LOCUS       AY358988                1049 bp    mRNA    linear   HUM 03-OCT-2003
DEFINITION  Homo sapiens clone DNA96867 SALW1939 (UNQ1939) mRNA, complete cds.
ACCESSION   AY358988
VERSION     AY358988.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1049)
  AUTHORS   Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J.,
            Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B.,
            Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E.,
            Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S.,
            Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C.,
            Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V.,
            Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K.,
            Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z.,
            Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
  TITLE     The secreted protein discovery initiative (SPDI), a large-scale
            effort to identify novel human secreted and transmembrane proteins:
            a bioinformatics assessment
  JOURNAL   Genome Res. 13 (10), 2265-2270 (2003)
   PUBMED   12975309
  REMARK    Erratum:[Genome Res. 2003 Dec;13(12):2759]
REFERENCE   2  (bases 1 to 1049)
  AUTHORS   Clark,H.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2003) Department of Bioinformatics, Genentech,
            Inc., 1 DNA Way, South San Francisco, CA 94080, USA
FEATURES             Location/Qualifiers
     source          1..1049
                     /db_xref="H-InvDB:HIT000253032"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="DNA96867"
     gene            1..1049
                     /locus_tag="UNQ1939"
     CDS             318..902
                     /locus_tag="UNQ1939"
                     /note="PRO4422"
                     /codon_start=1
                     /product="SALW1939"
                     /protein_id="AAQ89347.1"
                     /translation="MSALWLLLGLLALMDLSESSNWGCYGNIQSLDTPGASCGIGRRH
                     GLNYCGVRASERLAEIDMPYLLKYQPMMQTIGQKYCMDPAVIAGVLSRKSPGDKILVN
                     MGDRTSMVQDPGSQAPTSWISESQVSQTTEVLTTRIKEIQRRFPTWTPDQYLRGGLCA
                     YSGGAGYVRSSQDLSCDFCNDVLARAKYLKRHGF"
BASE COUNT          302 a          252 c          251 g          244 t
ORIGIN      
        1 gttgctatgt tgcccaggct ggtcttgaag tgccttgacc tcctaaagtg ttggaaccac
       61 agacgtgagc cactccaccc agcctaaaac ttcatcttct ttggatgaga tgaacacttt
      121 taacaagaga acaggactct atataaatcg ctgtgggctc accacctcta aggaggagca
      181 ctgactgaag acagaaaaat tgatgaactg aagaagacat ggtccattat gccttacaaa
      241 cttacacagt gctttgggaa ttccaaagta ctcagtggag agaggtgttt caggagccgt
      301 agagccagat cgtcatcatg tctgcattgt ggctgctgct gggcctcctt gccctgatgg
      361 acttgtctga aagcagcaac tggggatgct atggaaacat ccaaagcctg gacacccctg
      421 gagcatcttg tgggattgga agacgtcacg gcctgaacta ctgtggagtt cgtgcttctg
      481 aaaggctggc tgaaatagac atgccatacc tcctgaaata tcaacccatg atgcaaacca
      541 ttggccaaaa gtactgcatg gatcctgccg tgatcgctgg tgtcttgtcc aggaagtctc
      601 ccggtgacaa aattctggtc aacatgggcg ataggactag catggtgcag gaccctggct
      661 ctcaagctcc cacatcctgg attagtgagt ctcaggtttc ccagacaact gaagttctga
      721 ctactagaat caaagaaatc cagaggaggt ttccaacctg gacccctgac cagtacctga
      781 gaggtggact ctgtgcctac agtgggggtg ctggctatgt ccgaagcagc caggacctga
      841 gctgtgactt ctgcaatgat gtccttgcac gagccaagta cctcaagaga catggcttct
      901 aacatctcag atgaaaccca agaccatgat cacatatgca gcctcaaatg ttacacagat
      961 aaaactagcc aagggcacct gtaactggga atctgagttt gacctaaaag tcattaaaat
     1021 aacatgaatc ccattaaaaa aaaaaaaaa
//