LOCUS       AY039965                1512 bp    mRNA    linear   PLN 18-SEP-2002
DEFINITION  Arabidopsis thaliana putative 26S proteasome AAA-ATPase subunit
            RPT6a (At5g20000) mRNA, complete cds.
ACCESSION   AY039965
VERSION     AY039965.1
KEYWORDS    FLI_CDNA.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1512)
  AUTHORS   Yamada,K., Liu,S.X., Sakano,H., Pham,P.K., Banh,J., Chung,M.K.,
            Goldsmith,A.D., Lee,J.M., Quach,H.L., Toriumi,M., Yu,G., Bowser,L.,
            Carninci,P., Chen,H., Cheuk,R., Hayashizaki,Y., Ishida,J.,
            Jones,T., Kamiya,A., Karlin-Neumann,G., Kawai,J., Kim,C., Lam,B.,
            Lin,J., Miranda,M., Narusaka,M., Nguyen,M., Palm,C.J., Sakurai,T.,
            Satou,M., Seki,M., Shinn,P., Southwick,A., Shinozaki,K.,
            Davis,R.W., Ecker,J.R. and Theologis,A.
  TITLE     Arabidopsis Full Length cDNA Clones
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1512)
  AUTHORS   Yamada,K., Liu,S.X., Sakano,H., Pham,P.K., Banh,J., Chung,M.K.,
            Dale,J.M., Gibson,H.A., Goldsmith,A.D., Jiang,P.X., Lee,J.M.,
            Quach,H.L., Tang,C.C., Toriumi,M., Yu,G., Bowser,L., Carninci,P.,
            Chen,H., Cheuk,R., Hayashizaki,Y., Ishida,J., Jones,T., Kamiya,A.,
            Karlin-Neumann,G., Kawai,J., Kim,C., Koesema,E., Lam,B., Lin,J.,
            Meyers,M.C., Miranda,M., Narusaka,M., Nguyen,M., Palm,C.J.,
            Sakurai,T., Satou,M., Seki,M., Shinn,P., Southwick,A., Tracy,S.E.,
            Shinozaki,K., Davis,R.W., Ecker,J.R. and Theologis,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JUN-2001) Plant Gene Expression Center, 800 Buchanan
            Street, Albany, CA 94710, USA
COMMENT     RIKEN Genomic Sciences Center (GSC) members carried out the
            collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
            Arabidopsis Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
            Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
            Hayashizaki,Y. and Shinozaki,K.
            
            The Salk, Stanford, PGEC (SSP) Consortium members carried out the
            sequencing and annotation of the RAFL cDNAs: Yamada,K., Liu,S.X.,
            Sakano,H., Pham,P.K., Banh,J., Chung,M.K., Dale,J.M., Gibson,H.A.,
            Goldsmith,A.D., Jiang,P.X., Lee,J.M., Quach,H.L., Tang,C.C.,
            Toriumi,M., Yu,G., Bowser,L., Chen,H., Cheuk,R., Jones,T.,
            Karlin-Neumann,G., Kim,C., Koesema,E., Lam,B., Lin,J., Meyers,M.C.,
            Miranda,M., Nguyen,M., Palm,C.J., Shinn,P., Southwick,A.,
            Tracy,S.E., Davis,R.W., Ecker,J.R. and Theologis,A.
            
            Yamada,K. (SSP/PGEC) and Seki,M. (RIKEN GSC) contributed equally to
            this work.  Shinozaki,K. (RIKEN GSC) and Theologis,A. (SSP/PGEC)
            contributed equally to this work as PIs.
            
            Annotation is based on the January 2002 version of the Arabidopsis
            genome submitted to GenBank.
FEATURES             Location/Qualifiers
     source          1..1512
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /clone="RAFL05-07-D23 (R10022)"
                     /ecotype="Columbia"
                     /note="This clone is in a modified pBluescript vector
                     (Lambda ZAP) as a XhoI/SstI insert."
     gene            1..1512
                     /gene="At5g20000"
     5'UTR           1..78
                     /gene="At5g20000"
     CDS             79..1338
                     /gene="At5g20000"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /codon_start=1
                     /product="putative 26S proteasome AAA-ATPase subunit
                     RPT6a"
                     /protein_id="AAK64142.1"
                     /translation="MAAVGVEARPPVTAMEETCNVKGAAAKQGEGLNKYYLQHLDELQ
                     RLQREKSYNLNRLEAQRNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVH
                     PEGKYVVDIDKSIDITKLTPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTY
                     DMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHH
                     TDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSG
                     NGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPN
                     EESRFDILKIHSRKMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVT
                     QEDFEMAVAKVMKKDTEKNMSLRKLWK"
     3'UTR           1339..1512
                     /gene="At5g20000"
     misc_difference 1496
                     /gene="At5g20000"
                     /note="not present in genomic sequence"
BASE COUNT          446 a          278 c          379 g          409 t
ORIGIN      
        1 ccctgtgatc tatctttgaa tctcaaaagc atacttgaga gagatctgtt tcgataattt
       61 gcttcaatca ccgtgttaat ggcggccgta ggagtggagg cgagacctcc tgtgacagcg
      121 atggaggaaa cctgcaacgt taagggagcg gcggcgaaac aaggagaagg gcttaacaag
      181 tactacctcc agcatctcga tgagctccag cgcctgcaac gcgaaaagtc gtataacctt
      241 aatcgtcttg aagctcagag gaatgaactc aattctcgag tacgaatgct cagagaagag
      301 ttacagctcc ttcaagaacc tgggtcctat gtgggtgaag tggtaaaagt gatgggaaaa
      361 aacaaggtct tggttaaggt tcatccagag gggaagtatg ttgtcgatat tgacaaaagt
      421 atagacataa cgaaactcac tccatcaacg agagttgctc tccgtaatga tagctatgtt
      481 ctccacctgg ttctgccaag taaagtagat cccttggtta accttatgaa agttgagaag
      541 gttccagact ccacatatga catgattggt ggtcttgacc agcaaatcaa ggaaataaag
      601 gaggtcattg aactgccaat caagcatcct gaattgtttg agtctcttgg aattgcgcag
      661 ccaaagggtg tgttgttgta cggtccacct ggaactggga agacactatt ggctcgggct
      721 gtggcacatc acactgactg tactttcatc agagtttctg gttctgagct ggtccagaaa
      781 tacattggag aaggttctag aatggtcaga gaactttttg tgatggcaag ggagcatgca
      841 ccatcaatca tcttcatgga tgaaatcgat agtatcgggt ctgctcgtat ggaatctggt
      901 agtggaaatg gtgacagtga ggtgcaaagg actatgcttg agcttctcaa tcaacttgac
      961 ggattcgagg cgtcaaacaa aatcaaggtt ttgatggcta caaatcgtat tgatattctg
     1021 gatcaagctc ttctccggcc tggaaggatt gataggaaaa ttgaatttcc taatcctaat
     1081 gaagagtcac gttttgatat cttgaagata cactcaagga aaatgaattt gatgcgtgga
     1141 atcgatctga aaaagattgc agagaagatg aatggtgctt caggtgctga gctgaaggct
     1201 gtatgcacgg aggcgggcat gtttgcactt cgtgagagga gagtacatgt gactcaggaa
     1261 gactttgaga tggctgtggc gaaggtaatg aagaaagaca cagagaagaa catgtctctg
     1321 cgtaagctct ggaagtagga atttcagagt cacagattaa tttcgattat ttcttctcta
     1381 ctgtctgtgg ttctttctga aaccttttcg gctagcgctt taagcttttc taaacaatgt
     1441 ttgtacacta gtttctattc attcaaatgg ttgttcagca taacatcttc gattctaaaa
     1501 aaaaaaaaaa aa
//