57121 agaatacccc attcaggcgt ttgtagattt cgtagtttgt gtggaaaatg tcttcagtga
    57181 cttccgggcc aaaccaggtt ggaattgctg tgaaattcaa agcgtcgtat tcggatttga
    57241 attcgatttc agcgtatatt tcgccggttt tcagaatgtc caattcgatg atatggtgcg
    57301 aatatccggt tggaataaac cagcgttgct tgacgatgca ttccgggtaa ccggccatcc
    57361 gatgaatttc ccatgcttca tcacgagaaa taaaggtctc aatctcttca cgaataagac
    57421 ctaaaccagt tttaacggtt ttgataaaga cttcttcgca tccagcctcc ataacgctcc
    57481 gataacgagc acctttgtgg tagaattgcg cgatatcctg ctttcggtat gttacatttt
    57541 tcttaaatgg gaagacaggc acaacccact tgcgttcaat ttcaagcgcc attatgtttt
    57601 ctccgataac cgacggtaac aacttcgtat tgttcgactt cttcagcttc aacgaattca
    57661 ccttcatttt cccaaggcat ttcgtcttga cattcggtgg caccggtgcg ataaggcgct
    57721 ctgaaattgc gttttatcat gtctttttcg aatgagaata caaaatcgta ctctacggtc
    57781 catcggccct gatcaatgat gtcattgacc aatgtctcat aacttccaca gaaatcactc
    57841 ggcacacctt cgccgggcac tatttcaaat ttttcaccaa taagttcacg caacaaatgt
    57901 ttaggaaatt tcacgctatt aatctcgttt ggttgattat aagtttaccg ccaacgacta
    57961 attcgaagtt aacgattacc tcatcgccgt cgtctttgaa tgaatgaacg attatgtttt
    58021 cacatccatc cccgagcaat ccaataaaag cttcttcaaa gacccggttc atcaccgggc
    58081 caggtttttg ccatttattt gctgccatcg aattccacca cagtgatgtc gatgttagga
    58141 gtaacctcgt caataatcgc ggaaatctta ctccaatctc cgcgggcgag gccagcaccg
    58201 atcattggaa tacacattgt catattgctt ccgccaacac tcgtctctgc aaccgaatcg
    58261 ttaagcatag tgaaagtaga ccggacagcg tcatatgaaa gcatgtcggt tgggtcccaa
    58321 aatgttgcct gggtgtacat gttgacgccg cagctggtac gaccttcaac gtttatcagc
    58381 gctgcctgaa tagttccgag cttattgcgg tcgccgctaa cagttttcaa gtccattacg
    58441 tacaattgag gaagtctttc acgaacttct ttcgcgatgc cggaacccat tcggttgaaa
    58501 atgttgcaac catggccaaa gatgtcatat ttcccttcaa ggaacagact gatagcatta
    58561 cccttaacat attgaacgat catagtgtga attctccttt acctgaagat gtcgttatag
    58621 acagaacgtc gccaattgga ttgaacgtcg ggttgtccat acggcgaatt acaatggcag
    58681 agccagatcg aatgtaatcg acattctgaa caataccgtt cagactgatc attacacgtt
    58741 ccgtacctac caatatgttt ttgtcgtcgc gggcgccatc gatcagccag taatcactgt
    58801 tgaacacgat gcctaagcaa ttgtcatatt gctcgcggac ttcacggtcg cacgaggcgg
    58861 atagcgccga ttcgtacgta ccattctcgt cagtgaattc ttggattaca ccggactttt
    58921 gcggaaaatg aaacatttca ttaacgttgg cagtaactgg agcaactgca ctacatccgt
    58981 acatcccgat ggcaattagt gtcgcgattg attttttcat gattttactc cttggcgtgc
    59041 agtttaaacg atgatttcaa agaatttacg ttcgctcatg aaaatcatga tataaaaacc
    59101 ttcaacttca atacagtttt tattagagtc aacgatctcg atagtaccat cgtttagccg
    59161 attttccgaa ggccaccagt tcattcctaa aaattcagca atgactttat ttgccggccg
    59221 gatagcgatg aattcacctc gacttatttt ggatttgaat cgaactttca ttttaattac
    59281 tccgttgtgt ttaacttgag gctatagtaa tccatagcct catagttgta aacatttatt
    59341 tgtaaatgaa ttccatactt ttaagacgtt ggtttttcga aagaacgcga tcagcatacc
    59401 caagcccagc tttgtagttc caaccagcgt tgtatgatgc caaagccaat cggatgttgc
    59461 cttttcgaac agtcagccaa tagtgcaatt cgtccattgc ccattcagcg gaaccgcttc
    59521 gcgtttcgag gtcctttttc agataccaat gacgaaacgg aatacctcgt tggtccatct
    59581 tcttaacaac agttttgtaa agattctgga acataccata agcatggtgt cctttctttg
    59641 aacgacctgt gttaagacca gctgaagatt cttcccatgc tatcgccgca aacagagtac
    59701 caaggtgccg ctgattaagg aaattcgggt gatcaacatc tcgctgattt cccataaggt
    59761 cgtaaccttt gccatagtag taggcgtatg aaagattcgt tttctgagtg tccgtaaaat
    59821 ctggtgccga cggaccggca aaaacatgtg aggtgaaaag taggattagt attgtcaaaa
    59881 acctcataaa ccctccactt tgattacgcg ggtcgtcaca ttcgatgata aacgtcgact
    59941 attaacgata gccattctgc atgtgatcgc ggaactgtat tcgccggatg gtggtatttt
    60001 tgaagttgtt aaaccgatcc agaggttgcc atctgtaatc tccagacgta ttggcctgta
    60061 ttgcacttga tcgtcgcgct tgagatccaa tgtcggggga tatggcaaag acatgtgctc
    60121 gtcaatcgca tcgagatgat cgtcgattcg gttaactagc tgtaaaacat agtcgacgtc
    60181 gatcttgcgt atgatcaaat catctatgaa gtggtaggtg tattcgaggt gaaacttgtg
    60241 agaaccttgt ctcgtattac gagaggcttc aatacgacta ttgatttctt taaatttgtc
    60301 ctcgaggact ctcctgagtt tgtagcgatt catgatattc tcctatgttg attcagggta
    60361 cattctatca cgcatttttg tggttgtaaa cattggcgga aaacaaaaat gggctcctag
    60421 gagcccatca ttcaaattcc aagcttttcc ttaaggttcg ctacgttacg cggcacaccg
    60481 gtaaatcggt ccaatgtact tgtatttacc aacgttggca gagacctgat gtgatgtttt
    60541 gcggtcagct ctacgccttc gtcggtgtcg acgtcaacat aggtgtattc aacgttggcc
    60601 agcatcggtt taaccatttt acagtttgcg caccattctg cgccgaaaag atagatcata
    60661 gtaatttcct aattaagttg aatgcgtcga taattacaat cgacaggaag agcgaaattg
    60721 ataggtcgat tataaatcct attcctaata gcggattaga atatgagaaa caggcacata
    60781 gaacaaccaa ggcccacata attattccta ttgtatggtg tatcaacaga ggctcaaaag
    60841 agcctctggg acattgacct gggcaataac cagttcaatc aaccttcaca cgcaaggcaa
    60901 tcggatttgc ctgaagaagc tttaacacct cgctcagaac ggagataata cagcgacttc
    60961 agacgggggt catccatgaa agcgcggtga acagaagcaa taaccgattc tttttcatct
    61021 gctgagaaga aaaggttgat tgattgcgcc tggtcgatgt gccgttggcg agctgaagca
    61081 agacgtatga ttgcatgttg atcaatctcg taggcagttt taaacacaga cttttcgtga
    61141 tctgtcagaa tatcgagatg ctggacagat ccattatgat aagtcgcaat atcttccatc
    61201 agctcttgga tttctttgtc ggtcaatcga tctttcagca cttttgcgag caccgggttt
    61261 gaacgaacga aatcaccggc atttgattgc tgtatgaatg agttgcaaac caagggttcg
    61321 acaccttgcg aaacgccacc agccaaaagg gccgagctca tattcggagc gattgtgatt
    61381 aatgtcgcgt tgcgcattcc ggtaccttta caccattccg gctcaccata ctcttcggca
    61441 agttcgcgcg aaccttcttc agcagctttt ttaatctctg cgtaaagctg gttatttagg
    61501 atgtgtgcag cacctgattc aaacgcaata tcattcatct ggagatacgt gtggaaaccg
    61561 agggtgccga gtcccaatgc ccgagctttt tcggtgaaac gaatagcttt gtgcaatgta
    61621 tcatatgaaa gttcttttgc ctttgccagg aattctgaac aaactgagtc gaggaagcga
    61681 acagaccatt tgatatcgtc cgcggtaatc tcatcccaaa gagaaacatt aagagagctc
    61741 aaaatgcagg tgaatgtgtg catatcgtca gacgggagtg caatttcagt gcagagttgg
    61801 cttgagcgaa tcgggatgcc tgagttcttg atagcctgtg gggctaattc gtttgcaatc
    61861 cagtttttcc acatataacc tttgccagta cgagcgcgca tatacatcag ttcgttccag
    61921 cgggccatgt attccgggtc acgggctttg agtttttcat aatcttcttt ctcgaatacc
    61981 cagccaacgt gagcagatgc tggatttttc agcacataac cttgtagttc ccagaaatca
    62041 ccatgcgaga agtcaacata accggcccat tcaccacgtc gtccagcagc tgcaaccttt
    62101 gttttggtgt taacgaagtt gtcaaataca gggacaagtc cgtctgcttt gttgtggctt
    62161 gttgagatat ccgatccgcg cgggcgaatg tctccaagat atgacgcagt tccgaaaccg
    62221 tttttagcga gcattgcgac ttctgtttgt ccttcgtaga agtccagaac gctgtctccg
    62281 acataacttc cggcgcagga aacaggcatc ccacgatctg ttccggtgtt acagaaaact
    62341 ggggtagcca tcgccagctt accggaccag agaaggtcga aatagcgctc ttcagcttct
    62401 ggtcggatat catgctttgc aagtgttgaa gcgactcttc ggaatgcacc acgtacagtt
    62461 tctcctttat attgatagtt ctttttgaac atcgaccaac cctgggtcgt gtaaaactct
    62521 ggaatttcgc caatcgactg tagatatttg cgttcagcgg aaacggattc aaatttggat
    62581 tgagctttca tagtgcacct tataaagaaa taataacccc gaaggccttc ggggtttttt
    62641 taattaccag caatcggaga aaccagcgcg gtcccaattg atgttgtatt cagatccgct
    62701 accagtaaag aagtcatgga actttttcgc attgattgtg cgataaaacc aactcgcgat
    62761 cggattgctt tcgatttcga aaatcgggtc atagccgagg ttttcgagac agaggttaat
    62821 tcgagattta acgaatatgc gaagctcgtc tgcagtgata ccatcgattg gttcagcgaa
    62881 aacaagatca ataatgccgg actcatggtc ataaacctgg tgggccatgg caataatatc
    62941 atctttgagt ttttcgcgaa catcaacttt gtgatgttcc atcatctcac ggcaaagagt
    63001 acggaacagc attgcgccgc caatcgagtg atgatgctca tctgctacag agagatcgac
    63061 tccgcgacag atgttacgca ttaggtcttt tccgcattcc tgcgcttgga agtgcttaag
    63121 gaatgcaaag ctcgaataaa gtacggcacc ttcaatgaag gtaaaggctg caaaagattt
    63181 ggcatcatcg gggtcggata ccgatttacc gacaaactga atgcgacgag ataactcttc
    63241 gctttccttc caagaagtgt agaaagcttc atcatccaga taaaggactt cgttgacttt
    63301 attgtagaac ggtgcatgag agttgccttc aactgctgaa aacagagtgg ccatacggtt
    63361 aatttccgga cgaccgaatg tgcgagcgat ccgcccagtc caatagtctt cgcctacttt
    63421 acgctcgtaa atggtgaata acttcaagac cgtggtgatt ccattgagtt cgcctggggt
    63481 caatttggtg cgcaaatcct gcgcgtcgtt atcaacgact ggttcgtccc atggccaaaa
    63541 tgcatgcatc tgttcgtcgg caagtgcagc aaactccgga tagcgaataa tccaaccttc
    63601 ttggtcctga tacataggca aagacccgta caaattatgc attgtttacc tctaaattgt
    63661 atttttgaat atgtttttga accgatttac cagattacgc atagtgcttt ctttataccg
    63721 aacgtaatat gcggtaaatt cggttgattt tgagaatccg gtttttgaat agagcgcgat
    63781 tcgaatatcg gtcaacggcg tttgtgtgtt aaaaattatc acaggaggcc gaccgagaag
    63841 ttcaaaatgc attttatcac ggcaaaatga cattgcgtcc aacatccgtg gtttattacc
    63901 gcctgctctt cgtattgaag taattatatc acgatcagct acgataagcg ctccaccagg
    63961 tagctgatcg tatgataatt tatgcaattt caccgtggtc gcgatggtat catgggcatt
    64021 cacaaccgtg acgctctcaa agaaattgtc gtcttttata gtaactattt taggttttat
    64081 ttggttgcaa cattgacaaa ctacgttgtt cattttatct ccgaatacaa aaatagcctc
    64141 cgaagaggct atttaacttc aggcatttag ctggataacg tctgcatcca gagttacggt
    64201 gtctttgata gggaattcag taccaactgg cagcattggg tcggcgcttt tcagtacgtg
    64261 gaagtaagaa gcaacctttt tgactgccag ttcgccgtga ccgaaattta ccaggtgagt
    64321 tacgttagac ataatgattt cctcatgttt ttgtttggat tgatttgatg gagtaatcat
    64381 atcattgaat accaaaacat gaacatgcta ttgaaaatta tgtcataatc acaaactcga
    64441 caccatgggt acctgcccag tcatagattt cttggcgctg gtggcgggat gtgagggtgt
    64501 attcgctttc gtcaatcatc aggaatttga ctttaggaca acggtcagta agctcgctaa
    64561 ttgttgatat ccggatgtct ccacgccatt gatatgatac catatcttga acgtgtcgtt
    64621 tgtttgccga gttcatcgtg attatccgag cgccaccttg agctgatact tcgtttgcca
    64681 aatggagcaa acctgtcgtt ttgccggtca tgcgacctaa gttgaggtgg atagtccgat
    64741 gctcgcgtag aaaactcgac tttgactggc tcatttcctg tatacaacct gaaggtttat
    64801 tagcgtaaga cctgttgatt gcgtcaataa agaaggtttt gtagttgaaa aatcgttctt
    64861 ttacgataga catgcttgtc tccttaacgg cctgctggcc agtgggtatg aaaaaggctc
    64921 cattgtggag cctttaatta ttcggtttcg atagcaagat cgatccgggc tgaaagaatc
    64981 aactgatatg ctttcattgc atcaagttgt tgaaccatca gttcttgttg cgcaaattcc
    65041 agctgaggga agattggaga accgccgata aagctgtcca gagctacgat cttatcggta
    65101 agatctcgga gttcaacctg catacgatca atatgtgaca ttgttatttc cttaataaag
    65161 tgcccggagt agagcctgtt gtttacgttt caatttctgt tcttcagtga gctcttcctc
    65221 agggatttgc tctttaacta cgccaacttt ctttttcgga ccagtgctat cccacagtgg
    65281 tgagttgtac cagtttgcgt tatttccatt agcgccgcca cgaccctctc gagcgtgtga
    65341 tttctcgtgc atcattgcca tgcgtgtttc tcattaattg gtggtcccta ttggattcga
    65401 accaatgacc aacgacttag aacgacgttg ctctgtccag ctgagctaag agaccaattg
    65461 aacgaaaggc ttttaaccag cctgaagact atctcgaact ctgtacagat ttgagcaaaa
    65521 ttcttgctct gttagaacag tttcgttttt cttgtttttg cccattgaat gggtcaatga
    65581 agaattccgg gttgccagaa tagctcgttt gaaaccagaa ttcttcgaaa cttcgtcgta
    65641 agcgcggcta ataagttccg aatacgcgtc actttgtcgg tgcatcggtt tgccacgcca
    65701 atagagagtt tggtctcgcc accagttttt ctttttgcct ttaaacttcg cagctttacc
    65761 gactaaagag caaacatgct cttgcatctc aggcgatttg aatttaagag attgcaaaaa
    65821 tccttcaatc gaggcgcaac gaacaccatc aatatagaat tcatgaggag cgaagttact
    65881 taatgcgcag gatggccaag aggcaccaga accgatgtcc ataacaaata tctcactttt
    65941 aaagggattg tgtgaaagtt cgcgtgatta cgtcccgttg ttgctcagga gttaatgcat
    66001 taaagcgtac ggcataaccg gaaacacgga tggttagttg gggatatttt tctggattaa
    66061 cgattgcatc ttccagggta tttcggtcaa gaacatttac gttgagatgc tgaccacctt
    66121 caacagttgg ctccggctga acgtcaaaga aacgtcctgg gcgtccacga ataaccgaat
    66181 cttcgacgat agtgtcgatt tcataagttt tcgaagcgat caccttggca ttatttgtct
    66241 gatcatctac caggaaaatt gatccatgat cattcgagcc atcaagcaat tggaaaccaa
    66301 ttaacatatt gtcctcactt tgtggtgtaa tctggtggat ttggaccggt ctcgaaccga
    66361 catcatcagg atgcaaagca acctacggtc ttcccattaa acgacaaatc catgatatta
    66421 atttggtggc cctggcagga atcgaacctg ctacgagcgg ttatgagccg cctgcttgaa
    66481 ccgtctagct acagggccta gagacgaaaa agcccataac ggtcgattga caagtcatgg
    66541 gcattgtttt aattaggacg cttgctaggg tctcgaaccc atcacgaata tacgcacgtg
    66601 tagactgcca gacaacaagt acttagtaag ctaattaatg gtactcacgg tgcaccgctt
    66661 tcacatattt cgctattttc ccacgtctaa gcaagcgatt gaaattggat gcgacggatg
    66721 gattcgaacc accgatttcc gggatatgag cccgacgagg acgacctctc ctctacgtcg
    66781 catttgaatc ttgagaattt agagcggagc caccgaggat cgaactcggt gctatcccgt
    66841 gacaggggat tattttaacc gtataaacta tggctccgct ctaaactctg ttttggtatg
    66901 agttaatcat atcatgaatt cagatgtttg aaacaaaatg ctttaaatct tggcggagaa
    66961 ggagagattc gaactctcga aacctttcgg tttacttcct tagcagggaa gcgatttaaa
    67021 ccgctcatcc acttctccta gaatttggta gtggatactg gggtcgaacc agtgcgctct
    67081 cgattatcgg tcgagtgctc tacctactga gctaatccac tattggcatg acatcaagga
    67141 ttcgaaccct ggccgcacgg ttttggagac cggcatgcta ccgctaacac caatgtcata
    67201 taaatcgatc tggacgcacc atttccagac aaaacctcgt cggaggccaa gggccaacaa
    67261 gatatgatac agaccgacgt cctcgtcata tccagatggt cttccctttt actttacgct
    67321 cgggtctttt tcaagaaatc cgaacattaa cgtaatgaca gaataaaacg aataacaatc
    67381 gctaacggcc aaagcaagcc gacgagtaaa gatccaaaaa tattgccaaa aacctctgat
    67441 ggcgtatccg aatatcgctt ataatctcca aggaaagagc aaataaacac gataacggca
    67501 ataacttggt atacaagcaa catgatattt cccttaatta aatttggtgc cgattgtccg
    67561 actcgaacgg accacctgat gcttacaaaa caactgctct accggatgag ctaaatcggc
    67621 attattctaa gattgtcaga ccgtcttcgt cggagtatgc acgcacggca ttttctgaac
    67681 ccgtcaagtg aatgaaacct attggagtgt gtgcattaaa tttagataaa atataaatca
    67741 gatcagcaac cgttataccg aatgggagcg taatttcgcc gcagtcgtgt ttcttccaat
    67801 cgcgttttac ttcagcgatt gagtcagagt caatttccca ttctttttga caaacgacac
    67861 attttccaat ccaaccatct ccggctccac atgggccaaa acagtattcg tgcagaccga
    67921 taaatttatc ttgcccacag catacatcag gacgagtagt tgtaatattt acaattttca
    67981 taatgttttt ctcatggttt tgacaatttt tcagattctc ttagccgttg ctgcagcatg
    68041 gcactgaagt ttttgaggct atcgcctaaa attattttac gtggggataa ctaataacct
    68101 ccacatatta agagaatctg aagaattggg ctccgaagag cctattcttc aattgcgcct
    68161 tcgtgaataa ccgcatcacc agtattgccg ggagaggatg ttactgcatt tgacgacttt
    68221 atggacttgt ttgcaaccaa gtatccactc tatagaattt ggtccgcgtg gaaggattcg
    68281 aacctccgac tttctggtcc caaaccagac gacctacctg actagcctac acgcggaaaa
    68341 tttatacccc gtctatactt tttcgtttca ccgagcatgt cgggagtgac tacagaagtt
    68401 ctggccgagg attttacgag acgtctcccg atttccttgt taatgccgat cgtcataact
    68461 ttcgttaagc gtcggagaca atacgtttgc cctactcgcg ttctccagtc acggcgcaat
    68521 aaaggacaag tgcagcaacc aggggtgcga aactgactag gaatctagag ccctgtgcct
    68581 ttagctcatt tcagaataaa ctttattgat caggtccatg ttggcttttg ccattgcata
    68641 ctctggagta tcacgttcac gttcaaccca ttcacattta tcgtcgcaac accatccgcc
    68701 gaatcgagta cccatagatt tgtagcatgc ggttttgaac gatttaattc gcgatttagt
    68761 gagtgcgcgc aattcatttt catcgaattt ggtgtgaaca atatcggtag atcgcaacat
    68821 aatattttcc tcattttgtg ttggagcggg tagccggtat cgaaccggtc tactcaagct
    68881 tggaaggcta gcatgtatcc gtaaacacct tacccgcaaa ataatcatag gggtgacgga
    68941 cgaggattga actcgcgacg accaggatca caacctgggg ctctaccagc tgagctaccg
    69001 tcacacctat gattactcaa aactaaaact ggtggagatg actagagtcg attctagtaa
    69061 ggcttgtaag gcgggtccat tacgaggacc tgatgctctt tacatcttac atctccaatg
    69121 aatttggtac accgtctgag attcgaactc agaaccaacg gattaaaggt ccgctactct
    69181 gccaattgag ttaacgatgc tcttaaaaac tgtctatctt tatttctttc ggtattaaag
    69241 attcgcaaaa cgtcatcgag ctgagttgaa gtgttatcta cccactcgcc gtttgcacca
    69301 aacataaaat gcagttgttt ttctgtctta aagcggtcat gggtaaagaa gtatgtttga
    69361 attttataat cacgaaatgg cgaataactt tgatatgtag ccaatcggtc gtatactgat
    69421 atggtgctgc caattttaaa atgtccaggc caagccggat tggttaacac atatacataa
    69481 ccttcgcgaa tactagaagc tttacctaat cgattatatt taacatttag taatgatcta
    69541 cgaacgtagt tcaattgcga gcaaacactc ttaatataag atgagttttt gcgtaaaaat
    69601 ggcaacttag ttgtgcgata tatgtgattg aagaaaattc ttttaacgag atcatctgtt
    69661 atttcaaagt cgtaacaagc gcactcaagt tctagataag ttgaatatcg agcaatcaca
    69721 tcattcataa taaatttcca caatttagtg caacggaatt ccaaccagta ttggttatgt
    69781 tacggtaatt ccgatgcgaa atttggtgga acgccttgga ctcgaaccaa gaatgccaga
    69841 ggcgagcggg ttacagccgc ttgggatacc attacccgaa cgttccaata aattggtttt
    69901 ggcggtgatg actggactcg aaccagtata gaggaaattc ctcgcggatt aacagtccgc
    69961 cgctcaacct ctgagccaca tcaccccaaa atcaacttgt tttaatcgat gagataatct
    70021 taaactatct ccagcaattc tgaacatcaa atgcttcaga attaatggtt gctggaagga
    70081 ttcgaacctt cgaggtcttt caacccgtcc cgtttccagg gaccgccttc agccactcgg
    70141 ctcacagcaa cataatttgt catccactcg gttcacccca gaatcccgga gatgctggcg
    70201 catgcgaaca tggatggtgt ttggcggaag ctatccgatt tgaacggatg gaccgtattc
    70261 ctacgatcgc tagttttcaa gactagtgca ataagccaga ctctgccaag cttcctgaat
    70321 tcttttcaaa tctaaacacg tcctacgtca ctaggctgag agttctgtcc gattaaggct
    70381 tgctccagga aaactacagc ttctcactgt ttatcccatt caagactgaa tgcgtgtttt
    70441 gatttgataa gatgataata aactatttct agcaatcctg aacaaatgct tcaggatttt
    70501 gaatttggta ggagaggagg gactcgaacc ctcaatcccg aaggcgggag gttttaagcc
    70561 tcctgtgtat gccgttccac cacactccca caaataactc caggtgctcg ggtctatact
    70621 tccccgttta ccgaagccca gtccatccgc cgtaacttaa tcggttcaat attaaggatg
    70681 taaccgcttc gcttccttac cgcatcgcac cgaccttttg ttatttcgta tatctattta
    70741 taacgatctg gcagatgaat tattgcccta gaaccacaaa cggggcaacc tggctgtctg
    70801 ttcaatagac ctttcacctt ttgccatgaa cactccctga gtgtccaggt tttaccacaa
    70861 ccccagcaaa cgttttcaag gtcatgcagc cgttcagcgt atcgagtaat gtcacgattc
    70921 gtcattgtcg tacagtctca taacaatatc gcatttttca tctggttttt caccgcggca
    70981 tcgcgcaaaa tgaggatact cgaaggtcaa accggttcct ggaatctggc tatcatgacc
    71041 agcatagcat tccataagag tctgttcaag acaacagctc atcatcgaga tgaagaaacc
    71101 tttaagctca ggtggcactt tgatggtgac aatactgtcg tcagcgattt cataaggacc
    71161 ttcgagacca cctgatgttt tgtcgaccag ctgacgaata ctgtttggag catcaaaata
    71221 gtcatttcga tcagatacgt tagttgaagg tctttcagaa taaacccaaa gctcgccgtc
    71281 agcgtcaaca gcgtaattgg taaattcgtc gtcaacttca taagtttttc cggcgtgttc
    71341 aaactttttc atctaaatct cctccgctat caattccaac tgtttttcga gttcgtcttt
    71401 gtcagtgttc cagaccaaat tctcttgacc attgtgtatg tcttgggcgt atggacacag
    71461 atcccaatac acagttgatt tgaatgggat actcaatata tcatcatccc aggagtcaaa
    71521 gcgctcgtct agccactccc gcagtgattc ccatgattta aacgtctttt ctttgccagt
    71581 aggcgaaata gttttcattc gttaccctcg caatcaatgc caatcgactc gctgcgcccg
    71641 taatagcgac catctgacac aaaacctgcc gcaatgcaat gcccgatatc atgacaataa
    71701 tcgaatgcaa tatgaaccat tgcattaaga acatcaacat gattgagctc ttttgagaaa
    71761 atcgcctcga tggtcctcgc attgtcgcgg tcaatcagaa tccgaacaaa tttgaattca
    71821 tggtcaggat cgattgatcg tagtgcaaca acgccacgcg gccggaacca attattgtag
    71881 ctgccagggt aataaatctg agttgcttcc aaaacttcaa cggctaatgt atgctcattg
    71941 actttgtcac tcaacccact gatgttcatg gaaatttgaa agggatagcc tttttcacac
    72001 agatcgtaga tcatataaca atttcctcac aaggtatatt gatgcttagc tgctacttga
    72061 cgggctgcct tttccatact gcggaattgc gcagtgtcat tcttgaaagt gcagtcgata
    72121 acttgatcat ttttgaacat tatccagcac gaaatgccga agcggtaatg accgcgaatc
    72181 atgtcaactt ttgtgatacc attaacttta gcaatatgct gcgggtggta gattttcatt
    72241 taaattactc cttggtagat ttgatgggac catagtaaac catagtccca tcattgtaaa
    72301 catttatttt ttaatttttt cagtcacttt aatgtacgtg aattcacata atttgcaaac
    72361 cagataaatg gctagtggca gccaagcgcc tgcgatcatg ccatacacct gcacggcgca
    72421 caagcttcgg gctggcattt tatagtctgg acgcttctgg cgccattcat cgaagaaggc
    72481 aaagccatgt atgagcacgt ataccataac cgcgattata gaatattgga cgctcaaaat
    72541 aaacagttca aacagcagat tcattaaaag gcctcaacaa aagtcaatgg aagtttggga
    72601 acgacatatt ctgtcgggtt atagtatacc tcgatggtct caacaacgcg gataaagtca
    72661 cttccataac caacagcgta atttgaaata tggtcaatga cattgtctct caaatcgtca
    72721 atatcaaaac cgctatcaaa ctcttcggtt tctttgtcat aaacgtccgc actaaggtcc
    72781 aagaacttct tgaactgcgg ttctaatcca ggattatcaa tgagaatttc aaccaattca
    72841 acggctatgg attcagacca gctgctattc ccgtagtgat ttcccttaga atggcgactc
    72901 tcgaacaatg gttttacaag tgcgaaaaat gtggtgtcgg cttctgaaca accgaagtga
    72961 aaatgtgttt tgtagtcgtc gccatcattt tcccaagttt cgatcgcaat gacgtaacca
    73021 gccggtataa tggttcctgg tgtgaattta aaattttgca tatttcctca cagattaaca
    73081 atatcgatat gttcccaacc gtacaggcct tcgagactgt cggcatcttc atatgtcatt
    73141 ttttgcacat acgtcagcac tacgtcttcg atgtaaccgt tacgctcatt ttcttggaca
    73201 tgctctggaa acgttatcga tacaacttct tcgttattgt ttcctccaaa ctgaccggat
    73261 atatcatatt cacaccaaat tttgatagta gacgatggtc gaaattgcat aacaagttct
    73321 tgttggtctg tcacttttta gctcctatgg tatcaatgta cacgcggtac ggaataaggt
    73381 ggcaacatat aactgtcgtg agaacgacaa taaccttttg cgctggtgtc cacacaaaat
    73441 tccaacgaaa ttgttttgtg taaaatttta acacgttcac cgacagaata aaacatgccg
    73501 agagatacaa acttataacg attattgtaa aagtcataaa aacctccaat tacaaaaatg
    73561 ccctccgaag agggcatttg gaatttactc agcttcaaca aacccgccgt ccagcagttt
    73621 gggttcatga actacgaaag aaacacaatc aaaaggaact tcggctacca ggacgcgctt
    73681 ttcgccttca cctttagtca gttgatagaa accttgggaa gcagccacat taatggaggt
    73741 tacgtctaca tgacgagcag tggtactcag aacttcgccg gtggtcagaa cgatttgctt
    73801 ttgcattttt atttcctttt ggattgattt aagattaacg cattgtttta ggtctagcta
    73861 ctcgtagcca gttggtatga actatattat catgaaccgt ttgacactga acacaatatg
    73921 ctgtagaaat agccattcga cgagcttctg gtatcggttc gtcgcattct tcgcaaaact
    73981 caggagtatc tcctttatac tgcgttgacc ggatgaaatc cagggcattg tcgagcccag
    74041 cgttgatagt catatgtaga ccattttcag gtccaaatcc gacggccata agttgctcct
    74101 tgttgatgct gagagcatac taacatggtt ttcggcaaaa gtaaaacatt ttttgataca
    74161 aaaaaatgcc ctccgtagag ggcatcagtc agcatcaagt gcttccatat actcatgtga
    74221 gctaacgatt ggaaattcgt aagaacccat aaaagatgaa gagcctacat ctttagcgat
    74281 tgtgatatga ggaatgtatt cgtcaaagtc gtaagatgct cctaaaagca taccttgagc
    74341 gaatcgttta ttcatgtggc tggattcgaa agccagaacc aaaacgtttt tggttggagt
    74401 ctcaaatacg cgtaattctg cgctattagc taacagtgtc ggcatatctg atggaataaa
    74461 cggaatctct tcacggctat aaatgatggt tgagtgaagt tcatcgcgag gcactggatt
    74521 aaaaatcggc agcgcctctt gaatcttttg gattgcatcc aacgtttctt cactaaaccg
    74581 gcaggctaca tatgtaccta ccggagtttc cattacttgg tctcttcttt agctggtacc
    74641 agagcttcaa cagcagaaac gatggtagac agttcgatcg attcggcacc ttctgcaggc
    74701 tgaacaccaa cgatttgaac gatcttggtc agagtttcgg agaactcttt agcctgagct
    74761 tgggtattag ccagatgttc gccagcgtca aacagacgga ttttcaggga agcgatcagt
    74821 tgttgagctt gttgcatttc ttgggacatg ggaagttttc ctttatttga tgtagtttat
    74881 gaggttattt acaacttgac ggagatcatc gatacttccg tcattattaa tgacatggtc
    74941 gccgctttga atcggcaaac cctgttcggt tgaatgcata tcaactcgaa tttcttgatt
    75001 atcgcggaga atgtgtacta catgagcacc taaagaccgc atctcttcca tttcatggtc
    75061 ttgacgacag tctgtaacga cgatattttt gtgcgttggg atgaaatcgg tgagatattt
    75121 catccatata cgtttattta ttgcacatcc gatgtcggta ccaaaagttt gcataagacg
    75181 tctgattgac caggcttctt tattaccgag aacaacttca gcgattttgc cggtgtgggc
    75241 ataggtaaaa tcaaaacctt gatcgtcaga aacaagcatc caggcagagc gcataatccg
    75301 gaaaacatcg ctattcgaaa tcggcaaacc agcttcacgg tcatatccaa gaccgttgaa
    75361 gtcgtccata ttgaaatctt ggacaaacat cggcaatttg ctatcttcat gaatcgacag
    75421 atacaagaat cgtttaatgg gttctgccaa agcgtatttg gtaaaaccat ttgagacaag
    75481 aatatcgccg acggtatctt taccgcagcg ctttttcgcg gataatgcaa taatcatttt
    75541 agcctcttat tggacgaacg agctgacctt tacgctcaat ttcaaaatac ttgaaaaaga
    75601 atgtaacggt gaaataagct gaaacatcgc cttcttcagt gtatgaatat tcgatttcgc
    75661 ctatttcaga tggccaagca ccttggtaat tgaatgaagc tactatatca tgttttgagt
    75721 tacttagaac atgaagcgtc accccaggcg gttggcttgt agttccccac atagtcggag
    75781 tttgacgtgc ataatcgttg atagaaagca tccatcgata tatttcgaaa taggcgtcat
    75841 agtcctcatc aagaagaata cgaactatga gtggatcgaa ttcagtcgtt gtactcggaa
    75901 tgttctggcg tgctgttcct tgttcgccca atggtaactc tgttggagga atacgaaacc
    75961 ccggaattga tgcctgttgc acgttcatca atgcgacttt tatgcctgct gatgctggta
    76021 tgtctaacag gaagttagtt atgtttgatt gattgtttaa agccataaaa ccacctttaa
    76081 ttaaaaactt aactggcttc gccagttcga gcttcgctcg aatttatcct ttttatcctt
    76141 taggttatat aatctattag gccttaaagg ataaaaatgc tagtttggca gagccaaacc
    76201 ctggaggtat tgttatacga aaaaggccta gacattgtcc aggccaatac gttaagcttt
    76261 cgcccaaacc ttgcgagcag aatatctctt gcccttggat acgaattgct gcagaggcat
    76321 gtaaatcacg tttacccagt cagacggttt tatttccatc attgagcctt ttatatggcc
    76381 tggcaaatac gcttttatca tgacatccga gccactcatt cctcgtacat tcgaccagtt
    76441 tatcttcaga gtagttttgt ttgaaagtct ttcggtgctt gcgtaatttt taagcaattc
    76501 ctctagaaaa ctctgacgcg ctttaggcgg aatgtagtgc aagttgagac catagagcaa
    76561 tgggcctgag cctgatgatc caatgccaag aaaaacgata agtgggaatt tgtcccaata
    76621 ctcgagggta tccttatgct tagcgtcata tgcgaacgta taaattcttc ctggttttgg
    76681 ttttgcaacc atatgaccac ggatggactt gcggatcgta tcgtcgaacc atttttgcga
    76741 tttgttgtta tttgcggcac ctgaatcggc ggcgcgagct cgcatttggc ttctgaaatc
    76801 gtttatcatt gccaatgctt tttcgcggga gttgagtttg gctttattct ttaaactctc
    76861 gacctcgata gcaagatcga tttgtttcgc gaatttaagc atagttcgcc ggaacgtgtc
    76921 gaaattcaaa ccatttgctt tcgcaaaatc ccgcccagat actcccttcg ctttcgcatt
    76981 tctccattta acccctaaat caacccactg gtttcgagtc tttttaactg gtgcttcatc
    77041 aatatagtcg aatatcatta tcctctccag ccaaagtgag atttgagtgt cacctcggtt
    77101 attattttga aattccaccc tttgctttcg catagcgcct gggcagcttt ccacttatct
    77161 gtgtttactt gccaagtgta catttccgat atgaaattct tttttgcttt agctgtgttg
    77221 gtcgaaggca taacaggcgg ccgacattct ttttcgggtt taacctcgaa taaaaacacg
    77281 tcgccggtca ccattttgac atagaaatcc atgaaatatc gacggcgttt tccatcagca
    77341 tttgagaaat acggaattat cacttcttcc gacgaccaac taatcactga tgctgactga
    77401 tcgcaccatt tcatcagcca agcctcccag ctcgaccgat atgtgatttt gtttgggtca
    77461 ccgttgtact tgcttaaatt ttttggcctg aattttccag aatatgccat tatctacctc
    77521 tatttacgta gtctcttaaa ttgtttgccc atatcgtcca cgttccaaca actttttgag
    77581 aataggtctt ctgcatcgta tgtcgaactg gagggtttac cggaagtcct ggttcaactg
    77641 gaacaacgac atcatatatc atcacaacag aatatgtgaa tgtcttctcc aatgactggg
    77701 gagcttcaaa tgaataaaga tcagctatta acgggcttgg gagttcttcc cattttgatg
    77761 ctgtcaatcg ttcacctgtc ttaagacggt attttagacc gccattgagg gagaatacgc
    77821 ctgtgtattc tcccgagaac gatgaacctg cagcaataat accctcatta ggcgtcacct
    77881 gtgtcacggt tattgaaacc agggacgctc ctgcctcagt taagttggct gtgaaagttt
    77941 ggctaacagg agtattctcc cgggttaccg ggagaattgt tgaagccggg agtatgtctg
    78001 acatgaatta ccccaagttg attctagaac cgttgattga gaatgtacct tgcgcaatat
    78061 cattcacagt tgaagcgctt ctatcccagt ttccgccaac ctgatcattg cgtgtgccac
    78121 ctacttcagt gctgaagtta cctccaactt tgagcacata gttgccatca attgtattga
    78181 agcaatcacc gacaactttg atattagcgt tctggttgac tgtagcggcc atattgccat
    78241 caatctgcga atcaacgtta cccttgacat attgattgac tgaaccggta acatgctgat
    78301 taacattccc ttcaactcgt tcaatagagt ctccacgaat aaattgatta gcgttacctg
    78361 agatagtggt ttcggcatcg ccttggacaa aaacaacagc attgccgtca acgatgaact
    78421 ttaaattgcc acctacatgc acgttttggt tatttttgac aatgtagaag tcatcaccga
    78481 ttattttctg gactttggtt ccatcaggat gaatttcttc aaacgttcca gccttgtggc
    78541 gggtgtggat acgttcgtga cctggggtgt cgtcgaattc ctgtatatgc ccagattcgc
    78601 tctcgaaaac cttattgtat ggatataccg cggaataggc ggatgctggc tctttaaatg
    78661 aaacagtttg cgccgtggca gtttttgcct tccgagtgat tgaccgggtt gctatcaggg
    78721 gcatcgctac ggccctggtg atagaccgta caacagaacc ttgggatccg ccataagcaa
    78781 ctaaattgcc attccgtatg acatcggtta cacgtcgagc tcgattcggc gtttgtcttg
    78841 cccaaagaga atcgagagct tcatctgcgg ccttgtcata ctgccctaac gccaaatatg
    78901 ctagcatctt ttggaagttt gcaacaccac cgatgcccat ttggaaagtc atgttaatga
    78961 ttgccatttt gcgcgtatcg tcaagcatcg aatatactgg accgactgta gcacttcgag
    79021 aaatgtctga ataaacacca ttcaaatcac gtgcaaaaag agttgaacaa tcttcctcag
    79081 ttattcggcc ttgaacctgt cgacctacct gttggcttaa caagctgttg attcgcgaca
    79141 tgtttttggt tttttcgtga atgattagat ggccgatacc aacagtcgga taaccttcgc
    79201 tatcccaata aacaacaact cgaataccct cgtcatatcg aagcatgtcc tcgatggtaa
    79261 cgtccggatt tgggttcggt ttaatttcat cgtttggcgt tctgttcggc tcggctgccc
    79321 aatctcggtt caaatcctgg tcttcgacag tcgctggaac tatttcctca gtttgagcta
    79381 tttggccagg cgcaattttg atttcttttc cgccacgggc caatatgtta acgtcagaac
    79441 caacgtagcg cgggaattgg cgattcgggt ctgtaaagcc tttgttgaag ttgggcattt
    79501 ctggataaat tccaggatat gttcccatta ttaagccaga ttgataaaag tcatcaagat
    79561 aaaagccgta aacatgggta ccttcaacta tcccagtagg cgattgtccg acaccggaaa
    79621 tagaagcaga ggttgttgag gtaccaatag tcatccataa aagatcatcg gtagccatac
    79681 catagttttc agcttttact ttttgctcag ggtgtatacc atgcacacgg actctgactc
    79741 tgcccagcat gaatgggtca aaacgatctt cgactacacc tgtaaagaaa cgatcaacac
    79801 cattaagcat gccgtttaca ccttttccat ttcgcggatc atatcgctca aaaaggcgtt
    79861 tatatccgca gggttgatta tcatgatacg ccgtctgctt tcgtttaagc ttacttgtgc
    79921 ttcgagtgta tctacagctc gaagaggtcc aacatattgg acgtgcatgc gagctttatc
    79981 gcctttgtcg taccagtttt gcgggaaatc tggatcttca acaagattcc agtacttttc
    80041 accatttgcg tcaatatggt atgctatttg gtttactgga tattgctgtt ccgcgtattg
    80101 atatgccgca tcctgacttg ttaaccagtc gtaaaatggg tcataggtgt tattgagcat
    80161 aagaagaacc caataaagtt gttggttacc atacaactca tgagctaccg cttccggcct
    80221 tggcgacccg ctcagccaat aaacttccgg tttgtatttg actacaacac ggttgaaata
    80281 tgcccgatag tttttgaata tatcggttgt ttcttttcct tggtaggaaa ttggatcaaa
    80341 aaatgaaaat atcatagcgc actcctttta gattatttaa acgtcgccgg atgatcactt
    80401 aaatataata acaaggaggg ccatatgcct ggactaacct atgatatggc ctggacgacc
    80461 ggccatgata catacccgcc tacgagaatt cgagctaccc aaggcaaagt ttttgtcgac
    80521 ggtatacgcg tagtagttgc tggagacacc attgttccgc acactaatac cgttgagccc
    80581 tatgacaccc acagcggcta tgttataccc acaacaagca aaatatatgt tggcggtaaa
    80641 cctgcagcat caatcggaga ccctacatcc gatggagaca caattgccca atcatcaagt
    80701 aaggtattca ttaaatgaaa ttgaaaacta atataccgga cattttcaac ggggctacat
    80761 ttgatgagat taaacgcgac ctcatcaact ggcttcgaaa ccaagacgaa ttcaaggatt
    80821 atgatttcca aggctctcgt cttaacgtat tgaccgattt gcttgcttat accacactgt
    80881 atattcagca attttcaaac gcggcattat ttgaaagctt catacgaact gctgttcttc
    80941 gtagttcagt tgttcagcat gcccaagaca tgggttatat gccggattcc aagactggtt
    81001 cgtcaaccac tctgttgctc aaagcaacta acccattgaa ccctacgagc attcgtatcc
    81061 cgcgtggaac aaaattcgtt ggcactgttg aacggacaga taacttcccg tttgtgacac
    81121 ttgacgacgt tgttataatc cgcggccaaa acaacacata tgagtcattg gttaacgttt
    81181 atcaagggcg tattgttcga acagagacaa catttgacgg aacatcgcag attcttttgc
    81241 gcgacccgaa tatcgatcgg tctcaggtac gtgtgtgggt tgacggttct ccgtgggcgg
    81301 actggacaaa taattcaata gttgacatca ctggttcatc gaatattttc tatatgcgtg
    81361 aaacaatcga tggaactacc gaaatattct ttggtgaagg tgaaacatca gtgcaaattg
    81421 ccggcggtgc tcttgaggca aattatatcg gaggccttaa gccgaatatc ggtgcccgcg
    81481 ttgtcgtcga gtatttgagc acccagggtg aagctgcaaa cggttccaaa gatttcgcat
    81541 atactgatac tcttcagaat atcatcatca ctgatctggt tgagaacccg acagatgacc
    81601 gtgattacgt cggcacacag ggcggcggta atgttgaaga cattgagcgc atccgtgaat
    81661 tggcacctgt tatgagggaa acacaacggc gttgtgtaac tgcttccgat tatgagacat
    81721 tcgtctcgtc gaagtttggt tccgttgtac aggccgttca gtgcttcaca gacaaagaaa
    81781 agcgtggcta tgctttcatc gcaattaaac caaaacaggg tcttcgtttg acaactgtgc
    81841 aaaaagaaga catcgaaaat tatctggcac aatacaacat ggcgacgata acacctgctg
    81901 ttattgatcc aaactacatg tacgttaaat cgaaaatcaa agtaacgtac aacctctcag
    81961 aactgtataa ctctgaagag tggctccgcg gtcaaataat tgggtcgatc gatcgttact
    82021 acattgatga agtcgaagta ttcaacaaaa acttctcatc gtctaaaatg ttgactcgtg
    82081 tggatgcgac agacgattca ataattggtt cttctgccga catctcgctt gtgcgagaag
    82141 ttgataactt cttcaaaaca cctatggctg gtatatcatt ccagaacggc atgaagaaag
    82201 gttcaatcaa tagctcgccg ataaacttca caaaagattc atcatcttac gaagtttcgt
    82261 atgtttcgac aacgcaaagc ggcaaagttc ttatcggtcc atttaaaaca ggagatattg
    82321 cgcttgctga atattccgga actgatttca acaaggttac catcgaagga cgagacaaat
    82381 actacgacgt gggcagtgtt gattatgttc taaacactat aagctttgat cttggtgttt
    82441 taccggtgcc atcgaccgca tttacaggag catatataga aatagaagct ctcccaacgg
    82501 aagatactat ttttgcgcga gatggttcgc ttattgtgtt tgaaaatgac ctcagaccac
    82561 aatacactga aatcattctc gaagctattg ctcaataact aagggccttc gggccctttt
    82621 ggagatttta tggttattaa agcaccatct gttacaagtt tgaagatcaa aatattatct
    82681 gctaaccaag tgtatatcac ctgggatgac gtgggttcaa atttttatta cattgtagag
    82741 ctggcaagaa cacgcgattc cagtgttatc aactggacaa cactcggcat aactccgaac
    82801 gaagagtggt tcgaagataa agtaattcaa tcagacactc actacaaaat gcgcgttcgc
    82861 gtatcaggca aaggttttga aatgtctgac tgggttgaaa ccgaagagtt tcagaccttt
    82921 aacacaaacg catactacgt ttcttcaatg cgcgaattta caccagccgc aacattcatt
    82981 aatgaaaaat tcacaaaaaa caacaaatca tacgtagact tcaacgatga cgttataatg
    83041 gcatctctga tgggtgaaga ctttgttttc agcccacaat tcagcaatgc gacaaatata
    83101 gcggacaaaa tcgtcaccga cgaaaactat cacgaaatac agggttacat tgaaggtgtt
    83161 tgtgcagaca tcgatagaac aatgcttgct gaaatagacg atgtacttta tctgtttgag
    83221 cgtttccaac ctatggcgaa agtatcaaac gataaaggcc agaactggaa atattacaaa
    83281 gcgtttaacg gccgtatagg caatccaatt accagaacag taacttatca aaccagcaca
    83341 acaacttatg ttcttgggta tgagaacatt tattacggcc ggcgcgcgaa cgatgtccgg
    83401 tggtcagctg atgacgttcg tttcagttca gacaccgtaa cgtttgcaaa aacaggtgat
    83461 gaactcaatc tcggatttga cgttgaactt ttcaactcat atgctcgtct gcctggcgat
    83521 atgtaccgta aagctgaagc catcgcggct gacgacgact ggatatatgt tgctgctcgt
    83581 aacaatatgc gtcgtatccg aacttcaaac gcgccgattg aaaccgaccc aggtagtcca
    83641 aactttggtg aaaaactgtt tgacccagtc gcttatatgg taacaaatga cccgagcgct
    83701 attgtcaaga aaatggacac tttcaatggc aaattgtacg ctcttgtgac cggcaaagtc
    83761 aaatcacaat ggcttgaccc aacagtccca gcaaatatag tatcaactga tgccatcggt
    83821 gtttatatgt ttgacggagc tacatggact cgcgtttttg gcaatactgc cgatgaacgt
    83881 cgttggtttt cacatgaata taccaatatg tcaaccaatg gcgatgagct gttcatatcc
    83941 caggtcaatt ttaagtttcc gggaacactc ccagatctgg agcttccaga gaaaaatagc
    84001 caagttatcg aagctgtcaa atatcaattg cttcccggtt acaactcgga tataaccatc
    84061 catatgggta ctttccgcat aaaccaggat gatgacgttt ggaaattagg acctcagcag
    84121 tactataatg aagctgctta cacctggatg gctcgttctg gtactcgctg ttggataacg
    84181 aatgacaacc gtgcgcttgt tgtttatcca aaaatcgttt actcgaagtc tatcgatgac
    84241 gccggatttg ccgatgactc tagggtgaac aaggaaacac acaacaaagg aactataacg
    84301 ctctacgcaa acaacgtcag gttcaacggg tttaaacgat acgctaatgg tattttgttc
    84361 cacaaaaata caggtgagat tatcggatac tatgagtttc cttatcgcgt tcgcgatgaa
    84421 gcatatgttt tctggaaacc aaactttgtc atgctcgttg ctgaattgcg aaaccaggag
    84481 cgcgaaactc catggacgcc tgcgccaaat tatgggctca aagacccaga tctacgcccg
    84541 ctcgtaacca agatgatgcc tgaaagttat ctggacgaag atagtaattt tggtgctttt
    84601 gctaaatatt atctccagta cctttctgat ggcaatggca cttactacaa taagctgctc
    84661 aacctcatca aaaacaaata ccctcgcgag caatatgcgt acgagtatct ttggtcagaa
    84721 gttctgaagc gcaacatcta tctggatgaa gccaaacgcg attcagttgc tcgattcttc
    84781 gaagctagat cgtttgattt ctattcgacg aaaggtgttg agcaatcgta taaattcttg
    84841 tttaagcttc tgtacaatga agatgttgaa attgacattg aatcgaagca tggtatcgaa
    84901 tatgacatcg tcgtctattc aaccaacata agtcaggaca ttgtgggccg gacgatttat
    84961 actccaacag gtcgtgcaaa cgtaacgtat atcgaacgcg aatataatga aggaaaattg
    85021 cgctggcgga tcaccataca taatatgata ggtaaattct ttgagggaca ggaaataaaa
    85081 tctgaaacca ctggatttaa gggcgacgtt atcgttggtg ttcgtggtaa agaacttcta
    85141 agtgactcga tcgactatat caatcgcggg cgctcatatt atacgatgac aatcaaatcc
    85201 gttctacctg catccagata ttcgcaggac gttttgagat ttgttcatcc agtaggtttt
    85261 ggctttgtcg gcataacatt gcttacgatg ttcataaact ccggtctatc gatgaaacac
    85321 gtcgaaacca tcattgataa cctcaaaacg tatcgatggg atgccggata tccacttgag
    85381 caatatgacc gagtggccaa attggacgtt gacggtaata tcgaaacaga tccggttacc
    85441 ggtgaagcag tttatttggt tggtcctaac gcaggtcagc catttgatgt tccaccagaa
    85501 tatgacactg aagaatcaag ctggcatggt aaactaccat cagagcgtcg gttcaaaatg
    85561 agtccgctgt tcgaccaatc ggctgtgact ttctcaaact tccgtcgact tgttgaacaa
    85621 cgcttgaagg atgacgctgg aaacccacgt gaccctaaag tcccaacaca ggtaaaaatt
    85681 gatgagtaac ttctaccgag caattgtaac cagcaagttt cgaacaaaaa acttgctaaa
    85741 cttctatgac atggtgggcg acgagcccac caaaaacacc atttatgcct catttggtcg
    85801 cgacacccca tggtcatcta acgaaaccga cccaggattc gctcctccat atccaaacga
    85861 ctctattgat ggaattgtcg atatgtggac gaacatgcta ggtatggtca aaattgataa
    85921 atccctgctt gacgctatta taccgcgcaa agactggggt gatattcgat atgacaaccc
    85981 aaaaacattt ttcatcgacg atattgttgt tgttaactcc gcagtgtata accgcacaga
    86041 cagttcaact gggtggatga tttatcgttg tgttgatgta cctaatatcg ggtcgtgctc
    86101 gattgacggt attgacgaca agattgaatg tatcactatt ggcggcaagt ggactgcgac
    86161 ccatgaatct gttgagccgc cgcgcggaac agcaatggct atcgacatgg gtgatggata
    86221 catatgggaa tatttgtaca cgattccacc tgatgtttcg attaaccgat gcacaaacga
    86281 gcatattgtt gtcccgttcc cggatgaatt ggtcgctgat ccagcgcgat ggggttatga
    86341 aaacaccatt ctttggtacc cggacgacat agatctggtg tatcgcgtca aagttgatac
    86401 tcttcgattt agagcgtata tggattcgat atacttcccg gaagcctcgc ttcctggtaa
    86461 taccggattc cgccaaatga gtgttatttt aaacccatta gtaaagaaaa accaacctgc
    86521 agacactgac gtcaaagcta ctgaggtcgc atataaaccc gaacaattag aaaaagattc
    86581 tggcgaaatg gtttatatgg aaaacaggca accaataacc cgcgctttgg atcaaaccga
    86641 agaaatcaac atcatattct cattttaagg atcaaacatg ctacaggata ccaaaaaacg
    86701 cgttgacgtc ggtgtcatag gtaacccttc gaccggcgat atcttatacg acggcggcgt
    86761 taaactaaat acagttatcg atgctcttta taacacattt ggggactatc gcctctattc
    86821 atcggcatct gaaggtgccg attctcaaat actgcatgcc accggttttt atcaaaaact
    86881 gtctcgccag tattatgccg gtaacccggt agatattggt tcgatgcatg atgccgatac
    86941 aacttccggt gcactgacca tgactctgcc caacgccaaa ttaggagaag gttgcatatt
    87001 cataaatagt aatgggtcca tctcaccagc aaatccgctg attatacggc ctcagagtgg
    87061 tgaaacaata cttggaactt ccggcaactt gacaatcact tccccatatt ctcgaattgt
    87121 tgtatggtgc acgaaggctg acggaaacca aaagtattgg gaatatggaa ttactccctt
    87181 gtttggtgat tcaatgatgc cagttgaaaa aactattctg gctaccgcaa caccgacaaa
    87241 cataagaatc gcaggtaaaa acgaatatgt tgcaataaaa ttattgattg cagctaaaaa
    87301 caatgccggc acggctttta aaacagctga aacgttcatc gcaatagaca caataacaaa
    87361 cgaagtaata aacacagaat atgctgtatt gaaaaatacg gactcagaac tttacgatat
    87421 tcgttttttt attggcgccg gcgataacgt ttatgctgag gtcaagtcct taaacgggca
    87481 acttcgtttt tccattaaag ctattgatac cgtaaagatt ggggcaacat cataatggaa
    87541 ctaatcaaaa ttggacaagt tgttgatgac ggccaaggcg attatttgcg ccgcggcggt
    87601 caaaaggtta atgacaactt tacagagtta ttcacgcagt taggtgacgg tgatcgccca
    87661 tttgcagcag gagcatggaa aaatcacacg gtcggtgtat tgactccaaa gtttggcgaa
    87721 tcatgggcga tcaatacatc gtccggcgct atttccgtaa atctgccgaa aggatcagta
    87781 acagattaca acaaagcaat taaactgcgc gatgtttggt ccacgtgggc taaccaaaac
    87841 gtaacattat acgctgctac tggcgacact cttaaaggtt ccccgcttcc tcgtcgttta
    87901 gacaaaaact taatggacgt tgagctagtt tattgcgcac ctggaagatg ggaatacgtt
    87961 gaaaataagc gtgttgaccg aatcacaaca tctgacctca gcacggtagc caaacgtgaa
    88021 atattggtcg aaactgatgg tcaaactgat tttccagatg tttttggctc atctaattac
    88081 aacatcggaa acatcgaagt ttatctccgt ggtaaccttc tgtattacgg aagcgagttg
    88141 tcttcaaact caaactacgg ttctatcgac ccagcgagcc cgaccggcat tattccttta
    88201 gatgggcgaa gtattcgcat acgtggtatc gaaatacttg ccggcgatac catcacattc
    88261 gtgacatata tggacggtat cgcgtcatac cgtagctcgt acaatacgcg aagcgttcag
    88321 gtattttcaa cgactgatag tgctaaaaca tcggttgcgg gtgagatttg ggttggtgat
    88381 attgcaacaa agaatagttt tagtatcgaa gaaatcggta ttgaaatgaa caaccgtata
    88441 aacccaaact cgctcgaagt cctcattaat ggcatattga tgtctcgcgc aggcgatggt
    88501 gatttgccta tgtttgtttg tgaaggcgcg gacggtgaaa atcaaacaga ttgccaggca
    88561 aatggcggaa actgggtgcc gtcagcgatt gactacgcta tggttcttga cgatagtgga
    88621 aacgtttcgc aaatcaactt tggaaatcct ttcgaatcag gggatatggt aacattccgt
    88681 tggtttaaca atgatatcgg aacattgctt gattgggacg ggattaacgg aataaaggaa
    88741 aaagctgacc aggtttatct gaatgctgag cagcaagtca ctatccagaa cggcattgag
    88801 tacactgact ttgataatcc aagccagaaa actgctgagg tagttccagg ggttttcact
    88861 gggcgactgg atacaatcca gatgttcttt gactctatat acccaatagg aactatttac
    88921 gagaatgcca acaaccctgc caaccctcgg gactacatgg gtttaggcgt atggaaaaga
    88981 tacgctgaag gcaaaattgt agccggctgg acgtcaaacc aagctgatat tgaattcagc
    89041 atgaacaata acgatctgga tagcggcggt aacccgagtc atacggctgg cggaacatac
    89101 ggcgcaaaat ctgttgaact ggctccattg aatatccctg agatatcatc aaccgacaaa
    89161 gttcttgtta gccacccaga tggaaacata atcatcggcg gatgtttgat tgacccggac
    89221 gcgagcggcc ctggatacac aaaatatata gaatctgttt tagcagttaa taaaggcaac
    89281 ttgtcacctg ctaacataag cattcttcca ccgatcatca ccgcatataa atgggtaagg
    89341 gtaggataat gataacaaaa gcacgcggag gtgcgatgaa cacctcccgt cacgctactc
    89401 acattgagta tctgacaaaa ccaggaacag atgttatggg agcccgcaat atcggcgggc
    89461 ctaccgtcga ttctttgatc gcaggtgttg attatcacaa cgttcaatcg gcaattgatg
    89521 aactccaaac actcgcaagt ttcccaatca atggcctcta catctccgat gtcaaggcca
    89581 gccctgaagg cgttcggcaa gccgagttgc ttactttttc cggggtcgtt accgattccg
    89641 aggaagggaa atccataatc cacgtatatg gaataccgtt tactgtagac gctggaacaa
    89701 acgcagacgt tatttgtaac caagtgttag caaaatttga agatatgcgc gataacggaa
    89761 ttctattctt cagcgttaat cgtcaaagcg gtacaaccac gccagtattg gaagttcaat
    89821 tcctcgattc tgctacccat gtaaacatcg agaatttcgt cagtaatggt atcaccgttg
    89881 ctcgagaagt ttctgttcca ggcgttccag gttttggtac atgggactat cttggcgaag
    89941 aaaccaaaac actgactggc ggtactttag ccgaccccgt ccggttgtat tactttaaga
    90001 ggattggcta atggtcgcaa ataacatcaa aaaccacatc tccgattcag ccgaatcggt
    90061 taactacact ggtgataact ggccggcgat tgtgactacg gtcgccgatg ctctagatcg
    90121 agtagctccg tgggctatta tcgataacgg gctgcctttg gctactaccc agattgctgg
    90181 tattatccga atcgctacta ctgctgaaat gcaggcagga acaagtgcca acacagcgat
    90241 cacacctgct ttgttgaagt tggcgatgga aaccccgcaa gcttccgaga ccattgtcgg
    90301 gaatacgcga tacgcaacaa acgctgaagc tttagctctc acgttaaata cagcagcgat
    90361 cacaccagca aatcttgggt atgttttcgc gaataaggct gcaactgaat cagctcgcgg
    90421 cacaatgcgt atttcgaccc aggcgcaagc aacctctggg actgatgatg cgacaaccat
    90481 gacgccactt aaaactaagt tggctatcca ggctctaagt caggcatggg gaactgcaac
    90541 tgaatcagct cgcggtgttg ttcagatggc taccgtagcg caagcattgc aaggaacatt
    90601 gcgtgacggt tttgcgataa gcccatacac tctgtcaaaa atggctggaa ctgaatctgc
    90661 tgctgggatg tttaaaattg catctaattc gcaaattctt gccctcgctg ataacaccgt
    90721 tgtcgtaaca ccagctaaat tagatatttt gaaagcaact gcatcgcaat tgggtcttgt
    90781 caaactatca ggcgtatcaa ctgctgctgc taatactgcc ttggccgcat ctgcgccagt
    90841 actttacact tcaggcggta taatcactgg tgatgttact ttcactggca acatgcaagg
    90901 aattcaatgg tcgcgaaata cggatatggc gcatatcgtt ttcaaaaatg attccaacgc
    90961 cgattctaac tcgtttatgc aattctgcgt tggtgatgac aacaacgaat atttcagatg
    91021 ggtaaaccgt tttagcggat ctgacaatat tatggcgacg cttcgtccag gtggtcatat
    91081 gtggctggct ggtaatatcg atgtcaacga tttctatatt cgttctgatc gccgtcttaa
    91141 gcatggtttc aaacctattg aaaatgcgct tgataagatc gacctcttga acccgggcac
    91201 ttatcacaaa caatattcat tgaccgacga ccgaattgtc ggcttggaag ctggtatttt
    91261 cgcacaagat ttccagaagg ctatgcctga aggcgtaaga tcattggagg atggaacgtt
    91321 gacagtttct cctatgggtg cgatagcatt tttaatacaa tgcaacaaag aacttaaagc
    91381 acgtctcgaa aaattagagg gtataaaatg attgaacatc taacaaaggg ttcattgcca
    91441 tacgttgatg gagccccgga agtcgggcaa gcacgtattg actggattaa gaacggagag
    91501 cgcctgtgcg gcgcctctac aaaaacatca aatgatggaa cttataatcg gccgacccta
    91561 aacgttcaga aaaacgtcga ggctgcagat ggcgaacaag tcaaaacagt tgaaaaggta
    91621 aacgaaatcg ttgacaccgt taacataatc gttgagaacc ttggaaatat cggaaatact
    91681 gatcttatcg aacaggtaaa cgaaaatacc gctgatatcg ttgtacttaa acagcatgtt
    91741 gtcgatgcga ctgcacaaga tgcaatattc acaaacgaca tcgcggaaat aaacttgtca
    91801 gttggccaac gtttacccgc ggataataca actcgcgacg tctacaacga tttgttctgg
    91861 atcaaaacag aactcggtgc ttataatggt tttgatataa atggcggatc ggctatcggt
    91921 tctatcggtt caggattaaa gtatcgtttc ggcgaattaa acactttagt cggtaacaac
    91981 tcccgccgga taacaacact tgaagacaac tggaatgctt cggatgtcgg tcaactaact
    92041 tcggatttag aagatatgcg ccttgaaata gggcggtcgc agttggcaac cggaatcccg
    92101 atttatacgc gcttgagaat ccttgaagat ggcgccggtg gcgaacaaga cgatgttgaa
    92161 gctataaagt tgaaaatcga ttttagcaac gaaacaacta tagctgcacg aacaactttg
    92221 cttgaaagca cgacaagttc tctggcaaac acgattaacc ggccagatac cggattactt
    92281 cctcggttaa ctgtcgttga gaaccaaata gggtcaacaa gcgaaccata tacgatgatg
    92341 tacgacatta accagaatgc gatggctatt gtcaacataa atcaaatact tggatctaat
    92401 ggctcttcag gaatacaagg cgagatcgcg cttataaacg cggcaattgg accaaacaat
    92461 gagtctggat caatcaatgg ccgaatatca gttcttcagc aagaagtcag tcaaatcacg
    92521 ttaactcttg cagatatcga cggcaaaata ggtgatgaaa atagtggcct tgttggtgca
    92581 aacatcataa tgtcgactga cctgtatggc gatgcttctt ctattgatcc attcactaac
    92641 gcaggaatca aaaagacaac taaagatctg tttgacactg tcccaggtaa attggatcga
    92701 ccggctgaaa caggtagatg gtatttcgaa aatggcgcat ggaaaaaagc gtcaagcata
    92761 atggttgctg tagaaaaatc cgcgtttgat gttgacgcta ctgaagccga agttgatatc
    92821 ccatttatag actttgagca aactatcgcc aatggttgtg ttttcaacaa cggtgttatt
    92881 actttttccg ataatggtct cgttgaagct aaaatcgatg tcgaagttga aggcgttgga
    92941 gaaacagaca actatgaagt cgcgatcagc cacgatgtcg gtggtgttgt aactcgaata
    93001 gttttgcaag aatttgccca tcgtccgatt ggtaaacgct tatacacccg cgattggttg
    93061 tatacaattt caagtggcga caaggtttca gtgactatca aagctcttga ttctagttct
    93121 gttaaaactg ttaacataac tgatatgtct atcatgattg ttccggtata aaaacaaggc
    93181 tcccgaagga gcctttttcg tatttcaata accattttta tcctttaagg cctaatagat
    93241 tatataacct aaaggataaa aggataaatt cgagcttcgc tcgaacggct tcgccggcta
    93301 attttgtaaa taaaaataaa ggagtgcaac aatgtcttat acatgcaaca acccgcttga
    93361 acttaaagat gctattctta gacgtttagg cgcccctata gttcacgttg aagtaacaga
    93421 agaacaggtg ttcgactgca tctcacgcgc tttagaacta tatggagaat atcattatga
    93481 cggattccat cgaacttatg ctactgtcgt tttgactgag caacaagcga aaacaggtat
    93541 cattgatatg aaaggcggta acgtatttgc cgtcactcag gtattgcgta ccaatgttgg
    93601 ttcaataatt actatggatg gaaccgccgt gtacccgtgg ttcaccgatt ttgttatggg
    93661 catgactggt gcttctattg gcggccagtg taaatggtac ggcccaaacg cttttggcgg
    93721 agacctcggt tatttcactc aattgatgag ttaccggtca atgatgggcg atttgctttc
    93781 accgctacct gatttttatt acaacagctc aagcgaaatg atgaaaattg cagggcaatt
    93841 caaagctggt gatttaatcg tctttgaagt ttattgcaaa tcatatgcaa acgttgacac
    93901 gatgttggcc ggtacttcag ccggatatgg ctttgctatg tcatgcgacg gagacgagcc
    93961 ttcccaaagt caactttacg gcaacccgaa ccttgctggt ggtgcgatat atgctggagg
    94021 ttcaaatggc atgctaaaag acggagcata caataaccgt tgggttaagg atatgtcaac
    94081 tgcatatgtt aaagagctga atgggcaagt tcttgccaaa caccaaggga tgcaactccc
    94141 aggcggaata actatcgacg gcgtccggct tatcgaagaa gcgcgtattg atattgacaa
    94201 acttcgcaat gagctcgagc tcctcgacgc tccacctccg atcatcatgg gataatgcaa
    94261 tatgatggat aaatctcttt tcgccaccct ggaaaaccgg ggtggttata tgcgaacaaa
    94321 tgagaaaaat attcttaatc cgtacgttaa attcaacaag cacgagggaa ctcaagccct
    94381 gcaagacact ttagttgctg aatcaataca aatgcgagga atagagtttt attacctcga
    94441 acgcgagttt accgatttag atcttttatt tggcgaagac gtcaatagcc gttttgaaaa
    94501 ggcttggaaa tttgctgcat ggttaaacag ttttgaatca tatgaaggtc agcaaagctt
    94561 tttcagcaaa tttggtcata cacaaaacga tgagattcga atatcgataa atccagggtt
    94621 gttcaagtac caagtaaatg gcaaagaacc tgcacttggc gatttgattt acatgccgat
    94681 ggacaatagt ctttttgaaa taacgtgggt agaaccatat agtccattct accagaatgg
    94741 aaaaaaccca atacgcgtta ttgttgctca gaaattcatc tattcaggtg aaaagataac
    94801 tccggttgtt caagaaaaac cagaaattga agacatgtac aacggcttag accttgctcc
    94861 gctgctcaat ttagacggaa tgattgacca gaagattgat caatttgcgg aaaatatcgc
    94921 tgttcagcaa aaagttaaac aatacgcgga accgtttgat ccaataagca caaactcatt
    94981 cgggaacttt gatagcccgt tcggtaaaca tgaggcataa taatgtttgg aaatcatttt
    95041 tacaataatt cgattcgtcg gtacattatg ttgcttatgg aactgtttgg ccacatacaa
    95101 gtggcccgac agcgcgatgg caaaccatat tttcaggatg ttccgataac atatgcaagc
    95161 aaagaaaaat tcataatggc gctcggtgat gtcacgatgc caacatccga agcacaaatt
    95221 gccaaagttg aatcaatttt gcctcgtatg aacctacacc ttattgacgc acagtataac
    95281 gcccaagtta aaactggtgc tgctcagaaa cgttgggtaa ataaatcaga tggcaaaggt
    95341 ttggcccaat tcaacccagt gccatatacg tttatgtttg agcttggtat tcatacccgg
    95401 catgaagatg atttgtttca aatcatcgaa caaattcttc catattttca gccgcacttc
    95461 ccatgcacga taactgaatt gtacgacaac gaaatcatca taaaaggtcg cgatattaac
    95521 atcgtcattg tgtctaacac acctgacgag caaattgaag ggcctggcga gcaaagacgc
    95581 cgcttggaat ggtctatgat gcttagcttt actggctggt tgtatccaaa caccaaaaat
    95641 attgctggtg agattcgcac aatttatatc gacttcttcg gaaatgagcg tgaaattaat
    95701 aaagaaaccc actttgaatc cgtagaccac caagttgtgc cgaaaaatgt gccaaaacaa
    95761 gaatggactg gtgagtcgat tgaagtgtgg agcgacaata catcgcaggg tgagccgcct
    95821 cgcccttcat caggagaata atttatgaac gatgtcctgg acttcaccca gttgaaagat
    95881 cttaacggca ttgaaggtat acatggcgaa gacgttcaag tgtatgcacc attggtttta
    95941 cgtgatccgg tgtcaaatcc taacaaccgt aagattgacc aagacgacga ctatgaatta
    96001 gttcgtcgga atatgcacta tcaatctcaa atgcttttgg atatggcaaa aatcgcgtta
    96061 gaaaatgcga agaatgctga tagcccaagg catgttgaag tctttgccca attgatgggt
    96121 caaatgacca cgacaaataa agaaatgctg aagatgcata aagaaatgaa agatttggct
    96181 ggcgctgcta cagtggctat tgacggccag gtccaaaaag atgcagatgg cgaattcatt
    96241 gaatttgaag gctcgcctga cgaactgctt gacctagaat tagccgacga agatattgga
    96301 gacgactgat ggctgcagtt tatacagatg atcaccctct cgggatgcca cacccgagca
    96361 cattaaagcg tgagatgaga gaggacggcg aatgggtcct ctcaaaccac gatgacaaat
    96421 ggtatccgtc aacatttgac cgttacatga agttgcaggg agttaagcgg gtaaagattc
    96481 aatctgatga cccgtcaatg ttccggacat tcaaagacaa aacaaataaa cgaacccgat
    96541 atctgggatt accaaaccta aaacgtgcta acataaaaat caaatggacc aaagagatgt
    96601 tggccgagcg caagcgttgt aaagaagaca ttgtctactt tgcagaaaac tattgctgca
    96661 tcgagcacat cgactatggt attattcgag tccagcttcg cgactatcaa aaagatatgc
    96721 tgcggataat ggccggtaac agacttatgg cggccaacct ttcgcgccag ctcggtaaaa
    96781 caactgtggt tgctatattc ttggcccact ttgtttgctt taactcagct aaaaacgtag
    96841 gtattcttgc gcataaagca tctatgtcag ctgaagtgtt gcatcgtaca aaacaagcac
    96901 tggaattgct acctgacttc cttcaacctg gtattgtcga gtggaacaag ggttcgataa
    96961 ctcttggtaa cggttgcgcg attggcgcat tctcatcctc gcctgacgct gttcgaggaa
    97021 actctttcgc cctgatttat gtcgatgaag tcgcgtttat tccaaacttt accgatgcct
    97081 ggatggcgat acaaccagta atctcgtcag gacgccggtc aaaaatattg atgaccacaa
    97141 cacctaatgg tttgaatcac tggtacgata tttggaccgc agcaattaca ccaaactcaa
    97201 gcggggatgg cagtaaatct ggatttgtcc catacactgc gacatggtca tctgtaaaag
    97261 aacgactgta ttcggatggt aaagagttga gcgggagcga ttcttatttt gacgacgggt
    97321 attcatggtc atctaaaaca atcgccggtt cagcgctaga tgcattccag caagaacata
    97381 acacagcttt ccaaggaact tctggaactc tgattaatgg tactaaatta tcaaaactga
    97441 actggattga tatcccgcct caggataatt tcactatgtt cgaagagcca aaggaaggtc
    97501 gtaagtacat tgctactctt gactctgctg aaggtcgcgg tcaagactat catgcaatgc
    97561 acatattcga tatcacggaa ttcccataca aacaggtcgc ggtctaccac agcaacacca
    97621 cgtcgcacct gattttgccg gatgtactcc ttaaatactt gaatatgtac ttccaaccgt
    97681 atatctacat tgagctgaac tcaacaggcg tatccatagc caaatcactt tattccgaac
    97741 ttgactatga gaacgttatt tgtgattcat atcaagacct tggtctaaag cagacaaaac
    97801 gatctaaagc tataggttgt tcaactctaa aagacttgat cgagaaagat aaattgattc
    97861 tcaatcacaa gaagtctata atggaattac ggacattctc tgaaaaaggt gtatcatggg
    97921 cagccgaaga aggtttccat gatgacctcg ttatgtctct cgttattttt gcgtggctca
    97981 caacccagga acgtttttct gattttaccg aaaatgatga catgaggctt gctaatgaag
    98041 tattccgtaa agaaatggaa gaactgaatg acgactatat gccaatggta attgtggacg
    98101 acggagaaga tactttcgaa gttacccaca aaggaatgtc gttcgtataa atagctttat
    98161 aaagcgtaat aaatacactt gtgttaaact aacccaaagg aacaaaaaca tggcacttct
    98221 gagccctggc attgagatga aggaaacttc aatcaactca actgtcgttc ggtcagccac
    98281 tggccgtgcc gctattgtcg gcaaattcgc atggggtcct gcctatgagg ttcgtcaagt
    98341 aactaatgaa gttgaactgg ttgatatgtt cggtagcccg gataatgtca cagcacctta
    98401 tttcatgagc gctatgaact tcttgcaata tggcaatgat ctccgtttag ttcgtgtcat
    98461 tgacatggaa aaagcaaaaa acgcctcacc actggtcaac caggtatctg ttacgatcac
    98521 caccgaaggt caaggttata ctgtcggcga cgctatcacc gtcaagtaca ataacgcgac
    98581 gatcaccgaa gctggtaaag taacagctgt tgacagcgat ggcaaaatca aatcactgtt
    98641 tgttccaact gctgagatta tcgcaaagac tcgtcaactt ggcacatacc caactctcgg
    98701 cgacaactgg cgtattgatg tttctggtgc ttccggtggt tctgccgctg cattagccct
    98761 tggaaatatt gttgttgact ccggcgttac cttcggtaat tctgaagatg ccccggctgt
    98821 gatgacctct cctgctgtta tggagaaata cgctaaattc ggtatgcctc tggtatccgc
    98881 tgtttatcct ggtgaaatcg gttcaactgt tgaagttgaa attgtgtcaa aaaccgcatt
    98941 caatagcggc gctcagcaga cgatttaccc gttcggtgga acccgtacta gcaatgctcg
    99001 cggtgttatc caatatggac cgatgactga tgatcagttt gctataatcg ttcgtcgcga
    99061 tggaattgtt gttgaatcaa cagtgctgtc tacccgtaaa ggtgaccgtg acgtgtacgg
    99121 cagcaacatc ttcatggacg actatttccg caatggcggt agcaatttca tcttcgcctc
    99181 aagcgaaggt tggcctgctg gattcaccgg aattatccag cttggcggcg gcacttccgc
    99241 taatgctgat gttggtgctg atgagttgat caaaggatgg gacttgttct ctgaccgcga
    99301 agctctccat gttaacctga tgattgctgg tgcttgcggc tctgacggtg ctgaaattgc
    99361 ttcaactgtc caaaaatacg ttgtttcatt ggctgacgac cgccaagact gtgttgctat
    99421 cgttaaccct ccagcagagt taatggttgg aattccgaca tcaactgcgg ttaaaaacat
    99481 cgttgaatgg cgaaatggta tgaccggctc tggtgaagtt gttgataaca atatgaatat
    99541 cagctcgact tacgcattta tcattggcaa ctataaatac cagtacgaca agtacaacga
    99601 tatcaatcgt tgggtacctc ttgcggctga tatcgcaggt ttgtgcgcat ataccgacca
    99661 ggtaagtcat ccttggatgt ctccagccgg ctaccgccgt ggccagattc gcaactgcat
    99721 caaattggcg atcgaaccga agcaaagcat gcgagataca atgtatcagg ttgctatcaa
    99781 cccagttact ggttttgctg gcggcgacgg atttgttctt ttcggcgata aaatggcgac
    99841 tcaggtccca tcaccgttcg accgaatcaa cgttcgtcgt ttgtttaaca tgctgaagaa
    99901 aaacattggc gatacttcca agtatgagtt gtttgaaaac aatgatgcgt ttactcgtca
    99961 gagcttccgc atggaaactt ctcaatattt ggatggcatt cgttcactcg gtggatgcta
   100021 cgacttccgt gttgtatgcg acacaacaaa caacacaccg aacgtaattg atcgtaatga
   100081 gtttgtcgga acaatctatg tcaagccgcc ccgttcaatt aactacatca ctctgaacat
   100141 ggtagccacc tcaacaggtg ctaacttcga cgaactgatt ggtccaatgc aattggcgta
   100201 agaataagga gcccatttcg atgggcttct ataaataaac atagaggtta accaatggac
   100261 gttactgacg tactccgcgc ttttgagtcc ggcgattttg cccgccctaa cctttttgaa
   100321 gtggaaatcc cattcttggg gcagaacttc aaattcaagt gtaaggcagg taccatgccg
   100381 gcagctaccg tcgaaaaaat tccggtaggc tatatgaatc gtaaattgaa cattgcgggc
   100441 gatcgcattt atgacgactg gaccgttaca atttacaacg attctgcaca cattactcgg
   100501 caagctattg tcgattggaa cgcaatgacc catggcatgg gaaacactat cactggtgat
   100561 attcctgaag cttacaaaaa gcctggagtt gttcgccaaa aagatcgaaa tggcgagtct
   100621 actaaagaat acgcaattat cggcttgttc cctacaaacg tgggtgaagt tacccttgac
   100681 tgggacgata acaacactgt ttcaacgttc gaagtaacat tcgcgcttga ctggtgggaa
   100741 taataaataa aggcagcagt aatgctgcct tacatttgga gtttgtatga agtttttaga
   100801 cctttttaaa ttttgggatc gcgtcgatca aaatgaatac gatgaacgac tcaaattggg
   100861 tcatgaatcg attgctaccc cgaaaaaaga tgacggtgcc accgaaatag agactcgcga
   100921 aggcgaggct acttataatg ctgttatgca acaattcttc ggaattgaca ataacatctc
   100981 cggcactaaa gatttgataa acacttatcg ccaactcatc aataacccgg aagttgaacg
   101041 cgctgtggcc aacattgtga acgaagcaat tgtttacgag cgtggccata aggttgtttc
   101101 actggacttg gacgataccg actttggctc taacgtcaaa gaaaaaattc ttgaagaatt
   101161 cgatgaagtt tgtcgactgc tcgacgcgtc ccgtaaattg gacacacttt tccggcgttg
   101221 gtatgttgac tctcggattt tcttccacaa aataatgcca aatcctaaaa aaggaattgc
   101281 tgaattacgt cgccttgacc cacgtttcat ggaatattac cgtgaaatag tcacttccga
   101341 catcggcgga accacgattg ttaaaggata tcgtgagttt ttcatctata ccactggcaa
   101401 tgaaggatat tcatacaacg gtcggatatt tgagccaaac acccgtataa aaattcctcg
   101461 ctcagctgtt gtatacgcta gctccggttt gatggactgc tctgacagag gaataattgg
   101521 ctatttgcat aacgcggtta aaccagcaaa ccaattaaaa ctacttgaag acgcgatggt
   101581 aatttaccgc atcactcgcg caccagaacg tcgtgtattc tacattgacg tcggtaatat
   101641 gaacaaccgc aaagcgaccg aatacgtcaa cggcataatg cagagtctta aaaaccgtgt
   101701 tgtgtatgat tccaacaccg gtactgttaa aaaccaaaaa cgcaatctgt cgatgactga
   101761 agactattgg ttgatgcgcc gcgacggtaa atcagtcaca gaagttagtt ctctgccagg
   101821 cgcccaaaca atgggtgata tggatgacgt tcgttggttt aataagaagc tctacgaagc
   101881 actgcgtatc ccattgtctc gcatacctcg tgatgatggt ggaatggtta tcggcggtca
   101941 ggacacagca attacgcgtg atgaacttga tttccgtaag tttgttgttc agttgcaaca
   102001 tgattttgaa gaaattttcc ttgacccgct caagacaaac ctcatctata agcgcattat
   102061 caccgaagat gagtgggatg agcaaataaa taacataaag gttaatttcc atcaagattc
   102121 atattacact gaactgaagg atattgaaac gcttcgtttg cgcgtcgatg cactctcaca
   102181 gatcgagccg tacgtaggta aatatgtctc tcatgattat gtcatgaaaa acattctgca
   102241 gatgacagaa gagcaaattg ctcaagaaga aaagcagatt gaacaagagg caggtattaa
   102301 acgattccaa aaccctgaaa acgaggacga tttttaaatg gaaaaattaa tggaagcaat
   102361 caagtctggc gacttggttg aagctaaacg cgaatttgct gcccggatgg agattgttaa
   102421 agaatccacc ctcaagcaag aaaaaattgc aattgcccgt tccatcgtta ctgaaggcga
   102481 agagcctaaa ggtaaagacg gtgaagacga ggatgaagat gaagacgagg atgaggagga
   102541 cgaataaatg ttgattccat ccgattacat cgccgaagct gtcaaaattg aagctgttat
   102601 ggccgatgcg acctttcggg taaatcatct cgtcgaatcc ggttttgcca ccgatgaaat
   102661 tgtaggtgtt attagccgtg tcgctgctag cgagcctgac atggctattg ctatgatttc
   102721 cgtggttgaa agcacatcaa ttgatgaagc tatcgtcaaa cacgttaact ctcgtggcga
   102781 aattactcga acaaaagatc gtgctacccg taagcgtaac gcattcgcga caacaggttt
   102841 aacggcatct actcgccgtc agattgctcg ccgtgctgct aaaactaaac gtgctaaccc
   102901 gtcaataagc gtgaaggcac aacgtaaaac taaacgtgca cttaaacgcc ggaaggcttt
   102961 ggggttataa tggaagacga gttgctcata gaagtctggg gacttcctgg agacactcct
   103021 tctgaacttg ttgttgaatc tattgaccaa ggacgtggtg ccctctacat tgagggtatt
   103081 ttcatgcagt ccaacgttaa gaatcggaac ggccgatttt atcccaaaag cattttggct
   103141 aaagccgtcg aagattatac acaaacgcaa atcaacacca aacaatcact tggcgaaacc
   103201 aaccatccaa cgcgcccaat tcctgacccg aacttagctt cgatcattgt cgagaaattg
   103261 tggtgggaag gtgataacgt catgggaaga gcgcgagtta ttgaaggtga cttcggtccc
   103321 ggcgataaac tcgctgctaa tatccgtgct ggttggattc cgggagtttc atcccgcggt
   103381 ctcggccagg tgaaaggtgg tgttgttcaa gaaggatatc gtttgaccgt agcggttgac
   103441 gttgtatggg gaccttctgc tcctcaggct tacgtaaaac caatacggga acaaaccgag
   103501 gaagaaaccg gtaaaccggc ggatgctata aataatcacg taaccacact taatgaagca
   103561 ttcagccaac tggctaaaaa tatggcttca atgttgaact aaggaaaacc tatgtccctg
   103621 aaagataaac tgctggctga atccagcgaa aaactgggcg cggtagccgt tgagctggac
   103681 agcattttcg aatctgttca actggatgat tccgtaaaag ccaatgtcag caccgctttc
   103741 gagcaatctg tacgctcagc tgctatcaaa ctggccgaat cccatatcaa tgatatggca
   103801 agctctgcag aaacccaact ggctgaagcc gttgaaactg cccgcgttgc ttccgaaacc
   103861 aaactttatg aagatgctga caagttcctg acccatctgg gtaaaacttg gttggctgaa
   103921 aataagcaag ctgttcaaac cagcattaaa gctgaactgt ttgaatcaat gaccatcggt
   103981 ctgaaagagc tgtttatcga aaataacatc tctgtgcctg atgagcaagt aaacgttgtt
   104041 gccgaactga ataccgatct tgacgaagca actgccgaag ttaaatctct gtttgacaag
   104101 aacctggctc tggaagagca agtcgcttcc ctacaaaagg aaaaggccct ctctgaagct
   104161 accatggacc tgaccatgtc ccagaaggaa aaagttctga acctggttga aggcctggaa
   104221 ttcggtgata aattcgccgg taaactgtct gcgatcgttg aaatggtgac tgcctccaat
   104281 cagaagactc aagaagagct tcaagagcaa gcattaaata tagatgaatc tgcagctgct
   104341 gttaacttcg aacccgaagc tatcaatgag caaaaagaaa agcaggcaaa tgatcccatg
   104401 gccgcctacc tggccgctgc ttcccgtatg tcttaatttt taaaaggtca ataaaccatg
   104461 tctctgaaaa acaaagaaat cctgaacaag tggaccccgc tgctggaagg cgaaggcctg
   104521 ccggaaattg ctggcaaaaa caagcaagcg ctggtcgccc aaatcctgga agctcaggaa
   104581 aaagattcca agtccgatcc ggtataccgc gatgacaaac tgatcgaagc ttttggtcaa
   104641 tctctgatgg aagccgaagt tgctggcgac cacggttacg atcctaccaa catcgctgct
   104701 ggtcaaagtt ctggtgctat caccaacatc ggccctgctg ttatcggtat ggtacgtcgt
   104761 gcaattccgt ccctgatcgc tttcgatatc gctggtgttc agccgatgac cggtcctact
   104821 ggccaggtat tcgcactgcg ttctgtatat ggcaaagatc ctctggccgc tggtgctaag
   104881 gaagctttcc acccgatgta tgcacctgat gcatggcact caagcctggc aaccaaaggc
   104941 gctaccacca ctactgatgg taccccgttt gctaagctga ccgctggtca agccattgct
   105001 gaaggcgata tcgttggtca cttcttctac gaatccggta ctgcgttcct gcagaacgta
   105061 tctggtgctt ctgttaccgt tggtaccaac gagaccggag aagctcttga taagctgatc
   105121 aacgctgcta tcggcgaagg caaactggct gaaatcgctg aaggtatggc tacctcaatc
   105181 gccgaactgc gtcaaggctt caatggttcc aatgataacc catggaacga aatgagcttc
   105241 cgtatcgaca agcaaactgt tgaagcgaaa tctcgtcagc tgaaggctca atactccatc
   105301 gaactggctc aagacctccg cgccgttcac ggtatggatg ctgacagtga actgaacggt
   105361 atcctggcta acgaagttat gctggaaatc aaccgtgaag ttatcgactg gatcaactac
   105421 accgctcagg ttggtaagtc tggctggacc aagactgatg gctctgcttc tggtgtgttc
   105481 gatttccaag acccgatcga cgtacgtggt gctcgttggg ctggtgaatc ctacaaagct
   105541 ctgttgattc aaatcgacaa agaagcgaac gaaatcgctc gccaaactgg ccgtggtgct
   105601 ggcaacttca tcattgcttc ccgtaacgtt gtttcggctc tggctctgat cgataccaac
   105661 atcagccctg ctgctcaagg tatggcttcc ggtctgaacg ctgatactac caagggtgtt
   105721 ttcgctggta ttctgggtgg tcgctacaag gtctatatcg accagtacgc tcgtcaagac
   105781 tacttcacca tgggttaccg cggtgctaac aacctggatg ctggtatcta ctactgccca
   105841 tacgttgcac tgaccccact gcgtggttct gatccgaaga acttccaacc ggtcatgggc
   105901 ttcaagactc gttacgccat cggtgttaac ccgttcgctg aatcccgcac ccaagctcct
   105961 cagggtcgta ttacctcagg tatgccaggt gttaacagcg taggtaagaa cgcttacttc
   106021 cgccgcgttt gggttaaagg tctgtaattc aaaaggactt ggttccaacc aaggaatggt
   106081 aaagggagcc ttcgggctcc cttttttgta acaaggggta aaaatatgat acttattaaa
   106141 tcaagtgcgc cagtcatttc caaaacttac gaagccgcta atatgagcgc tatgacatgc
   106201 caattggtta ttgatggcgg cgatactggc aaagttgaaa ttgacggctc attggatggc
   106261 aagagttgga taaacatcgc caaactcagc gctgcactaa acgcggatgg tattgcaacg
   106321 gacggtggta ttgcatctac gtcgtggaat ttctatcgcg caaatttaac tgaaacttct
   106381 ggtttggcca ccgtgattgt ttccatatcg taagaggcaa accatgatac ttaaccctaa
   106441 agcagtatta aataatacca gtagtggctc gagcggcgtt agtagtttta atgggcggat
   106501 tgggccagtc gacccagaat cgggtgatta cactgccgat atggtaaacg ctatcgaaaa
   106561 agctccaaca gattcgcaac gaagggttct cattggaact acaccaactg ttgaagaatt
   106621 gatcgaccct atcaccgtcg ttgacaattt aacttccgat tcatctactt cagcactatc
   106681 tgccaaacaa ggtaaattat tgcaagatgg aaagcaacca actataacag gggctgcttc
   106741 gactatagca tcagtagatt tgacgccggt acgtatcgcg gctactgatt caaatggcaa
   106801 aatgacaaca agtcttgtat ccgtatctga tctcgattta ataaaagatc gcacaacccg
   106861 ggtaaaatca gaacttgagt ggaccggttt aaatatcgat gtgacaggca ccgctctaaa
   106921 tttagtaggt gctttgaaag cgataacacc agtatacggc agttgggctc ctatgtttga
   106981 cataatcaac gacaaaatgg tggcggctaa gaatgatgac cgaactctat tatacaagat
   107041 agccatcact ggcacttttg acaatacaag ttcgactaac gctctcacac tcacaactac
   107101 aataggttct aacatagatg tatcttccgc cgtgcgattg ccaaaccaaa atccgcagaa
   107161 tattaattac atttctttaa taagtgttga caaaaacgga aatttcgcca ctaacggtgc
   107221 atctttaaca cttaggtcaa cgacatccga ttttacaatc actcgggttc gtttaatcgc
   107281 tgaacaataa gagagaaata tatgagcaga atcaccgatc tgattaatga atcaactaca
   107341 actgcggcga atagtcagag ccggcctgct ctggcaggac tcactcgcgc ggtcaacaat
   107401 ttaattttta ctgaaatggt ggctattcaa gaaacgaata tgccgtcgtc aaccttatac
   107461 ggtgtaaaat acctcaaccc ggctggtaac caatcgtttg ccagtgcagc aacatatatg
   107521 ggcgacgtcg gttaccgtga cggcatacca ttagccgtgc tcaactctcc aatgactgaa
   107581 ggctttgtct ttaaagactc cttggatgtg gtgtacacag ttataaaacc attgacatta
   107641 atgtcggcca ccagcgatgt taatgacgca atcaatgatg ccgtgctgct cggcgacatt
   107701 cggataaagt ctgaagcggc tttagctgaa aaatttgaag gtgcagaatc atttgtcgaa
   107761 actgacttcc aatttgaccg atggaccgtt ccagtacgca gccgaaaact caaaacaaat
   107821 atatctgttg agcttttaca agatttggaa gcaaataaac tagatgcagt cggcattatt
   107881 gatgatgttc tgtcaacaat gatttcagaa gatatcaaca aggatatcat tcagtcaatg
   107941 gtaacagttt cgcgtcgata caaggttgaa ggtatttcgc caaatggtat cattgacttg
   108001 acgtcgtcaa tcgatgctcc aataatcggt agaactcttt accaacaagc atgcgaaatg
   108061 aaaaaccaga tgcttagaaa tacgtcatac gaagcaacct atgttctttg tacaacacgg
   108121 gtatcagcaa tgcttgaagc atctggctgg atggaagcga acgacgatcc actatctgcc
   108181 ggaactctta agaatggact attggttttt gttgacactg tgtcttcatt tgactatctg
   108241 atcaccggat gtaagcacaa tgtcaatgat atagaacatg ttggttcttt gttctattct
   108301 cctttcattg aggctgatga cctgggcgcc tataagataa tcaatgaccc aagttcactg
   108361 cagccggctg ttggtattct cattcgttat ggtttgtctg tcaacccata cactacaagt
   108421 attggccgaa atggtgatcg agatgtagtc ggtgatgact ggagcaaact agcaggcgaa
   108481 tctgatatgt catatttgct gggcgttaag ttgcctaaaa ttatgccggt ttaatccaaa
   108541 tacaacaaag ccccgacaat gtcggggctt ttcttttatc tgttacatga ggcggagcca
   108601 aaaccctttc tcatactgca tttcgagctg gcatggtttt tcggattttg cgtctcctac
   108661 aacctcgatg accaaaatct tgccaggatt ttcacggcac catttacgcc agtccttgtt
   108721 attttctttg ttgtaccgtt ggatgaagaa gaggcgtgtc atttcaccca gataacccat
   108781 cgttggctta cctttcatcg gtggtaccga aattcctgga taattgctgg tattgtcatt
   108841 gaatttgcta atgactttat cagcgaattc tgcttcgcgg gtccaatcgt tcatggtcac
   108901 gaggtactta tcttcgagga tggcactcga gaatcgtttc atgcaattca ttggtttttc
   108961 tccatttggt atattgcttt acgcatcaat ttgattttca tttcagtcgg gatatgatta
   109021 tcgtgaacga actgatcgag ttgcgctttc tggctatttg cacgagaggt aacaattaca
   109081 acgttttcca ttgtataccc ttccttcgga ttgacacgct caattgaacg gcctgaatct
   109141 ttggggaata ttgtaccagt atacgcgcat gattcggtat gcattaactc tacaaattgc
   109201 gggaatgtaa tgcgccattc aagtccgcgt tcttggcaac cagtgacttt cacctgatat
   109261 gcgtgtaagt accgcttatt tttgctgatg aaattcatca tctcgatttg acgagcaact
   109321 tcttctcttt cagctttaac ctgttcttcg cgacgtttga tttgttcgtc acgcaaaacc
   109381 tcgaagtgat gctttttcgg cggctcaggt gctttaacag aagctgaggc gatagaggca
   109441 taacgagcta gcatttctga acgagtggac atgataatta ctccgcaggt ttggttagtt
   109501 tcattatgga cattataacc aaacctgcga gattgtaaat cactttttgt tgaatttgtt
   109561 caacaaagct tcgagtgact ctccggtagc cggagtcacc ttaaaccgac tgtcggtatg
   109621 cggccgcgct tttccgcgtt tcggattcac atagtgctta cggaaaacaa ccggttcacg
   109681 agtctcaaag tccagtttcg ccccgtcaac ataggctacg atgtcaggca catcaaccgc
   109741 gcggatgtcg tacatccggc caatctggac gtaaccctgc ttcatttcac gaaacataaa
   109801 gtggatttgc actttttcag catttgacag ttcagtaaat ttgcgcatta tttcagtccc
   109861 catttttcgc ccatgttgta gtatgcagtc atatatttga cagcccgctc agtatcttta
   109921 ggtgtgacac ctttcaagcg gcgcaggtcg gcattgttgc gcaaatcata acgcttgcac
   109981 ttgacagacc ggatgtcact attgacacgg atcaggtaac attcgtaact ttcgccatcg
   110041 cgtttagtca cattgtctac caactgcgcc atggatgagc cgaataacgt gttgatgtcg
   110101 cgcaaacctt cttcgcgatc atcatagcaa tcttcaacaa catcatgaag aacacatagg
   110161 atctggacgt ccaatgcttc tcggtctcga cgagcccagt gcatgagttg caatgggtgc
   110221 agaatataag gcgcgccacc tttgtcaaac tgaccggcgt gacgattggt tgcgtattga
   110281 atggcctcag ccagatgttg ttgggtgtat ttcattacga atacctcatg ctaatttgtt
   110341 gtgggcgcat cataaatgga aatcgggcgc cctcttcgat tttaagagtg tcattgccat
   110401 tttcgtcagt tcgatcttct agcggacaaa tagaatcaac gtaggcttta atgccttcaa
   110461 taatttcctc ttttgtcttt ggcaccattg caccactgat aatatgatcc ggacgatttg
   110521 ttttgaaatt gaagtaagtt gttgtgaatt tcatctcgat tagtcgctca atttaccgaa
   110581 tggaatctgt tcaacgaaag cccatgcggc atggtaaact gttgcacctg gtgtttcaga
   110641 cataaagacc gtgtcgaccg gtgcaacaac tcgaaataga gttggctcgc cgcctataga
   110701 gcgcgctgct cgtctggcat atactttagc aaggccacga tctttggtga aaaacacacg
   110761 atccaaattc tttttccgac ccttctcgga aatcgtgtcc gtcgcttcgg gtggaagaag
   110821 catatcacct ttaaggccga gtgtacaaga gccatggtaa aactcgacat attcgtcttt
   110881 gcaatggatt gttctcatga tatgctcctt ggtagatttg atgggaccat aataatccat
   110941 agtcccacca ttgtaaacta ctcttttatg aattgttgac gctgattttt gagcaatctc
   111001 gttttgattt tctcggtgca tagacgaaca cggcgcattt tgccggggtc agcaatgtat
   111061 ccgtgttcaa aaatcactat cttcgaatat ttgtcattgt gttgagtttc tgaaaatgta
   111121 ataggcgctt cagcagcata aacaaatgtg tcaacctgtg cattaagtaa aattccgcca
   111181 gacgagatta tggaaattgc agctcggtca tattcgcttt ttgcgatttt tacaaatttg
   111241 cttacatcaa attctcgatc gtcgacaaat cgcccataca taaaacacaa aatagctttt
   111301 gcgtaccact gtgctttgtt gtaatcgata ccatcgtccg gatagtcacg aagtttggca
   111361 agatgcgcaa gagccatttt cttcttgaac tcacgcctga gttcaattaa cgcatcaata
   111421 acatcgcgca aactatgccc attgagattg aaatcaccga aatgatcgcg caaaatcatc
   111481 ggatacatca aagaatagga tgattcccat attgggccat cgaaaactac cgggtaagtt
   111541 gtcgcagtgt acagcaaatc gtgaaacggt gtttgaaatc gttcatcacg atgttttatg
   111601 atgtgccgaa taggcgaatt tgggtcggtg aacattttct tagcgtctgc cacaagcact
   111661 ttgtctttga tggcctggct attttccaaa atcatatttt ctaatgttga tttcaacata
   111721 atttcctcac tctcgtttag gacaattcct taattattcg gaaccgcgtg attgattcgg
   111781 attgcgtctt gtgcaatcat tattaactct gttgtatggt gtatcatcag gttgatagtg
   111841 acatattatc atataaaacg ttgattgtaa acataaaaca aagggagccc tggggctccc
   111901 ttttattacg attttacaaa ttgtgatgct ttgtagatat acccgtttcg cgactcttgc
   111961 atcagacagt caccatagtc agtaacagcc ttgtcgatag cataagttac cttcggccat
   112021 gggctgttta ctggatcgtc acgccatgcg ggattagctt tcatccaatc atgaatccag
   112081 tatggcaacc aggtgaagct ggaatttttg aattccaatg gattaacaaa ccaatggcct
   112141 tcaggaataa ccgggatttc ttccacagtg atagtagaag cagtgctggt tattgtcaca
   112201 ggtgcagcgc cgtcatcagc aactaacgcg taaacgacac ggcatttgac ttcgaaatcg
   112261 ccttcggtat caaacagttc agcgattgta tctgacgttt ctcctgacaa aactgaatca
   112321 ttcaaaagcc aagcgtaaga aacaatttct ttaacagtgt cgtcaccagt gaatgtcgca
   112381 gtgaattcaa cgtctgtccc aactgcaaca gtttgactca acggggcgac tgtgagtgta
   112441 attgccatat attttcctta acagcaaaag ggaccagagt cccttgatta tgaaataaca
   112501 atgaatttgc tatttcgact ttcgcgaatg gcaacagaac catcgcgttc aatgtagaat
   112561 gccagagatt tcaacatatc tttatcatat ggacattcag tgatatcagc tcgccaattt
   112621 cgaccttgca tccagtcata gatccaatat ggaacgttaa caaatgcgcg accttcagga
   112681 ccaactaatt tatacttcgg ctgataacct tcagggaaag ttaatacaag ctcggtgatt
   112741 ttttcaggaa tgatttcgcc tgagaaaaca cccagaggag cttcaatttt gattacacct
   112801 gatttgatgc cttcaacaat cttgtcttta tcttctttcg ggatgtcatt gatggagatc
   112861 gcgccaacat cctgaaccac gggcttatgt tcgacctgat cgatgataag ctcgtcgtct
   112921 tcggtaaaaa tctcttcctt atccatgagg tccgggtcaa gttcaaccga gtcagaaaaa
   112981 tctacgcgtt cttcaaggtt gatttcctcg atagcatcgc ctgccatttt acgggcatct
   113041 tcgaatgtag cactaacagc ttcttcaaga tcgttcatca tattgacgaa agatttttga
   113101 cgagacagct taacatcata atgtttcatg gcgtaatcgg ccaatttctt tttgctttcg
   113161 gatgcagata atgacccgaa tttggtttct aactcagaac ggacaaaaag tttctgtttc
   113221 atgtcgtgga ttcctttata aataaaacta tatgacttta tttaagggtg tctaccgtga
   113281 tcgatattgt actcgaaaac tatagctttg tgagggttga atgcgaagat tcaatcttct
   113341 ttgaaatgcg ggagtatttt tcatttaagg ctgatggcta ccaattctcg ccaaaattta
   113401 agtgtggcgt ttggagcgga gacatcttcc tgcttggata cgaccgactt ctgccatttg
   113461 ggcttgtctc tcaagcgatt aaatttgctg agcaaaacga ttataaaata accgttgacc
   113521 ctgcgatcag acagcgtgaa aatttatctc gagccgactt tgacgcctgg atccagtcaa
   113581 aagaaatcta ttcgggttca acgcgaatta ctccgcattg gtatcagtcg gacgcggtat
   113641 atgaagggat ttgtgcacgt cgaaaaatcc tcaaccttcc gacatcagcc ggtaaatccc
   113701 tgatacaagc acttctatcg ttgtggtatc tagaaaacta caaaggcaaa gttctggtaa
   113761 ttgttcccac gacttccctc gtaactcaga tgatcgacga cttcgttgac tatcgtctgt
   113821 tcccacgaga agcaatgttg ggcataaaat caggaaccgc taaagattca aacgctgtca
   113881 tttatgtttc aacatggcag acagcggtta aacaaaagcg tgaatggttc aaccaatttg
   113941 gctgtgttat gaatgacgaa tgccatcttt caactggaac gtcaatcaaa aagatcatcg
   114001 agtctgttga ccacatacca ttcaagtatg gtctatcggg ttccttgcgc gacggaaaag
   114061 caaacatttt acagtatgtc ggcatgtttg gcgatatttt tagaccagta acaaccaagc
   114121 aattgatgga cgaaggtcaa gtaaccgatc tcaacataaa agttgttcaa ttaggttatt
   114181 cggatgaaga tcgtaacgct gtacggaaat acaactacga cgaagaaatc aaattcataa
   114241 cttcgcacgc aaagcgaaat cgaaaagttt gtagtattgc taaagggttg gctgaaaaag
   114301 gcgaaaacgt ctttatgatg ttcagactta cagcccatgg aaaagcactg tacgaaactt
   114361 tgatcaaaat gggtgtcaag gcacattata tttccggtga aaccgagaca gaagtccgcg
   114421 accaaatgaa agttttggca gaaggtggaa ccggccatgt gtttgttgca tcttatggag
   114481 tattctctac cggtatctcc attaaaaacc tccatcacat tattttcgca catccagtaa
   114541 aatcaaaggt tactgttctc caaacaatag gccgggtttt acgtaagcac aaatcaaaag
   114601 ctattgcaac tgtttgggac atatgtgacg acctcggcat tctgaacgcg tttggtaaat
   114661 acactagaca gaactatgca cttaaacatg ctgttgagcg agttgagagg tatgtctctg
   114721 aaaaattcga atacaccatg cacaaattaa aactttaagg ggaagatatg ttatctttta
   114781 aaagctattt gcatgaagca atgattgaca gctttatggg aaaaatcgca agttgccaga
   114841 ctctagaggg tctggaagaa cttgaaaagt attacgacaa acgtgttaaa gaagtggacc
   114901 tcaagtcttc tgacgatatc tctattcgcg acgctctagc cggaaagcgc actgaattcg
   114961 aaggtggcga cgaagaagag caagaagaag agttctaata caacaaaggg aacccgaggg
   115021 ttcccttttc ttttacataa gcagttgagt ttcttcgagg atactttctg actcagaaag
   115081 cggaagagcc tctaggtggt gagcacatgg acccgggtga gctgggccgt aaggcgtgtc
   115141 aacggctaaa actttctcta ctggcatttt gcacgctggg cagagagtag taccttgtgg
   115201 caattgcatt gttagactcc aattgtttcg agtgctgcaa taacgtagct ctcgatttct
   115261 ttcttcatct cttttggttt tgcgacagtc caacgaccat ctttaacacc agcagagata
   115321 cgacccatca atttgccggc cagaacatta atgttcggac caacaaggcg atggatatcc
   115381 atcagttctt taccgttaac gatcgaatta aactgatcaa cggtgatttc ttgtggcaga
   115441 aatttcgaca gcatctcttt ttctttgaga gcttcaacca aatcttcaga agtgtatttg
   115501 ttctcgattc gatcgttaat gcctttcatc aggctcagga ttactttacg aaccgattcg
   115561 tcatcggttg cacgactttg gttaacttca ccaatgacca gcccaagaag ctgtacggct
   115621 ttgttgccat gttcacgacg agcttggctg cgagattcgg tgatttgttc gaacagtgtc
   115681 ataatgatta cctcttgttg aattgagatt atcctaacac ccatttgaca atcttgaaca
   115741 aaaaattttc tggtgctaac cagtttggcc tcgccaaatt tatcctttaa ggcctaatag
   115801 attatataac ctaaaggata aaaagactgt tcgagcgagc tcgaatcgga gcgagctccg
   115861 aggttctttt aatctcatct ccaccaatcc tattctcttt taaaaccgaa ccaggaaccc
   115921 tggtatttat acattccagc ggcacttccc gcgggtacat acaaaaatgc cctccgaaga
   115981 gggcaaaagg tcaatttgac agacgcattt taatctcatc gattagtgct gggttgtcaa
   116041 cgatagaaaa gcgaattgtt acgataagtt cattgttatc gaagttgccg atggaatcga
   116101 ctgttagatt atagacgcgc ggttcgaaat ttcgaatagc ggttttgata ttgcgctcaa
   116161 ctgtgtcaat gaccagtggc gttatgtttt caaacaattg atctgggagg tcacacccaa
   116221 aatatggatt gaacgcgcgt gatcctattg gcgttgacac gatacctatg atcgaatttt
   116281 ttacagctcg agaccctttg gtcatgagaa catcattatc ccacgacttg ccaaaattag
   116341 gatcgagatc tgaatacagc atgtttatgt tcatttgact cctaatgctc ccagaattgc
   116401 acctggacct tctataacag caggccactg attaccacat tcgcacgaca gtggaacgac
   116461 ggcatatatc ttgtttgctg acagcttacc aactatttgg cgaatgtcgt cgatatgcaa
   116521 ttgtttaaac agaaggtctt tctccaggtc gctcgcatta tcccacgata taacctgccc
   116581 atcatgctca aaagacacca aacaacgatc aaccatttca aacggatcac ggtcctcaaa
   116641 cattttagga tgcctgaggt tgattataac gccgccggca tgatgagtca atgcatcatc
   116701 ggaagtgaca cttatagcat caggtgaaac aacgaaactg tgttcattgc cacaggtgca
   116761 ttttgttttc atcttaatct gtttgcgttt tgataatgct accaatttaa cgaaagcttg
   116821 ctccgctaaa tgctttggaa gctctccgaa tcgactctcg attgtctgat ttactgcttc
   116881 ttcaggagag tttattgagt aggaattaac caaccccaaa tactctgaaa ctgtaagcat
   116941 atcagtttca acggctttgc cgcctatcgt cattttaatt tgcatgggac tatcctccag
   117001 aaggtattta aataatctaa aaggagtgcg tatgaatata attcgtgtaa aacttccagg
   117061 cggaacgaaa agatttaagc cattcacggt atcagaatat cgtgacttgt tgctcgttcg
   117121 aaatgaaatg cgaagcaatc caaaagagcg ccaagaaatt ctcgacgaac ttttggctga
   117181 gatgtttccg gagtatactc cgttcgaacg ggagtatatt tttcttaacg tctacatcgg
   117241 aagcatgggt aaggcattag ttgatgcgac atttaaatgc cctaaatgcg ggtcgaccca
   117301 ccgtatacgt cttaaactca cccaggaacc tatgaaggct cccgaactga cggtaaacaa
   117361 cataacgttc aaattcaaaa tgcctgagaa atcggaggca cctgacgtgt tgtttaataa
   117421 gactattgat aagatatctg atggagaaaa cgaatacaac tggagtgatc tggttgatca
   117481 gcgcgacgaa ctcatcgata tgatatctta cgaggaattt gtcgaattgt ctaaaagctt
   117541 tagatcgata aaggtttctc aaaagataca atgttgtgtt gagcatgatt tgtcatttga
   117601 caatatgctt gaactttttg aagttctttt gaatcctgat gaaatattca acttttacaa
   117661 aatcaatagg gcacttgtga aatatgacta ttcgctagat gacgtcatgt ccatgatgcc
   117721 agtcgagcgt tcaatagttc tgagcctcgt tgaaaaggaa ttgaaggaga aaaaataatg
   117781 cttcaaagag ccggatatcc taacgtatcc ataaaattgt accaaaatta tgacgcctgg
   117841 ttggaaaaca gattcattga actggccgcg acatttgtca cattaacaat gcgtgatggc
   117901 ctaatgaacg gaatcaatga aggtctattg cagatttatg acgcaaacaa ccttcaaaca
   117961 aaactaaccg gcgatgagat tattcaaaca tctctaaaaa ctgcgaacac tgaaatcaca
   118021 tataacagac tttacggcat aaagcatatc ggtgcttcgg tcgatatgaa aggcgataac
   118081 ataatcacct tccagcttgg ctcgatgcat tatgtgaaga atttgaaatt ttcgcggatg
   118141 ttcaccaata atgcggttgt atctgttcag gaaatgatgg actacattta caacgatcag
   118201 gttaaattga tgccgccatt tcagtcggtc aacacacgag ttccaatgac aaactgggtt
   118261 cttggaataa acgattattt caattttatt cgcaaattcg gccagactgt tgagagagaa
   118321 catatacctc tcgtctggga ggacatggaa ggcctgcaca tctcggattt cgcggaaatg
   118381 caatcaaaag aaccgattag ttatatcgta accgagccaa ggcttttggg cgaaacgata
   118441 tcgatgatag accacaaagt ttgttttgat ttcgaatggc tgaccaaagc aaatggctac
   118501 acccgaaatc catacaagaa catgtcgttt tatgctcact ctttcatcga caagcgacaa
   118561 acaagagttg ttaccggtga aggtcttaac gctacatcga ttagtcgttc gggcgcttat
   118621 tatgaccaaa tcgatcgatc tggatcagag gaatacaatc gcatgctgac attttcacag
   118681 tatgacgcat attgcagcgc gaaaacatac ggtgagttcg gcctaacacc tgggaaaaag
   118741 ttggagtttt acgacaaaaa gaaccaattc cttggcgaat atttcgttga cgaagttatt
   118801 cacgagattt cacgagagca gtcaataaca agcatgttta tgttcaataa ctcggttaaa
   118861 ataactaacc acgaagaaag gcaaatatca tgaaaccacg cctaaatatt atccctgctg
   118921 ttaaaatcat caatgttaat ggcaaagaga tcaaaatacc taaattgggt ttccgtcaga
   118981 tgaagctcat gaaagatatg caaggtgtcg acgattgtat ggttggattg ttagactcaa
   119041 ttcgccccgg cttaacggct gcggaagctg atatggtaat actccacttg ctggcattca
   119101 acaaacgtat tcaaactgtt caattggttg gcggcgttga gattgatatc gataaagcgt
   119161 atatgtgcgc cgtatatgat tttgactttg acggcaaaac gattcatttc aaagcgccag
   119221 cagttacaga tcgttttgtt agcaaaatcg atatcctgga aaaacaattt gaccgcgata
   119281 aaaccgggtt cgacttcgat tttagagaag caccggcgtt cgtgcttgat tgggcggacg
   119341 aaataattgc cactattgca ctcgacacac cagttgggac catttacggc ggttctagca
   119401 tagtcggaac aatataagag gttaaaatga ctacatcatt acgcgatttg cgtagacaaa
   119461 aacagcaaaa tgatgctact aaaaatttag cgtcagacgt tcaaaaggcg gttaaccagc
   119521 cgcctaatgg agattcgctg gctgcacagg agcttatcgc tgaaactgtt gaacagggca
   119581 acaatgaact acgacagata aaagcgaata cagctagcct gcatgataca gccgccgcaa
   119641 ctgagcttgg cgctgaatcg acagaaatgt caaacaccat tcttcgtgaa atatccgaaa
   119701 ctggtaagca gacattcagc aaattgagtg agtttgccga gcgcctcaaa ggcagtttta
   119761 gtgctgatga cgttgaacag acgcctatac gcgctgcttc ttcatctgac caggcaattc
   119821 agataatcaa tgaagaaaac ccggagccgg aaaatccttt agttggatat ttgagaacaa
   119881 tctccgaaga tatcaaattc ctgagagaga ataaaaacga gccaagcgat ccaaaagacc
   119941 ctgatgttgt ccctgacgac aaagatgatc ttaaaacgat gattgaccgc attggcgatc
   120001 agatcgttaa atctgttgac tcaggcttca aacgtaccgt taacattgcc gattcaataa
   120061 gttcaacact gtttaaatac accataacag ctgcgttgaa ttttgcgaag atggccgcgc
   120121 tggttctttc tcttataatc gcatttgatg ttttaagccg tcatttctct cattggactc
   120181 aaatgtttca ggagcaatac gctgagttta aagaaaccct cggttctttt gggacgccat
   120241 ttgaaaactt gaccggtatt gtaacggatt tggtcaatta tttcaaatca gacgaatatc
   120301 tcaaaatgtt tgttagactc gctgaaggtg ctgctgacca aatgatttac attgtcaaca
   120361 tgatgatggt tgggctggct aaattgggag ctgctatact tcgagccctt ggtgctgacg
   120421 ataaagctga tactctagaa gcttctgcaa tatcggtagc gacaaagact gttggatata
   120481 ctccatctga agaagaggag gccacgattg gtcgagtccg caaacgccaa gcccaggaag
   120541 aagctgaaca gagtgaagcg agctggtggg aaaagaaaaa gcgcgaatgg gatggcaagc
   120601 cgattgaaac tgatgaagag aaagcagttc gtgagcgcaa aaagtccatt gctgaaaata
   120661 caacggctga gcaattcggt aagcatgatg ctctaagtca gaagattcaa cacgtgggcg
   120721 ttaccgctga aaagaacgaa acttcaaacg aacttctcgg aaaacatcgt gaactgcttg
   120781 aaaaacgagc cagtgatgtt gagcaagcca agcaatcagg cgagatcacg accgagtcat
   120841 ataaacaatt gaaggttgag atcgagaagc agcgcgagtt tttagacgca catgaacaga
   120901 aactcctgaa acctaaagct tcaatcaagc cggcaccaga gcctgaaatt ggtgttgtag
   120961 gatcaatcgc aaaggaagaa aagcgggttg aagcatctca aacagctaaa caagaagcag
   121021 ctagcaacta taacacaaat gctaacatcg tcaagaacaa caaccagaca ctggtccaag
   121081 ctccacggac tagttcacct ggaccaggta taggaaacca tttatgaagg taaccgaact
   121141 tattgatggc ggagttcaag acgtcgtcaa aggaatactg aaaggagaga accctgccgg
   121201 gggttctact ccgcgacagc cattgagtaa aatcacaatc gcgcagttcc cagccgaacg
   121261 aaatgctgct aatgattcga ctcaagattt caacgtaaac gatctgtata aaaatggtct
   121321 attgttatcg gcgtttaact attccggccg acagactggc gatcttcgat cgtttagaac
   121381 cgatcagaat aacatcggcg actatcgcaa gggtgttgtc aaggaagcca tcgctaatat
   121441 cctgatgcca aaagggcaaa ctgatataga tacaatcaac cacaaattca atgatgtcca
   121501 gcaatcactg gttgaacgag gtaatggatc aataaccggt gctctgagta gcatggcgtc
   121561 gcacgctgtt tatggtggtc ttgaatccat tacacaaggt gcattcgcgg atcgaggcga
   121621 acaagtttat attgcttcac gcgctatgta cgcgggagct gaaaatagaa ctaagaccta
   121681 cacttggcaa cttactcctc gtaatgttta cgatctggtc gaaataatca agatatatga
   121741 gatgctttcg tattattcat acggctcagt tgagaaatca aatacagcta atgatattcg
   121801 aaaatcggtt gacgctgcgt ataaagaaac gatcattaac ccattaaccc ctgaagctac
   121861 ccatgggcaa acaacaatgt ttgaacggat aacttcattc ttgagcaatg tcaacgttgt
   121921 gtcaaacccg ataatttgga caatacgcaa ctttggccag agtagttcgt ttgattcacg
   121981 ctcggatata tttggcccag cacaaatcca gagcatccga tttgacaaaa gtcctgatgg
   122041 gcattttggc ggtttagctg tagcgccaaa cttgccgtcc agtttcgtgc ttgaagttac
   122101 attccgcgaa atcctggcac tgaatcgttc tgacctatac agcgaggatt aatatgtacc
   122161 gtttagatga atttcaacag gaattgaaca aagacttcca gcgttccaat atgttctcgg
   122221 ttgtctttgc gaccacacca tcgtcaaaga caaccgaatt acttgatggg ttcggtggtt
   122281 ttctttataa caacctgccg tttggtaagg atttcgccgg attaacccag gggatgattt
   122341 cgagctcgct caataagatc attgtgcaag gtactcagtc ggtgatgagg agttccgggg
   122401 tatccaaata cctcattggg gctatgacat ctcgaacagt tcaaagcatt ttaggacagt
   122461 ttgaggttgg tacatatctt ctcgactttt tcaacgctgg aaatacgcac actggtttaa
   122521 ccgtttattc cgttcaaatg ccggaaaacc gtcttggcta tgaaatggat aaattccata
   122581 atgcgccgaa cataaagctg atgggacgtg aatatgatcc tctcgtcatc agtttccgga
   122641 tggaccacca agcttcaaac tatcgcgcga tgcaggattg ggttaacgct gttgaagacc
   122701 ccgtaactgg gttgagatcg ttgccagccg atgttgaagc ggatatccaa atcaacttgc
   122761 atgcccgaga cggtattcca cacacggtga caatgttcgg tgggtgcata cctgtcgccg
   122821 tctcatcacc ggagcttagc tatgaagaca acaatacaat aacaacattt aatgtgactt
   122881 tcgcatatcg cgttatgagt gttggcgccg tgaatatggc aatggttgat gattggctta
   122941 aaggagattt gttgcctgcg cttggatcgc aagctggtgg gtggctttct aaatttggac
   123001 catttagcta aaaagggagc cctagggctc cctttgtttt attcgaagaa cttcggcgat
   123061 acgccgtcaa agctcatagc gttggctaaa acactaaacg attctgcttt ggtgagttta
   123121 ggctcgttgc gcgacttgac gaaattgcta aatcccatcg gcttaacttc gccagtttcc
   123181 agcaaatggt caccgtcgta aattacttcg ctttcttcca gcatatttaa cccgacagct
   123241 tcgcattcaa cgataacgtt tgtacggccg cctgtgccgc cagctttgta tgttttgttg
   123301 aatttgaaga ctgtaccgcg aggcaaaata aattcgcact catcattgtg ctctgaccaa
   123361 tagcccggga atattgctgg gactttagtc tcggttatga cgaaaccaaa ataaattgct
   123421 tcatccattt tgtctgcaac ttcaatattt gtcgggtcaa cttcttcgcg gttcaatgag
   123481 atatctgacg acgaacccaa ttggcctgaa tacattatag gttttgctga agtggacaca
   123541 aagttggaaa agtaaaaagc tttattttcc atcgctgctt tcgataccca gctatccgat
   123601 cgctgacctc ggtagagtgt cattcctttt ggtatacgaa ggccagcctt tttgaatgcc
   123661 gtatcaattg cttcgatatc ccgcttggtg tcaggatcga ggtgtcgcat atttccagta
   123721 agagtgccat ttatgtttat gtacccttcg gcacaataca tctcaaccgc ttttcttgaa
   123781 gcgaccggag cctcggaaag agaatattca acgcgatctt tatactgccg gttgaattta
   123841 ctctctatga gaagttggta attatggaga gcctgtttga tacgcgggtc tgcacgtctg
   123901 cgcgccatgt ccataaccat tttctctttg cctggatggt catcgcttat atgatccaaa
   123961 cgttcaagag ttttgtcata ttcgtcttcg atataaacat cgctgataat ctgggtaaaa
   124021 gcattgagtg cttcaatacc atttatgctt ttgttatctg acgcgataat aattgcatcg
   124081 atttcagtct gctcgagttc gatcttatcg ccgaaagctt ggataaaatc acgatccggc
   124141 gccataaatg tttgcgcagc aacgttatat gactcgatat ttcgaccttc agagttgatt
   124201 atgttttcaa ccggttcgaa ataactggtg gcatcaaact tatcgatatt gttcgcggcg
   124261 ttgaaggttt tgataatttc agcacggctt attttgaagt gcgttgctga attcatcggg
   124321 cgtttgtctt ctttcttttc gatagacttc gcaatagcct ccgtctttgt aactgtttgg
   124381 ccggtttttg tgtcagttac aatatctcca actttggtgt ttgtgatagt gtagagctca
   124441 gggtctattt ccaatccagc aacgccggtg atgccgactg acttccgata catcataatg
   124501 tatgtatatt tgccagcgtg ctcgagcaac tctggcaata caatgaaacg accgccgcct
   124561 cgtgttttga gcaggcgaga agctattcgc ccaatagttt ttgactggcc atgcagactt
   124621 ttcgtcggga agcgaagcag tgccccatcc agccgatatt tgaccatcac attcaatatt
   124681 tcgtcgcata tgacgttcat agcgccaatc ggatcattac caaggccggt tttaaggacc
   124741 tgtagattgc cttttggcga aagttgcatt acttgaatct gcatgaattt atcgcctgtt
   124801 ttgacttgct taacagcatc gcctttggcc gcatagttgc agaatcgaat taccagattt
   124861 tcagctccag gagctttaat cataagcata tgtggcactt ttgctttggg cgttaaattt
   124921 acgacatcat actttccagc tgcgtcgaat acttcggtta ataacatttt gactccaaag
   124981 ggcccggagg cccttattaa ttgtaaaact tcggcgacat atcttcatca gagataattg
   125041 atgcgagaat atttcgccct acctgggctt tattaagctt ttgagcttca tcggccacaa
   125101 cactttcgga aaggaagctt gagaaccctt ggattatctt tagctcaccg gtctccatca
   125161 gatgatcgcc atcatagaca acgtctgatt cattcaacga gctcgccgaa acagctatgc
   125221 actccgccca aacagttgtc tggcttgaaa agctataatc cgggtcgata atttcagcct
   125281 tcgagacagc agtgaatttg aaagttgttc cacggggcaa tattacctcg ttttcatgcg
   125341 gatgttttga tgtattgcct ggtataataa caggaacctg gacatcatgg acagcaaaac
   125401 cgaaaaatgt tttcttttgt tctgctactt gcgtctcttc actgcttatc atcgcttttg
   125461 aaatattctt gtttccacca ataccgctac cgaaaatatt cggagtgaac gagcatgata
   125521 cataattgga gaaatagaac atcttgttgg ccaaagaaat attcgccagc tcagaagcga
   125581 ctttcatccc acgataaacc gacatgcctt caggcaattt cattccaatg ttcttaaatc
   125641 ctttatccag accttttatc caccgctctt cacgctcgcc tggcttcata ttaagcacaa
   125701 acacgtcgtt tatatcttcg taatacacac cagtgtattg cttaacagcg gtcgaaactt
   125761 cattggtcat gtgtttttca ttgtacacat cagcaaaaga aattacctgc gacatctttt
   125821 tacgctgaga atcattaaca gctcgcatca tatcaaccat gtgattttca atatattttt
   125881 cgcgagtcaa agattcggat ttatttgtta gttcatcaaa gcgagggctc aagtattctg
   125941 atatgtcgta tgccagtgat gccatgtttt tagcattaac aacttcatat ttcttcacaa
   126001 cttcatatgg cagatcaact tgtcctaaat cgccgttgcc ataacgcggg gaattaacaa
   126061 taactccgat agcttctgat tcaggagatg ttttaccgcc cagggccgtt atttcatctg
   126121 ggttttcaaa tcggtcaccg tgaatttcaa gtgaatttgc aaatttatca gatgttagtg
   126181 ctcgcgacgc atccaggaaa gccttcttgt caaggtgcgc acccgtgaga acagatcgag
   126241 ggctgcgctt gttttctttg gccgccaaag tgccttcaac agcttcaact tttgttactt
   126301 tctcgccggt ctttttgtcg attacgacct caccgactgc agccggaacg atttcataaa
   126361 gctctggatc aattcctagg cctttaatgt cagccaattg tttcgatttg cgagcaacaa
   126421 ggatgtacat gtacttgttt tcgaatttgg ccatcccagg cacatattga aacattcctt
   126481 tcccgcgctt gttaacgatg cgctcagcga ttcgagcgag tgtcttggat tgaccctgga
   126541 gttgtttgat cgggaatctg atgagacatg catcagcgtg aataagtttc atcacgtcaa
   126601 ttgtggtgtc acatatcgca ttcattgcat cgatcgggtc tgaaccaagt cctcccttca
   126661 aaacttgcag gttgcctttg tcagacattt gcatgatttg aacttgcatg aatttatcgc
   126721 ctggcttaac ctgcttgacg gcatcacctt ttgcagcgta gttgcagaat cgaacaacca
   126781 aattttcttt tcccgcagca gcgatagcca tcatatgtgg cacttttgct ttgggcgtta
   126841 gattagcgac attaaatttc atcgctgaat cgaacacttc attaagctgc ccgtccatag
   126901 cgttatcaat taccattgtt ttctccggag tatacgtaaa acaatattta aacaactaac
   126961 gtcggaccgt tgaactggct caacggcaaa gcctttgccc gtatcagaca tttcgcggtt
   127021 gaagaattag ggtggtcgag atattcaaac acttcgtcta tgacgataac cgtatttcgg
   127081 tcgaggatta tctcgcactc ttccggatat ccggtaatct tggcaggaac gatgtgctta
   127141 attccagaac agtcaatatg catgttgatc tttatttgcc gatttgggaa gtcgggatta
   127201 taacgaacaa cggctgtcgg tttattgata tgcagattac gacattcgac aattccgtgg
   127261 ttgtacataa ttggagcgat ggaagttgat acaaaatttt tgaacaatat cgatccatta
   127321 ttgcggaatt gttcgtaaga cgcaactggc atcgacattc ctcgccatac actcccacga
   127381 aattcaatag aatcatccat gtagcgatcc atcacttcga cgcactgctt cgcgaatatt
   127441 ccagctgagc cagaatcgaa cgtcccactt ctcaaacccg ccgcgacact agcaaatcct
   127501 tcgtcacaat agttgtgtat gtgatcgtca aactctatgc tgcctaccgt cgagcgactt
   127561 tcagaataac gctcttcgag tactcgattg catgagtgga ttatgtttac gcatgtgtcg
   127621 tgatattggc tgtcagagtg atagtcaaat atcatccgca cttgttcata cgaccccagt
   127681 tctaagttca tccacggcat atgccctaaa agccatgccc cggaaccgca tttagaccaa
   127741 gcccagataa actctttgag agttatgggc tgattgatcg tatcaatcgt gaaattgcta
   127801 taatccggtt ctgcttcttc ggacaatttt ccaattgatg gcgatttctt gtgctggtaa
   127861 acgcaatcac ttatttcaac tttaattatg ttgtcgagtt caaacattat atgctccaaa
   127921 tgagctcccg aaagagctct agaatagagt tagtcaatac ggaaaaacac ggtgattgcg
   127981 tagtcgtcac aacctacacc gtttttgtaa ccacgatata cttgggccgg gtgccaacct
   128041 gagtcgcgga acacctgcat gggtttgaca aaaatggacc actcttcgcc atctggatga
   128101 tgcggagctt ggccaaagcc atctttaacc agatgggcga tagccgtcac cgcggcgagg
   128161 tcattggcga ctacaaactt aaactcttta ccgtcataac gaacatgtag attcatatca
   128221 ttttccttgt ttggtttctc gtttatagta tcattgtttt gtcatggtgt aaaccacttt
   128281 tcaataaaaa caaaaaaggc tccctaggga gccttttatc aatccagaat tgcgtctggg
   128341 aaaacgtcgt ggatgtggtt tgcgactttt ttgtcatgcc gaatcaactg gaagataggc
   128401 aaaaacagct tgtactttgg ctcgtgaggc tttcggcctt ttcgagtttg cagaccatta
   128461 cacttaagtt gagcgataga acctttcagc tggtcaatct gagtcatcag caattcacgg
   128521 tcatattcat gccgctcgct caatggtatc tcaaccttct tgccattgat tttacggtga
   128581 gttgtatcct tgaaccctga gccacaattg acttggatgt tacctgaagc atcctgtacg
   128641 gtgataccgc ctactttgtt tgggtgcttc ttgtgtggat aaacatcaac gataagcaaa
   128701 tcaatttcaa tttcttcttt gaatttgatc tgatctgcgg ttcgcgcatc gacccacatg
   128761 ccgtgtttat ttttcaaaat gataccttcg cgatcgcgtt gcacattccg gcgataaatc
   128821 tcgagtgctt cttcgtaatt ttctacttct tcgcattcga tcaattcgat gtttgaatac
   128881 ttcattgaac ctgtgtcgcc aaccaactct ttgaggagat tgaagcgatc ttcgcattcc
   128941 atgaaacatt tacgttttcc gaaataaaca tccgcaggaa cgatatccca aacgttgaac
   129001 aacatttccg attgttcttc ggcggtaaga gtaccattca gtgatttatt gccgaggccg
   129061 ttagacttgt ttcggtctga ttcttggcca ggttcttcag taatttcttc aagtccgaac
   129121 aaatcgtcca gggtgtgttg ttttggagtc tttactggtt tgcggtgtgg attatgaacc
   129181 aactcgccgt caactacaaa atcaccaagt ttgccgttca atgcaccagc aatttctttg
   129241 agctgcgctt tgatatctac caacccaata tactcgtttc caccgcgtga cacgatatta
   129301 atctcttcac catcaactga aatgatagcc atcgatctgg aaccgtcggc cttcagttga
   129361 gcgaaagccg ggaaaatgat ttttgcgaga gctttaagac tgaatgattc agccaggaag
   129421 catggttgct caggaataat gcctggccat gttttattgc caagtgcaac tgatgcacca
   129481 cattcaaggt ctcgagccag aattcgacgc gcaacttcac agctcgcact tgtcatgctg
   129541 tccaacattt gctgcatata gttgaaacct gcgttgccgg tcaaattgcg agttgagtat
   129601 tttgaaacaa gctcatcgca gaattgttcg aggctcatcg gaccgacgga acctatgaaa
   129661 cgtaaacctt tcggcgtaat accgtaggta aggcgtttgt tgtaggctag tttgaaaact
   129721 gtctcaagaa gagcattacc tttatgctga cctaagattt tttctttttc tttggttgaa
   129781 tctgtggctg ccagagaatt aaggatgtct aaaatatgcg tcatgctttc gcctcgatgg
   129841 taacaggttt atcttcccaa gtggaaagat gtgacaagtc cattttaatc ggttttggat
   129901 tgagattaac aaggagcttc tcgatatcat accaattctt tgctgtgtgg tatttcgcaa
   129961 tatcgtgctt tacttcacgt gcattttcgg tgcgcaacat gtgaatttgc ggcaattggg
   130021 acatcgcatc atggcagtct tgcaaattac ttaccagatc gtcaacaaag caaacaagcc
   130081 ggtctttata cttctgctta accgagatgt aatgtggcat ttttgtttcg ccgatatcga
   130141 cgcacagaat gtctttaaaa gcacctggga acagggtatt gaggttgcaa caccggttca
   130201 ttagtgcttg gttcgaatct cccagagcag taatagcaat aaaatcgtaa tgctctttga
   130261 gacggttaac aacgtcaata gcgtctacat atcctgccaa atattttatg aagtcagagt
   130321 tgttgtattc gcgcatcagg atgtccgcga tgcggccgtt aacaccgaaa agttcttcgc
   130381 cggtgcggaa acgctcgtca acgagagttt tcagaatttc atcagtacga ataccgtttt
   130441 tctgcgcgaa atacggaaga ccggaagtcc attgaaccag aacgccatca acgtcggtca
   130501 gaataatcgg cttttcaatt tgcattatat ttcctctttt tatgtctctc atattataca
   130561 ataatggggt accaaaagat accccattta aaattatttc aacgtgttga tcacatccat
   130621 aggatgcccg ggtacaagtt ttagggcata ttcagtccag catcggccat cctgttccct
   130681 ggcaaacttt tctaacttga atattgcatc atcgggcgta tttttgatag gacgatcgca
   130741 gatgcgccaa tttccgtctt ctccttgaac caacttcggc aaagtgtgct gtgcaggtcg
   130801 gccgttttcc aggaataaaa ctttgctgcc gttcatcaga tagtagtcgc tattgaaagt
   130861 ctgctcttcc accgcgatat ctactgcttc aggatacgcc gcattcgata cgtctttatt
   130921 cataaaccat cgattaagca gagccgtagg aatacgacat tcaatagaac ctttttgatt
   130981 ttcacgggta aagagttgcg tatagaagcc acgattctga agttcttcaa cgacagcgtt
   131041 cttaacatct tcaaccattg gctttgctcg agcgccataa ccttcgtcgt tatttgtgcc
   131101 atgccattgt gtcatattct gacagaaatt aacgcattcg cgataaacgt cacgatcact
   131161 aaggcgggta cgatgctctg aagacatagc agtttgccaa gccaagcgac tcgctaatcg
   131221 atttactaat ttctcttttg atggattgac atcaaactca ttgtatcgca ttgtcgcgac
   131281 atagtgggct ttaattgcgt tcattttatc ctcggtgggt tacactatac tgggaacgta
   131341 aaagaaaggg agactcaaag gtctcccatt ttaattactt ctggcgcttc cggccttcat
   131401 gcttgggctg accaaacata ttgatgtgcg ctacctgacg gtttacacga gcaaccagtt
   131461 tattgccgac ttgatcgatt cgagcgttct tgctgcgctt gtaaccggtg cggccagttt
   131521 tcggagcttc aactttcttt tcaactgctt tcatttgctt agccattttc attttcctta
   131581 ttgaattgtt taactattat gcgtaaatta cttggatgtt tttccagtgg gtgacagaca
   131641 ttttgcgact ttgcttgaca tcaatttcac cacgaagata tcgagggtct ggcacattat
   131701 ccaatcgacc attcgggacc aggataacca tgcctggttt gatgtgatcc ggaacttcag
   131761 ggccaaccga gataacttct gcggtcagcg gaatttcagg caggtcgcgt ttacccacaa
   131821 caaagccagg aattgtagaa gacatgatct catcgccagc acttgcgagc tgctttgact
   131881 cgatgatgat gctctcgaat tgagcgattg gcaaagcgtt atcgaatttg ctcatattta
   131941 cctctttgag ttgatgaatg aattatataa cagcccgaag gctgttaaac aattgcttaa
   132001 aattcgttta cggcttcatc aaccagccag gttttaacac catacttgtc agaaataagc
   132061 tcaaagcgac tcgcgttttc taccagatcg tcgatgtacg atttatcctg ggcgtggaca
   132121 tcaaagtaaa ccgctttcgg agcaacttca acataacggt catatgtgaa ccccatattg
   132181 agatactctg gccgactgtt aatgaggcca gcaagcgtgc cgataccggt gccgttgatt
   132241 gaaaccagac gatcaatacg gaatgaacgc cagcctttcg catcaatatc gtaaacaacg
   132301 acattaagaa catttgactc tttgcgttct ttcttctcga cctcctggga atcagccggt
   132361 ttgaaagcat tgctaccacg ttcggatact tcgaccagga taggatcgcg ggttgctcgc
   132421 attacccggt gagtatcgtc agcctttttg aagatcagct catgctggcc atcgttaaga
   132481 acagaaaaca ggagttgttg cagaacatat tgctttgaca taatttcacc ttacagttgt
   132541 gattctttgt tcagatagtt tgccatttcg cgtcggatga tttcaggcat attttgtttg
   132601 catgcagcaa ccaggcgcga ttcgatttca gacaaagctt gggcttttga tttcgcgatg
   132661 gctgtttcag ctcgggaaat atacatttcg atgaaatgtt taccggcttc ttcgcgcttt
   132721 ccaagttctt tgctaaccat ttcattggcc catgcttcca taccttgcat cagcttcaga
   132781 tcttgttggc gagcatagtt gcgaacggcg tgagccaagc ttgaagtatc cttcaactgt
   132841 gcatttgagg catcccaacc attgtttgtg attgttttgt tcagcatgtc acgaacaatg
   132901 gaatatgaat ccattgaaac accagcatca cgaacagctt tttgaatctg ctctcgagtt
   132961 acgccttcaa ggtgtttttc ttgcattttc ttggcgaagt tagcaattac tgcattttgc
   133021 agttcaaccc gagcttcgga accttccgga aacagagctt caatggcttt cgtatcaagt
   133081 tggattttca tttcgcgatt accttgtaaa cagagttggt agtcaagacg taggtatcac
   133141 ctttgtagtg cacaatggct tgaatgcttg acgtgcggac acattcgcct tccgcgaaag
   133201 atttgtgccc atagacccga ccgatcagac gattataatg ttcacacaat acatggtctt
   133261 tatcgacttc gatcgtgccg gtaagatttt caggctgcaa ccaatccggg tcaataccaa
   133321 cgttgatgca accctcgtgg gtgtctacat tgaaataacg tacttcttca gcgataacgc
   133381 cttcgccaac tggaataatc ataacaaaac ctctttttga atgtatggat atcgtatacc
   133441 aatatccata agatgtaaac tagttttggt tgcttactgt aaattctttt ttcaacaaat
   133501 tcagtggaac tttgttgtga ataaccttta taccagattt gacaaggatt tcgtcccagc
   133561 ctggagtatt ccgatcatac aactcgttgt agaacacttt ctttatgcct gattgagcaa
   133621 ttgcttttgc acattcccgg catggcgaga ctgttacgta catttcggca ccgtcaatcg
   133681 actggccgga ttttgcagcg taaagaatgg cattgagctc agcgtgaatt tcgttgcaac
   133741 tggaccattc attatgcgct tgacggtaca tggccttaag tttgccggtt tcagggtcaa
   133801 gccatccggc agctttcgca tggtcatcac agttttcatg accaccggca ggtgtgccgt
   133861 tgtatccggt tgaaatgatg cgcccatctt tagttataat tgcgccaact ttccaagaca
   133921 cgcagtgtga ttcctgtgca acaatgtatg catgttgcaa aacgctcgaa actttcatca
   133981 aataatcctt gcaatgttga tttgcccgtc gatggaaata gtgaacgcgt aatctacccg
   134041 agttccttct gagttgatag tcgtcagctg aaattcaccg aaaccggttg gggtatattc
   134101 cacgcgaaca cccgggtcga ttgccttgca tttctcttca aacagaacac atttttcagc
   134161 gatgagttgc tgggcggtaa tcatttcgtc tgcgctaaca ttggtcattt cattactcca
   134221 tttcattaac ttgatggtat cttatcatgt cattaatgtg ttgtaaacag tctttttcaa
   134281 taaaaacaaa aatgccctcc gtagagggca ttcggattaa aaatcgccag gttggacttg
   134341 ccaacattca agtccgatac ggcgccacat atcaacgacc ttggtacgat catcaatagc
   134401 gcggaaaacg ttccaggcgg gtgcgatctt ttcccagaag atttcttctt tgacgatatc
   134461 atccgggcga ctatcgccag cagcacgctg gaagtgagca tccggatagc aaccgatacg
   134521 gcggagtgct tccagactat cagcttcgga gactccatca cgtccggaaa cggtgaggca
   134581 ggagtaaccg cgatctttgt acatgctgaa cagttcaacg attgaagggc gaggagcatc
   134641 ttcaagcaca cgattccatt ggaatgggcc acgttggctg ttatcaaaca gggtaccatc
   134701 caggtcaaaa ataacgcatt tcggcaggtt gtaatcctga cggtattggc gaacgccacc
   134761 atatgctttc atatattggt catattgacg cttgacaaca tgctccggca agccacgggg
   134821 acctttgtag cggttacgct ccagaagagt ttccaggctt ccaggtgcaa agaacttgag
   134881 ctcgaaatcg gtgaccatgg aatcagcaaa ttctttccat tcgtgttgaa cagactcagc
   134941 catgttggtg tccgaaacga taacggtttt gctcatattg atagcttcag ttgccgctgc
   135001 tttaatagct ttggtaacaa gtgcttcact atgcttgtta aacttataat cagaccaggt
   135061 gcggcagcca aaaagactga agcgatagtc gtcacggttg agattgacgt atttggtcgg
   135121 ggcgctacga accatttctt cagcccaagt ggttttgcca gaactggtcg ggccgacagt
   135181 acaaattacg cgttgactac tcatctaatt cttccttcac atatttgtat gattgctttt
   135241 tggtctttta tgtatcgatt gacatcttca agccatacgc caagacgatt gtagtcctca
   135301 aaactcagag ttgcgccttc agttgtcgct ttccaggtaa cttcaagttt atggacgggt
   135361 tgtggagttg gtaactcctt tggtttggct gcgcaggaca tcaccaggag tgacagtaac
   135421 acgatgccaa tatgtttcat tgacgtcatt tcgttgtctc ctggattttg tcggtcaact
   135481 gccgaaaacc agtattcatg tgtttttcaa gaagttgcgg ctttttctcc gcaatctttt
   135541 ccatctgcct tgtggctttt ggggccttca gcatcgcttc ttggactggc ttagcattct
   135601 caactgagct aacttgaaac ttttggattg tttcaatctt tgtctcaaga ttatcaattt
   135661 gctcggattg attttttatc gtccatccaa gcaaaccgat aattatcatg taaagaacgt
   135721 tatttcttag ccagctgatt gttgaactca aactcggcaa catggcgggc aaatccttcg
   135781 actaaggcaa tgccagcgtc ccgttcaaga ccgtcaatca ttatgtccat accaccacgg
   135841 cgaatttcga gtttggccga tttcgggaaa acatatttca tccggcaagc atttttatgg
   135901 atgatgttaa cccgaacttt ctgggtcaat ggagacagaa tgaagtagaa cttcgcgccc
   135961 atgaaatgaa cgtttggcat tgtttcgttg ataaacacct ttgcaggcac atttgcaaaa
   136021 acgtttttca actccttcag aacgtcttga gccagtggac cgatatcgtc tttgaggcga
   136081 ttgtaacgat ctgctgcata agtacgggag tattcttttt tcttcgcatc tttcatcatc
   136141 tgctgacgga gatcggtaat atagccgact tcacgaccgt ttttggcgaa gatttgaatt
   136201 ccatcagaat aaccgccttc agcgaattcg ttgataatat cttgagtggt gaacattttt
   136261 ataactccat ttgatttgat ggaatcataa tataccaacc actcaggatt gtaaacagtt
   136321 tttgcaaatt tatttaacga tattttgccg gagtgtactt gtcatagttc ttcaccatat
   136381 gctcttcgat tgccccgatc acttcctcag agtcccagtc gcgggcgtac tgccgcatga
   136441 cgatagaaaa cagataccgg tgatcgctca gtttagcctg ggcttcgatc gcgaaagacc
   136501 gtcggtcttt accttggaga gactgataaa cgctaaagca caactcatgg tatcgagaaa
   136561 tggtgctgat atagagttct tcaaagtctt cgattttcgc aatagaaacc gcatcgtcag
   136621 cgaaaaggcc ccggagatcg tcggtagctc gctctttgat agattgaatc aacgctttat
   136681 tgttattgat ggaatctttg gtgcggtgaa gcgcagaata ccaatcggtt tttagcttaa
   136741 agagttggcc atcgtccata atgccgataa caccttcaat atcggtctca gctcggacac
   136801 ctgcttccca ttcagctgga gtaatctttt cccaatcagg gctaggataa acacctacca
   136861 tacgactacg ggttgccggg tcattcatga gagtgctgat attgacgtat tcgccagtct
   136921 cattatgacg aacgttcagt acgatgagct cttcatcttc gtatggcaga acaatacggt
   136981 tactcgggcc aacatattcc atgttgaaag tatagccagg cccgctatca gcaattcgtt
   137041 cgcgcagttt ttcatatgct ggcgaattca acaaagccat agctttattc gcttgatcag
   137101 aatggatagc tgctttggat ttgagaaaaa tgtaaccctg atcgtgatag ctgctaatga
   137161 gcgaaccatc tgctttttcc atcaatccga ccattttggt gagatcaaga ttcatggtga
   137221 aagggttttc tttcaagttg aagaactttt gcattgggcg agccatgatt cgaacaggct
   137281 tgccttcttc ggtaatttca aacatgatgc cgcgggattc aagcgcgcca ggaatcaacc
   137341 agtcagaata agacgcgata aagtagctaa agattcgtgc tttagttccc atactggttg
   137401 tcacatcttt gaaaaagaaa ttacctttct cagaagaatt gacaacgttc atcagattgt
   137461 cgtaaagttc agtaatattg gtcatttctt tacctttaat ttcgaattaa gcggagggtc
   137521 aaatatttcg atgtattttc gttcttcatc gtctaagttg gcgatgacgc ttgacccaaa
   137581 aggagttgtt ataactatct tgaagcaatg ttttatccaa acagttactg gtactccgtt
   137641 gcgaacggct tcctcaagaa gttcagattt ttcgatatgg gactgatttg tgttgttcca
   137701 atatttccca ttggagtagg aatccatacg tttatgaaga ttcttcgttt gcccgatata
   137761 agctacagtg tcgcctactt tgaatgcgta tatcaagtgc ttaaaatcgg ggttctttgc
   137821 aaacgtgcgg tctattcgat cattttctcc aataaacaat tgggctattt gtgtaaatcc
   137881 gtgctgttcg agagtcatat aaaatcatct atgcttggca catccttaaa catgcgatta
   137941 accagattgg cgagaatatc accgtgacag ggcaacggtt tacaaccaca gcccagtttc
   138001 ttgcctctta gggataataa atcatcccgg gttatggcgc cggtcctgat ttgttctttg
   138061 agatgcttct tgtaattatc gagataatct tttcgggtcc aatggggctc cccgtaagga
   138121 ttaccccata tcgtgccacg ttgaatcctc acatcgcaag gttcatgttt gacatttaca
   138181 accgtacaga tcatacggcc atcggcatct tgattggcgg gtgaggatca tattccgtca
   138241 gaacgtagtc gtcaacagtc atggtgcgca attcagccaa attagctacg tcgtagtagg
   138301 caagtttcgg cagcggacgt ggatcccgcc agaagatttc aaccaaatca tcgacgtgat
   138361 tctcgtaaac gtggacatct gcaccagaaa atacaagttc gccgacttca agaccgcata
   138421 tgcctgcaat aatgtgaacc aagagggcgt aagaagcgat attgaatggg agacccaacc
   138481 cgacgtcgac gcttcgttgg gaccacataa gactcaattt gccttcatat acttcgaatt
   138541 ggaatgcgaa atggcatggt ggcagagcca tagcatcgat atcttccggg ttccaagcaa
   138601 caaccagaag acggcgggaa tctggattcg atttgatttg gtcgataact ttttgcaact
   138661 gatcgactgg gttcttattg ccaaactgac gccactgctt gccatatacc gggcctaaat
   138721 aaccatcaga atatccaaga ttgattgcct gttcttcata gttggcatcc caaatagttc
   138781 gcttatcgga attcggccca tgggttatcc tgcgaagatg gtcgacgtta gtggagccgc
   138841 tgataaacca cagcaattcg ccaactaccg atttccacgc tagctgtttg cacgtcaccg
   138901 cagggaaacc tttagacaaa tcgaatcgca gcattcggcc aaatactgac cgagtgccaa
   138961 caccggtgcg atcggttttg cgacggccat tcgcgataac atcttcaact aagtctttat
   139021 attgaatcat ttccatactc cttcgcggat actacggcag tgcggcaaat cgacagaata
   139081 tctgtttgaa tttagttgct taccaccgag gtatcggttt aacgattttt cactaatgta
   139141 aattgatggg ttaatcgtat catattcagc ggttagcatc aaaaagttta tgtgtatttc
   139201 atcacataga tgcaagttat tgattatcat accaaggccg ccgataatcg cgatatcttg
   139261 gtctggatac agagattcaa cagtactcat ccaatcatgg tcgtttatgt tgacgtgcaa
   139321 cgccggcagt tcaccggatt tgttccggca acttcggttg atatcaccaa tgacaaccat
   139381 tacccttccc ggaaggttga acgggagcga ctggaacgtc ttcgctccca tgacgcatat
   139441 gcaacccata gttttttcgc ggaaaagcgt aaaatctttt gggatctttt cccaaggtag
   139501 gtcattgtct ttaccaaatg caaacattcc attcatgtga aaatcagacg ggacacctaa
   139561 agcaaatacg gctttaatca ttctggacct ccatatttca ctaatcgata aagatcgctc
   139621 gcataagccc ggcacgcata ctcgtcgtcg gttccattca aaaagccttg ctcaatgtta
   139681 taccatgaaa gacgcgatat gtcatgcttt attgaatgat atgtttcgta tgtcaacggc
   139741 caaaaactgt aatgttcttt tagctgagca agagaaaagg ggcattccag ccccttgtta
   139801 atttccgtca ttttaatcct cgcatttgag caggaatttg ttgttgattg ctttgaagtg
   139861 gaccatacgg ccatcaacca attcaacgga tttatataca acgccttcgg caattttatg
   139921 ctcgatcgat gggatatcgg cggcagcgag catatctttc acattggtga attcctggaa
   139981 cgggtaggag tagccgagtt gagggcaaat ctccatacca agggttctgc acaggtcttg
   140041 gaattcttca tcggtggcga aacgttgttc gtcgatgaag aatgcgcgga aagcgaagat
   140101 gcgatatttg tcaaagttct cacggttctt ctggataccc ggacccatca gttcgccctg
   140161 gattgctaca gacatcctga gttctttcaa gcggtcaacg atttggtagt tttcaacacc
   140221 cttccaccat ttgctgtcag cattgtagcg gagaacttga ttgcgtgatg ctacaatgaa
   140281 ctgagcatca tcataatcgt gggcatatgg ttcttcttcg gtgccgagat ccaggaaaag
   140341 ctcagggtca gtaacccacg ccatggtaat ggaacttccg tccaacttca gagatttagc
   140401 aaacttgaca tccgcgtatt tctctttgta gcgattgaag atattttgac agcgttcttc
   140461 atcagttttt ggaatgaaga tcgggaaggt accaccggga ttacagccag tgccatcctg
   140521 cggcggctca tatttgatga tgtcgagcat ttgatcgata gttttgtcca tctcctggcc
   140581 gcccagcagt tcgccaacag tgaaagcacc ggtaggaagc gcaatacctt gactgatttg
   140641 accgcggagt ttaatggttt tgattcgtgc gcgcattttg ccgtcgtaaa tctttgcgcg
   140701 ggtttccagg aaacggaaag ccggatgatc agtaggcagc agagaatcga tctcgaaata
   140761 gacacagtca gagcctaccc ggaattcgcc tttctttaca acgacttccc agccgtcaat
   140821 agttgcaact tcaattgcat ccgcaccagg gataggttgc agatcggcaa ttttgcgcat
   140881 ggaagcgagt tgacgttcgt cattaataat cataatcatt tccttaaacg tagatagtgt
   140941 ctttagcaat aatatcatcg ccgagatgaa tagcaacttc atgctggtca cggcgaattt
   141001 cagttatatc gatccacacg ttttctgata taaacttggt cacatgttcc ctgtttttat
   141061 ctaaccattc atcgtatgtc attgttattc cttactgagg gatatgtagt cataacccga
   141121 tattgtttcg ttgccaaccg aaatatgaac tttgactttg atgtcattag acgacgtata
   141181 atcggtgttt tcgagctcga catcaacttg catatgttca gcgacccatc gactcaaaaa
   141241 ctccgcgttt tgggctaacc acgcctggta agctttcgtc tcttgggatt cggattgatt
   141301 gcataattct tctcgcaaag gcataatatt ctccaaatga aggccgccga tcagcggcct
   141361 tttaaattta ctcgtagtcg aattcgaggg tagggcagat tttggacttt ttggctcgaa
   141421 tgtaattaat gacgatattc tcagttttga tggtgaataa ttctttttca gatgcataga
   141481 agaatccaaa aaagacaccg atcacggctg ctaatacgct aacaactagt gtaaatccga
   141541 atagcgtcgc atatacaaag ttggcgtcgt agtcaaacca attccaaagt gccttggcgc
   141601 cgactccgtg gaatatgatc gccaagaaag tcgtgataac gccaatgaaa ccgatcgtaa
   141661 aaacgacttt ccagaagtac gggcagagtg accgcgggat actcatatcc atagtgttca
   141721 acagacgata atgccaggat ttggtgctga ttttcatgat attttcctta tattccaaaa
   141781 atgatgttgt tgggaaaatt tagtgccatt cacttcttca aatttttctt tgtaatcgag
   141841 tatccaatca ccagccggct tagacttgat aagcatgaaa aatgcttctt gaccgccaag
   141901 tgcttcaacc gttttggcac cacgttcttc atgtaggtcc aaaagttctt ttggaagtcc
   141961 ggaagctcga gtgttttctg gataatcgag gatgtttttc attttatgtg ctccgtgttt
   142021 atcgatttga tgtgaccatt ctatacaacc gaacggcatt gtaaacagtc tttttcaata
   142081 aaaacaaaaa gggaacccga aggttccctt tctatattag cccagcagag agtcgagatc
   142141 gtcgtccaga tccgtaccac cagtttgttc aaaagcattg gctggtgtat cagattcgaa
   142201 gctggtcagt tcagcatcaa actcgttgag ttcagcattc agagaaccgg cagcacttgc
   142261 agctttacca gcagccagtg aggtacccat gatttgtttg aacttcttct cgaggtcgtc
   142321 gagagatttg aattcggaag gagctaccag cttgctgata tcttccatac cagcgtccaa
   142381 gaacttctgg aattctgggt cgttgatttt cggaatttcg ctgcagctaa ggaatttgca
   142441 gtcatcgtag ttggtaaaac cacctacttt cttggttttg taaacgaagt ttgcaccttc
   142501 gaaaacgcat gtcacatcaa caggagtttc gcccatctct ggatcgacgt tgatcatgga
   142561 agtgattttt tccataatct tcatgccgaa tcgcattttc attaccttac cttcgttttc
   142621 cggagtggca gggtctttga taaccaggat gtttgcccag taggaagtct tgcgcttcag
   142681 caggctgtac tcttctttgt tggtgttgta ggaatcgttt cggctcaagt gttggcacac
   142741 tgggcaatta tcaaaatcac cgtgagttga ggagcagttc tcgatatacc acttgttgtt
   142801 tttcttgaag ccgtggttaa tcagcttaac aaaaggcaga ccttcatcac ctttacccgg
   142861 caggaaacga ataactgctt gaccattgcc gcttgcatcg gtcttcagac gccattcatt
   142921 tttatcaccg ccaaaaccac cttgattacc tttcagagcg gccagttgag cttgcagttg
   142981 ggatgggttg ctacgcttga acatattttg atttccttta atttatttga tttgttttcg
   143041 attgagttta tattttatat catctttgga acagttaaac ttgatctttg aacgctttaa
   143101 catgttcaat aaacttccgt ttagctgtgt ctttatttat gacaaccaat tttcgatatc
   143161 cggataattt cgtatgccag ttctgccata tgatgtctcc ggacatcata gcgtcatgtt
   143221 tgtctaaaat gccgagaaat gaatcgataa ctaggaatgt ctcgattgat atcataccag
   143281 actggagcaa tttgaatatt gggctcgtca tcttatcagt attatattcc ataattttgc
   143341 ctaacggaac atccaatttc tctgcaaaat aaacaatgtt ctttatatct tcacgatata
   143401 tgttgggaaa acgtaaatgc cttcccaaaa gttcgcggtg ggctgtcatt gcttcgtcag
   143461 aaacaagatc tcctgcccat ccgctcggat tttcgatgaa tgttgcgagg tatatctcca
   143521 ccatatcttt aaggtgaaac ttattgctca gcttttcaaa aaagtactta tcctttcgtt
   143581 tgttaaacgt ggcatcggta actttcatgc cccagctgta ctttatgacg tcgtattttc
   143641 cggccatgtg ctgctttatc atcaaataaa gcatgaatgc acctttggcg ctaataaatc
   143701 tgtctggtcg cgggggatat cgaagagcaa tcataatata tctcacatca aaaagtcaag
   143761 agtgttcctg gtcattgaac ggacaatcga gggacgcaac atatccgatt cgatgcactc
   143821 ttgggaaagt ttgtcaatta aggctcgagg aatatacttt tggcagttgc tgatttcgag
   143881 cgaattttct tcgagccact ggatacatgc ttccatgtat gtgaggccct ctttaacaac
   143941 gagggcttcg atttccagac catttgatgt tttatcgctc aaattgtttg gatttgacat
   144001 tagttacctt taaagatttg gtcataggcg gaggtgactt catcggcggc atcttcgaac
   144061 tgctcgcgct cttgacgatg gtaaatccgc agtagttggt tgaacagttt accttcaacg
   144121 ccgcattcgc gtttggcaat atccttttgc tctttaacca tttcaccgta tttttcctgc
   144181 tgaatcttca ggttggatgc ctcaacaatc aattgctgaa gacggtcacc gtgaacagac
   144241 gggttgaatt caactttttc tttctttttc ttttctacgt tttccatgat atttccttag
   144301 aattgattga cttttgtgag tagtttagtg aggcgatttt taacgaagta actgtaaagt
   144361 ttaccacgtg gattaactgt gcagttatta taactcgtta gaattttttc agcaacgtga
   144421 tcaggaattt gagataaatc aagcaatttc acgttttcat cccatcgttt ttgccattct
   144481 tcgttttcga gagcagctcg gggatcttcg gattgtacca aactttcgat ccatttggcg
   144541 gaacatgggg gtgctctttc gccttcaaca cgatcgataa cgtaagttga tcgacatttg
   144601 ataccggcta caccgtcctt gccatcaccc ttaatgattt tgtagaacaa atcatgcttg
   144661 gggcttccgt ttttcggctt aaccgatttc ttctgggccg gagaatattg cttcacgcct
   144721 ttgaatttgt gcaattgagt gaagtccgag tcagaagaag atatcataac gcatcggccc
   144781 tgatccgtaa atagttttgt caggatagcg atgatatcat ccgcttcggt tttaccgatc
   144841 tttatcatct taacaccagg ataaacggtc agcatctcat caacaatttt attgatgaag
   144901 ccgaacaaag catcccagtc ccatttggat tcttcttttg aaatagaacg gttcttttta
   144961 tagtaccaag ccaaatcgcg gcgccagtat ccatctttcg aatcatcaaa tgcaatgatt
   145021 gtttctggat actcagcttt aaacttctta acgttgtttc gcattgtatc aaaaatgaga
   145081 tgtcgaagca tagcttcgtt aacctcatct ggctcgaagt tggccattac tgttgcaatg
   145141 ataagttgcg aggcatcaat aatgtttaca tcggggcctc cagtcttttc ggcctctccc
   145201 atgaaactgt ctaaattcat aacttgtccc tcgttgtttt aacgtggagc cattataata
   145261 aataattagt gcctatgaac aggagagctt taaaatgcta ggacaacact tccgagcgac
   145321 cagcggctta gatgcggctg gcgaaaaatt aatcaacgtt gctatagcag acaaggctac
   145381 cctgtctgac ggcgttaacg ttgatttctt ccacaaatac aatacaattt accagtacga
   145441 cccgttacgc gggtacgacg cgaaacacgc aatcatatac cagcgtcgca tatacttcgc
   145501 gaaagcagat atagcttctc cagccggaga attccagccg acactttgga ccggacttcg
   145561 cgtcgaccca acgtggcagt tcgtgaactc ggttgcaact gcgatgcaac ttgtgtcggg
   145621 gcaatatatc tcagcagata accgtttcaa caaccttgta ttcaatctgc ctactgatcc
   145681 gattgacggg gatacaatcg taataaaaga tatcggcggg atgcctggga taaacgatct
   145741 ggtattttcg actatcggcg cagccatcat cgagtataac ggacaaactc gtggaagcag
   145801 tttccgcgga actatcccat tctgcgaata cgttttcatg tacaaagctg ccggaaatcg
   145861 ctggcaactt gacatatgcg catcaactga gcaaagttat tttgttgctc cgtctacgca
   145921 aggtttccaa ctccagtcag gaatggttac ttggagacag actgcccaag gtcagatccg
   145981 tctgattttg ccgaagcatg ctaaccatgg tgatgttata acaacccacg acattgacgg
   146041 ccttaatgct ataaatcatt caacgcttga aatttatcct ggaagtggcc atagcatcaa
   146101 cgagaatggt gtaacgttaa tcgaatcgcg gacttctggc tacggctcat tcgtgtttga
   146161 ctccggtgca aaagtttggg aagtttggga tggcgatcaa agaactcgta ttcgcgtaac
   146221 aaaggcggat acatcggttc tgccgtttga acatattctt gtaacaggtg acggcactgg
   146281 agcgagccaa gtggtcacac ttactctgcc tgaagatgtt gctataggcg accgagtaca
   146341 aataacatta gattatttgc gccgagggca aacatgtaca attcaggtaa aaccaaactc
   146401 tggcgaggtt atggtcgggt ctaaagccca gatgcaattt cagcgcagat ctgaatatcc
   146461 ggcaactaac ggttgggaac ttgtttcctc tgtgtcaatt gttgcaaaca ccgattatgt
   146521 tccatatatc gaattgatgt acgccgaact tgacccagct ttggttgggg ttacacctgc
   146581 acgttatggc tggatgatcg ggcaagttgc tccaaaagtt gaacgggttg acgcaaatca
   146641 acgtgaccgc ctcggcgtcg ccgccctagc agcccagagt gaagtcgata aaaaccacga
   146701 gcaaaatcca aacgatgaga ctattgtcac acctctgact ctgtcgcgta aaacatctaa
   146761 tgagactcgt cgtggaatac tgcgcatcgg cacaactgct gaagtaaacc aagttacaac
   146821 cgcatcttat ttggatgatg tcgcaataac tccgaaaaaa ctgaatgagc gttcagctac
   146881 tgaaactcgg cgtggtctgg ctgaaattgc tactcaagcg gaagcaaatg gtgcaacgga
   146941 cgatatcact atcgttactc ctaaaaaatt acataataga attgcggctg aaaatcagac
   147001 gggcatattg gctatcgtgc aaaaactcgg tacagcagga acagctcgta atctcgcggg
   147061 taccggcatt tataacagag ccgatcattt aagggctgtc acaccggcaa ctctggatga
   147121 gttcgcagca actgaaacag ctaagggtgt aggatatatc gctacccaag ctgaagttga
   147181 cggtggatca tctgatgcaa acggcccact actggttaca gcggaaagac ttgctgcccg
   147241 gcgtgcttct gaaacaaacc acggcctgat tgaaatcgcg acgcaagctg aaaccaacgc
   147301 tggaactgat gacgttcgcg ccataactcc aaaaaagttg aatgaccgta ctgctactga
   147361 gtcccgtact ggtattgctc gcctggctac tcaaactgaa gttgatgctg gtacttcagc
   147421 gctcacgctt ttaactccat tgaagttgaa aacaagattt gataatcttt cgcgggttga
   147481 agttgatgct gacgctggat taactcgcac cggaaccatt tgggacacag tgtcgattgg
   147541 tgttaagcta tctaccgaag ttcaacgtgg gaccttacga gtcgcaactc aagttgaagc
   147601 taatggatca actgatgacg cgaccgtaat aacaccaaag aaactcgacg ggcgtaagtc
   147661 tactcgaact ttggacggta ttattcgggt agctacaaca gcggaaacaa gaaccggaac
   147721 gtcacaaaca ctcgccgtat gccctcagga cttgatttac atggcgcaga ctgagccgac
   147781 atggtcagga aacgaaacta gacgcggata cgtaaaaact gcaacaatgg aatcaacatt
   147841 tgttggtaac gacactgttg gttctacaca agtctataca tcgtatgcga atgatggttt
   147901 ggctgtttcc ccacgtggtt tgaactatgc tttgcagaat tttttacctc tcaaggctac
   147961 tgctcaaaac tcattggcac tcggcggcgt taactctgct gattgggtac gtagaactat
   148021 tgctcaaact gtcacaggtg cgatgaactt cacagctgcg atgacggccg caaacatcac
   148081 atcaaatgtg acgtcggttt caagtctaag agtccgcgat ggcaatttag gtgcggttga
   148141 aattggcact caaggcgtta gtgttttggg aactggcata ttgatgcatt ctgctgatgg
   148201 cgctggtgcc gcaaacgatt ggttcatgta ttccggcggt cggtcgtctg ttctgggtgt
   148261 caacgaaatc ggttttgttt cgacgaatgc tgataacaca agtttgacaa agcaatttag
   148321 cgttagccgc gatggagact caacaacaaa tagacacatc cgttcaacta atggtcacgt
   148381 tgttctcgaa aactcaggag caagaatata cgtcggcggc ggaattgcta caacaaacca
   148441 attggcacag tcaataactg gcgggtttat tttcggtaat atcaactctg ctatgtcggt
   148501 tgtaaccaat ggtgacgata atttcaaaat caatggttct gtagttatca acgttgcgaa
   148561 tgcgcaaaca aaacttgatc cagtttatct gcgccgcgac ggcggtaaca cccaaacagg
   148621 taaagttctc gcagcaatga ccggcgatgt taaatacagc acattccgaa atgataaccg
   148681 ttacatctct tcgcgaggaa acgatttcgt atttggtaat actgacacag taaatggccg
   148741 tgtatgtctc gatacaaaca aaaacccaat tgttaagatt ggtaacttcg agtatgagat
   148801 ttatcacaaa ggtaacaagc caacagctga agacgtcgga gctgtagata tcactggttc
   148861 atcagccaac aaccttacaa ttcgcgattg gataaagatt ggcaatgtta aaatcatcgc
   148921 taataacctt ttgaaaactg ttgaatttgt ttgggaagaa taaggaataa aaatggcgac
   148981 tcaattcatg gcccacctcg ggccatctta tgttgaaact agccacctaa gtgaaaacaa
   149041 tgcgattaag tataagttgg aagcattagg ttctaacgct gactcaactg taaaagtccc
   149101 gttcattaag ttgaacgggg caagtcgttt gtcttcatat agtcgtggta taactgcagt
   149161 aacaataagt cctactggtg ttgctagtaa tcaggcaaca tttgatctgt acacccgtcc
   149221 ggaacacttt gacacactca ggtcatattt gatgtctgca ccgtcaaata atatcgtggt
   149281 tctagtgtca tatgatgcga tgaaatctac tgaagcattt gacgaattca tgtaccaata
   149341 tggctctcgc tcatggccag gtgtccctta cctgaataag gtattgccgg attctcggtt
   149401 gtataggagt tcgtatgtcg ctatttttaa tacgtctctt aagcgttttt gctacgagaa
   149461 tttcgttgga aatgattaca cagcaacatc ggatacctcc gcatatctcg aagtagtttt
   149521 tgatacggtt gaagatattg gcgcctgcgg aacgcctgaa cgtaaagttg atgatatcaa
   149581 tgaatatttc agccgtccag acgattatgc tttcatcaga tatttcccaa ctgaaaatat
   149641 aaccaactgg gaagcaatct atcatgtcaa atgtgagtta tataacgatc aagttctaaa
   149701 agatgcaaac ggccatgccc ggctatattt gtggactcaa aatagcggcg gtacttggtt
   149761 ttcgcaaatg atactgtcaa acgtagatgg cgttgttggt caatggaaca catatgaggg
   149821 gtatttcaaa ctaccggccg caggcggcgg tgctacatta tggggctgcc aggcatacag
   149881 atggccgtca agtgctaaag ttggtttagc tggtgctaga aacgtcatag ttacccgagt
   149941 aactcgagat gacgatgaca aagttgaaaa tgctgctttt ggtgttaacg gtatgagagc
   150001 gaacacattg tctgacaatg gaaacttctc aaaccctgta atgcaactgc ttaatttgaa
   150061 accgaaaaac gttgttactt caaacgaact tcgggaacgt acctaagggc cttcgggccc
   150121 tttgttgtaa ataaattata gcaaatttac tggcacaggt ttggctctgc caaactagca
   150181 tttttatcct ttaaggccta atagattata taacctaaag gataaaaagg ataaattcga
   150241 gcgaagctcg aactggcgaa gccaggtaaa tcattcagat cgtattggtt aaatacaacc
   150301 agtaggacaa tagatacatc aaagcactgt atgaactaaa cccggaccta gctggctaat
   150361 catagaccag tccggttcac ataaggagac tgcaatggca gatctgaaag ttggaactac
   150421 gataggtggt tctcctgctt ggaaccaagg taatttgcca ttagttccaa gcggtgatag
   150481 aatattatac aaaggagcac gtgtttacag tgaatctgat aaaccgtctg ccgatgaact
   150541 gagtgttctg tcaataaatg gtggtcgttt gaagggtcaa ttacagattg attcagcatc
   150601 cgataacatt ttcgatttga actcaaccga ttctggcgca gttttcatgc gctatatgca
   150661 taacaatagc aacaaagcct acactggcat cgacgcgagc gggaactttt acgtccgcat
   150721 ggctgacggc gcatctcgcg ctggcattgc tttccaaatt gacaacgttt cgcaagacat
   150781 aaccttcggg gcgaacctga aaggtcctgc cggccgtgca ttctcaatca acaaaggcga
   150841 tcaaccgttc atccgtgacc acggcaacgg aaacgttaca atttcagctt tgtcaaaagt
   150901 agatggaaac cctggtgatc tgtacctcgg atacaattct gcaggcatgg tgaccaatac
   150961 agttcgactg gaaagtccgc tgttttggaa gggtgcgcgt caactggttg actctaatgg
   151021 tttcatcctt cgttcagcga tggataacaa ctattacaac caatctgaag ctgacgcacg
   151081 ttttatccgt ctgaacaata acaccacgac cgacggtttc atcctgtcga aaaccgctga
   151141 atatactgac gccggtcgaa acatgggtta ttctggattc tatcgccata atggtgttga
   151201 cggattctcc ggtttaacga tgcatgtcgc tcatcctagc tatagcaacg gagcatactc
   151261 ccgtggtatc acctttgctt atggttcttc gtcttatggt ctttacacct atggttatga
   151321 cagtgctggt gttcgtctgg cgaatcagaa aatctatacc gaagccgata agccgactcc
   151381 gcaagagtta ggtgcgctcg ccgccgaggc caacgcagta tcagcttcca aacttcagac
   151441 ccctcgtcgt atttcgcttt caagcggtgc ttctggttct gtattgtttg acggctctgg
   151501 tgatgttgtt attccggtaa caatcgcaaa cgacagtcac acgcacaaca tttacgttaa
   151561 gaaatctggc gacataatgt caggtaactt ggttgttaat gctgcagttg acgcgaatga
   151621 attgcgggct ggcgatgcga caactaaagc tagaattgct ctgagttcgg acaccgtatt
   151681 cttccaaggt ggtcctatcg gaactaccgg tttgcataaa atcgcgatgt ctggttatat
   151741 gggcaaagga atcgacgcac tgacctattg gatgaccaat ggcgttactc cggtagttcg
   151801 ttggggttca gttgacaaca agatgttcca cgaaggatac cgtccttttg acgtccagtc
   151861 aacttcatta gcttcaaaaa gctgtaatga cgctttagaa tcaggtttct actctatttt
   151921 cggaacaact gccgatactc catatggcac tggaccttct ggttcaacta tggttgtttc
   151981 acgctggtct ggcactggag tttcgcagac attttacacc tacaactccg accgcgtatt
   152041 cgtacgtcgc ttagttggga caacttggaa tgcttggttt gagttgtatt caacctcgaa
   152101 aattccaacc cctgctgaag tcggggcttt ggctgtaaac gcgaacgctg tctcagctac
   152161 tcgtctgcaa acagctcgtt tgatttctgg tgttccattt gacggtactt caaacatcac
   152221 aattactgct acaaacgttg gtgctctccc aataaccggc ggtgatatta acggtaacct
   152281 tttggttaaa ggaaccttga cgaacgaagg tcaactgatt tcgtacgaca gttcgacccg
   152341 cggttatggt ttccggtcaa cgtattctac tggatggtta tacacccaaa caggtaaagt
   152401 tgatcgcgac gtaaacgatc aaaagcataa tttgtcgggc tggtatggaa ctccgttgtc
   152461 ggcactgaga ttcaccatgg ctgaaggaac ttctcctcac gtcctttggg gttcaacgtc
   152521 tcatgatgtt ttgcacattg gtaaatcgta tggtgtcgga attcgtcaag gtaatggcgc
   152581 cagtaatggg cacatttaca ccgaagatgg aagtcgtgat ttcgacaaat tgattaccgc
   152641 tggtcgttat tcagtcgatg ggcaatggtt aaatggccga gccggcgcag cagctgcgac
   152701 atatgttgga accgctgaag ttgaagttcg cgcatggggc tcaggtcctg cctatatcca
   152761 gacgttcact caacttgaag gtggtttgcc gtcacgttac aaccgagtcg gtaccggaac
   152821 atatccgaat atcgtttggg catcatggga atcaggcaca aaggaatggg aatatcaagc
   152881 tggttatcgc atgatgattt ctcgttccgg ggaaggcgta tatccgtata tgaccatcca
   152941 caaggctgat ttgccgccga ctggcaccga gtctgttata ggcgcctggc agtcgaaaat
   153001 cggagctccg cctacagcta ataacccgga ttcagcacaa ttagcaacaa tagttgcatc
   153061 tgtcgtggat acaaccaatc gttatgctac tttaagattg tctgcacgcg atatcacaac
   153121 aaacggaata ctgtctattg ttgatattgg taaagatggt ttagtcgtga ccaatggtgg
   153181 taaaaaggtt gaattaactg caggcgttgc acgcgctgaa aagtttattg caagcgaccc
   153241 ttatgcattc gtttcaagta ctagcaacac ccatggtgtt tatcttggca atagtgctgc
   153301 ggacaagaga ctgatactcg gtggtggtaa caacaccgct ggcgcagttc atgttcgtcc
   153361 acagggtatt agtaccgaaa caggcgaaac agtattcaac accaacggta ccattagtaa
   153421 tggtactacc ccgagcgcgc ccggtcattt gaccaacaag gtttatgttg ataacctaat
   153481 tgctcagcaa gtgagtaaat ctggcgatat tatgactggt caactaacca ttcatacagc
   153541 aaacaatgca cctcttgaat tgaagagcac aactgctggt gtagtgacac ctcaatatat
   153601 catcggtaac gattctactg gggcacaacg ttggtatgtc ggccaagcaa gtccgaattc
   153661 tccagacgta cttctgtata gcacggcaaa cggaacttac cttcgcctgg aagcaaacca
   153721 aatatcgttc aacaaaaatc caatatcaac cgccttgcaa ggtgcagcag ctggttctct
   153781 ggttcgtcga gattttctcc aaacttctct gtcttcacag acaccgaata acccagttta
   153841 tattggagcc tcagcgaacc ttaacaacta ccaaacaccc ggatattact atcaggattc
   153901 caacgcaaac gcgggttccg gaagtaacta tccaacgcag caagctggtg ctttggttgt
   153961 tacgaaagct gctggaataa tccaagaata taccgtttac ggcactggtg ctcgttatgt
   154021 tcgagcgttt tataccaacg tctggtcagc ttgggcgctt gtgtatgatt caacccgtcc
   154081 gcctggagct actgcggtag gagcattacc aatagctggt ggtactctta ctggtggata
   154141 tttgcaattg cagagtgcga ctaactcgat attagaattc catcaacctg gtcgacacgc
   154201 tgcgatgatc ttcctgtcca atggcacagg ccaattaaga tttagcacat caaacggcgc
   154261 tgctggcgaa acgaatgttc gcatgacatt agatgcaaac ggtgcgctag caactaccgg
   154321 tagtatcaat ggcggcgctg gtgtttatga tgtcgggcaa cgtgtttatt ctccgaataa
   154381 cccgcagcca agtctgacac caacccaaat cggtaacgct ttggcgagta tggcttatga
   154441 tgctgttggt caatacgcaa tgctcttggt ggctgttgac gtaggaactt ggcttgtgcc
   154501 tggaaccgtt ttgccgggtt cacaacttag atactctaca gctgaaggta aagatccatc
   154561 aaattctcct ccaggaaact ggcgtttgca cggtcgtata aaccaaggcg gacaatgggg
   154621 tgcttggaac gtttcgcttt ggcagcgtgt tagctaaatt aacggagccc ttcggggctc
   154681 ctttggagaa attatgtcac agagacatgg tcgattttgg agtattggat ttaacgcagt
   154741 aggctacaca ggtagcctac ctgcaccaaa ctggggtact caaataagac gatttgctgg
   154801 tttaaacccg gtaggaaatg ggttagaccc ggctctatct gaattttatt ttggacaggg
   154861 cgcccaacct gctggtagat ggatgtctca atatttcaac cgaggtcgaa caccttcaag
   154921 atgtttcatg tggtcgggtt caagatatcc atacaatagt tggagcggtt ttgattgggg
   154981 tggagaattg acgcagatcg ctaacgcaac cataaaaatt ggatggattg gtacgggtcg
   155041 tgcttctcat agaggaggcg atatgggcta tatcaatttg cgatggaaat gggataacga
   155101 tttgtggcaa gaaactcgaa tattcacaac accagataca tacgtatctg attggtatgg
   155161 caatcgtgtt atgaacctca atcgcccagg tggcggtcgc ggcacactga cttttaaaat
   155221 agttggtaac gttggcgatt ttgaccagca tgacgttggc gatcgcggtc ctaacgctag
   155281 ttggtctcct gtggtcgaca tgtctgtggc gggttcgggc tatcaaggtg agcttttcaa
   155341 gtctttccaa ggtcaccaga caagacaata caacgaaaac aattagaggt aatttatgac
   155401 tttagaagat atgttggttt acgacgaagg tcgcaagctt aaggtttatt gggaccacct
   155461 tggatatccg acggttggta tcggtcacct gatcgttctc cgcgaaacca aggatatggg
   155521 tgtgataaat catatgttgg gcgaacaact aggtcaccgg gttgacgggg ttatctcaga
   155581 cgaggattgc tccaaactgt tcgaatctga tgttaaatcc gttaagcgcg agattggtcg
   155641 atatcctgct atcaaatctg catttgatgc atgcgatgag actaggcaga aagcgattta
   155701 caatatgatg ttccagatgg gcggtcctcg cctgagtggt ttcaaaaagt ctctcggttt
   155761 aattgctgcc cgtaattgga ctgccgcgta cgctgaacta ttaaattcat catgggcacg
   155821 acagactcct aatcgcgcac aacgtgttgc tcaggttatc ctgactggca ccatggacgc
   155881 atatcgttga tttttataca atttgccggt gcttcaccgg catttttgct ttaaatatca
   155941 ctgttaacta ggagtaacaa tatgtcaaac caaccaacca aaactgaaaa tcaaacgggt
   156001 ggtcgggctg gggtattgat ggacattttg gatcggttgt ttaaagacgc tgtaaccggc
   156061 gaaatagtat tctaccgagc aattcttctc acactcgtat tcctcatggg ctttagctgg
   156121 tatagcaaag aagaaatatt tgcgctatat aaggaaacac gttttgaaaa ttaccaagaa
   156181 atccttcaag ccgagcgcga tcgaaagttt gagatggctg cgcaagaaca gcttcaaatt
   156241 gcccacgttt caagtcgagc ggatttttcg gtagtttttt cattccgtcc acgaaatatg
   156301 aactactttg ttgatatgat ggctacggaa ggtaaaaccc cgacggatct tattggccgc
   156361 gaaaaaggcg gatatccaat aaacaaaacg tcaaacgaat atatggttca catgtctggc
   156421 cgacatttta gcaactacaa agaattcgcg tatttgcctg cgggccatga agatttcgaa
   156481 tacatgtaca gttgtccgat tacaaatctt gacaatatct atgccggatc agtgtcgatg
   156541 ttttggaaaa agaaaccagt tataaacgag aacaaattgt tcgttatttg caatcaggct
   156601 gaaaggcttt tgagcagagc gcggtgaaca ggcaaaagaa aagggaaccc gagggttccc
   156661 tttgttgttt ttatacttct tcgatagaac cggtgtaatc ggctttttca tcagtgtttc
   156721 cattgcgacc gttaagcagc aatgcccatc cctcgctagg tgcgaatgcg ctttttccgt
   156781 cgcggccgtt ccatgagata tcgtaggtat acaaatcgcc gtcgtcatca atattagtca
   156841 ccgtaaattc ggtgccgttt gtgattccgt gttcagccat aaaacgttct gcgtctgtta
   156901 cacgatactt ctttccgatt tcaatttgca taatatttcc ttagttgttt gagtacatca
   156961 tcatttggtg gttgacgtcg cgatgacctt ggttgaacat ctcgatcaat tcttcacgtt
   157021 gctcgattgg caagcgtttc atcatttgtc ggaatccggc tcgggtaaat tcttcacctg
   157081 tgggagatcg aaaacccaat tcgtttaaga atgaaacgaa ggtttcttgc ttattgagga
   157141 tatcttcaca accgaatttg atgagcaggg atgcagtggc aataatgtct ttgatatttt
   157201 cagaataatt catgtggatc tcgttatcaa tacgacttaa tttgatggga ctattgtaac
   157261 atggttctgg ccaaatgtat acttttaaat gtcacttaac aatttggtat actaagacga
   157321 tcggccataa aatggtcaac aaagaaatcg tgatagcgag aaatgcaatg gttaccggca
   157381 cagcatattt tccgaaaagc ggctttccgc tctcaagtaa tgacaaccag cactggattt
   157441 ggtggatagt cttttgcgtg ggagctcggc aattcatcat ggtgagaatc atgagagtta
   157501 aactaatcgc cacgaaaatg atagcaattg aaactcccag ccaatatgaa cttataacaa
   157561 attcaaacat tatcataatc cttctttttg tgtttttgtt tacgttttcc ctcagaatct
   157621 cgccttttgc gatctacatg gggtccacct ttgttgaaat cattcttcgc gactgggttc
   157681 atttttacct cacggtttat ttggcggctg cggcttattc ttcgacatcc aatcacgagc
   157741 ttgttgttcg agcttttgat tgtgcctctt gatgcgcttt tcttggttaa tgtctttgcg
   157801 aatttgccac atcagtccgc atccagcaac agcgaaaatt ccgtacacta tatgttgagt
   157861 tagaacagcg tcgatattca tccaatatgt cccattgaat ggggttccaa agaaccccag
   157921 gtttcaactg gcttagcagg cttgagcaac gatgttctta aggtacttgc cacctttaag
   157981 ggagtcggag atcagcgctt cttgaaggct caggtcatcc attttaatgg agtgggaatc
   158041 catggccagg cggatggctg cttcatgccg gcgcagttca ttttcacggg atttcgcgag
   158101 ttcttccagg cgagtctgat cgtgggcaat tcgttcttca attttcttga agagttcgaa
   158161 cgcttctact ttcaggtcgg agatcggcag cggcgttacc gtcggctcga ttttggtttt
   158221 cttcatttga aacattttga tcagattcca ggatttgtcg ttcatcattt tctccattta
   158281 cattaactat tgagtatgtc tcttcaatca acatgtcgat atctgagagt gatttcgggg
   158341 tattcggtac tagcatcaat atgttccatt gaatatgccg gtatgtttca accggcatta
   158401 tcagggttat ttgagaaggg ttacttcagc aacatcagcc cagtcggaat cagtgttgat
   158461 gaaatccgcg aggtaaagtg cagttcgcag agatactgag cgaagacggt cggtatgttc
   158521 tttcatccat tcgagagcat taacagtctg ggcttcggtc aaaccacgtt tttgcagcat
   158581 atcggttttg gtgataacat cttcaacacg aatcattatt tcgcgagaag tgtgaactcc
   158641 aaggtcgagg taaattgagc gagactgcag agcatcaagg tgcggagcaa gtttggaacc
   158701 gcgggctact tcagcatcga tatcagcgtt ggtgatgaaa acaactgaac ctttgaactc
   158761 aaaattgttc gggatatcgc gttctgccag gtaattgctt gctgtacccc atgaaacaat
   158821 gcgttcttca ccagtatcga gtgcagcttt caaaacgttg agagtatctt cattggaaaa
   158881 cacatcaacg tcgtccaaca gaactacaca atcgtcttcg cgattttccc agaggtgaat
   158941 gtaaagacca attgctgagc atttaccttt gatagatgag aaatcgattt cgccaacctc
   159001 atgagcatgc ttgagttttc tctcgagagt gaaagtttta ccgattccag gagctccgga
   159061 gataatcagc gagcgaatgg ttccttttac cagaccaact gacattttgt ccattaccat
   159121 aaaacgcttc gcaatgcgtt cgcgcatttc ttcggcactt tcttctacat ttttaacggt
   159181 accggcaaca tcgccatctt cgtagatgaa ttcgaaatca tcgcgattta cccaaaccat
   159241 gcgagattta cctttgatga tcgcgtttac tttaccttcg cgaggatcgt gcgggtttgc
   159301 atcccaccag gttgttccat ttgtttcgaa ggtgccagtg tattcgttac caaagtagag
   159361 ggcatttttc aggataactt gcatttgata tactccgtgg ttttgtttag gtagttcgtt
   159421 taacttgagg ctatagtatc ctagagcctc atcgttgtaa actacttttt caaaactttt
   159481 tcattaattc agttgtttct tcagaaattc aacctccttc tgaagttttt caatccggat
   159541 caacttgtct tcgatgagac gcagacggca ctcttcacat tcttcttccg ggttatcgga
   159601 gaccaaatcc aggaattcgt tgatttggtc ctgggtgaag gcgatagttg ggcaatcatc
   159661 ttcaggaggt cgaccgctgt agtcgcagat gtcgaaaatc gcttcttcgt gaccgtacca
   159721 aatggtcata gacccaacga atggttgttc cggatccata tcgccgtaat agttttcaac
   159781 gtctggctta attcgcagcc actcaacgaa atgctccggt gatttgaatt tgaaaagttt
   159841 gaaatctttc acatcgccat acagttcaaa catgattttt ccttagtgcc cgagcacttt
   159901 tttgatttcg tcaagttgtt tggggttagc agaatcggtg gctttcatca aaaccaattt
   159961 cgcttcttca agatttgcct gggcttcttt atacgattcg atgagattgt caatagagac
   160021 aacataacca tcggtatcga atgctgaacc ttccggcgta tccgattcga tgatttcgcc
   160081 gagttcgatc aaatgcatct cattttcgag aattgctata cggccggtat caatcgcttg
   160141 gccatcttta tccaggattt cccaaacaca tttccgttgg gatggagata tgacgcataa
   160201 acgcggtttg caatcgacga gagcttccat ctcagatgga aacgaccagc gccttctgaa
   160261 ccattgtttt ttccacgtat taaacgcagt ttgtgatttg aacttgaaat agcgtatcat
   160321 aactaatcct tggttgatgc gatgagacta tagtatctcg ttaaaaggac attgtaaact
   160381 gtttttatca acaaaaacaa aaagaggccc gaaggcctct tttatatagc aaacaaccca
   160441 tcaagactgc acattttcga ctttccgcct acttccatag agattggcgc attggcgcgg
   160501 ccaacagcgg cttgccagtt ctcagacaaa cgtgtgaaca cgttaaactg acaacatgcg
   160561 atctcgcatc caaacgtcgt gaagtacccc atttctgttg cttctttatg gtaccgtttg
   160621 tcctcagctt cttttatctc gtaaaaatct tcttgattat cacggatagc cagtagcatc
   160681 ttggttgttg tctcggcgtt gatgggaact ccaggccaca gccgttcaag tgtagcacat
   160741 gcgccaggac cggccataac gaagtcagcg ttctcatcca ttttgccatg ggtaacaccc
   160801 agtcgatcga actctgcttt gaattcagct tcgattaacc ctgcatctcc aacacccggc
   160861 atacgacaga ggttacttga gaagtggtag caatagtatg gacccatgcc acggagttgg
   160921 ttgaggaacc agtatgattc gctcatcgtc ggcttggctt tatagaaatc aatccaacct
   160981 tgggattgac caggcgctct tccgtatgcg agagcatgca gccaatgtat catatcagat
   161041 gcccgcatct ttctctcaga agtgtccagg tttggcgcga tcaacaccgt tttattgacc
   161101 ggacaaataa caccacgaac atcgattgga ctcggatttt gacgagcaaa gttgcgagac
   161161 gcagtttgca gagacgtcct cagctcagtg gttccccaaa tcttttgtcc tttggagaaa
   161221 gcaacttcga tatttttcat caaagtatac ttgtactcag ggtcggtttc cattttgtca
   161281 aaatggatat aacgacttcc tgtgttgacc agatatggga tgtcgtctgc tgaaccggtg
   161341 ataatgtcca gggttcgaga cggcccatag aatttaacaa tcgctgagtt gatcagctta
   161401 tcttcaaatg acacatcagt tcggaaatag aggtgttcgt ttagccaaat gatttcatcg
   161461 tggaaagaac gatttgggtg gaagtacggc accggtttgt tttcgacgca gaaaccatat
   161521 ccaaactcgg gcttatggac atatccgttc aactggtagt caacaaagtc tcgatgcgtt
   161581 tgtccgattc gaaccgacca ttcgcgtttg ttgaattcct tgatgaaatt gccgagtttt
   161641 tctttcacat ctttatcagc gagcgccaaa acctcttcat tgctcagcgc caggaaatca
   161701 gcggttgcac cacctttttt cttcggcggc ttatcagctt ttggagcctt ttcttctttt
   161761 actttcttca cctttacagg cttttccata accggcattg gtttagtcca acgataaaat
   161821 tctcggctca ggtgaactga acgaggtttt tccatcttat cgaagaagct caatggatcg
   161881 gccgcagtat caacatacca ttgttcaggc cacgcgaaaa ccttgaagcc tggcaatttg
   161941 gtaagcttaa acagcttctc attaaaatga gtcatccaag cggtgcgttc agcctgtgtg
   162001 ccgaagaaat tttgcttcaa gaactggcct gtacccggaa ttgcacggga ttcatcttcg
   162061 atcggcaaca atgttaccaa ttcaatctca ccggtgattc ttccttgatt gcgcagggtg
   162121 atcaactgtt ttgccagttc tttaatcttt gcgtcgatat ccgcgaatgg gtcttcctga
   162181 cggccgaagt ggaagcgaat atcgatattg ccgagatata cggttagatt tcgtacagct
   162241 accggcaaaa atgaaccaat acccttcttg agtgcgcctc gaagtgtttg tccatcatga
   162301 cgaagtgcct tgtacccggg ttgccatgct gaaaaactat ggctatcgcc aaatacaaca
   162361 tcttctcgcg ggaggtcgat catagccaat cggcttgact tttgtagacg ttggtcgata
   162421 gcaacccaat cagcatcttt ccattcagcc ggaacctttg ggttgacttc tcctttttta
   162481 tcatagattc tgtcacggca catttcgccg taaagcggca tgtctacgtc aagcgataca
   162541 atttcaccct tgaaatctag gaatttggaa atatgcagag cgcttttagc atcagggccg
   162601 ccgaacagat tcaaaccacc cttaaactcc ataccatggt aaacgtatac gcgatcatgg
   162661 tccgagaaat cgtggccacc aaccgcaact tcacatggat ggccagtttc ttcttcgatg
   162721 atttgtttcc ataggaaagc ccaagcacct ttatgtgaat tcaatttgcc aggaacggca
   162781 ttgaaaggca tagtaataat ctgtttcata tcaaaccttt tataaacgac aatgtcctga
   162841 gacatattac tacatctcag gacattatta acatagcatt atgcgaaagt gatatacgtt
   162901 gcgaagaaaa taatcgctac gatcgatcca ccgattacaa gggttttgga aggagcaata
   162961 tgagcatctt cgacttgttt tccactgaac agagagtaaa gaacaccaca cccaaccaga
   163021 accatgagga atcgatcaag ccatgctaat tccggtacag tgaatttaac gatggcgttg
   163081 gcagcaaccg agaacacggt aactgcgatc gcggcatttg aatttgtttt ccagtacaga
   163141 gcagcaaaga agattacaag cattgcaggg gtaacaaatc cgacaaactc ttggatgaag
   163201 tgatacgctt ggtcgagatt accgaggaac ggaatagcca gactagcacc gatagcaccg
   163261 catacaacta ctacagttcg cgctaccttc atcaaggttt tatctgaaag ctcaggctta
   163321 tggaccttca cgatatccag cgtgaacatt gtagagatcg agttcaaaat agcagccagg
   163381 gtcgaaataa ttgcagcaaa tagtgcggcc attaccaaac cgtggaatcc agcaggcatg
   163441 aagttatcaa tcaaccatgg atatgcttta tcagacgggg tcaaagaacc attcgtcatc
   163501 gagtaagcca taatacccgg gataataaca accagtggca tcagcaattt aaggaaggct
   163561 gcgaacacca tacctttttg agcttcttta actgatttag cggccaaagc accttgaaca
   163621 atgaattggt tgaatgcgaa ataagacaga gaaccgagga atacaccgac tacaccgaga
   163681 atacctggga tattttcgta tgctggatga ccgggttcaa gaactaattg gaagtgattt
   163741 ggcaattctt tgtaaagaga aaccatactt ccggcgatcg acgttgaacc aacatgaaca
   163801 ccatatgcat ccagagtgaa ccaggtgcat gcgatacctg ctgtcaatag gataccaacc
   163861 tgaatgaaat cagtccagac aagtgaactg agaccaccaa cagcggaata cagaacagca
   163921 aaaccaatca gagcccatac gccgacttca agcgggatac caattgaagt gaaagccaga
   163981 gcacccatgt aactaacagc tgtcaggtta acaagcgtgt aaacgacgat ccaaaaagtc
   164041 gcaaacatcg atcgaactcg attgtcgtac ttcattgcga ggaattgagg catcgttgtg
   164101 atttggtttt tgacgaagta tggaatcgca agccaggcag ccacgactag cgccagtgca
   164161 ccggtcaatt caaaggcacc gattgcaata cccattgcgt atgcactacc agttgtaccg
   164221 atgaggtgtt cggcgctaat gtttgcggcc aaaattgcac agcccagaat ccaccatggc
   164281 aaagatcgat cagccatgaa gtacgacttg gtcgtccccg atttcttcca accgatgacc
   164341 agcccggcca taacgataca tccaatgtat ccggcgaaaa ttaccatatc aagtaattgc
   164401 attagatttt cctttgttta agtgatggag ccattataca atggctccgt tattttccaa
   164461 ctcagcgttt agatggagaa gcctactgct atctgcataa ccttagcaat atttacttcg
   164521 ttctgctcga tgtcgatgta agtgttggaa ccgccaacct taatttctgc accaacttgg
   164581 cggaaagctt cgagcttatc ttcagcaact ttgtaaccga agatacggaa cttaccattg
   164641 ttcagtactt caaacttacg gtaaccttcg gcagtacgct tggagaagat gatttggtag
   164701 ttttggcgat agatttcaac cgctttcaga ccaatgtttt cttcaaccag cgcggagatt
   164761 ttctccatca aaccggtcat ttcagcggtg atttcgcgag atttgcgcgt acctttcttc
   164821 ttctcaactt taacttcttc taccggttga gcagctttcc acatttcagc agcttctacc
   164881 agaatcgcat cgccagcttc ggtagtgatg tagccatcgc cagacttctc gatcaattcc
   164941 tttttgatca ttactccgat gttggagtaa actgcgtttt tgttcatctc gacagattca
   165001 gcgatttcag aaactgtgat gaaagctttc ttggcgactt gaataaagat ttgagttgca
   165061 ttatcagaga tggacgcgtt gttcagaact tttgcgatag cttcgatttt agtcatagtc
   165121 atttttaatt actccgtttt ggtttggttt gtagcttgat ttgatagtgc tataatatcc
   165181 tatagcacta tcgttgtaaa ccactttttc aactattttt caataatgtt gaaaaggtgc
   165241 acctcgtcgt aagcgatcgt atggagggcc atgccatctg cagggtccac cgcgatatcc
   165301 caaaagaagt tgtcttcgtg gataatcaca tcgatccggt caacgataat gatcgaatcc
   165361 cagccgtcag gcataaaatc gacaatcttg gcattgccag gatacaggcc gccttggtca
   165421 caatattcat tgaacgcctg ctcagattta aactgaattt tcatgatttt tcctcttttt
   165481 caaattgtac ttcgattagt tttatcagcc tcttgcaagc tgattggtgc cttgcttttt
   165541 cttcctcagt acgcgcgtag cgatcgaagt cgttgacatc gaaatcaata tgcggcaatg
   165601 agatggcatg agtgatgaac tggggttgga cgccacattg aacaaagcaa tcatattcaa
   165661 ccttgccgcc attacgatag attcggagtt cgcgcaggtg gtggttgacg aattcttcag
   165721 ccgatagctc ataagtgcgg ttgacaatca catttttggt aaatttcacg ggtgttcctt
   165781 agatatcact caaaaagtct tcaatgatct tattggtctt cttaacaggt ttcttctggt
   165841 caacatccgg ttcacaccaa ttcgagttgt cgatgtaatc cgggttcggt ttgtacacca
   165901 gatttccgaa agtttcacgt ttacggcgct ttatgtatcg gccagcagca tcttcaccgg
   165961 tacgaaggac atcggaatac ccaactactt cgccgcgaca ttcgattatg aatggccgtt
   166021 gcaaatcacc tatcgcgaca cgcgtctgcg gcattgcacc gaggcgaatt gccatctgct
   166081 gccatacaac gtcatgacta tggccaggag ttgcccaatg cgcgagttca tgattgattg
   166141 tatcttttat gcattcccac gtcgccgaac gattcaagag ttctgaaatc ctgatttcgc
   166201 gtttcgcgta gtggcattgg cctacatagc ctttgtgttt agtaaacaca agtttgtatg
   166261 tcggggtggt cacatttacg atgttgttat cgcgtatgtg cttaacacgt tcttcgtaat
   166321 attcccggat tttggccttt aaggcggctg ataacataat ttgctccgtt ttgcatttcg
   166381 tttaacttga ggctatatta ttctataagc ttatcgttgt aaacaatttt taaacaaaat
   166441 attgaacgac cttctctgta aatcatacct tcgcttccaa gttctttcag attcagggta
   166501 atgccatgag tgtgttcaag cttcatttca cgaacatgtt taatcatgtc gaagtacttt
   166561 gcaccttgat tctgcttgat gaattcgtat aaccagttct gagcgaacag agaaatcatg
   166621 gaatcgatgg aagcttggat acgtgctttg tcgttggtga ttttcataag atactccgtt
   166681 ttgtttgtgg tagttcgttt aacttgaggc tattctatac aaactgaagc gtatgtaaac
   166741 tgttttgtga aaaagatttc aataaaaaca acaaaggcct ccgaagaggc cttttggtta
   166801 gaagtctggg tgggttccat agcgaacttt aatcgaattg aagccagcaa tgactgctaa
   166861 aatgtaaacg ttttcgacat cttcagttag agctattgtg ttgactaccg acagcagcga
   166921 tggcgctgct tcgccagcag gcacatccat cattcgacat ttacattcga tgaggtgccg
   166981 aggcccacag tggttgttat caaccacctc gccataacga ttgatcgcga aacatggtgc
   167041 gggtgcaagt ttaatagttg ccatttattt acctttcagc gaatttaggt cattgatgta
   167101 ttcggcttcc ggcgttgtgc ctagccagta atcaaacaat ttgccctgtt tgattgcttc
   167161 atcttgaagt ttgtatgtct catcttcggt catccgatag atgctcatac caaccagttc
   167221 attctcgaat cctttaaagt ctggattcga tgcgatttct ttgacgagct cggctttctg
   167281 cttaccttta atcgttatct tgtcgtcaat aaccatgttg atgaacttga actttgccca
   167341 ggcgagatca cgggcatgtt ctgatttttg acgttcgtat tcgacacgtt cggcagtaaa
   167401 tttgcggcgg tgttcaacga aatcgcggat aacatcttca gcgcattcgt actcagccag
   167461 tttgccttct gggttaagaa cagttatgtt ctgagtaaga acttggcgca aaccaaacat
   167521 cttgataatc ttttcatggg tcgcttcagg attgttctgt agctgttcac caaatttgtc
   167581 ttggcgtttg agagtaacat cgaaacggaa gccattttta tgttgctctt tgtaactgac
   167641 gattttacct tggtctttca gtttgtccaa taggattaca tacgaaagac gatcaaattt
   167701 aaccggcaat tcggtaattg tcagctttgt ttgaccagac agttcgtaca aaccttcaac
   167761 ttcgatggtt ttggcgctaa ctcgacgtat aacaccactg aattccggga attggacttc
   167821 tagtctcgga ataggtttgc cttcgatcgc ggctttggtg catttgatca aacttttgta
   167881 tgaatgcgga aaaatgtttg tcgcataacc agttgcaatt cccttcacac cgtttgccaa
   167941 gaccatcgga attaccggca ggtaatatcg cggcggtaaa tgttctggtt ccggatgaac
   168001 tggcgccagt tcgatatcgc gatagatatc ccaaaagttt tgatggacac ggcagaaaac
   168061 ataacgaggt gctgctgcct gttgaaccat acgagaaccg aagttgccgt cgccctcaag
   168121 aattgggatg ttattgttcc aagtgttggc aatcaactgg ccggcaccag ccgccgaacc
   168181 ttcgccgtgg tgataaccgg cttcagatac accgccagca agcgcagcaa ccttgttaaa
   168241 tttcgaacga ttttgcttcg catattcgag tgcgcggtac ataaagaatc gttgaaccgg
   168301 cttgagacca tcaatgagcg atggaattgc ccgttcttca accgtgtaca ttgcaaattc
   168361 gagagcttca tggttgataa tcgattgcaa cgaacgatta tgcagctctg tgagatggtt
   168421 actcagaatt gttcgcttcc aggcaggaat ttcttgagct aatgcatcct cacactgccg
   168481 aatttgttca gagatcactt catcttctgt tggatgttcc attggctcaa taacttctat
   168541 ttcgccagta tcaccaggtt caacctctat taatccacgt tgataaccag caggcgcaaa
   168601 ccacacgtct tcttttgcgc ctaacgttaa atcaacttca acatcccagg gcggggtctc
   168661 aggattagaa gtctgctttt gagccggcga agccggctct tcgtcaaaaa atgcgtctaa
   168721 actgaaattc atgaaaaccc cttatcgttt ttgatattcg aaattatata ccttaaacag
   168781 ttgacgcgaa acagtggtga gggtttgtgc tttggccata ttttcgccga aaagctccaa
   168841 ctgtgctgga cttttcagaa gagacggaac caggtgaagc ggcatgaaat aaacgacctg
   168901 attcaggcta tagctcttcg accaaatttc gtcggtcaat ggttggaaac cgtggcaaac
   168961 acgataaatt gtctcgttga aaccacggtt ggtctcttgg tcacctacga atgtgcgtgc
   169021 cttcacaacg cctgcgctaa caataaagta gaacccttta ccgcgagcat catctttgct
   169081 tttgccggta acgaacttga aattaccatt ctcgaaatga cccagacgtt gggcgccagc
   169141 agaaatgata cgttgtacgt taagattttg tttgctcatt atatgtttct ctctatatta
   169201 cagtagcggt taaacaaacg acttgataat cgtctgggtg gtaatgtgaa acttcaaatt
   169261 caaagaaatc gtgtgacact tggattttgc cgttcatgca gtctttcgca tcagcgattg
   169321 tatcgaaaac atgaactttt gtgccgtctt gcatatcgtc gcaatcgaca aacgaaatcc
   169381 caatatagcc ggatgagcta tactcaatag agcgtataca ctttccagat tctttgtgct
   169441 gtattgcaaa catcatggtg ttcctatgca attgccttct atgagtttag gtttggcttc
   169501 aaattcaatg atgtcgtact catcgatgat gtcaatgtca ttgatgacat aatcgtgttc
   169561 atgcttaatg attgcgtgca tctcttcgat tgaagaggcg acgaataccg gcgcttcgca
   169621 gccatattca acaagataga tctcatcaac caaatggtaa agctcagcga gagttccatt
   169681 atttctgtgc ttgaacgcaa ataacttcat aacttaatcc ttggcggagg gactatagta
   169741 aaccatattc ccatcagcgt aaacaggttt atccaatctc tttgacaaca tatttcgtct
   169801 tgttgagtct ggagcacagg aaaacgtggt tattttccaa gatagcaacc atgtcttgat
   169861 aactgctatg ggctaacact ggctcaaatt cattatagtc gatggcgaca atgtcatcga
   169921 acgaatcttt tataaacgag gccggcttac cggtttcgat atgctctaaa acgtaaagtt
   169981 tcatgcttca acctctacaa gccgactgcc aaggtcgtcg ctaacaaacg ggtaccaatg
   170041 gctgctgcag atgtattggc cgttgatctc ggcccaatcc gtcataccct cacagctcag
   170101 atcctcggtg gcaaaaacat cgtcccactt cttaaagtgc tttgcgaatt ccttcgcata
   170161 gttctgacta gaccaggcat tgaattgctc ttcactaacg aaacgataca gcattaccaa
   170221 ccctccatcg ggaattccat gtaaacttga gcattacgac gaatttcatt cgtgattttc
   170281 tttacacgat cggtattgcg agaaactcgt ccaaaccagc gccatccggt gccaacagac
   170341 ttcgacccag tgtgccaggt ttgccagtcg aattctacga tagtccgatc aggagcaatg
   170401 tgtttactca actcaccgct gccgagttta gccataactt cctggtgcca ttgccggtag
   170461 atcaactctc cgtctggaat ctgagaaaac tcagattcgc caatcgcaaa atgcgtcggg
   170521 caaacatcag cattaacaag cccaagaata tggttcgagc gataacgagg gttgtcgtaa
   170581 tccggctgcc cagcggtgat gaaatgctgt cctgcgggaa tgtctggccg tggcacatcg
   170641 tcgtgatggt atccaggaat cgccgggtac cagccgggca tcagcatgtg aacccgagaa
   170701 tcaaagacta cgtcgtcata ttgccactct ttcggcagat ttgcgatgaa gctacgcgtg
   170761 atcgggccgc catgcatgat cgcaaaagca aggtcgcaat tgaaaaacat cgtttcattt
   170821 ttgatgtcgt catttgagac actctcagca aacttaccat gaagcttaaa ctgactattg
   170881 aaaatcttgg aactgttcat aatgttactc cgttgtgttt aacttgaggc tatcttaaca
   170941 cgatagcctc acattgtaaa ctgtttttaa tctgaaagtg gaacaaaatc gaagaaaacc
   171001 cagttggcgt cgagctcact atcatagaag tgtccgatgc gctttgccca acatggaaaa
   171061 tccgacatat gctttttgat gccaggagcc aggcattcaa tcccaaccag cgtgttgtgt
   171121 aaatcactga cggaattgac tttcacgtaa ccaatacttt ccatcacatc gtcaaaagtg
   171181 tacattttca tgatgtaatc tccaaaagca gattttcaat tcgttcttta tcgctccgag
   171241 ctttgagaag ctctggcgaa ggttctcgat catagcacat gatggtgtga tgatctacca
   171301 tagctctcag cattttatgc tcagccataa gctctttctt ttgctgacca caacccggtc
   171361 gagctcggcg tttgatgaat tcgtaagtct gcataacgta ctccataacc ctatcgattt
   171421 gacagggcta tagtaacatg gaaaaatcag agtgtacacc actttttata aaaatgcaca
   171481 tatctatcat ggttgcgatt gatgtatgca ccatcaacca tacggcgggt tgctatctca
   171541 tatgggtact tctccatagc gcgtttggtg aagaaatagt ttgggttgaa gtatgtttga
   171601 ccatcgacgt tttccatatg cagcaccagg aaaacgtcag catttccttt ataccccgcg
   171661 tacaggcata ggccatctgc ccttccgtaa ggctccgcac cagcagtatg catcgtcggc
   171721 cagcgattga acgacgtctt gatttccagg ttgaaatcag gtgttgggac gtcgaaggtg
   171781 atgtcatcat tgtccaacca aaccattaca cccgtaagac caccgaggat ataggcgatg
   171841 cctagttcgg cgtctagaga ccgtccagtc cgttccgcaa tttctgcttt agataatgtt
   171901 ccaccggctt tagcatgttc ttttatcgca taatcaacgg ttgaatcaat tcgagccatt
   171961 cgtctatcaa agaatgacgt ccattcacgg ggttctttgg caagacgaga gtgtatttga
   172021 tgcatgatga gttcgattgt gaatgactgc atatgtcgca attgggtgaa aattctttcg
   172081 cgaactgcca tcggaatcat tgtttaagct ccattgagaa ttcataaggg tcgaatgttt
   172141 taataagccc aacaattgtg gccattttat cgtaatcttc tttaaaataa acgcgaccac
   172201 tggatataaa gtagaaccat tctgctaccg gtttattttc ctctccgaat cgtgcaccgt
   172261 tgactacatt gatgatgttc tcggcatatc gaatattcga cggcgatacc cagccatgat
   172321 tgccatacct aacatcgact ttttcattcc ggtcattata gaattcaacc gtaaaagggc
   172381 tactcatatt ctatttcctt acaaaaaggc cctccgaaga gggcctttga aattagtagt
   172441 gtttcatttc tttgaagtct tcagttactt cataaagaac ttcataacca gcgcaacgca
   172501 ttttggcgtt ttggtaatcg gttggaattg caaccacatc tgcagggtta accttacagg
   172561 caataacctt accacttcca ccaccgtaat gagggatata tgacttggct gcaacatgca
   172621 atccatgaga acaggtggtg ttggggtctt catcaacctg gaaacggttg attttaacaa
   172681 ctgtaccagg cgagttatca aacttaccag tgtacatgtc tttgaagcta tgattgactc
   172741 gcttccaggc gatgaaatga ccgtcatcgg tgatttcgat atcgttgtgc tccaggaaat
   172801 catagagctg gtataccgcc cgacgacttg ggttatccat cagattttca aagaaagcga
   172861 tcagcggcag gaaaggttcg cctgattgca tacgagaaac gattcgacgg gtcaaaccgg
   172921 aatcaatgac caggtctttg tatcgcaggg tgccgccttc gataaccaga tcgccggaaa
   172981 tgtaacgctc cagaccacgt ttgatattga gaagttccat cgcttcatca tatttttctg
   173041 cgcgaagaag accgatgatt tccataaact gtgggtggtc gccagaggca ttgtaagtct
   173101 cagagccaat ggtaacagaa aggaacttgg agttggccat ccaggtacat tccagttctt
   173161 tatccgcttc gatcacttcg tcgaggtgtt tgattgccac atcagcctga gcaatgagac
   173221 cttttgcttt ttcctgagct tttgtgattt cttgattccg gcgggtaaca gcattgtgag
   173281 cttcaagacc ggtaataccg aaatggcggc cagtgtcttc gaatgtattt tcggtcgaac
   173341 tgtagaaatg agcagcgatt tcttcgtcgg tcggattttc cggaactacc tggcttgcag
   173401 caataggcca ggtccgaact tctttaagaa cacgggcaat tgtatcaacc gaaacaccgt
   173461 gctcactcgc cagataaccc tgcgagatat tacctgcttc atactttttg aagatctgca
   173521 gtttggtaac atcatcaaaa cacttaacaa ttttaagctt agccatatca taacctcaat
   173581 aaaaggggct c
//