LOCUS       AY177664                3579 bp    mRNA    linear   HUM 12-FEB-2004
DEFINITION  Homo sapiens desmoglein 4 preproprotein (DSG4) mRNA, complete cds.
ACCESSION   AY177664
VERSION     AY177664.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3579)
  AUTHORS   Whittock,N.V. and Bower,C.
  TITLE     Genetic evidence for a novel human desmosomal cadherin, desmoglein
            4
  JOURNAL   J. Invest. Dermatol. 120 (4), 523-530 (2003)
   PUBMED   12648213
REFERENCE   2  (bases 1 to 3579)
  AUTHORS   Whittock,N.V.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-NOV-2002) Center for Molecular Genetics, Institute of
            Biomedical and Clinical Science, Peninsula Medical School, Old
            Pathology Building, Barrack Road, Exeter EX2 5DW, England
FEATURES             Location/Qualifiers
     source          1..3579
                     /db_xref="H-InvDB:HIT000084989"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="18"
                     /map="18q12"
     gene            1..3579
                     /gene="DSG4"
     5'UTR           1..135
                     /gene="DSG4"
     CDS             136..3258
                     /gene="DSG4"
                     /note="desmosomal cadherin"
                     /codon_start=1
                     /product="desmoglein 4 preproprotein"
                     /protein_id="AAO47078.1"
                     /db_xref="GI:29335956"
                     /translation="MDWLFFRNICLLIILMVVMEVNSEFIVEVKEFDIENGTTKWQTV
                     RRQKREWIKFAAACREGEDNSKRNPIAKIRSDCESNQKITYRISGVGIDRPPYGVFTI
                     NPRTGEINITSVVDREITPLFLIYCRALNSRGEDLERPLELRVKVMDINDNAPVFSQS
                     VYTASIEENSDANTLVVKLCATDADEENHLNSKIAYKIVSQEPSGAPMFILNRYTGEV
                     CTMSSFLDREQHSMYNLVVRGSDRDGAADGLSSECDCRIKVLDVNDNFPTLEKTSYSA
                     SIEENCLSSELIRLQAIDLDEEGTDNWLAQYLILSGNDGNWFDIQTDPQTNEGILKVV
                     KMLDYEQAPNIQLSIGVKNQADFHYSVASQFQMHPTPVRIQVVDVREGPAFHPSTMAF
                     SVREGIKGSSLLNYVLGTYTAIDLDTGNPATDVRYIIGHDAGSWLKIDSRTGEIQFSR
                     EFDKKSKYIINGIYTAEILAIDDGSGKTATGTICIEVPDINDYCPNIFPERRTICIDS
                     PSVLISVNEHSYGSPFTFCVVDEPPGIADMWDVRSTNATSAILTAKQVLSPGFYEIPI
                     LVKDSYNRACELAQMVQLYACDCDDNHMCLDSGAAGIYTEDITGDTYGPVTEDQAGVS
                     NVGLGPAGIGMMVLGILLLILAPLLLLLCCCKQRQPEGLGTRFAPVPEGGEGVMQSWR
                     IEGAHPEDRDVSNICAPMTASNTQDRMDSSEIYTNTYAAGGTVEGGVSGVELNTGMGT
                     AVGLMAAGAAGASGAARKRSSTMGTLRDYADADINMAFLDSYFSEKAYAYADEDEGRP
                     ANDCLLIYDHEGVGSPVGSIGCCSWIVDDLDESCMETLDPKFRTLAEICLNTEIEPFP
                     SHQACIPISTDLPLLGPNYFVNESSGLTPSEVEFQEEMAASEPVVHGDIIVTETYGNA
                     DPCVQPTTIIFDPQLAPNVVVTEAVMAPVYDIQGNICVPAELADYNNVIYAERVLASP
                     GVPDMSNSSTTEGCMGPVMSGNILVGPEIQVMQMMSPDLPIGQTVGSTSPMTSRHRVT
                     RYSNIHYTQQ"
     sig_peptide     136..198
                     /gene="DSG4"
     misc_feature    199..3255
                     /gene="DSG4"
                     /note="encodes desmoglein 4 proprotein"
     mat_peptide     283..3255
                     /gene="DSG4"
                     /product="desmoglein 4"
     3'UTR           3259..3579
                     /gene="DSG4"
BASE COUNT         1067 a          729 c          834 g          949 t
ORIGIN      
        1 caccacagtt atcacccatg ccctcctaaa agggtgtctc aaagcatatc tttctgtaga
       61 gcagaattcg gaactgagaa gacgagggct caaattgaat ctcacaggat ttgcgtgcaa
      121 gagaaaccca aaggaatgga ttggctcttc ttcagaaaca tttgcctttt gatcattcta
      181 atggtggtga tggaagtaaa cagtgaattt attgttgagg tgaaggaatt tgacattgaa
      241 aatggcacta caaaatggca aacagtcaga agacaaaagc gggagtggat caagtttgcc
      301 gcagcctgtc gagaaggaga ggacaactcg aagaggaacc ccattgccaa aattcgatca
      361 gactgcgaat cgaaccagaa gataacatac cggatttctg gagtagggat tgatcgacca
      421 ccatatgggg tattcaccat taatcctcgc actggggaaa ttaacatcac ttcagtggta
      481 gacagagaaa taactccact tttcttgatc tattgccggg ctctgaattc acggggtgaa
      541 gatttagaaa ggcctcttga gcttagagtc aaagttatgg acataaatga taacgctcca
      601 gtcttttcgc aaagtgtata cacagccagc attgaagaaa atagtgatgc caatacattg
      661 gtagtaaagt tatgtgccac agatgcagat gaagaaaatc atctgaattc taaaattgcc
      721 tacaagatcg tctctcagga gccatcaggt gcacccatgt tcattctgaa taggtacact
      781 ggagaagtct gcaccatgtc cagtttcttg gacagagagc aacacagtat gtacaacctg
      841 gttgtgagag gctcagatcg ggatggagct gcagatggac tgtcttctga gtgtgactgt
      901 agaatcaagg ttttagacgt caacgataat ttccccacct tagagaaaac ttcatactca
      961 gccagtattg aagagaattg tttaagttcg gaactgatac gattacaagc aattgatctt
     1021 gatgaagaag gcactgataa ctggttggct caatatttaa ttctctctgg aaatgatggg
     1081 aattggttcg atattcaaac agatccacaa accaatgaag gcattttgaa agttgtcaag
     1141 atgctggatt atgaacaagc acctaacatt cagcttagta tcggagttaa aaaccaagct
     1201 gattttcact actccgttgc ttctcaattc caaatgcacc caacccctgt gagaattcaa
     1261 gttgttgatg tgagagaagg acctgcattt catccaagta ctatggcttt tagtgtgcgg
     1321 gaaggaataa aaggaagttc cttattgaat tatgtgcttg gcacatatac agccatagat
     1381 ttggacacag gaaaccctgc aacagatgtc agatatatca tagggcatga tgcaggcagc
     1441 tggttaaaaa ttgattcaag aactggtgag atacaatttt ctagagaatt tgataagaag
     1501 tcaaaatata ttatcaatgg gatatacaca gcagagatcc tggctataga tgatggctct
     1561 ggaaaaacag ctacaggaac catatgtatt gaggttcctg atatcaatga ttattgtcca
     1621 aacatttttc ctgaaagaag aaccatctgc attgactctc catcagtcct tatctctgtt
     1681 aatgaacatt cttatgggtc tccgtttact ttctgtgttg ttgatgagcc accaggaata
     1741 gctgacatgt gggatgtcag atcaacaaat gctacctcgg caatccttac ggctaagcag
     1801 gttttatctc caggatttta tgaaatccca atcctggtga aggacagcta taacagagca
     1861 tgtgaattgg cacaaatggt gcagttatat gcctgtgatt gcgatgacaa ccacatgtgc
     1921 ctggactctg gtgccgcggg catctacaca gaggacataa ctggtgacac gtatgggcct
     1981 gtcactgaag accaagctgg agtttcaaat gttggtcttg gaccagcagg gattggcatg
     2041 atggttctgg gcatcctgct actgattttg gctccactct tgctgctcct gtgttgctgc
     2101 aaacagagac agccagaagg cctgggaaca agatttgctc ctgtgcctga gggcggagaa
     2161 ggagtgatgc agtcttggag aattgaaggg gcccatcccg aggacaggga tgtgtcaaat
     2221 atatgtgcac ccatgacagc ctcaaatacc caggatcgga tggattcctc tgaaatctac
     2281 accaacacct atgcagccgg gggcacggtg gaaggaggtg tatcgggagt ggagctcaac
     2341 acaggtatgg ggacagccgt tggcctcatg gccgcagggg ccgcaggagc ctcaggggcc
     2401 gcaaggaaga ggagctctac catgggaacc ctgcgggact acgctgacgc agacatcaac
     2461 atggctttct tggacagcta cttctcggag aaagcgtatg cttatgcaga tgaagatgaa
     2521 ggtcgaccag ccaatgactg cttgctcatt tatgaccacg agggagtcgg gtctcccgta
     2581 ggctctattg gttgttgcag ttggattgtg gatgacttag atgaaagctg catggaaact
     2641 ttagatccaa aatttaggac tcttgctgag atctgcttaa acacagaaat tgaaccattt
     2701 ccttcacacc aggcttgtat accaatcagt actgacctcc ctttgctcgg acctaattac
     2761 tttgttaatg aatcttcagg attgactccc tcagaagttg aattccaaga agaaatggca
     2821 gcatctgaac ccgtggtcca tggggatatt attgtgactg agacttacgg taatgctgat
     2881 ccatgtgtgc aacccactac aattattttt gatcctcagc ttgcacccaa tgttgtagta
     2941 accgaagcag taatggcacc tgtctatgat attcaaggga atatttgtgt acctgctgag
     3001 ttagcagatt acaacaatgt aatctatgct gagagagtac tggctagtcc tggtgtgcct
     3061 gacatgagca atagtagcac gactgagggt tgtatgggac ctgtgatgag cggcaatatt
     3121 ttagtagggc cagaaattca agtgatgcaa atgatgagtc cagaccttcc cataggccaa
     3181 accgttggct ccacatcccc catgacatct cgacacagag taacacgata cagtaacata
     3241 cattacaccc aacagtaagt gctttatggt cagtattcta tgtggagacc ttgcaccttg
     3301 taatcatcaa tacatccacc aaaaatatat aatgtaccat atatattaat agtcaacaaa
     3361 tactcagata ttctaaggtc aatgccatta tttgattata ccattttgag ggtgaatatg
     3421 gctaggcact ttagataagc ctttttaaaa ttctttctga ttttaaataa tgcgtcaaaa
     3481 aatgtgcaga aaatgtattg catcccttga tactgtctaa cgaatagcac ataactcata
     3541 ttgtgaatcc tatgggtctt gaggcctgta gaaccaatc
//
	

LOCUS       AY168788                3531 bp    mRNA    linear   HUM 01-MAY-2004
DEFINITION  Homo sapiens desmoglein 4 (DSG4) mRNA, complete cds.
ACCESSION   AY168788
VERSION     AY168788.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3531)
  AUTHORS   Nguyen,V.T.
  TITLE     Experimental Mouse Model-Passive Transfer of Nondesmoglein 1 and 3
            Antibodies for Pemphigus Vulgaris
  JOURNAL   (in) Chan,L.S. (Ed.);
            ANIMAL MODELS OF HUMAN INFLAMMATORY SKIN DISEASES;
            CRC Press LLC, FL, USA (2003)
REFERENCE   2  (bases 1 to 3531)
  AUTHORS   Nguyen,V.T.
  TITLE     Novel Pemphigus Vulgaris Antigen Desmoglein 4 has an Important Role
            in Mediating Keratinocyte Adhesion
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 3531)
  AUTHORS   Nguyen,V.T.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-OCT-2002) Dermatology, University of California,
            Davis, Neuroscience Building, 1515 Newton Court, Davis, CA 95616,
            USA
FEATURES             Location/Qualifiers
     source          1..3531
                     /db_xref="H-InvDB:HIT000250885"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="18"
                     /map="18q12"
                     /cell_type="epidermal keratinocyte"
     gene            1..3531
                     /gene="DSG4"
     CDS             30..3209
                     /gene="DSG4"
                     /note="cadherin; keratinocyte adhesion molecule;
                     recombinant protein is recognized by Homo sapiens
                     pemphigus vulgaris antibody to desmoglein 3, a classical
                     autoimmune skin blistering disease antigen encoded by
                     GenBank Accession Number M76482; may have a role in
                     mediating keratinocyte adhesion"
                     /codon_start=1
                     /product="desmoglein 4"
                     /protein_id="AAO43657.1"
                     /db_xref="GI:37727191"
                     /translation="MDWLFFRNICLLIILMVVMEVNSEFIVEVKEFDIENGTTKWQTV
                     RRQKREWIKFAAACREGEDNSKRNPIAKIRSDCESNQKITYRISGVGIDRPPYGVFTI
                     NPRTGEINITSVVDREITPLFLIYCRALNSRGEDLERPLELRVKVMDINDNAPVFSQS
                     VYTASIEENSDANTLVVKLCATDADEENHLNSKIAYKIVSQEPSGAPMFILNRYTGEV
                     CTMSSFLDREQHSMYNLVVRGSDRDGAADGLSSECDCRIKVLDVNDNFPTLEKTSYSA
                     SIEENCLSSELIRLQAIDLDEEGTDNWLAQYLILSGNDGNWFDIQTDPQTNEGILKVV
                     KMLDYEQAPNIQLSIGVKNQADFHYSVASQFQMHPTPVRIQVVDVREGPAFHPSTMAF
                     SVREGIKGSSLLNYVLGTYTAIDLDTGNPATDVRYIIGHDAGSWLKIDSRTGEIQFSR
                     EFDKKSKYIINGIYTAEILAIDDGSGKTATGTICIEVPDINDYCPNIFPERRTICIDS
                     PSVLISVNEHSYGSPFTFCVVDEPPGIADMWDVRSTNATSAILTAKQVLSPGFYEIPI
                     LVKDSYNRACELAQMVQLYACDCDDNHMCLDSGAAGIYTEDITGDTYGPVTEDQAGVS
                     NVGLGPAGIGMMVLGILLLILAPLLLLLCCCKQRQPEGLGTRFAPVPEGGEGVMQSWR
                     IEGAHPEDRLFSAYALPGGGGTADGGGSVLGRCALQATPALLNQHPPFSEIYTNTYAA
                     GGTVEGGVSGVELNTGMGTAVGLMAAGAAGASGAARKRSSTMGTLRDYADADINMAFL
                     DSYFSEKAYAYADEDEGRPANDCLLIYDHEGVGSPVGSIGCCSWIVDDLDESCMETLD
                     PKFRTLAEICLNTEIEPFPSHQACIPISTDLPLLGPNYFVNESSGLTPSEVEFQEEMA
                     ASEPVVHGDIIVTETYGNADPCVQPTTIIFDPQLAPNVVVTEAVMAPVYDIQGNICVP
                     AELADYNNVIYAERVLASPGVPDMSNSSTTEGCMGPVMSGNILVGPEIQVMQMMSPDL
                     PIGQTVGSTSPMTSRHRVTRYSNIHYTQQ"
BASE COUNT         1035 a          722 c          835 g          939 t
ORIGIN      
        1 ggatttgcgt gcaagagaaa cccaaaggaa tggattggct cttcttcaga aacatttgcc
       61 ttttgatcat tctaatggtg gtgatggaag taaacagtga atttattgtt gaggtgaagg
      121 aatttgacat tgaaaatggc actacaaaat ggcaaacagt cagaagacaa aagcgggagt
      181 ggatcaagtt tgccgcagcc tgtcgagaag gagaggacaa ctcgaagagg aaccccattg
      241 ccaaaattcg atcagactgc gaatcgaacc agaagataac ataccgaatt tctggagtag
      301 ggattgatcg accaccatat ggggtattca ccattaatcc tcgcactggg gaaattaaca
      361 tcacttcagt ggtagacaga gaaataactc cacttttctt gatctattgc cgggctctga
      421 attcacgggg tgaagattta gaaaggcctc ttgagcttag agtcaaagtt atggacataa
      481 atgataacgc tccagtcttt tcgcaaagtg tatacacagc cagtattgaa gaaaatagtg
      541 atgccaatac attggtagta aagttatgtg ccacagatgc agatgaagaa aatcatctga
      601 attctaaaat tgcctacaag atcgtctctc aggagccatc aggtgcaccc atgttcattc
      661 tgaataggta cactggagaa gtctgcacca tgtccagttt cttggacaga gagcaacaca
      721 gtatgtacaa cctggttgtg agaggctcag atcgggatgg agctgcagat ggactgtctt
      781 ctgagtgtga ctgtagaatc aaggttttag acgtcaacga taatttcccc accttagaga
      841 aaacttcata ctcagccagt attgaagaga attgtttaag ttcggaactg atacgattac
      901 aagcaattga tcttgatgaa gaaggcactg ataactggtt ggctcaatat ttaattctct
      961 ctggaaatga tgggaattgg ttcgatattc aaacagatcc acaaaccaat gaaggcattt
     1021 tgaaagttgt caagatgctg gattatgaac aagcacctaa cattcagctt agtatcggag
     1081 ttaaaaacca agctgatttt cactactccg ttgcttctca attccaaatg cacccaaccc
     1141 ctgtgagaat tcaagttgtt gatgtgagag aaggacctgc atttcatcca agtactatgg
     1201 cttttagtgt gcgggaagga ataaaaggaa gttccttatt gaattatgtg cttggcacat
     1261 atacagccat agatttggac acaggaaacc ctgcaacaga tgtcagatat atcatagggc
     1321 atgatgcagg cagctggtta aaaattgatt caagaactgg tgagatacaa ttttctagag
     1381 aatttgataa gaagtcaaaa tatattatca atgggatata cacagcagag atcctggcta
     1441 tagatgatgg ctctggaaaa acagctacag gaaccatatg tattgaggtt cctgatatca
     1501 atgattattg tccaaacatt tttcctgaaa gaagaaccat ctgcattgac tctccatcag
     1561 tccttatctc tgttaatgaa cattcttatg ggtctccgtt tactttctgt gttgttgatg
     1621 agccaccagg aatagctgac atgtgggatg tcagatcaac aaatgctacc tcggcaatcc
     1681 ttacggctaa gcaggtttta tctccaggat tttatgaaat cccaatcctg gtgaaggaca
     1741 gctataacag agcatgtgaa ttggcacaaa tggtgcagtt atatgcctgt gattgcgatg
     1801 acaaccacat gtgcctggac tctggtgccg cgggcatcta cacagaggac ataactggtg
     1861 acacgtatgg gcctgtcact gaagaccaag ctggagtttc aaatgttggt cttggaccag
     1921 cagggattgg catgatggtt ctgggcatcc tgctactgat tttggctcca ctcttgctgc
     1981 tcctgtgttg ctgcaaacag agacagccag aaggcctggg aacaagattt gctcctgtgc
     2041 ctgagggcgg agaaggagtg atgcagtctt ggagaattga aggggcccat cccgaggaca
     2101 ggctttttag cgcctacgcc ttgccgggtg gtggtggcac cgcagacggc ggcggcagcg
     2161 ttttaggcag atgcgcgctg caggcaactc cagcgctgtt aaaccaacat cctccctttt
     2221 cagaaatcta caccaacacc tatgcagccg ggggcacggt ggaaggaggt gtatcgggag
     2281 tggagctcaa cacaggtatg gggacagccg ttggcctcat ggccgcaggg gccgcaggag
     2341 cctcaggggc cgcaaggaag aggagctcta ccatgggaac cctgcgggac tacgctgacg
     2401 cagacatcaa catggctttc ttggacagct acttctcgga gaaagcgtat gcttatgcag
     2461 atgaagatga aggtcgacca gccaatgact gcttgctcat ttatgaccac gagggagtcg
     2521 ggtctcccgt aggctctatt ggttgttgca gttggattgt ggatgactta gatgaaagct
     2581 gcatggaaac tttagatcca aaatttagga ctcttgctga gatctgctta aacacagaaa
     2641 ttgaaccatt tccttcacac caggcttgta taccaatcag tactgacctc cctttgctcg
     2701 gacctaatta ctttgttaat gaatcttcag gattgactcc ctcagaagtt gaattccaag
     2761 aagaaatggc agcatctgaa cccgtggtcc atggggatat tattgtgact gagacttacg
     2821 gtaatgctga tccatgtgtg caacccacta caattatttt tgatcctcag cttgcaccca
     2881 atgttgtagt aaccgaagca gtaatggcac ctgtctatga tattcaaggg aatatttgtg
     2941 tacctgctga gttagcagat tacaacaatg taatctatgc tgagagagta ctggctagtc
     3001 ctggtgtgcc tgacatgagc aatagtagca cgactgaggg ttgtatggga cctgtgatga
     3061 gcggcaatat tttagtaggg ccagaaattc aagtgatgca aatgatgagt ccagaccttc
     3121 ccataggcca aaccgttggc tccacatccc ccatgacatc tcgacacaga gtaacacgat
     3181 acagtaacat acattacacc caacagtaag tgctttatgg tcagtattct atgtggagat
     3241 cttgcacctt gtaatcatca atacatccac caaaaatata taatgtacca tatatattaa
     3301 tagtcaacaa atactcagat attctaaggt caatgccatt atttgattat accattttga
     3361 gggtgaatat ggctaggcac tttagataag cctttttaaa attctttctg attttaaata
     3421 atgcgtcaaa aaatgtgcag aaaatgtatt gcatcccttg atactgtcta acgaatagca
     3481 cataactcgt attgtgaatc ctatgggtct tgaggcctgt agaaccaatc t
//