LOCUS       AY358289                2755 bp    mRNA    linear   HUM 03-OCT-2003
DEFINITION  Homo sapiens clone DNA37150 LLWI233 (UNQ233) mRNA, complete cds.
ACCESSION   AY358289
VERSION     AY358289.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2755)
  AUTHORS   Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J.,
            Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B.,
            Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E.,
            Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S.,
            Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C.,
            Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V.,
            Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K.,
            Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z.,
            Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
  TITLE     The secreted protein discovery initiative (SPDI), a large-scale
            effort to identify novel human secreted and transmembrane proteins:
            a bioinformatics assessment
  JOURNAL   Genome Res. 13 (10), 2265-2270 (2003)
   PUBMED   12975309
  REMARK    Erratum:[Genome Res. 2003 Dec;13(12):2759]
REFERENCE   2  (bases 1 to 2755)
  AUTHORS   Clark,H.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2003) Department of Bioinformatics, Genentech,
            Inc., 1 DNA Way, South San Francisco, CA 94080, USA
FEATURES             Location/Qualifiers
     source          1..2755
                     /db_xref="H-InvDB:HIT000252333"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="DNA37150"
     gene            1..2755
                     /locus_tag="UNQ233"
     CDS             167..2257
                     /locus_tag="UNQ233"
                     /note="PRO266"
                     /codon_start=1
                     /product="LLWI233"
                     /protein_id="AAQ88656.1"
                     /translation="MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEK
                     KGFTSLQRFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAF
                     LGLQLVKRLHINNNKIKSFRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLI
                     LNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTC
                     DLLSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPA
                     QEETFAPGPLPTPFKTNGQEDHATPGSAPNGGTKIPGNWQIKIRPTAAIATGSSRNKP
                     LANSLPCPGGCSCDHIPGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRK
                     SHFVDYKNLILLDLGNNNIATVENNTFKNLLDLRWLYMDSNYLDTLSREKFAGLQNLE
                     YLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMY
                     LPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSEVLMSDLKCETPVNFFR
                     KDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGL
                     LLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASEINSLQTVCDSSYWHNGPYNADG
                     AHRVYDCGSHSLSD"
BASE COUNT          681 a          751 c          690 g          633 t
ORIGIN      
        1 gggggttagg gaggaaggaa tccaccccca cccccccaaa cccttttctt ctcctttcct
       61 ggcttcggac attggagcac taaatgaact tgaattgtgt ctgtggcgag caggatggtc
      121 gctgttactt tgtgatgaga tcggggatga attgctcgct ttaaaaatgc tgctttggat
      181 tctgttgctg gagacgtctc tttgttttgc cgctggaaac gttacagggg acgtttgcaa
      241 agagaagatc tgttcctgca atgagataga aggggaccta cacgtagact gtgaaaaaaa
      301 gggcttcaca agtctgcagc gtttcactgc cccgacttcc cagttttacc atttatttct
      361 gcatggcaat tccctcactc gacttttccc taatgagttc gctaactttt ataatgcggt
      421 tagtttgcac atggaaaaca atggcttgca tgaaatcgtt ccgggggctt ttctggggct
      481 gcagctggtg aaaaggctgc acatcaacaa caacaagatc aagtcttttc gaaagcagac
      541 ttttctgggg ctggacgatc tggaatatct ccaggctgat tttaatttat tacgagatat
      601 agacccgggg gccttccagg acttgaacaa gctggaggtg ctcattttaa atgacaatct
      661 catcagcacc ctacctgcca acgtgttcca gtatgtgccc atcacccacc tcgacctccg
      721 gggtaacagg ctgaaaacgc tgccctatga ggaggtcttg gagcaaatcc ctggtattgc
      781 ggagatcctg ctagaggata acccttggga ctgcacctgt gatctgctct ccctgaaaga
      841 atggctggaa aacattccca agaatgccct gatcggccga gtggtctgcg aagcccccac
      901 cagactgcag ggtaaagacc tcaatgaaac caccgaacag gacttgtgtc ctttgaaaaa
      961 ccgagtggat tctagtctcc cggcgccccc tgcccaagaa gagacctttg ctcctggacc
     1021 cctgccaact cctttcaaga caaatgggca agaggatcat gccacaccag ggtctgctcc
     1081 aaacggaggt acaaagatcc caggcaactg gcagatcaaa atcagaccca cagcagcgat
     1141 agcgacgggt agctccagga acaaaccctt agctaacagt ttaccctgcc ctgggggctg
     1201 cagctgcgac cacatcccag ggtcgggttt aaagatgaac tgcaacaaca ggaacgtgag
     1261 cagcttggct gatttgaagc ccaagctctc taacgtgcag gagcttttcc tacgagataa
     1321 caagatccac agcatccgaa aatcgcactt tgtggattac aagaacctca ttctgttgga
     1381 tctgggcaac aataacatcg ctactgtaga gaacaacact ttcaagaacc ttttggacct
     1441 caggtggcta tacatggata gcaattacct ggacacgctg tcccgggaga aattcgcggg
     1501 gctgcaaaac ctagagtacc tgaacgtgga gtacaacgct atccagctca tcctcccggg
     1561 cactttcaat gccatgccca aactgaggat cctcattctc aacaacaacc tgctgaggtc
     1621 cctgcctgtg gacgtgttcg ctggggtctc gctctctaaa ctcagcctgc acaacaatta
     1681 cttcatgtac ctcccggtgg caggggtgct ggaccagtta acctccatca tccagataga
     1741 cctccacgga aacccctggg agtgctcctg cacaattgtg cctttcaagc agtgggcaga
     1801 acgcttgggt tccgaagtgc tgatgagcga cctcaagtgt gagacgccgg tgaacttctt
     1861 tagaaaggat ttcatgctcc tctccaatga cgagatctgc cctcagctgt acgctaggat
     1921 ctcgcccacg ttaacttcgc acagtaaaaa cagcactggg ttggcggaga ccgggacgca
     1981 ctccaactcc tacctagaca ccagcagggt gtccatctcg gtgttggtcc cgggactgct
     2041 gctggtgttt gtcacctccg ccttcaccgt ggtgggcatg ctcgtgttta tcctgaggaa
     2101 ccgaaagcgg tccaagagac gagatgccaa ctcctccgcg tccgagatta attccctaca
     2161 gacagtctgt gactcttcct actggcacaa tgggccttac aacgcagatg gggcccacag
     2221 agtgtatgac tgtggctctc actcgctctc agactaagac cccaacccca ataggggagg
     2281 gcagagggaa ggcgatacat ccttccccac cgcaggcacc ccgggggctg gaggggcgtg
     2341 tacccaaatc cccgcgccat cagcctggat gggcataagt agataaataa ctgtgagctc
     2401 gcacaaccga aagggcctga ccccttactt agctccctcc ttgaaacaaa gagcagactg
     2461 tggagagctg ggagagcgca gccagctcgc tctttgctga gagccccttt tgacagaaag
     2521 cccagcacga ccctgctgga agaactgaca gtgccctcgc cctcggcccc ggggcctgtg
     2581 gggttggatg ccgcggttct atacatatat acatatatcc acatctatat agagagatag
     2641 atatctattt ttcccctgtg gattagcccc gtgatggctc cctgttggct acgcagggat
     2701 gggcagttgc acgaaggcat gaatgtattg taaataagta actttgactt ctgac
//