LOCUS       AP025277             5078148 bp    DNA     circular BCT 27-NOV-2021
DEFINITION  Aeromonas hydrophila NUITM-VA1 DNA, complete genome.
ACCESSION   AP025277
VERSION     AP025277.1
DBLINK      BioProject:PRJDB10427
            BioSample:SAMD00424814
KEYWORDS    .
SOURCE      Aeromonas hydrophila
  ORGANISM  Aeromonas hydrophila
            Bacteria; Pseudomonadota; Gammaproteobacteria; Aeromonadales;
            Aeromonadaceae; Aeromonas.
REFERENCE   1  (bases 1 to 5078148)
  AUTHORS   Suzuki,M., Dao,TD. and Takemura,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-NOV-2021) to the DDBJ/EMBL/GenBank databases.
            Contact:Masato Suzuki
            National Institute of Infectious Diseases, AMR Research Center;
            4-2-1 Aobacho, Higashimurayama, Tokyo 189-0002, Japan
REFERENCE   2
  AUTHORS   Suzuki,M., Dao,TD. and Takemura,T.
  TITLE     Genomic analysis of Aeromonas hydrophila strain NUITM-VA1
  JOURNAL   Unpublished (2021)
COMMENT     Annotated by DFAST https://dfast.ddbj.nig.ac.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Canu v. 2.1.1
            Genome Coverage       :: 192x
            Sequencing Technology :: ONT MinION;Illumina MinSeq
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..5078148
                     /collection_date="2021"
                     /country="Viet Nam:Hanoi"
                     /db_xref="taxon:644"
                     /mol_type="genomic DNA"
                     /organism="Aeromonas hydrophila"
                     /strain="NUITM-VA1"
     CDS             101..1402
                     /codon_start=1
                     /gene="dnaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEC3"
                     /locus_tag="NUITMVA1_00010"
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="BDC80058.1"
                     /transl_table=11
                     /translation="MWIRPLQAELSDNTLTLYAPNRFVLDWVRDKYLIRVNGIINELC
                     GVDGPTLRFDIGNRPHPVAVARAPARGADPVNNSQKSWESKAEAKPEPNHKSNTNVNY
                     TFENFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNAIKERKQ
                     DAKVIYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFFANKERSQEEFFH
                     TFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMRKA
                     DENQIHLPDEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAINIDFVREALRDLLA
                     LQEKLVTIDNIQKTVAEYYKIKLADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIG
                     DAFGGRDHTTVLHACRKIEQLKEESHDIKEDYSNLIRTLSS"
     CDS             1486..2589
                     /codon_start=1
                     /gene="dnaN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEE7"
                     /locus_tag="NUITMVA1_00020"
                     /product="DNA polymerase III subunit beta"
                     /protein_id="BDC80059.1"
                     /transl_table=11
                     /translation="MQLEISREALLRPLQLVSGALGGRPTLPILGNVLLDVSNGLLSL
                     TGTDLEVEMIGQVYLNSDSQDGRTTVPARKLLDICRGLPEGADIRLNTEGERLIIRSG
                     RSRFNLSTLPATEYPNIEDWESVLEFDIGQLELKKLIDATQFSMASQDVRYYLNGMLF
                     ESEGHGLRTVATDGHRLATCRREVVTESLPDHQVILPRKGVLELVRLLEAEDKPVRLQ
                     IGRSNLRAALDGFIFTSKLVDGRFPDWRRVIPRNSDKALIAGREDLRQAFARAAILSN
                     EKFRGVRLNLQENLLRITANNPEQEEAEELLDVQYEAGEMEIGFNVSYVLDVLNTLKC
                     DQIRISLSDSISSAIIEDFDSQDAQYVVMPMRI"
     CDS             2592..3695
                     /codon_start=1
                     /gene="recF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEE8"
                     /locus_tag="NUITMVA1_00030"
                     /product="DNA replication and repair protein RecF"
                     /protein_id="BDC80060.1"
                     /transl_table=11
                     /translation="MSLVKLQLSDFRNIQQASLALSPGLNILVGCNGSGKTSVLEAIH
                     YLGLGRSFRTHLTGRVIRQGERAFTLFAQCELEGRQVPIGLAKDKSGETQLKIAGAQA
                     QRLAELAELLPVQLIHPDGFNLLTGGPQARRAWLDWGVFHQEPTFFSLWGRVRRLLKQ
                     RNALLRQSSQYRQLAYWDQELVRLGGELAEFRASYCQAITPLIKEMTADFLPEFDISL
                     GFYRGWEKDTPLNELLEAGFERDRALGYTGVGPQKADVRLKANGVPAQDILSRGQLKL
                     LVCAMRLAQGLYLNQHSSRGCIFLIDDFASELDVDKRRLLAARLKQCASQVFITAIDT
                     GQLADMMDANDCKLFHVEQGKISETLEKAESKL"
     CDS             3692..6103
                     /codon_start=1
                     /gene="gyrB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEE9"
                     /locus_tag="NUITMVA1_00040"
                     /product="DNA gyrase subunit B"
                     /protein_id="BDC80061.1"
                     /transl_table=11
                     /translation="MSENTYDSSNIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEV
                     VDNSIDEALAGYCSDIQVKIHSDGSVSVRDNGRGIPVDIHPEEGRSAAEVIMTVLHAG
                     GKFDDNSYKVSGGLHGVGVSVVNALSDKLLLTIRRNGHVYEQTYHLGEPQAPLKQIGD
                     STGTGTEVRFWPSPTIFSDTLFHYEILAKRLRELSFLNSGVSIRLLDERDGREAHFCY
                     EGGIKAFVEYLNQNKTPIHPKVFHFTTEQDGIGVEVAMQWNDAYQEGVYCFTNNIPQR
                     DGGTHLVGFRTALTRTLNSYMDKEDYSKKAKSAASGDDVREGLIAVISVKVPDPKFSS
                     QTKDKLVSSEVKTAVEQAMGEKLADFLLENPGDAKIVVNKIIDAARAREAARKARELT
                     RRKGALDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKI
                     LNVEKARFDKMISSQEVGTLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGAHIRT
                     LLLTFFYRQMPEIIERGYVYIAQPPLYKVKKGKQEQYLKDEDALLQYQTAMALDGATL
                     HVNESAPAIGGEALERLVNQHRSVTHLITRMSRRAPEAVLTQLIYQPELNEALLSSES
                     DLLAWCQSMEAVLNESNHGIQYQMQVRHDEERRLFVPHAVVRQHGVDREYPLSYDFLQ
                     SSEYRQLVSLGKEIANLIEEGGYIKRGEKVKPVASFVEAVEWLMGEGKRGIYIQRYKG
                     LGEMNPDQLWETTMDPEARRMLRVTIDDAVGADQLFSTLMGDAVEPRRDFIETNALRV
                     ANLDV"
     CDS             complement(6220..6597)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704051.1"
                     /locus_tag="NUITMVA1_00050"
                     /product="glyoxalase"
                     /protein_id="BDC80062.1"
                     /transl_table=11
                     /translation="MLVPQFTILYVANPARSALFYRELFGRSPVEESPTFAMFVFESG
                     ARLALWSSATVEPAVTQTAGAMELAFALPDDAAVDRLSAEWLARGLTLIQAPTRMEFG
                     YTCMALDPDGHRLRLYCPAPELG"
     CDS             complement(6664..6924)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_00060"
                     /product="hypothetical protein"
                     /protein_id="BDC80063.1"
                     /transl_table=11
                     /translation="MTLSYRDLKEESSERTVWPCALGYFDLVRVLVAWCELRQDFRHF
                     RVDRISAMRLEAEPYPGNRGRLLKEWRDSQQIPQPRFIADRN"
     CDS             complement(6921..7232)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_00070"
                     /product="hypothetical protein"
                     /protein_id="BDC80064.1"
                     /transl_table=11
                     /translation="MSRSERLLALLQLLRGHRYAITGSELASQLGISLRTLYRDIATL
                     QAQGAHIEGEAGIGYVLRPGFMLPPLMFSEEELDALVLGSRWVAAHADHALSTAASSA
                     R"
     CDS             7467..7880
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010635612.1"
                     /locus_tag="NUITMVA1_00080"
                     /product="heat-shock protein IbpA"
                     /protein_id="BDC80065.1"
                     /transl_table=11
                     /translation="MRSIDFSPLYRSAIGFDRLANLIESAASNGNAGYPPYNIEQLGD
                     SDYRISMAVAGFTQEELELSFQENLLTVKGNKQADTERNYLYQGIAERGFERRFQLAD
                     YVRVKGADLKNGLLHIDLVREVPEAMKPRKIEING"
     CDS             7973..8410
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704053.1"
                     /locus_tag="NUITMVA1_00090"
                     /product="heat-shock protein Hsp20"
                     /protein_id="BDC80066.1"
                     /transl_table=11
                     /translation="MRNLDFSHLYSNAVGFERMARELEGLFEQKTAAYPPYNIEKRDH
                     DGYRITVAVAGFEREELELETENGTLKVKGRKAATDERQFLHQGIAERDFELAFKLSQ
                     HVEVQGAKLEHGLLTIDLARELPEALKPRAIPIGKPDQLALPG"
     CDS             complement(8483..9721)
                     /codon_start=1
                     /gene="avtA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704054.1"
                     /locus_tag="NUITMVA1_00100"
                     /product="valine--pyruvate transaminase"
                     /protein_id="BDC80067.1"
                     /transl_table=11
                     /translation="MFGEKFTRHAGITQLMDDLNQGLTNPDAIMLGGGNPAPIPAMLE
                     RFQAEAKGLLDNGELVKAMANYDGPQGKDRFTKALAALLSKELGWDISARNIALTNGS
                     QNAFFYLFNLLAGEFADGRKKKVLFPLAPEYIGYADSALADDYFVAYKPTIEKLADGQ
                     FKYHVDFESLQVGDDIGVICVSRPTNPTGNVLTDEEIEHLDQIARDKGIPLLIDNAYG
                     VPFPGIIFSEARPFWNANTILCMSLSKLGLPGTRCGIVIADEKIIQAITNLSGIINLA
                     PGSLGPAITIPMIESGEIIALSEQVVKPFYQQKAELAVQLLREAIPDPRFHIHKPEGA
                     LFLWLWFEGLPIHCQELYERLKAKNLLIVPGHYFFPGIDDPEWRHSQECIRLNYSQSE
                     ELVRRGIAILADEINTLYAG"
     CDS             10017..10250
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704055.1"
                     /locus_tag="NUITMVA1_00110"
                     /product="hypothetical protein"
                     /protein_id="BDC80068.1"
                     /transl_table=11
                     /translation="MKILIATLIASSLSLNVMADEYPRPELDSAKLAQEIAAQQQQAS
                     HAVVEEAIHNLKPLALETLVVEASSADATHPES"
     CDS             complement(10180..11004)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704056.1"
                     /locus_tag="NUITMVA1_00120"
                     /product="AraC family transcriptional regulator"
                     /protein_id="BDC80069.1"
                     /transl_table=11
                     /translation="MAFILPDHPFDPDQHDGSAIGIASALGWHDSGRHQHRRHQLLFA
                     QAGCMTIELDDQVCLLPPTRAAWLPAGLPHRVLMRGVVAYRSLYFQPEPGLPTEMAVL
                     AVNPLLREIIERMAIWPWDKPAAEQHCTLALLQEELAQAPRESWQLPLPSDPRLAGWL
                     QEVKRGDTLPDRLNRLAERVGASDKTIGRIFMRETGMSYQAWRQQWRLLRALELLAEA
                     EPISRVAATLEFASDSAFISFFRQHTGQTPLRYLNSRGESHRPSSPPPPGSPAPAA"
     CDS             11097..12224
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704057.1"
                     /locus_tag="NUITMVA1_00130"
                     /product="MFS transporter"
                     /protein_id="BDC80070.1"
                     /transl_table=11
                     /translation="MNNKLPPLWLVVGLMMFPQIVETIYSPVLTHIASQFRVSEGQAS
                     QTLSVYFLAFAAGVVCWGRLCDLVGRRPAMLAGLMTYGAGTLLALLATQFETLLLARV
                     IAAFGAAVGSVVTQTMLRDSYQGSDLARVFSVMGIALSLSPVLGLVSGGQLASGFGYL
                     GVFSALLVLAVGLLLVTCWQLPETRPAITQRVALWPLAQRMVRDAALWRSAALVALFN
                     TMLFGYYSLAPFLFAGLGLSAGEFGYSGILLALATLGGSLLNKRLLGRGWSPASLIRL
                     AAALALGSGWLVWASQASLWFLLPMMGVVVAFGLAIPNVLSQALLAYREVAGSAGALF
                     GLGYYLLLSLGLAVAASLQDLGLLLGGCGLLALCCGWRRST"
     CDS             complement(12229..12912)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704058.1"
                     /locus_tag="NUITMVA1_00140"
                     /product="DNA-binding response regulator"
                     /protein_id="BDC80071.1"
                     /transl_table=11
                     /translation="MAHILVIDDEAAIRRFLRISLIAEGHQVSEAVGVNEGLAQYRHL
                     NPDLVILDLGLPDGDGIQVLQAIREHHQHPVLVLSARDSEQEKVRLLDAGANDYMSKP
                     FGIGEMMARIRVLLRQRAGVSSGELRHFPQCGLTLDSSSHRVTLGEEEVPLSRKEFAL
                     LQALVCHPGKLVLQTQLLNDIWGPSHKEDTHYLRIVIASLRKKLGDNPQQPTLIETES
                     GIGYRFIGS"
     CDS             complement(12943..15531)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704059.1"
                     /locus_tag="NUITMVA1_00150"
                     /product="sensor histidine kinase"
                     /protein_id="BDC80072.1"
                     /transl_table=11
                     /translation="MRDEVRADALLASLEQEHRGKLKVFLGAAPGVGKTYAMLQAVRE
                     QAKEGVDILIGVVETHGRQETLALLDKLAIQPRKLHLHRQQRLEEMDLDGLLTRKPAI
                     AVVDELAHSNAPGSRHEKRWQDVEELLGAGIDVYTTLNVQHLESLNDLVWQLTGVRVK
                     ETLPDQVLLEADSLVLIDLPPKELLGRLKEGKVYVPHQAKAALQSFFSLNNLTALREL
                     AMQTAASHVEGDLQLQWQAAGKTTLPLRGKLMVCLGDQHGAALVRYGHRFAQRRQLPW
                     LVVHIDSKGQRSVELEQALALASQLGAKVLTLSSPAVADTLLETAEQQQVSQLLLGKP
                     HKAPWRRSLVQHLLKQAQGLEITLVDTEKRKPSLGLQPLHPKDIRQSLLAVAIMGTTS
                     AAVWGLSHWLPPASLPMLFVLGVLATALTTSLMPAILAAVLGFVGHNLLFTAPYFSLS
                     VASHSDLLTLFVLLIVGITAGRLASRQRQQLIGLRETQQLGNALLSLSQGLATASSPE
                     EVLRQGSQAISLALGQPVFALDQHYQHRAGSTQHKPGQTDKAAIDWCLAQKQSAGAHT
                     ATLNAAEAQYHHLSDELVLGIVLANPLASSAEHQLQALLTDIRAALARIDLNERLADS
                     QLQAETDRMRAALLSSVSHDLKTPLATIMGAGSTLLEYGDRISSEDRSELLHSVQDEA
                     RRLHSYVQNLLDMTRIGSPDFQLKRDWVDLADLVENARRRLDSSWRQHKLLVHFDQQI
                     PRLYVHGALIEQVLVNILDNASRYSPAGTPIEFKVMLADPDLILDIIDIGVGIAESDR
                     DKIFNLFYTQPVGDCGSRGTGLGLAISRAMIEAHGGRIWAFSGPNGNGTCMRISLPLA
                     LNAAAA"
     CDS             complement(15635..16162)
                     /codon_start=1
                     /gene="kdpC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KED3"
                     /locus_tag="NUITMVA1_00160"
                     /product="potassium-transporting ATPase KdpC subunit"
                     /protein_id="BDC80073.1"
                     /transl_table=11
                     /translation="MIAIRTLLTLTLLLGVAYPLAVTGLAQLVFPWQANGSLLTNAKQ
                     QVVGSALLAQKFERADYFHSRPSASDFATIGGGASNLGMSSPLRAEFAAAAVRAQPEA
                     RVPALLTRSASGLDPHLPLAAALAQVERVAGQRGLDPVQLTEQVKSAAQAGILGPQVV
                     NILQLNLQLDHQKGA"
     CDS             complement(16321..18378)
                     /codon_start=1
                     /gene="kdpB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KED4"
                     /locus_tag="NUITMVA1_00170"
                     /product="potassium-transporting ATPase ATP-binding
                     subunit"
                     /protein_id="BDC80074.1"
                     /transl_table=11
                     /translation="MSKSASMSTDTIQVKGKKQKSQILQAMVEALYRFNPRALFGSPI
                     LFTLWLAAVMATLESLLGQPLSGVAPSLAWQLTAWLWLTLWFANFAETLAEGRGKARA
                     DSLKAGMSQLKARRVTSPQDDKGEWVPATSLFKGDLVLVRSGEMIPADGEVVAGIASV
                     NEAAITGESAPVIRESGTDRSGVTGNTTVVSDQIWVHISNNPGESTLDRMIALVEGAK
                     RQKTPNEMALDALLVGLTLIFLLVVATLPWFLDYNGTQVPRLYLLALFITLIPTTIGG
                     LLSAIGIAGMDRLVKLNVIAKSGRAVEAAGDVRTLLLDKTGTITFGNRMADELIPAPG
                     VDPSLLAQAAMLASLGDNTPEGKSILTLAGKSHTRPSQLESDILIPFSAETRLSGLDR
                     NGHHYRKGAVDAVLRYLSLDRKAVPELILKSVDNIARQGGTPLLVCTHEKLLGVVFLK
                     DIIKPGIKARFQILRHMGIRTVMITGDNPLTAAAIAAEAGVDDFIAEATPEKKLAYIR
                     QEQADGRLVAMCGDGANDAPALAQADVGLAMNEGTQAAKEAGNLVDLDSNPTKLLDVV
                     LVGKQLLVTRGALTTFSIANDVAKYFAILPALFIAAYPQLGVLNLMQLGSPESAILSA
                     IIFNALIIVALVPLALRGVSLQGSAASLLRRNLLIYGVGGLIVPFIGIKLIDLVITGL
                     GLV"
     CDS             complement(18434..20116)
                     /codon_start=1
                     /gene="kdpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KED5"
                     /locus_tag="NUITMVA1_00180"
                     /product="potassium-transporting ATPase potassium-binding
                     subunit"
                     /protein_id="BDC80075.1"
                     /transl_table=11
                     /translation="MWQEIIYPVAFVLLVLLPAPLLGNYLYRVFEGKSRWLAPLERAT
                     LACCGTDGREQDWKSYALSLLAFNGAGFGLLFLILLAQGLLPLNPQQLPGLNWQLAFN
                     TAVSFMTNTNWQAYSGEASLSYFSQMVGLTTQNFVSAATGAAVAIALFRGIARQQTTH
                     LGNFWQDLVRFCLYVLLPMALILALLLVWQGVPQSLSAYLPFHALEGQEQLLPLGPAA
                     SQIAIKQLGSNGGGFFGINSAHPFENPTALSNWLEMVALLTLAAAMVCTLGRYVKDLA
                     HSRAILIAMTIMLVLGLCLAISQELKPDPALAHLTSEAGNWEGKESRFGPVLSSIWEV
                     ATTAASNGSVNAMHDSFAPLAGMVAMINMLLGEVVFGGVGAGIYGMMLFVLLTVFLCG
                     LMVGRTPTYLGKRLGITEMKWVVASMLVMPIGVLVIGGITLLMPDSATVIGHDGPHGL
                     SRLIYAYASAAGNNGSAFAGFAAADSWQCIAIGLAMLLGRFGYIIPVLAIAGQLARAP
                     RQERSEGDFPVSGPLFITLLIVTVLLMGGLSFLPVLALGPVAEHLSLLGGAF"
     CDS             complement(20434..21783)
                     /codon_start=1
                     /gene="gor"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704063.1"
                     /locus_tag="NUITMVA1_00190"
                     /product="glutathione-disulfide reductase"
                     /protein_id="BDC80076.1"
                     /transl_table=11
                     /translation="MAQHFDYIAIGGGSGGIASANRAAMYGKKVALIEAKELGGTCVN
                     VGCVPKKAMWYAGQIADALKYGADYGFDTTLNHFNWAKLVESRQAYIGRIHQSYQNVL
                     GKNQITVIKGFARFVSSNTIEVNGEQYSADHILIATGGRPEVPAIPGAELGIDSDGFF
                     ELQSQPKRVAVVGAGYIAVEIAGVMQALGSETHLVVRKHAPLRNFDPMIHETLVEIMA
                     QEGPKLHTHAIPKAVVKNADESLTLQLEDGRHLTVDCLIWAIGRVPATDNLNLAAAGI
                     ELDEKGFIPTDKFQNTAVANVYAVGDNTGRIQLTPVAVAAGRRLSERLFNNKPNEHLN
                     YDLVPTVVFSHPPIGTIGLTEPEAIAEYGEGQVKVYRSQFTAMYSALTQHRQPTRMKL
                     VCVGPQEKVVGLHGIGFAMDEILQGFGVAMKMGATKADLDNCVAIHPTSAEEFVTMR"
     CDS             complement(21860..23857)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704064.1"
                     /locus_tag="NUITMVA1_00200"
                     /product="sensor histidine kinase"
                     /protein_id="BDC80077.1"
                     /transl_table=11
                     /translation="MAIYPDRKDAMSGLFSKTAKAVGRNGLSYRLLSYILVCSTVLAM
                     IITVLQLAWDYRKDVAVIEDSIGQIEASFLQPIAASLWNLDEEQVKVQIEGIMNLPNM
                     QFVMVKEMLGNSEVPLLTQGVERESYDISREFNLTYQGEVVGKLFVAASLEQIYQRLI
                     EKSVLIMVSQTIKTLVVSFCILIIIYYLVVRHLNRIANYAQKFNLDRLAIELTLEGRP
                     LPRKKPDELDTLVATLNQMRTRLNDEFAARHQAAEQLQQERDFSATLINSANMVICCM
                     EPDLNIASINPAAILLTGYHQQEILQHNWLDLFVSKAQRDELAATLADHGSIEDKEVI
                     MHDQQGHELVLQWTFAPFYEGPNLKYLIGFGYDITRLKKVEREIIQLNEQLEGKVVER
                     TRSLSDANDQLGKAYDDLKQAQQTLVESEKMASLGSLVAGVAHEINTPIGISVTASSY
                     LQERVADFKQHIDSKQLSRSYLTEFTVNLDESMQLLQGNLRRASELIASFKQVAVDQS
                     SEARYNFSLADNLHQVVVSLGHKLKKAQCEVDIQCDPKLSIFSFPGSFTQIYSNLILN
                     SINHGFDNWDKPKKITIKVEQQSEELLIDYSDNGRGIPPEILPRIFDPFVTSKRGQGG
                     SGLGTHIIYNLVVQLLRGRINCVSEPDNGAQFHIRLPIQHN"
     CDS             complement(23950..27030)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704065.1"
                     /locus_tag="NUITMVA1_00210"
                     /product="transporter"
                     /protein_id="BDC80078.1"
                     /transl_table=11
                     /translation="MRFTDIFIKRPILAISISFLIALLGVQAVFKMQVREYPEMTNTV
                     VTVSTSYYGASADLIQGFITQPLEQAIAQADNIDFMTSSTQLGSSTITAYMKLNTNPN
                     AALSDILAKVNSVRSQLPKESEDPSVTMSTGSTTAVLYIGFTSPELNASQITDYLERV
                     IKPQLFTVGGVSKVDMYGGTKYALRVWLDPAKMAAFNLTAADVMSVLNSNNYQSATGQ
                     ATGYFTLYNGNAETQVNTTEELERLVVATRDGKVIRLADIAKVSLEKSHDTYRATANG
                     REAVVLAINAAPTANPINIAHDVLEMLPSLKSNMPSTMEANVLYDSTVAINESISEVI
                     KTIAEAAAIVLVVITLFLGSFRAVIIPIITIPLSLIGVVMVMQMFGFSINLMTLLAMV
                     LAIGLVVDDAIVVLENVDRHVKEGEEPFRAAIIGTREIAVPVIAMTVTLAAVYAPIAL
                     MGGITGSLFKEFALTLAGAVFVSGIIALTLSPMMCAKMLKANEEPGKFESKVHHLLDR
                     MTVRYDAMLHAVMQKRIVVVLFAVIVFASLPMLFKFIPSELAPNEDKGVMAVLGTAPS
                     NVNLDYIQGTMEQVNKVLDEQPEVAFSQVFSGVFNANQAFGIASMVPWSQREASQKEV
                     LERVGKLVENVPGMSITTFQFPELPGASSGLPIQFVITTPNNFESLYQVASEILTAAQ
                     GSGRFVYSELDLQYDSATMKIKIDKDKAGAYGITMQDIGITLGTMMSDGYVNRIDLDG
                     RSYEVIPQVERKYRLNPESIKGYYVRAADGQSIPLGSLISIEVVGEPRALPHFNQLNS
                     ATIGAVLMPGTTMGNAIAWLDATASEKLPQGYRYDYMGEARQFVTEGSALYATFALAL
                     AIIFLVLAIQFESARDPLVIMVSVPLAISGALIALAWGAATMNIYSQVGLITLVGLIT
                     KHGILICEVAKEEQLLHGRNRMEAVMAAAKVRLRPILMTTAAMIAGLIPLLYATGAGA
                     AQRFSIGIVIVAGLAIGTLFTLFVLPVIYTYLASEHKPLPVFDESIPPKAKGSH"
     CDS             complement(27046..28152)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704066.1"
                     /locus_tag="NUITMVA1_00220"
                     /product="MexH family multidrug efflux RND transporter
                     periplasmic adaptor subunit"
                     /protein_id="BDC80079.1"
                     /transl_table=11
                     /translation="MKKWMSIMLLIALALFGSVIGFNLFKQKMIANYMANMPEPEFPV
                     TTHKVETRDWVPTIEAIGFIEPNQGVTLSTEQSGTIDSISFESGDTVKPDQLLLSLDA
                     SVEKANLRASMAKLPAAKAKFDRYQNLFTKGSISRDQLDDTEATYRSLEADIESLKST
                     IARREVRAPFAGVVGLRNVFLGQYLQPGTDIVRLEDTSVMRLRFTVPQTDISRIRLNQ
                     DILINVDSYPHRQFKGHISAIEPAVNYQSGLIQVQADIPNNDGQLRSGMFARASILLP
                     AQKDQIVLPQTAITFTLYGENVYLVKEKDGVKRVEQVVVKVSERKGNDAHVVSGIKAG
                     DEVVMSGQVRLSNGAKVKIVQDQGLKVPDQVPML"
     CDS             complement(28185..28748)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704067.1"
                     /locus_tag="NUITMVA1_00230"
                     /product="TetR family transcriptional regulator"
                     /protein_id="BDC80080.1"
                     /transl_table=11
                     /translation="MNKKERIFDAAHEVLGEQGFHGLSIAVVAKKARVAAGTIYRYFS
                     DKDDLIRQLYRHTILQCHPLVMEGVQTEEVSFEQFRRLWLNIHAIFVDEPNALKCKLQ
                     YETSPLGAELEQDPVIKAAWAPLDRFFERGLEQGLFIDLPVRVLQVLSLDCVANMALQ
                     SQVHQFELTQDQLEAVIRACWRAILTP"
     tRNA            29009..29085
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00010"
                     /product="tRNA-Arg"
     tRNA            29136..29211
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00020"
                     /product="tRNA-His"
     tRNA            29232..29317
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00030"
                     /product="tRNA-Leu"
     tRNA            29390..29466
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00040"
                     /product="tRNA-Pro"
     CDS             29652..30161
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704068.1"
                     /locus_tag="NUITMVA1_00240"
                     /product="lectin"
                     /protein_id="BDC80081.1"
                     /transl_table=11
                     /translation="MHPNSFRVSTLALVVVALSGCSYKPKPDEILMGAAPMQSTATSA
                     LVTDAGFCVALNDHNQLITQPCDQTARQQFSWDAGALQLDQRCLVAKGVSELTMAECQ
                     DEGRQWQWQEDRLFNSKADRCLDVAGRRHKPGTPLRLADCFGGANQSFAWQNKGSMFD
                     KLNLKSLIW"
     CDS             complement(30166..31245)
                     /codon_start=1
                     /gene="pyk-1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KR09"
                     /locus_tag="NUITMVA1_00250"
                     /product="pyruvate kinase"
                     /protein_id="BDC80082.1"
                     /transl_table=11
                     /translation="MRKTKIIATLGPASSSATMVEQLIQAGTNVFRLNFSHGSPEQHL
                     ALAAKIRACAVRLDREIGILADLQGPKIRIASFADGSIRLQPGDPFTIDAGLDSHLGD
                     QSRVGTDYPALAGELQTGNIVLLDDGRIQLCVEQVIDERIETRVLVGGTLSSRKGINV
                     LGGGLSAPALTDKDKADILTARLLEADYIAVSFPRSAADLEEARTLIRASGSRAAIVA
                     KVERAEVVASVAAMDELIHAADLIMVARGDLGVEIGDARLPGVQKRLIRRCRALGRPV
                     ITATQMMESMIASPMPTRAEVMDVANAVMDGSDAVMLSAESATGRYPVEAVAAMARIA
                     LAAEQEMEPAGHGLAASHGELARLA"
     CDS             complement(31313..32650)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704070.1"
                     /locus_tag="NUITMVA1_00260"
                     /product="MFS transporter"
                     /protein_id="BDC80083.1"
                     /transl_table=11
                     /translation="MFNFFKTRADLPVMEASPDKIRSIYRKYQWQVFLGLVLGYAMFY
                     VVRMSLNVVKKPMLDSGVVTLEELGVIGSAFLFTYAVGKFSNGFLSDYANIGRFMSVS
                     LGLSSICTILMGMNTATFFLVLMWGLNGWFQSVGSAPSCVSIFQWFSPKQRGSVYSIW
                     GGSRNIGEGISWILTATIVSYFGWKAGFIGAGIASLIAALCMYLVLKDRPQTYALPEP
                     AVAFGEAPEIAKKVDPAEIRRAQLFVLKQPAVWLIAAACACMYMSRYAMSSWAVLYLQ
                     EQKGYSLIDAGFAMSAYPIAGFLGAILAGIISDKLFNANRHIPTLLYGLANVAGMCLM
                     FWGPQSRMMDAVALALIGYAIGGLVVFLAGLTACDLMPKTAVGAVKGFIGLCSYIAAS
                     IQELVSAALIKTSEIDGVTHYDFSSAQYFWLGASVVSMLLAMTVWNAKKVVNH"
     CDS             32964..34223
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704071.1"
                     /locus_tag="NUITMVA1_00270"
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="BDC80084.1"
                     /transl_table=11
                     /translation="MHLFFRRLALLTGCVLLPFSTLQAASLTVLTSFSEAPVKAVIEG
                     FAEQYPGIRVEVIYRRTIPSLRLLTEAGAPKVDIIMSSSPTFFNTLDKAGLLAALPNE
                     TMPPKWLAPHTLGLGNKVAVVGYSSSGIMYNRHYLAKYQLPQPTTWQQLASPLFMGHV
                     MMSSPSQSGTTHMMVESVLQQYGWQQGWALLMRLGGNLSAITARSFGVSDGISRGLAG
                     AGLVIDSYALNSQARFDHVGFNIMPDSVILPTYLGVARHSTQPASAALFIQYLLSDSG
                     QAIIATPGMAKATLSQPRLARQTRYVTDKALLYRRAGLLKALFEQTITQQLPRLKMTW
                     QGINGLNTHGEPWRVALLEQAVAKASTPPLSEQEAQDPALLALFDGLYDREQGNPQAE
                     RVMHQWRQATEARLHEAQRLVEQAARP"
     CDS             34220..36652
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704072.1"
                     /locus_tag="NUITMVA1_00280"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BDC80085.1"
                     /transl_table=11
                     /translation="MSRLGRMLAMPRTLGRRLILAFVTITALTGAMGMAAYVMWDRLG
                     RQIHLIVEESLPAIDGAYQLERASSRLLLLLAQLRDTRDPVQYQRLSNAVSTTLRDIQ
                     RAYLLGTPGDQTPSQRQAFEALGALVADHGRYLKQQIDHAETLQQLQKRSNWLHQDLV
                     DDAAPLLQEVEWHLTSMVASPDDMSEFGNVIKEFSALQDLTFKENELQSLVGEVIAQR
                     YQQDLESAFLFIGYKIDEIDALTSRLAEYPSTVSYRQILQDIITLVKPDGPLHRLLLA
                     DVLTHQQLTALRPRLDDAVSRYHQRVSLMVSDANRSLSALGEDSSQLVATGKLVILVV
                     LALTLLLSIFVLVVLIGRRLIKRLDLLGQELDRVAAGRLDVPVSTCGRDEIGRLGDSL
                     RHFSLQLQQMERANALNLINNTQACLITCHPDGTIESVNPSALTLFQQTGVEPGQPLW
                     QAFPAEARAVLADQFRAGQPLHRFGHSECTLACGLGETPRFLHLNLRRFEQGRGYRFI
                     ITITDVTRQELTARELSLRVAERTRELTENNRLLAEEVVQRQQAERTLLQTQDELIQA
                     AKMAVVGQAMTSLAHELNQPLSAMMTYLYTSRTALAAGQLQALDQDLGKLDKLGRRMS
                     RIINALRHFARKSPAEEVRVRLALGSLAEQAMLLLETRAKRDGCILCNELPDGLWLET
                     DPVLLEQVLVNLLVNGLDAVAGLARRETRLQLLERSEARLRLAVVDSGAGFSEAILPR
                     LFTPFTTSKEVGLGLGLTICRSLLARCGGEIMLGSALTGGAMVIMEFALADPAGSVAH
                     QNEENAIDVVAR"
     CDS             36636..37913
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704073.1"
                     /locus_tag="NUITMVA1_00290"
                     /product="two-component system response regulator"
                     /protein_id="BDC80086.1"
                     /transl_table=11
                     /translation="MLLPANRPANVLLVDDDEDVLESYCHLLRLSGYHPRATTSPHEA
                     LALLADQWPGVLVSDIYMPAMNGMDLLASVQALDAEIPVIMITGHGDIPLAVRAVKQG
                     AFDFLEKPLNPQDLLGLLERACRQRSAVLARRSEIQATVDDELIGTSPQIVALRSQLN
                     QLAQTDKDLLLEGPAGSGRHTLARLLHRISARREQAFQLHDCVSASSLAEVQASLAQA
                     GQGTLVLQSPARLSADCQRWLGNHLLDQERKGSKSLRTIGLFDESPEALVERQQLMPE
                     LYYFLSQVRLKLPRLVERSCDIIPLFRAFLRQGCKRIGRSVPAVDRAYLETLKRHQWP
                     GNLRELRNVAELYAVGIVKLAGAEQVIPLASGKEPLDDLVEEFERRVIEDTLFLFSGR
                     VTDAAQYLGIPRKKLYLRMKKHQLDKDRFKPAT"
     CDS             37965..38279
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704074.1"
                     /locus_tag="NUITMVA1_00300"
                     /product="hypothetical protein"
                     /protein_id="BDC80087.1"
                     /transl_table=11
                     /translation="MRCPHCMSEGVARIEDERVKRACALGLGAAGGYACAATLARMGA
                     ATGSALGGVGTVVGALAGALGGAVLGGLMGGGLGWWLGRTLDRRLSRHYRCGVCGHRF
                     RR"
     CDS             complement(38327..39202)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704075.1"
                     /locus_tag="NUITMVA1_00310"
                     /product="haloacid dehalogenase"
                     /protein_id="BDC80088.1"
                     /transl_table=11
                     /translation="MGSRERLLYTAPAFIRNPEVMMYKVVVSDLDGTLLNGQHQISPR
                     TRDTLHRLVDQGIKFVVATGRHHVDVRSIRDTLGLDIYLITSNGAVVHDKQDQLIFNQ
                     ALPDSVAAELIALERDPSIHINLYYGDEWLVEEEMPWLLQFHHESGFSYRLTDLASHP
                     LDKVNKVFYIGEHEKLLQIEAELNQRYGDRLNVTFSLPDCLEVMHAGVHKGNAVRAVL
                     EQHGLEMSQAVAFGDGMNDFEMLSMVGRGVVMGNAHDRLKLALANHEQTLSSDEDGVA
                     VYLEQLFALQGVNVA"
     CDS             complement(39233..40273)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704076.1"
                     /locus_tag="NUITMVA1_00320"
                     /product="lysophospholipase L2"
                     /protein_id="BDC80089.1"
                     /transl_table=11
                     /translation="MKLNHLPLLALTLFSAGALAVNNPYQLTPEADVVTLHQQTLPDF
                     WRQHAVESAFKGKDGVTIRYAALRQAKVDRAILIVNGRVESYLKYQELAWDLWRQGYS
                     LYLIDHRGQGLSDRLLADQEKGYVDQFDDYVLDLKQFHDEVIAQDQPAKLFLLAHSMG
                     GAISARYLERWPDDIEAAVLSSPMMGINLGGLPKWLAKGLAATIGTVGGWLGEPPYGP
                     GQGPYESHDFADNGLSHSEARYQAFRELYEQRPQIKLGGATAHWIYQGLTGADAAVAE
                     AGAIKTPLLLLQAGDDGVVDNAAQDAFCALARCEGGKPLRIEGAWHELFMEADPQRQA
                     ALNATLAFFARY"
     CDS             complement(40263..41006)
                     /codon_start=1
                     /gene="trmH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KR25"
                     /locus_tag="NUITMVA1_00330"
                     /product="tRNA (guanosine(18)-2'-O)-methyltransferase"
                     /protein_id="BDC80090.1"
                     /transl_table=11
                     /translation="MTPERFKRITDMLAQRQLDLTVCMEEVHKPHNLAAIVRTADAIG
                     IHRVHAVWPKTWIHKRKGTARGSQNWVDVKLHPDIGSAVAELKASGMQILATHLSDSS
                     VDFRSIDYTKPTAILVGQEKHGIGEEALALADHHIVIPMVGMVQSLNVSVAAAAILYE
                     AQRQRELAGCYQRGCPLDLEEQNSILFEGGYPIYAQLCKEKEMPYPQLGPAGEILADE
                     QWWQQMQLTRKGWAAQQSDDPSEEYADEA"
     CDS             complement(41231..43348)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704079.1"
                     /locus_tag="NUITMVA1_00340"
                     /product="guanosine-3',5'-bis(diphosphate)
                     3'-pyrophosphohydrolase"
                     /protein_id="BDC80091.1"
                     /transl_table=11
                     /translation="MYLFENLKEIASSYLPSEQVEKLRQAYVVARDAHQGQMRSSGEP
                     YITHPVAVARILGDMRLDHETLMAAVLHDVIEDTPVTKADLAELFGDAVAELVAGVSK
                     LDKLKFRDRKEAQAENFRKMVMAMTQDIRVILIKLADRTHNMRTLGSLRPDKRRRIAR
                     ETLEIFAPIANRLGIHTMKNELEELGFEALYPMRSRVLRESVRRARGNRREIIDSIQS
                     EIEGRLREAGIESQVSGREKNLFSIYNKMEKKELQFHEVMDIYAFRVRVKDIDTCYRV
                     LGQMHSLYKPRPGRFKDYIAIPKTNGYQSLHTSLVGPHGVPVEVQIRTEFMDQMADKG
                     VAAHWAYKQDGDSSGTTAQIRAQRWMQSLLELQQSAGSSFEFIEGVKTDLFPDEIYVF
                     TPEGRIMELPAGATPVDFAYTVHTDIGHACVGSRVDRHPYPLSSPLHSGQTVEIITAP
                     GARPNAAWLNFVVTTKARSKIRQFLKNLRTEESVVLGRRLLNHALGAKNIEDIPEPRI
                     KQVLADTKHENLQGLLADVGLGNAMSVMVARRMLGDELPPEEQPKSSSKKMPIKGADG
                     MLVTFANCCRPIPGDAIIAHISPGKGLVIHQEACRNIKGYSKEPDKYLPVQWEVDKEQ
                     EQEFRTGISIEIVNHQGALAELANVIAATGANIHAISTEEKDGRVYLVTLLITTKSRI
                     HLANIMRKIRVMPNVLKVSRQKN"
     CDS             complement(43486..43761)
                     /codon_start=1
                     /gene="rpoZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KR23"
                     /locus_tag="NUITMVA1_00350"
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="BDC80092.1"
                     /transl_table=11
                     /translation="MARVTVEDAVKQVGNRFDLVLVAARRARQIAVQGKDPLVDEEND
                     KPTVIALREIELGLVNNQVMDTQDRYEQQEQEAAELAAVAAIAEGRG"
     CDS             complement(43841..44695)
                     /codon_start=1
                     /gene="gmk"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEC4"
                     /locus_tag="NUITMVA1_00360"
                     /product="guanylate kinase"
                     /protein_id="BDC80093.1"
                     /transl_table=11
                     /translation="MAADVGDAPAASYEYFDRLEYDSGRFFIRHLLLKFAAFTSLLIQ
                     EFSAFRIWLSPFRAQDGGLCYNQNTVSLKGTDMAQQGTLYIISSPSGAGKSSLLNALL
                     TQHNSAGKMQLSVSHTTRATRPGEEHGVHYHFVKVEEFKALIERGDFLEWAEVFGNYY
                     GTSRAAIEACLAQGIDVFLDIDWQGARQIREQMPTKSIFILPPSREELERRLIGRGQD
                     SAEVIKGRMEKAIAEMVHYDEYDYVIINEDFEQALFQLRAVIECQRLELRQQQQAQQN
                     LLQQLLAE"
     CDS             complement(44739..45821)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704081.1"
                     /locus_tag="NUITMVA1_00370"
                     /product="glycosyl transferase"
                     /protein_id="BDC80094.1"
                     /transl_table=11
                     /translation="MPLFQTPPSSICILRLSAIGDCCHALALVRVIQRAWPTTRITWI
                     TGKIEATLFADLPGVEVIAFDKSKGWRGYRDLWQTLRGRQFDALLHLQAAMRASIATL
                     GIKAKVKLGFDRERASDGQWLFTNHKVPSPASPHVLDGFLAFAKELGVQDLTPDWQLP
                     ISTEHQAWAKEKIDGKPTLLICAAASKAFKNWTAAGYAALADHAAGRGFQVYLCGGPA
                     KLERDLAADIQRLSHSKPVDLVGQTNLKQLLALIKEASLVLAPDTGPTHMATLVGTPV
                     LGLYAHHNPDRTGPYLCRDYAVSVYQELVEQETGKPLAELGWRTRLKDPDAMSKITRE
                     RVIAAFDRLCADRQLTAGQQLGISEQ"
     CDS             45766..45966
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_00380"
                     /product="hypothetical protein"
                     /protein_id="BDC80095.1"
                     /transl_table=11
                     /translation="MAESRRMQMEEGGVWNSGMMWRNGGKMDGWHYANSPVDCKIAHD
                     RQPVLLTGPVLPLPALALCSHD"
     CDS             45986..46699
                     /codon_start=1
                     /gene="kdkA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEC7"
                     /locus_tag="NUITMVA1_00390"
                     /product="3-deoxy-D-manno-octulosonic acid kinase"
                     /protein_id="BDC80096.1"
                     /transl_table=11
                     /translation="MQIQTEHNQICWYAEGAFRDPSPELFDPAWWQTHRQVVGSSIGR
                     GVTWFVKDESRHLVLRHYYRGGMVGKVVRDRFWFEGVESSRAMAEYTLLAKLSAQGLP
                     VPRPFAARMAKQGPFYRADILIERIRGAKDLVALLKQGPIAGEVWHKVGQTVRRLHDA
                     GVYHADLNSHNLLLDKEGKVWVIDFDKGAIRSPGNWQQANLERLLRSFNKESQLHTSF
                     HFVPENWQALMNGYQGKAS"
     CDS             46770..47633
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704083.1"
                     /locus_tag="NUITMVA1_00400"
                     /product="diguanylate cyclase"
                     /protein_id="BDC80097.1"
                     /transl_table=11
                     /translation="MDMLKAPLREAITRFDLALMADAIALLEAGLWSWSPQQGVQRDL
                     SCLRLLGLNEAGLDDLGWLERVHPDDVGSLQEALTACQSGRVAQIRLEYRILHHDGHY
                     VRLEERARRDVHGQVLGVVRLLDSQALLVEERHGTDPLTGLESRSHFELLLDERLASE
                     SGSFSLLQFSVDHRAKIQQLFGEVACDAMLAKLARIVRHELRREDPFARWDEDGFILM
                     LSQTDRLSGLEIAERLRLEIADASLLPQRPVTVSIGLVQSQAGEQIDHLLARLATCHG
                     QARREHNTVVG"
     CDS             complement(47641..48495)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704084.1"
                     /locus_tag="NUITMVA1_00410"
                     /product="membrane protein"
                     /protein_id="BDC80098.1"
                     /transl_table=11
                     /translation="MNYLIGVTLLWSFSFSLIGVYLAGQVDAYFSVLTRIVLASLVFL
                     PFLRRRWLRPDLVAKLMALGATQLGIMYLFYYHSFLLLTVPEVLVFTIFTPIYVTLIH
                     DLLERRFKPTYLWGALLAVLGAAVIRFDGLTESYVLGFLVVQGANICFAIGQVGYKVL
                     LAREKEQPPQLAVFGCFYLGALAVALPAWLLLGTPQYPTSTLQWGILLWLGIGASGLG
                     YFLWNKGATQVSSGVLAIMNNALIPAGLLVNLLLWGKDTDLLRLTLGGLLMLASLWVC
                     QRHGVSER"
     CDS             48539..48997
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704085.1"
                     /locus_tag="NUITMVA1_00420"
                     /product="hypothetical protein"
                     /protein_id="BDC80099.1"
                     /transl_table=11
                     /translation="MAEMEALIQRLWRQLPQIGAFAFTASNGEGSATDWCGSGEGEVT
                     VTDHQGGWLFAEQGRYTTPHGRVLAMHNRFWWQRGERGIRLSHLRYAQPVVLFELLPQ
                     ADGRWLTAEPHLCGQDHYSAELTPTGDGFLLGWQITGPRKNERLSYRYRV"
     CDS             complement(49121..49282)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704086.1"
                     /locus_tag="NUITMVA1_00430"
                     /product="hypothetical protein"
                     /protein_id="BDC80100.1"
                     /transl_table=11
                     /translation="MSGILTTLCGGLVVIAGWQYRQRLMGLLGLLMVLLPWFFDSKLQ
                     AMLSYALSA"
     CDS             complement(49267..50166)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704087.1"
                     /locus_tag="NUITMVA1_00440"
                     /product="membrane protein"
                     /protein_id="BDC80101.1"
                     /transl_table=11
                     /translation="MRSYLLLLAIGLLWGSQFIFMHQAVTELPPIMVAAGRALCGSLT
                     LGLLCLFMRLKSEHTPWRTYMLIALLDATLPFIMVAWGQQYVDSAIAAVVMGCIPFVT
                     ILMAPLLVSGEKITKGGLVSVVIGFVGVLVLFWPKLASGMNAGLLGAMAILFGASCFA
                     IGLLMIKRFAKDHPVVVARNILISSAIQLLLAAPFVTDLSALTMPSQHAIGAVAVLGV
                     FCTGLVYFLYMALIQKAGPTFASFSNYLVPLFGVMLGALFLGEQIQSTTGVALALILG
                     SVALNQWAQQRRVQREAALCQAS"
     CDS             50258..51232
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704088.1"
                     /locus_tag="NUITMVA1_00450"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BDC80102.1"
                     /transl_table=11
                     /translation="MELPLSRLDLNLLTVFDMLMQERNVTRAAERLHLSQSTVSHALG
                     RLRTALDDPLFVMSRREMMPTERAKALAGPVRQALAMLEQGLRQAKGFDPASARRIFR
                     IATPGSVEHGLVPALVERLHRHAPHCRLEVCELADSDYERELEKGELDLVIGFADANH
                     LSPRLWREPWFNNPLVCLSPLGSELPDVLGPDELVSRPHIHTSSWGHSQAMVDLWLAR
                     FGVARELGVRLPSFMAVPPLMATGRYLVVVPEMIGRHFCRYYPLRLHQLDPDIPIVYL
                     MAGHPLTAHDEAIGWFKGLLHRLAFERYGADALGSPAQRGADQFNPAK"
     CDS             complement(51211..52224)
                     /codon_start=1
                     /gene="trpS-1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704089.1"
                     /locus_tag="NUITMVA1_00460"
                     /product="tryptophan--tRNA ligase"
                     /protein_id="BDC80103.1"
                     /transl_table=11
                     /translation="MHNPVILTGDRPTGKLHIGHYVGSLRQRVAAQHHYRQFVMIADL
                     QALTDNGHNPAKVTDHVLEVMADYLAAGLDPAKTTFCLQSALPALAELTTYYLNLVSV
                     ARLERNPTVKAEIQQKGFERSLPAGFLIYPVSQAADITAFRATHVPVGEDQLPMLEQT
                     NEIVRRFNTLVGKEVLNECQPILSDTGRLPGIDGKAKMSKSLGNTIELGMSAEEIKQA
                     VFAMYTDPNHLKVSDPGQVEGNTVFSYLDAFHPDKALVAEMKAHYQRGGLGDMRCKQV
                     LNDCLQTLLAPMRERREAAIADKRQLLRLLQQGTEQARALTDEVLAEVKGAMGLDYFA
                     GLN"
     CDS             complement(52416..52850)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KR05"
                     /locus_tag="NUITMVA1_00470"
                     /product="universal stress protein"
                     /protein_id="BDC80104.1"
                     /transl_table=11
                     /translation="MNGTYYKHILAAIDLSEDNRKVIEKAVDRARSNGAKLSVIHVDV
                     DLKDLYTEMIDIDIDNVQDQVIAEAKEKLEAFLASVDYPIEKKLVICGDLSERVNQAV
                     RDYQIDLLVCGHRQSFWSLLTSSARQLMNTVPCDLLVVPLQK"
     CDS             53317..54504
                     /codon_start=1
                     /gene="fabV_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEB7"
                     /locus_tag="NUITMVA1_00480"
                     /product="enoyl-[acyl-carrier-protein] reductase [NADH]"
                     /protein_id="BDC80105.1"
                     /transl_table=11
                     /translation="MIIHPQIQGCVARNCHPIGCRAAVLQQIERIRAAGPFNGPKRVL
                     VLGASSGFGLASRIALTFGAGADTIGISFERGPSDKGSGSAGWYNNIWFRKEAEQAGR
                     IAINLIGDAFSTGMRQQAIDTIRQQLGQVDLVIYSLASGIRVLPDGTQVRSVLKTTGQ
                     PFSGWGLDLEHDTLVQQSLDPATPEEIRDTVSVMGGEDWQLWLQALQQADCLAPGAQT
                     VAYSYIGPESTYPLYRDGTIGYAKEHLHATAETINLQLAEIGGHAWVSVCKALVTKAS
                     AYIPVLPVYLGLLMGVMKERGVHEGCIEQMQRLFATKMYGPQGVVADGNRLIRMDDHE
                     LDPAIQAAVSALWSKVTPDNFHALGDFAGLRQDFMQLNGFELPGVDYGAPVDLASLTE
                     LLP"
     CDS             complement(54521..56311)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704091.1"
                     /locus_tag="NUITMVA1_00490"
                     /product="GGDEF domain-containing protein"
                     /protein_id="BDC80106.1"
                     /transl_table=11
                     /translation="MALALLWMTQLQATPSLLKEAELQAARDPVGYLQRLDANPQQDM
                     EQFYARALAQAALGRYPQALLDNARARGLASAQQETLRLLDFRLQQIALTLDTEAPDQ
                     ALTLLEQLKPAVAGHPQQTSEWHALNGLALYRTQQLSAAIAELKTAFRLKQTIPNSTI
                     ASLQCARLLMTLGNLYADLNLAREAESYYLEALQRMVQLDEPNSQTIIRANMARLYID
                     TDRPAQARRLLDNLLANPALAPDYRAIILGYQAMALNAERDWTGALRALDEAQALYQQ
                     LGYPEAGVRLLETRARALQGSGEKQLALQLLTTQGPAGAGSKALQASLLADQGRYPEA
                     YQALNEYVNDYKQHFNQTLSQHAAAFQAEMDLARSEASNRVLQQENENKRQQLLHQQS
                     ARHYQLALVGLLASALLLLGVTTHRLHRSSRHLYKLATFDQLTELPNRRALLERLATQ
                     WQQEGPLTLLIIDIDHFKQINDRHGHQAGDRAIQRLARELRSWAPDLQLVGRWGGEEF
                     LVAVPLPAADCWYLAEQLRQRIGQIDKPRMTISIGVAGRSAADDGLGQLIHRADMAMY
                     QAKRQGRNQTILAAEPNSPEQPEALASSVA"
     CDS             56521..57045
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEB9"
                     /locus_tag="NUITMVA1_00500"
                     /product="ferritin"
                     /protein_id="BDC80107.1"
                     /transl_table=11
                     /translation="MLAKAMIEKLNEQINLEFYSSNLYLQMSAWCEDKGFEGAANFLR
                     QHAVEERQHMERLFTYVSETGAMPLLGAIDAPPHEFKSLGDIFRTTLEHEYHITKCIN
                     GLAHVAFTTQDYSTFNFLQWYVAEQHEEEKLFKSIVDRLSLVGEDGKGLYFIDKELAE
                     LAKGAPASIMDGNA"
     CDS             57206..58390
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704093.1"
                     /locus_tag="NUITMVA1_00510"
                     /product="membrane protein"
                     /protein_id="BDC80108.1"
                     /transl_table=11
                     /translation="MKQFDVVVIGAGAAGLMCAAQAGYRGRSVLVLDNAKKPGRKILI
                     SGGGRCNFTNHQAGPHAFLSANPHFCKSALARYTQQDFIELVDRHGLSYHEKTLGQLF
                     CDESAKEIVDILLTECDWAGVTLQFQTEILTVSKSDEGFVLTTSQGEISCHSLVVATG
                     GLSMPKLGATPYGFKLAEQFGLKVLPTRAGLVPFTLHQAEKEAFADLAGVSLPVAVTA
                     EDGTCFKEAMLFTHRGLSGPAILQISSFWLAGEKIHINLLPELDIAATLREWAQAHPA
                     QELKTVLGRELPKRFVDKLVELGQLVSKPMRQYNERELEAVAALLGDWQILPNGTEGY
                     RTAEVTLGGVDTNELSSKTMEARKVAGLYFIGEVVDVTGWLGGYNFQWAWSSGWVAGQ
                     YC"
     tRNA            complement(57558..57645)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00050"
                     /product="tRNA-Lys"
     CDS             complement(58578..59798)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704094.1"
                     /locus_tag="NUITMVA1_00520"
                     /product="MFS transporter"
                     /protein_id="BDC80109.1"
                     /transl_table=11
                     /translation="MEKSLSTDQPLAAATAHDALNRTTYPVIAAISFSHLLNDMMQSV
                     LLAIYPLLKLGLNLSFAQIGLITLTYQFTGSLLQPLIGLYTDRRPMPYSLPFGMGFTM
                     IGLLSLSQAASFGAVLLSAMLIGIGSSVFHPESSRVARMAAGSQPGLAQSLFQIGGNL
                     GSAIGPLLAALIIVPQGQGSAAWFSLFALVGVIVLSLVGRWSSHHAANFHKRMKAHLG
                     HGLSRRQIGWSLAILGLLMFSKFFYMASLSSYYTFYLMDKFSLSLDSAQLYLFAFLFA
                     VAAGTVLGGPIGDRIGRKRVIWISILGVAPFTLLLPHVDLFWTSVLSVIIGLILASAF
                     SAILVYAQELVPGKVGTISGLFFGFAFGMGGIGAALLGQLADATSIETVYRVCAYLPL
                     IGLLTAFLPTLRKG"
     CDS             60075..60713
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704095.1"
                     /locus_tag="NUITMVA1_00530"
                     /product="leucine efflux protein"
                     /protein_id="BDC80110.1"
                     /transl_table=11
                     /translation="MFESLGVINVWTYLVGLFFIIIAPGPNSIYVLRTGASRGVGPGY
                     QAALGVFVGDAILIFCAYLGIASLIRTTPLLFTLVRYLGALYLLYLGVKILHANFIAR
                     REGQASVVEHGERYFSKALTLSLTNPKAILFYVSFFVQFVDFNYAHTWVSYLVLASML
                     EAMSFVYLTLLIFGGTLMARFFARKVRLARLGNGLIGLFFMGFAARLATLSS"
     CDS             complement(60757..61443)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704096.1"
                     /locus_tag="NUITMVA1_00540"
                     /product="hypothetical protein"
                     /protein_id="BDC80111.1"
                     /transl_table=11
                     /translation="MKNDMHRILWLLLAGTLSSQTMAIDIGAMTIAMAPNEEFIARTV
                     TNNSSSPKVYEVQMEKISNPTATGTSVPTVPGELLFAPKRFTLHAKRMQNVKLYYKGP
                     ADGQERYYRITFTESPAAQLDESGQARRRGALEMKLALQSTLVVRPRQVRFQYQLDPA
                     RSSITNTGNTYFEFMVKRGCLQADSEADSKYLLPGETYRNPKISQAGNQKLIVYQSRF
                     IRVGKECWPD"
     CDS             complement(61446..63065)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704097.1"
                     /locus_tag="NUITMVA1_00550"
                     /product="hypothetical protein"
                     /protein_id="BDC80112.1"
                     /transl_table=11
                     /translation="MMNPAYKWLLAMVIATSWASQASAAVIKYNLVDADLRHFLFIEN
                     QEDHNLFITPTDYLDPRLTGGNAWTTDSRQVSLAYADNGHNYTVTNYNIDMWENGPVK
                     YPYINQRCIKSWAGCDPQTAEAMNKPASVNEAGFFGLMKAATGYAHAKLSSAFFDYLR
                     TMPAGGILNREMNLCMTTRIYDAAAGERCINQDSGTWYVKRTQHKKAGHLRFIQTNAI
                     SEVIVDSNGAPYVLPGSQGCENYRLGTRDGVLCRFLDYDFNQDGSQSFSDPYIYTNIK
                     NAALNSAIVGGDVQMSANLTNWALKGADYNVSYLRGQLSIYLFLSSNFFKQVVRLGLQ
                     EQLTRNLINFNMRNIKAPESGFYEFSGTTEIIIKPRDFSVSILSSEGVSNPYREGNVG
                     KDILSFSYNISDSGPISADMLEITVSQDIGAPYQGLCTFYPAGQAVPEQAVPIPTRLV
                     FDSTNHGTASRHAVRCDQTPLDIRSLGIQDSQPPQEWNDPVSGKGITRFYKLALEFDL
                     TDPMVQRTIGNDLWEGEVQQSGTITIKGTWR"
     CDS             complement(63065..65494)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704098.1"
                     /locus_tag="NUITMVA1_00560"
                     /product="hypothetical protein"
                     /protein_id="BDC80113.1"
                     /transl_table=11
                     /translation="MLPLSLLMVVSASANSAAPLKIANVIIPASFAQALAEGLAVPVR
                     LQYTDEKNRLDTLTDNPIGNATLLLQDGKLHLLHIDFGAGQQQGLLNDQLTAMLASEE
                     KRTFSAEGSLQIDANASMQLDLVAMLLTIRVSRDAFGQARQPDNRVTLTPTVDTLTGV
                     HRYNLGYSFNSNRQNGHSDSNFLQLDSTVGMGAHHMALDASLYNLGEPEQSGDIYRAM
                     YERDLDDRRIAAGMVSTWDLQTLGVVTGLSTGRIYGASYGNQAQSRKQKADTSTTPVQ
                     VFMPANGEVRVYREDRLISLQNLAIGNQNIDTSAFPSGVYNVTVEVYVDGRLTSTTTQ
                     RVTKLGGSLGFTQEWGWQWWGGMMEGAQNNGDSPLLGVSLARSLDTLELATTTYAFKD
                     AAVGEARANWQATDRVSAQLQTMLASDQSWRFASSLALQAHDNASLWLSQEKLETGSA
                     LTVSNAELYSAGITLNLGGWVSGLGQLTFNTLHDRQMNSDRSYADYYQHLYAGKYGNL
                     SLRASLQSDSGTLNGFNNKSITLDYSIPFDNLFSFGMSSNEQGQTTANVNYQKRMDGV
                     INLASFNASRMMHGSDEHNMALSGTLGFENRVIGGTMTLGRGHGGDMNGNLIARGALV
                     TTEDALVASSRSSSGAGLIINTGIDRQGQMLAKVNGQDYPLHGEQTFLALPPYGEYEI
                     ELLNSKRGKDSYDINTGKQRYTLFPGNVATLDASSTIKEMVTVFGILRAEDGSLLANA
                     RIDNHIGTTVTNEEGEFSLDVDKANPMLTFRQGNDFCEAELDLEKHSGAAWVGIITCQ
                     GLPTYAMVREY"
     CDS             complement(65594..66259)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704099.1"
                     /locus_tag="NUITMVA1_00570"
                     /product="hypothetical protein"
                     /protein_id="BDC80114.1"
                     /transl_table=11
                     /translation="MNLKMLMAWMLFIPGVSQAINVGSVTTFIDAGSQDVAKEIENGS
                     AQARLVTISVSRISSPEEGGQEIPMEVAGELMLSPSRLMLPAHAKNNVRFFYKGPQDG
                     KERYYRIRWLDTALSMDDQSNNRRQAVATTSAQIGTILVVTPRQQHFAYNLQNGMLSN
                     QGNASYRTVAYGPCLDRKAQAQCKETYYDLPGKQRRFKKVDMQDPQSHLGLWLGQEFV
                     VVK"
     CDS             complement(66319..66900)
                     /codon_start=1
                     /gene="matB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704100.1"
                     /locus_tag="NUITMVA1_00580"
                     /product="fimbrillin MatB"
                     /protein_id="BDC80115.1"
                     /transl_table=11
                     /translation="MKKTLIALTVAGLGFAAAAQAAIVESVPAVATWKATAKKDTESA
                     LVVTPLDSLSFQYAEGIKGFNTVNGLFDVAIKGDASATDFTLKAKKLSGTLNHLSGGS
                     TVDVGVLWQGAPVSTTAYTTLIDTAAGITGGNLSPLASSFMDDTQRSTAQGSFTFNIE
                     SATVNGTEAAFETLPDGLWSGEVNVEFVASWSK"
     CDS             67620..68123
                     /codon_start=1
                     /gene="evgA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704101.1"
                     /locus_tag="NUITMVA1_00590"
                     /product="DNA-binding response regulator"
                     /protein_id="BDC80116.1"
                     /transl_table=11
                     /translation="MARKYQPDMVVLDIGIPRLDGIEVIKRLKEMDADIKVVILSAQA
                     THHIMVRCLQAGANGFISKLDDLSLLKTVLVKIGKGQLYFPRDVIAGAKNAHEVDRKD
                     LLSALSDREMSVLLQICQGHTNKQIAESMLLSEKTVSTYKSRLMQKLNVTTMVDLISL
                     AKRQELL"
     CDS             68120..68974
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_00600"
                     /note="frameshifted, deletion at around 68869"
                     /product="hypothetical protein"
                     /protein_id="BDC80117.1"
                     /transl_table=11
                     /translation="MIMRHWFAALLVCCCASWASAHELAAPYLHVYARNDSEYLEKQT
                     LPLHAEDWLWLRNRGRLVLGVPMPDNPPMDITLRANAYEGVTADIVGMLSHLLRVEIV
                     VKNLPSRAAAIAALKRGEVDLLSTSNAYEEEQQLLLTDKYMPDDPAIYKNIHVKERDI
                     RTVAVPEYYLPALDVMRYLPKVQIKMYSSRYSALSAVAYGQVDAVMLDMISGNFIVNK
                     FYQDSIQLLKPLYIDTHGFSFSLERKNQRLKKSSILRWMKFWKASGRKLPNAGMAAAS
                     LSGLARSS"
     CDS             69019..71712
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704102.1"
                     /locus_tag="NUITMVA1_00610"
                     /note="frameshifted, deletion at around 68869"
                     /product="histidine kinase"
                     /protein_id="BDC80118.1"
                     /transl_table=11
                     /translation="MAVNSGVPPLSFLDINDTLHGVVADLLQVLRAKLGVEIEVVPVK
                     TPGQMLQLLEGGQVDIAVLSPSEERRSRYLFSRAFVLDPLAYVVGVRHEATAPETLLK
                     TGTVAIIKDFISELAIEDEYGKLTTRKFERIEDALRCVASETCDVTVLPLRVAKYYIN
                     SKFPDSLLITGELFDSIPIGAAFAVSPKQHMLRDILDRVIAIIPPDELEGLSNRWRVS
                     TQQEAITWQELVREFGGIIALIMLLTIWIGLWGLSLHKQVRQRRAAEVALSAQLKFIE
                     DLVDGTPHPIYARDREDRLVLCNSTYASFFGEEKSRLLGSTMADDVQRWPFLAPLFED
                     LSTARTVRCARQGDHRLSMATGSVAVYHWVQPYYDLEGNVQGGIGGWIDVSERLRLLE
                     ELALASQDAQEANRAKSTFLATMSHEIRTPMNAIIGLLELTLRRDRLHEEDKTSLSIA
                     HGSARDLLSLIGDILDISKIESGRLELRPEPHEITALTASVVTVFTALARQKNLQLDL
                     AAGEPRWVQIDGICYKQILSNLISNAIKYTEQGSVRVELQSKTSDGWCTLQLVIQDTG
                     IGIAPVEQARLFQPFGQARQPEHIQRSGTGLGLMISRSLCESMGGSLLLESEPGHGTC
                     ISIEMKLPLASAVESVTPVALGTMTGHHRRLRVMIVDDHPTNRLLVSQQLAYLGHDAT
                     AAESGREALALFANTPFDVMITDFNMPGMSGFELTRQYRALELSRGTHRCLILGLTAD
                     ARQEQVSEGLTAGMDDCLFKPVGLEELERCLCRHMQHEEQREIERCVQEIKQCLGPLT
                     GNQPALMLPLLHEFVRASDDDLLGLQQAAEGGELARFLDYVHRLKGGARIMGAMKLVA
                     VCSETESARLGPQGLPRALQPLQHAYGIVRQAIMEMQAEPE"
     CDS             complement(71748..72071)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_00620"
                     /product="hypothetical protein"
                     /protein_id="BDC80119.1"
                     /transl_table=11
                     /translation="MEISLTHPGQQPVNSVSTSSPVQTEAINLSNPDFNTTYQLQART
                     LYASLPEQAGTDFKLALNGQPLPQHHALPLTQATRYFLSYLAPAAKPDQTGEAAYELL
                     VYWHG"
     CDS             72361..74034
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704104.1"
                     /locus_tag="NUITMVA1_00630"
                     /product="sensor histidine kinase"
                     /protein_id="BDC80120.1"
                     /transl_table=11
                     /translation="MLENQMMLLAVFERAALMLMTLFFLTRTRPFQRLFQKRDHTPAE
                     LVLVAAIFCLFAVFSTYTGIPVEGALINVRIIAIISGGILFGPWVGIPAGVISGLHRY
                     LIDMDGHTSIPCLIASIIAGLLATWLHLRCRKSRLWLYGILAGMLCEGLTMLLIWLLT
                     EPHAVGIEIVSHIAYPMIAGALCIGLIIKLVQDLDDEKELIAAKQAKLALDIANKTLP
                     FFQNIDRHSLSQVCAIIRSEISADAVAITDTRDVLAYVGVGKDYYELDEHHAISDMTQ
                     RAVLLDQIIINNDLRQYHLSDFHSVIIIPLRENGSVSGTLKIYYRRTHSITSSLKEMA
                     VGLSQLISTQMEVSRIEQLKEMTRKAEFTALQSKINPHFLFNALNAISSLIRIRPQQA
                     RQLIANLADYLRYNLNKGDTLIDIQEELQQVRDYVAIEQARFGDKLEVVFEVDDVHIQ
                     VPSLLLQPLVENAILHGIQPRSAPGRVTIEVKQLAGGIRVAVRDTGYGISQEVIDGVA
                     AGRVESRSIGLMNVHQRVKLLYGDGLHLKRLEPGTEVSFYLPDQESMPC"
     CDS             74164..74895
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704105.1"
                     /locus_tag="NUITMVA1_00640"
                     /product="DNA-binding response regulator"
                     /protein_id="BDC80121.1"
                     /transl_table=11
                     /translation="MLKAIIVEDEYLAREELAYLVGQHSSIEIVASFEDGLEAFKYLQ
                     DHEVDVVFLDIQIPSIDGLLLAKNLHKSSHPPHIVFVTAYKEFAVEAFELEAFDYILK
                     PYNEPRLISLLQKLELAGKSQTGQGSEPGTPHNRTVNLVKGERIIVTPCEQIYYAEAD
                     EKLTYVYTRDDRYVMTMTLSEFVSRLPAEGFFRCHRSYCVNINKIREIVPWFNSTYLI
                     RLHDLPFEVPVSRSNIKAFRQLMRL"
     CDS             75005..76195
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704106.1"
                     /locus_tag="NUITMVA1_00650"
                     /product="MFS transporter"
                     /protein_id="BDC80122.1"
                     /transl_table=11
                     /translation="MTKEMNRTRYLTLLGTIITQFALGSVYTWSLFNAQLSDKLDEPV
                     SQVAFAFGLLSLSLAVASSLAGKLQERFGVRNVTLGAGVLLGIGFFLTAHASNLAMLY
                     LCAGILVGFADGTGYLMTLSNCVKWFPERKGLISACSIGAYGLGSLGFKYINLLLLSS
                     NGLETTFQLWGLIAMSMVLVGGMLMKDAPKQAAAVQQSESRDFTLAEAMRKPQYWMLA
                     LMFLTACMSGLYVIGVAKDIGENMVGLPAVVAANAVAIIAMANLGGRLVLGILSDKMS
                     RIRVITIAQLITLVGMALLLFVPLNANLFFVAVACVAFSFGGTITVYPSLVSDFFGLN
                     NLTKNYGVIYLGFGLGSIIGSIVASLFGGFMATFNLILVLLVVALVLSLTIRLPAPVS
                     VERA"
     CDS             complement(76270..77394)
                     /codon_start=1
                     /gene="purK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEE1"
                     /locus_tag="NUITMVA1_00660"
                     /product="N5-carboxyaminoimidazole ribonucleotide
                     synthase"
                     /protein_id="BDC80123.1"
                     /transl_table=11
                     /translation="MILPPATLGMLGGGQLGRYFVMAAHRLGYKVVVLDPDPASIAGA
                     AADHHIVAAYDDPTALHDLASRCAAVTCEFENVPATALALLEQYQPVRPAAGAVRICQ
                     DRREEKAFLSRAGIPVAPNQTLQPGEPLPALSASLFPAILKTAREGYDGKGQWTIQAA
                     DQLPAALAASGVPCVLEQRLALEGEFSLTLARSPSGAIGALPLVQNWHSGGILDQTRS
                     PANVPALEADARRIAEQLIAALDYVGVLTVEFFLVAGKLLVNELAPRPHNSGHPSLDN
                     AECSQFELQVRALCDLPLPARIAVHPAMLLNLLGDLWQGGTPDWAALLALPGVHLHLY
                     GKGEPRPGRKMGHVTITAADWPTVEETCHRVRQLLGLPPR"
     CDS             complement(77391..77900)
                     /codon_start=1
                     /gene="purE-1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEE2"
                     /locus_tag="NUITMVA1_00670"
                     /product="N5-carboxyaminoimidazole ribonucleotide mutase"
                     /protein_id="BDC80124.1"
                     /transl_table=11
                     /translation="MNTPPLIGLVMGSDSDWPVMQAAARILKEHGVPYEARVVSAHRT
                     PDLLFEYAASARERGLRAIIAGAGGAAHLPGMVAAKTTIPVLGVPIPTRQLKGMDSLL
                     SIVQMPKGVPVATFAIGEAGAANAGLFAVSLLSVAQDGDAPRYQQQLDGFRANERDRV
                     LALTLEDPA"
     CDS             complement(77964..78266)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005306985.1"
                     /locus_tag="NUITMVA1_00680"
                     /product="hypothetical protein"
                     /protein_id="BDC80125.1"
                     /transl_table=11
                     /translation="MQTEIRTLLTVITEANLEPTLLRTLTREGLRGYTITDARGRGDH
                     GERNASWSESGNIRLEAICSREQAERLLAHLQSRYYPDYAMVAFLQPVEIVRPEKF"
     CDS             complement(78271..79146)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704109.1"
                     /locus_tag="NUITMVA1_00690"
                     /product="sodium-dependent bicarbonate transport family
                     permease"
                     /protein_id="BDC80126.1"
                     /transl_table=11
                     /translation="MRSELKLPPALYDTLSLFLLLAIGLKGGVGLAQQSLQPLLPQLA
                     LVILLGMLQTLAGFAVLRLKMNRVDAAATAAHYGSVSVATFAVGVNWLTERGISFESQ
                     LSIFLAVMEIPAILVGIVLAQGVSRQTRWRRLAHETFLGKGVTLLLGGMAIGYLAGPD
                     GIAPLKPLFVDLFKGALALFLLEMGLIVARQCQDLRRHGLFLLGFALLMPLASAGLGL
                     VIGQLMGLSLGGLTLLATLAASASYIAVPATMRIAVPQANPGLSLSAVLGVTFPFNIM
                     LGIPLYHSWARHFTE"
     CDS             79036..79239
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_00700"
                     /product="hypothetical protein"
                     /protein_id="BDC80127.1"
                     /transl_table=11
                     /translation="MQGLLRQADAALEADGQQQEEGESIVERGRQLELGAHQTGQQAK
                     QEKEYNNIQHGSSQEAIHRVVAC"
     CDS             79309..80211
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704110.1"
                     /locus_tag="NUITMVA1_00710"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BDC80128.1"
                     /transl_table=11
                     /translation="MLNYKQLYYFWHVARSGSVTRAAEQLHLTPQTVSGQVAELELSL
                     GVALFNRVGRRLALTAAGRQALEQAGAIFSLGADLEHTLRHASQELTMQVGIADSVPR
                     TLAFELLAPAMALATPLRLVCHEERAEQLFSELASHKLDMVLIDRPLPPDSGVRGYNH
                     ELGRSPLALFASPELAARARQGFPASLEGLPLLIPGEKSATHDSLLAWYRQQGIHPHL
                     VGQFDDSTLMKSFGKAGMGIFPAPLAMADEIARLYGVERIATLAEVTLSYYLVSAGRH
                     LSHPGVQAVMEGAKQRLAALGGKK"
     CDS             80476..82311
                     /codon_start=1
                     /gene="btuB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEE6"
                     /locus_tag="NUITMVA1_00720"
                     /product="vitamin B12 transporter BtuB"
                     /protein_id="BDC80129.1"
                     /transl_table=11
                     /translation="MSKKLLAAALLPTAAFAQTTIPVNPTLVITANRVEQPISSVLAP
                     VVVIDRAEIESRQVQSLPALLKTLPGVQITTLGGRGHMSSLFIRGTNSNHSLVLMNGR
                     PIAAMVAGTPDLSQIPLGNIERIEYIRGPRAAVYGSDAIGGVINLITKTSAKNGSETH
                     LKGGVGSNGYGQGQLRTVQALGQQTDMNMMIGYERTDGFDVVANAQQPDRDGFDSLNG
                     QFGLNHAFNDAWSADFNAQGYDNQTEMDDAYQSADQSRVQAFQYDGGLKYQSGALSSR
                     LEASYGENKLKSWLESKGESSAEPIHTGLTRFSWINSWSGVEGLNLTGGADWQQEQLK
                     SDTRSYGQAFNAPDRDNTGLFVVGSYRWQALLWELSGRTDDNKQYGRHNTWSAASGLD
                     LDDNHNVRLSYGTAFKAPTFLDLYYPGYENPALKPEESKNLELGFNGRYTGWDWSLNL
                     YRNQIQNLIACQSASSTCRPDNTDAEIRGVEVALGLETGPLRHDLSFDYTRAEDKNDG
                     DQQLLRRAKQKASWLTQVQLGPVDLSTELLYVGKRDDKNFSSFPAERVELGSYTLINL
                     GASYGVTPQFTLGGRIDNLFDRDYAPAYGYASAGTEFKLTADYRL"
     CDS             82429..83223
                     /codon_start=1
                     /gene="murI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEF2"
                     /locus_tag="NUITMVA1_00730"
                     /product="glutamate racemase"
                     /protein_id="BDC80130.1"
                     /transl_table=11
                     /translation="MANILVFDSGMGGLTIYREIRRALPAHNYFYCFDNANFPYGELS
                     EAALTEVCTRLVSHMVVEHAIDLVVIACNTASTIALPSLRAAMTVPVVGVVPAIKPAA
                     ALTRNGCIGLLATPGTVSREYTHELIAQFAPGKRVLLKGATELVVEAEHKLAGLPVNM
                     ALLREVLADWLEGEEHPDTLVLGCTHFPLLDEEIRQLMPACQLVDSGSAVAKRVAHLL
                     AGLVTTPTRLEDVGGKAYCTRLDAQTQKLTAPLQAWGLSSLEEVRF"
     CDS             complement(83242..83733)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704113.1"
                     /locus_tag="NUITMVA1_00740"
                     /product="RNA-binding protein"
                     /protein_id="BDC80131.1"
                     /transl_table=11
                     /translation="MNLSKFPVYVQAAILALVLALVGYLVAQALQFSLKAEVIFAVGL
                     AIGGFVVPLFLNRAPAGVAELASSQETCTLYVGNLPYRANEIAVRELFAEQGQVISVR
                     LMKDKATGKRRGFGFVEMPAADAAKAIAALNDKEYQQRTLKVREANDKRDKDEREGSE
                     VDA"
     rRNA            84341..85880
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="NUITMVA1_r00010"
                     /product="16S ribosomal RNA"
     tRNA            86082..86157
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00060"
                     /product="tRNA-Glu"
     rRNA            86397..89282
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="NUITMVA1_r00020"
                     /product="23S ribosomal RNA"
     rRNA            89392..89500
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="NUITMVA1_r00030"
                     /product="5S ribosomal RNA"
     tRNA            89603..89679
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00070"
                     /product="tRNA-Asp"
     CDS             89801..90664
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707894.1"
                     /locus_tag="NUITMVA1_00750"
                     /product="tRNA cyclic N6-threonylcarbamoyladenosine(37)
                     synthase TcdA"
                     /protein_id="BDC80132.1"
                     /transl_table=11
                     /translation="MAALKQGGGMKAEYLQRFGGIARLYGQSALRSFSQAKVCVVGIG
                     GVGSWAAEALARAGINQITLIDMDDICITNTNRQIHAMQGTVGRLKTEVMAERIRAIN
                     PDCEVIEVDDFVTADNLAEHIKREFDYVVDAIDSVKAKVALIAFCKRNKIPVIVAGGA
                     GGQMDPTQITVADLAKTIQDPLAAKVRSDLRRLHNFSKNPARKFGVECVFSTEQLSYP
                     DGNGGTCQAKAASDGNMKMDCASGFGAVTPVTATFGLVAASRVLKKIAERGARAEKEA
                     GNEGAGSIGEA"
     CDS             complement(90686..91120)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707893.1"
                     /locus_tag="NUITMVA1_00760"
                     /product="SufE protein"
                     /protein_id="BDC80133.1"
                     /transl_table=11
                     /translation="MNSLATYTRIGVEPDANSIRQQFAAAHGWENQYRLIIQLGKQLP
                     ALPGEWQQEAFRLKGCESQAWLKGEKGEDGNWHFACDSDARIVRGLIVIVLAALNHQP
                     AAAIHSFNMEGYFSELGLEKHLSPSRGNGLRAIVLAIREQAV"
     CDS             complement(91134..92354)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQW0"
                     /locus_tag="NUITMVA1_00770"
                     /product="cysteine desulfurase"
                     /protein_id="BDC80134.1"
                     /transl_table=11
                     /translation="MNQQQHARLRSQFPALTQEVNSHPLIYLDNAATTQKPQAVLDAI
                     AHYYRADNANVHRAAHALSGRATRAFEAARETVARFINAPHSREAIWTRGTTEAINLV
                     AQSWGMSELQAGDEIVLSTLEHHANIVPWQLIAQRTGAVIRVIPLDERGDLDLAAYRA
                     MLGPRTRLVSVAHVSNALGTVNPVKEMVAAAKAVGARTLIDGAQAVAHLEVDVQAIGC
                     DFYAFSGHKLYGPTGIGVLWGRTELLERMPPWQAGGEMIDRVSFAGTTFNTLPFKFEA
                     GTPHIAGAIGLAAAIDFVMEQDRASLASHEATLTDYLVAGLRQVPGLRLVGEPGQRAG
                     AVSFLLEDIHPQDAATLLDMQGIALRVGHHCAMPLMESLGIGGTLRASLASYNNRDDV
                     DTLLAALHKLSDFF"
     CDS             92507..94519
                     /codon_start=1
                     /gene="rep"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQV9"
                     /locus_tag="NUITMVA1_00780"
                     /product="ATP-dependent DNA helicase Rep"
                     /protein_id="BDC80135.1"
                     /transl_table=11
                     /translation="MKLNPNQNEAVKFVSGPCLVLAGAGSGKTRVITNKIAYLVQQCG
                     YNARNIAAVTFTNKAAREMKERVGQTLGRKEARGLMVSTFHTLGLEIIRREHKSLNLK
                     ANFSLFDDTDQLALLKELTEAELDNDKDKLSALISQISNWKNDLILPARAMRIARGPE
                     EVLLAQLYERYHRQMVAYNALDFDDLIVMPTLLLKSNEEVRTRWQNKIRYLLVDEYQD
                     TNTSQYELVKQIVGERARFTVVGDDDQSIYSWRGAKPQNLVLLNEDFPSLKLIKLEQN
                     YRSKKRILKCANILIANNPHVYDKALFSELDEGVKLKVLFAKNEEHEAERIAAELMGH
                     KFMNRTRFKDYAILYRGNHQSRIFEKALMTNRIPYRISGGTSFFSRTEIKDIMAYLKL
                     LVNPDEDTAFLRVVNLPRREIGPTTLEKLGQYANQRGKSLFAASFELGLEQHLSGRGL
                     SALQAFTNWLVRLGDQALRGNPVEAVRDMIKEIHYEEWLYETSPSPKAAEMRMQNVST
                     LYRWITEMLEGDELEEAMTLAQVVTRLTLRDMMERNEGEDEADQVQLMTLHASKGLEF
                     PYVYMVGMEEGLLPHQTSIDEDNVEEERRLAYVGITRAQTELTFTLCKERRQYGESVR
                     PEPSRFLLELPQDDLEWENQKKVTAEERQQKGQVGVANLRALFKKD"
     CDS             complement(94527..96812)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707890.1"
                     /locus_tag="NUITMVA1_00790"
                     /product="GGDEF-domain containing protein"
                     /protein_id="BDC80136.1"
                     /transl_table=11
                     /translation="MSAQPIAPHYSTPLLALVSAIMDFPAPSAATSKDYDTLIQQLNQ
                     LCPLQHFGMLGLSEAGLQWVCEYQISDSFKLQLGLEESRITDQLTQLDEADGWCSLPV
                     EHGQVQWLLACCQPKELPTLRLLLECLAKRLNETQAGSQLSELASPLIRKDPDWQKKI
                     ESINRIIRLANTLPSQALFSQLEAVLRQMLAIQDMLLVRIDSHRLEKIYPEQPPHSDE
                     FITGLCHSTNNMEQHKEQLYWYSQPLRLQQQYFAHFLISLQHPLETDDRLFLDFLRSQ
                     LTLLLELRRIRQQLHDINSEDSINQRLQQLRQTNLRLQKQLKQHQELERRLQFDALHD
                     PLTQLPNRALLMNHLNHAMTHFHRYKSPGFSLIFIDVDHFKQVNDTLGHSAGDQLLKE
                     MSRRLQTCIRQNDMVARLGGDEFVIYLDNSKTEEDISPVLNRIISRLSYPFRLMGNEL
                     GITVSLGVASVSEQTSDISQLLHQADLAMYQAKRNGRSRIVSYSEECSVQTWASPEEM
                     LARALREGRIVPYFQPVIRLKDSRLTGLEVMARWITEEGVLKDAFDFIPLAEQCGLIQ
                     ELDYQILSHTCQQLKEWLPLSGQSKFKVAINLSGKHLVSHEQIMKLVEIIESEGIAPG
                     YLIFEFNERELSRQDSDALTSLHELRAKGIQISLDDFGTGFSSLNALFHFPVDYIKVD
                     DSFTHRMLQSPKDLALIRAMRDICQDLDFTLVVEGIENQQQLQKLIDLGCLMGQGRYI
                     SPPMPGADITPLLTQTKSERG"
     CDS             complement(96898..97353)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707889.1"
                     /locus_tag="NUITMVA1_00800"
                     /product="cytochrome c"
                     /protein_id="BDC80137.1"
                     /transl_table=11
                     /translation="MSVLKKLSYLLAVGMTAASLSGVVLAADDMSPEAIAERIKPVGQ
                     VYTAKDLEGIATAGAAPAAAAASGPRDGEAVFKGACFACHDAGIAGAPKRGDKAAWEP
                     RIAQGIETLKKHAIAGFAGKTGVMPPRGTCATCSDEEIENAIHYMIDKL"
     CDS             complement(97554..98582)
                     /codon_start=1
                     /gene="tdh"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQV6"
                     /locus_tag="NUITMVA1_00810"
                     /product="L-threonine 3-dehydrogenase"
                     /protein_id="BDC80138.1"
                     /transl_table=11
                     /translation="MKALSKLHKEVGIWMTDVPAPELGHNDLLIKIRKTAICGTDIHI
                     YNWDEWSQKTIPVPMVVGHEYVGEVVAIGQEVRGFAVGDRVSGEGHITCGHCRNCRAG
                     RTHLCRNTIGVGVNRPGAFAEYLVIPAFNAFKLPDNVPDELAAIFDPFGNAVHTALSF
                     DLVGEDVLITGAGPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVAKE
                     QLSDVMSELGMTEGFDVGLEMSGVPSAFQDMIDKMNHGGKIAMLGIPPATMAIDWGKV
                     IFKGLFIKGIYGREMFETWYKMASLIQSGLDLSPIITHRFHIDDFQQGFDAMRSGQSG
                     KVILSWDK"
     CDS             complement(98639..99829)
                     /codon_start=1
                     /gene="kbl"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQV5"
                     /locus_tag="NUITMVA1_00820"
                     /product="2-amino-3-ketobutyrate coenzyme A ligase"
                     /protein_id="BDC80139.1"
                     /transl_table=11
                     /translation="MSNGFYRHLTEQLEQVQAEGLYKQERVITSAQQARIAVGGEQVL
                     NFCANNYLGLANHPDLIAAAHQGLDNHGFGMASVRFICGTQDQHKELEQKLSGFLGTE
                     DTILYSSCFDANGGLFETLFGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMAEL
                     EAQLKQADADGARFKLIATDGVFSMDGVIADLKSICDLADKYDALVMVDDSHAVGFIG
                     ENGRGTHEYCGVMDRVDIITGTLGKALGGASGGYTSGKKEVIDWLRQRSRPYLFSNSL
                     APSIVAATIKVIDMLAEGHALRSSLKENSQYFRERMSAAGFTLAGADHAIIPVMLGDA
                     KLAAEMASRMLAAGIYVVGFSFPVVPKGQARIRTQMSAAHTREQLDKAIDAFIRIGRE
                     LDII"
     CDS             complement(99945..100589)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707886.1"
                     /locus_tag="NUITMVA1_00830"
                     /product="TetR family transcriptional regulator"
                     /protein_id="BDC80140.1"
                     /transl_table=11
                     /translation="MKTRDRIIHSATELFNDQGERNITTNHIAAHLGISPGNLYYHFR
                     NKEDIIHSIFDQYARHLSESFTPARSDEIKLENLMGYLDAIFYLMWQFRFFYANLPDI
                     LSRDEPLQQKYLKAQEQLRAAVVALLRSLREGGIINVSDEDLPDLGQTIKMVVTCWIP
                     FQIAQAPNTRITKPLLYQGVLRVLFLLRPYVQPQVADQIRQLEQHYRQLAQPAG"
     CDS             100716..101702
                     /codon_start=1
                     /gene="hldD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQV3"
                     /locus_tag="NUITMVA1_00840"
                     /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
                     /protein_id="BDC80141.1"
                     /transl_table=11
                     /translation="MAINVREANSMIVVTGGAGFIGSNLVKQLNAQGRTDVVVIDDLT
                     DGTKFVNLVDLTIADYMDKDEFQARIVSGDEFEEWDGGIEVIFHEGACSATTEWNGKF
                     IMEVNYEYSKDLFHYCIEREIPFIYASSAATYGGRNDNFIEDPKFEQPLNVYGYSKQL
                     FDQYVRRWMPEINSQVVGLKYFNVYGPREQHKGSMASVAFHLNTQVKKGENPKLFEGC
                     DGFPNGGQMRDFIYVDDVCKVNLWFWQNPQHSGIFNCGTGRAEPFQNVAEAVIKHHQK
                     GAIEYIPFPDHLKGRYQSFTQADMTKLRGVGYDAEFKTVAEGVADYMAWLNR"
     CDS             101824..103575
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707884.1"
                     /locus_tag="NUITMVA1_00850"
                     /product="protein WavL"
                     /protein_id="BDC80142.1"
                     /transl_table=11
                     /translation="MALSQLEVTGAEVYATTVGNELTRRGHQVFYVSDTLTKPTLGEV
                     FKLRFNKRSILRRFWHVFYLVYLIKKHHIQLVHAHSRASGWSSYVACKLTGTPMITTV
                     HGRQPVHASRKAFHALGFRAVAVCEDIAHQIIDNLGVDPAIVQVLRNGIETDTFQPVP
                     APTNARPVIAIVGRLSGPKGELCYRLLDEVLDLNACQVKVVSGSQLPARFQRFQERVD
                     FVGYVEDVPALMAQCDLVIGAGRVAMEALLCGRPAFAIGEAKAIGLVTEHNLDEALAS
                     NFGDIGPQDLAIDFAALKAQIAPALASGTVSDTIRQRIQAEYGLAGVVSGLESIYQDA
                     VVETLRREMPVIMYHRFIEHDSEKGVHGTWMPIAMFEKHLRLLKWLGYETLTFRDLAD
                     KGFIHRLQYGKKYLMITADDGYQDNLTRMLPLLEKYGYKAVVYVVTGEGYNRWDVEHA
                     SNPDTRVDLMDGEQLKALAASGHVEIGGHTLTHPRLSKLAPEQQAHEIQENKRQLEAL
                     LGHPLLSFAYPYGDMDESAKAQAMAAGYRFAVATNSGPRAMHQDPFRIRRIAIFPRTD
                     VFGLWRKIRGNYVFRKS"
     CDS             103579..104790
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707883.1"
                     /locus_tag="NUITMVA1_00860"
                     /product="O-antigen polymerase"
                     /protein_id="BDC80143.1"
                     /transl_table=11
                     /translation="MLSRSLALLDRTTTALFALTILFSFCGLFLAPFGQSIQSNLLAV
                     TGIFGLLNYFVGKQRDVGLKDRRILWGLLVYAAMIFVNRLIHGDQYGVMRGLFYVVVF
                     ALMMPRKPILLVLGYLAIVLGGMGLGILSIWQYQHGIARVEGFTNAILFSQAALTLAI
                     LNWFVFQQKQLPGWLRGGSLFGLIAALFALYLSQSRGVWLAFGIILAYVICYKAYFKP
                     WKYIAVAILCTATTGAIYQTNQLVQVRVAEAVSDLNSAEKGSYDSSWGLRVIAWQSAW
                     LGFLDSPVIGVGTDGFDEQKQKQVNNHQISQLIFHPSLAHSHNQYMQNLVIRGSIGFI
                     ALVIFLGLPLYLAANNISRISAGVLVPLAFAINSLSDVPFEHQEVLYLYTLSLVFIWF
                     AHEFKKDTRTS"
     CDS             104787..105452
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707882.1"
                     /locus_tag="NUITMVA1_00870"
                     /product="lipooligosaccharide biosynthesis protein LpsA"
                     /protein_id="BDC80144.1"
                     /transl_table=11
                     /translation="MIPVFVISLARSVERRAMVVQQMAHLGIDFEFVDATDGKALSSA
                     ELAKVDVELAKEVCGHALSFGEIGCAMSHIRVYECIVAEGIERCVVLEDDIYLHMHSK
                     AIIETIVHSCQSEIVFLHHGKAKRWPFLSSLPGGYRLARYLTPSRSSRRGVLSTAGYV
                     LTLAGAKKLLQCAYPLRMPSDYLTGRLQLNGLSASGVEPCCLDVDLFTTTIDDRAYGH
                     YLK"
     CDS             105634..106563
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707881.1"
                     /locus_tag="NUITMVA1_00880"
                     /product="heptosyltransferase III"
                     /protein_id="BDC80145.1"
                     /transl_table=11
                     /translation="MLVVGYDAIGDFILTLPAIARLREMYPAARLELVCSQRNQLLAA
                     SVAGIDECHVITLNDTLWSSSMWCKLRELRQRQYDLVINLFDEPDDIAMAKLLLLANG
                     RLQSLPLRFKSDGQQKLLPLFNKKATIVSSRPVRDHFVYRMLSVAGDAAGVPATVPSP
                     CNEQLDTSAYGRYLLVNLTGSQVGNSMTEAQIDGILAQLPSYQGISYLVFSRQPVACP
                     RQDMRVLFPDTILDAAKIIKDAQGVISTDTSIIHISSSFGVPTLVLMNNERWRDAFIP
                     LAGRNIILRSTTDNLAALSPAEISRQVDALMTL"
     CDS             106619..107731
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_00890"
                     /product="hypothetical protein"
                     /protein_id="BDC80146.1"
                     /transl_table=11
                     /translation="MSLINDLQLQRDILRRKLGQLLFDRKRPVPLRERKGKIVLLRWD
                     AKLGDAIVSSWVAREIKRASPEREVWIVTTAAMAPLFRDHFGMDKVIEVPKRPGYGQL
                     KRLARSLGEVECLVHFGKMLKMKDIYFISQVRADWVAGMDDALQVVNLKLGKASSGMH
                     FSDKFALLLQRLGVTNPDQQYIIPTMSPPDALASWWPTEPVICFNPYGSGSSRRLRPE
                     LISQMLEQMLAAGSCAICLLYPPGMEEEVAGIRAGLSRPERLLLSPDAPSLAGLFAQL
                     RQCQGLISVDTATVHIAAGLHKPILGLYNPDIGGGNENFLEWHPNSPSATVLFSTNTR
                     EQDINSLDLAEFERTFRAWLLANQAALSAAPSPARA"
     CDS             complement(107667..108695)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707880.1"
                     /locus_tag="NUITMVA1_00900"
                     /product="ADP-heptose--LPS heptosyltransferase"
                     /protein_id="BDC80147.1"
                     /transl_table=11
                     /translation="MLISTALCNNLKQNDPSGEVHYLVMDYCAGMAQGNPNIDRLIII
                     EKARRNEWRYMKDLLLAIRRERYDVVVNSQGQMIGLLSCLFSGARLRIGFDSFPWRLG
                     HNRIVRFRKDTEFQGNSTLVDDRFSLLKPLKLASEDRNYYLWLSEEEKQQGKDALLAA
                     GVDLNRPLIAMGVNSLGHYKRWPIDCFAKVAQWLIEQHDAQILIYCGPGEEEYNRGLK
                     PLLPAALQASVFDHIKTRSVRELVGLFAHCRLFVGNDTGPRHMAQAIDLPLLTIVAPG
                     GDKIIANPVNHPRYQAIDVFDAKGPDFQLPQNAEKDFIDEALLRAITPELVMERLTAL
                     PGWQAATP"
     CDS             complement(108901..109752)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707879.1"
                     /locus_tag="NUITMVA1_00910"
                     /product="hypothetical protein"
                     /protein_id="BDC80148.1"
                     /transl_table=11
                     /translation="MTAYARKELKGDWGTAVWEIRSVNQRYLETYIRLPEQLRSLEPV
                     LRERFRAKLQRGKVECNLRFEAAQAAASQLHINEELAKLIIDSANWVMKEAGQGQLNP
                     VDVLRWPGVMAAAEQDMDAVATELLGGFDLTMEDFLASRASEGANLKALIEQRLAGIQ
                     VEVKKVRVHLPQIIEWQRQKLTDRLAEAKVELDPARIEQEIVLLAQKIDVAEELDRLE
                     MHISETNKIMKKGGACGRRLDFMMQEFNRESNTLGSKSINAEVTQSAVELKVLIEQMR
                     EQIQNIE"
     CDS             110181..110897
                     /codon_start=1
                     /gene="rph"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQU6"
                     /locus_tag="NUITMVA1_00920"
                     /product="ribonuclease PH"
                     /protein_id="BDC80149.1"
                     /transl_table=11
                     /translation="MSRPSDRTAAQLRPVTITRHFTKHAEGSVLVEFGNTRVLCTASV
                     DTSVPRFLKGKNQGWVTAEYGMLPRSTHSRMNREAASGKQSGRTLEISRLIARSLRAA
                     VDLTALGEHSITVDCDVLQADGGTRTAAITGACVALVDALNWMVEKGMLKQSPLKQMI
                     AAVSVGMYEGEAICDLEYIEDSAAETDMNVVMTEDGRIIEVQGTAEAEPFTHEELLEM
                     LALAKGGIADIIALQKQSLS"
     CDS             110973..111626
                     /codon_start=1
                     /gene="pyrE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQU5"
                     /locus_tag="NUITMVA1_00930"
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="BDC80150.1"
                     /transl_table=11
                     /translation="MKAYQRQFIEFALEKQVLKFGEFTLKSGRKSPYFFNAGLFNSGR
                     DLARLGRFYAAALMDAGIAFDVLFGPAYKGIPIASATAVQLVEQHDVDVPWCFNRKEA
                     KDHGEGGNLVGSPLKGRIMLVDDVITAGTAIRESMDLIQANGASLAGVLIALDRQEKG
                     KGELSAIQEVERDYGAHIIAIIQMSDLIAYLEEKQAEQPELAAQLVAMKAYRAQYGI"
     CDS             111808..114228
                     /codon_start=1
                     /gene="copA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707876.1"
                     /locus_tag="NUITMVA1_00940"
                     /product="copper-translocating P-type ATPase"
                     /protein_id="BDC80151.1"
                     /transl_table=11
                     /translation="MTTHLQSPIHLQLPLSGMSCANCAGRITTALNKLEGVEATVNFA
                     LEQAAIDLASPDRLPAVLESIKAQGYDYGSETILFQITGMTCAGCSARLNKMLAALPG
                     VISADVNFSIEQARIVLVPGMQTPAALREQIEALGFGAQLAQGSASGRRQQLLEREAQ
                     EAASARQAQTRVIVSALLTLPLLAGMLAMAGLLPWHLPAWLELVLATPVQFWIGARFY
                     RGAWLAIKNRSANMDVLVATGTSAAYFYSLYLLLNLGMAASGQLYFEASAIIITLISL
                     GKLLEARARRSTQSAIRELMALRPETATVWRGESWQSVAIDEVLRGDRLRVLVGERVP
                     VDGRIVSGASELDESILTGESLPVPRGEGDKVLGGAINRSGVLEIEATTVGEDSSLSK
                     IIALVENAQMGKAPLQQLVDKVSAVFVPVVMAIALFTLLVWYAISNDFGQALLAAVAV
                     LVIACPCALGLATPAAIVTGTGVAARHGILIKDVDTLQKAHAIKALIFDKTGTLTQGR
                     PVLASWSGNDEQLRLAAALQQASEHPLALAMREAVGKEAVLPQPEAVEVRVGAGIVGQ
                     VAGHTVAIGNISLLAQLGIDVPQQDEQAADGATRVWVAIDGVVAGIAALADTLRPESP
                     DAIATLRQRGIASWLVSGDAPAPVAHIAAKLGLDGAFDSVLPAGKVEKVEALRAQTSG
                     LVAMVGDGVNDAPALAAADVGIAMGSGSDVAMETASITLMRSDPRLVADAIDISAATW
                     RTIQQNLFWAFVFNIIGIPLAALGYLSPELAGAAMALSSITVLSNSLLLKRWQPRARH
                     HVSTESNR"
     CDS             114239..114628
                     /codon_start=1
                     /gene="cueR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010635698.1"
                     /locus_tag="NUITMVA1_00950"
                     /product="Cu(I)-responsive transcriptional regulator"
                     /protein_id="BDC80152.1"
                     /transl_table=11
                     /translation="MNISKVAKATGLTAKTIRYYESIGLISAPVRSDNGYRSYTEGAL
                     RELRFVKRARETGFNLEECQELLALYRDEHRTSAQVKKLAQEKIVDLRARIAGLQAML
                     SSLEGLVGCCHGDENPECPILDELERG"
     CDS             114755..115909
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707875.1"
                     /locus_tag="NUITMVA1_00960"
                     /product="GGDEF domain-containing protein"
                     /protein_id="BDC80153.1"
                     /transl_table=11
                     /translation="MTQSVTRQVKQAIMAQLYTHASFSLPCLGLLALGWSLLFHDYLP
                     AAEALGWLAGVLLLLICRGWHLRWRQPRLAQIPLPVLERELFIGVTITSIIWALGVLL
                     YMDKLPDTYRAAMMMLSSLILTGSAIMLFGSRRSLYGAVLPLGLAMLFELGAGNEQER
                     IVSCMLAGYLFVFLPTLLRRLRRDQVASLYHRFSNADLVAELKAVSEHLKLTSRLDGL
                     TGIANRAHLDYCLERAWRRCHRARAPLSLVLVDVDYFKQFNDLYGHQLGDECLQQVAG
                     LLAEVQRREDDLAARYGGEEFALLLPCTSMQGALQIAENVRVALKDLSIPHQKSLVSG
                     RVSCSFGVATLVPDQSLSISELIQKADAALYQAKHNGRDRIEVALMGKVA"
     CDS             115940..116203
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005306857.1"
                     /locus_tag="NUITMVA1_00970"
                     /product="hypothetical protein"
                     /protein_id="BDC80154.1"
                     /transl_table=11
                     /translation="MQCHRIEELLELLQPAWIKEQDLSLVQFIAKLAAEAGYDGALSD
                     LTDDMLIYHLKMRESDKQAMIPGLAKDHVPDFKEALLKARGIK"
     CDS             116403..117851
                     /codon_start=1
                     /gene="ccoG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707874.1"
                     /locus_tag="NUITMVA1_00980"
                     /product="cytochrome c oxidase accessory protein CcoG"
                     /protein_id="BDC80155.1"
                     /transl_table=11
                     /translation="MADQDKIDIKDVTGDVTGTYNPNTFKASDDRFNPGNRIYVRAQT
                     GYWQRVRKAMGWFFVVLFVAIPWLRYDGRQAVLFDIGHQQFHIFGATIWPQDLTLLAW
                     IFMIAAFGLFFVTTFLGRVWCGYLCPQTVWTFMFIWFEEKLEGAANKRRKLDASPWNA
                     EKLARKGAKHLAWILLSLGTGLTFVAYFQDVFQLVPDFFTLQASGWVIFWVVLFAACT
                     YGNAGWMRAIMCIHMCPYARFQSAMFDKDTFIVGYDAKRGETRGARARKADPKALGLG
                     DCIDCDLCVQVCPTGIDIRDGLQYECINCGACVDACDQTMERMGYPKGLISYTTEHKL
                     ANDSTHVARPKLIGYGLVMAVMLGVFVYNAMSIMPMGLDILRDRNQLFRENSEGLIEN
                     TYTLKILNKTLHPQTYQLDVEGLPEHEWFGPREVTLKAGEIFTLPVSVAVDPFNLKKP
                     TLDIRFVLKREGAAADDSKGILRQPSKFISRL"
     CDS             117952..118929
                     /codon_start=1
                     /gene="srkA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQT9"
                     /locus_tag="NUITMVA1_00990"
                     /product="stress response kinase A"
                     /protein_id="BDC80156.1"
                     /transl_table=11
                     /translation="MRFNYSDLNPDLIMDALDLSGLRIDSGLIELNSYENRVYQFQDE
                     DRRRYVVKFYRPGRWSRAQILEEHDFAARLNEAEIPVAAPIAFAGETLLEHQGYPFAI
                     WQSVGGRQFEVDNLDQLEWVGRYLGRIHQIGASRPFHHRVRLDVESMLHEPRQLLASG
                     EWLPSGLAKSFFGVLDELIKHVSDAMTLDVAQISLHGDCHPGNILWRDGPMFVDLDDC
                     RSGPAIQDLWMMLSGERHEQLIQLDTLLAGYEEFMEFDPRELALIEPLRAMRIVHYMA
                     WLARRWEDPAFPRHFPWFNTDHYWRQQIATLHDQLEALKAPPLTLTPGW"
     CDS             119067..119675
                     /codon_start=1
                     /gene="dsbA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQT8"
                     /locus_tag="NUITMVA1_01000"
                     /product="thiol:disulfide interchange protein"
                     /protein_id="BDC80157.1"
                     /transl_table=11
                     /translation="MKKVLFFLAAMLMIPMVHAAPEFKEGVNYDVVKQTGSAQPEVLE
                     FFSYYCPHCAKFEPIAEDLKKNLPEGVPMKKNPVAFLGREMGPEMQRAYAVASLLNVE
                     GKLTPAIFDKIHTQRQYPQSRADVKQIFVDNGVPAEEFDGAVDSFAVSGMVSQFDRNT
                     ESYNIRGVPAFLVNGKYMVKIESITSQEQFNQLVKFLLAKKD"
     CDS             complement(119751..120929)
                     /codon_start=1
                     /gene="pncB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQT4"
                     /locus_tag="NUITMVA1_01010"
                     /product="nicotinate phosphoribosyltransferase"
                     /protein_id="BDC80158.1"
                     /transl_table=11
                     /translation="MPPILNSLLDTDAYKLHMQQAVFHRYPDAEVVAEFHSRNEEDLL
                     PMMGQIEEQLHLAGSLRLTRPELNFLAERPFFTADYLDHLRRKPLDASLLKVFEQDGR
                     INVRVEGPWQDVILWEIPVLAIISEMRNRFRYPQFGVTQALERLDQKIDKLERELSRE
                     EMSEFNLIDFGTRRRFSLAVQDAVVGRLKERLPAFRGTSNYLLAQKYGLPAVGTQAHE
                     WFQAHQQLGFPLEHSQRAALTSWLDEFTNHLGIALTDCITMDAFLRDFDFELASRYQG
                     LRHDSGDPVVWGEKAISHYQRLGIDPTEKTLVFSDGLNLDKAVELFRHFRGRINTSFG
                     IGTKLTCDLPGVSPMNIVFKLMECNGGPVAKISDSPGKTLCRDADFIRNLKQAFHVGV
                     "
     CDS             complement(121031..121666)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707867.1"
                     /locus_tag="NUITMVA1_01020"
                     /product="amidase"
                     /protein_id="BDC80159.1"
                     /transl_table=11
                     /translation="MGTVASLDIDAQKGFTPLCPNELPVAGGDDIVAALNAQATLASL
                     RIGSKDSHPANAAWAVSDPAGMLLPLDLPNADLTWPVHCVPGTRGFELLDGLPAPVDY
                     DFFVWKGVEPDLHPYGTCFHDLAERRSTGLIEFLHARGVTTVLAGGLATDYCVKTSVL
                     QLRRAGFRVIVHLDACRGIAPETVASAHTQMIEAGAELAQSLIDVQRLLDA"
     CDS             121763..122392
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707866.1"
                     /locus_tag="NUITMVA1_01030"
                     /product="DNA mismatch repair protein MutT"
                     /protein_id="BDC80160.1"
                     /transl_table=11
                     /translation="MVVLRLNEERLELLLETRDRPPFAHCWQLPALRIDETRDRDLDA
                     ARHRLLTEWGLGHCYSEQVCTLGNLERDPRGWSTTLVYLCLVDSEVEAVHGCWHPLCD
                     LPGLSLAFDHTQLIARGLERLRIKSRYSTLPLQLLGAEFTLSEVQRAFEIILQTPMNT
                     AAFRKRIHRAGILLDTGRKRTGKQRPAILYRMESPCCVMFDQVMNGAEA"
     CDS             122393..122911
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707865.1"
                     /locus_tag="NUITMVA1_01040"
                     /product="hypothetical protein"
                     /protein_id="BDC80161.1"
                     /transl_table=11
                     /translation="MAQVLASGEQSMSETSVHKVLVSACLLGQPVRYDGQSKGIVSDW
                     LRELGAEGRALAFCPEVAGGLPTPRPPAERQGERVVTEGGLDVTAEFDHGARLALQLC
                     QAQGIRFALLKEGSPSCGSGRIYNGRFEGQSVAGEGMTTALLRRHGIRVFSEDQLPEL
                     ASALALAACGSA"
     CDS             complement(122857..123813)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707864.1"
                     /locus_tag="NUITMVA1_01050"
                     /product="acyltransferase"
                     /protein_id="BDC80162.1"
                     /transl_table=11
                     /translation="MLTLLPGPLVLLISAGLTILFTALCASLILLVSLAKLLLPIPAF
                     GRACSRLNNRFMRLWLACNALVIRLTTRIDWQVEDDTRLRKDGWYLIISNHMSWTDIV
                     VLGHLFRDRLPVPKFFMKHELIYIPLLGLACWGLDMPFMRRYSREFLLRNPHLRGKDI
                     ETTRNACEKFRHIPTTVINFVEGTRFTEAKRDASRSRYQHLMSPKAAGLAFTLAAMGE
                     QFDSLINVTISYPDNPETPFKDFLMGRMKRIRVRIEELPVDEQLVGDYFNDKQFKRGF
                     QQWLNQRWQEKDAVLAQWQAADAAAQAEPQAAKASAEASSGS"
     CDS             complement(123807..124721)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707863.1"
                     /locus_tag="NUITMVA1_01060"
                     /product="acyltransferase"
                     /protein_id="BDC80163.1"
                     /transl_table=11
                     /translation="MPNKLIERLRGSLSTLLYFLNTLFWFIPILTLGLLKLLLPLKGW
                     RTLCNALLDGSAGCWIGFNNMIQKTIIRTPFDVVGVDKGRRNEWYMVIANHQSWVDIL
                     VLQRIFNQKIPFLKFFLKKELIWVPFLGLAWWALDFPFMRRYSRKLLEKKPHLKGKDI
                     ETTRQACAKFRHIPVSVMNFVEGTRFTARKHDKQAAPYRHLLHPRAGGIAFTLAAMGD
                     QLHKLVDVTIAYPDGIPSYWDFMCGRVKEIKVRVRFLPIERNLVGDYFNDPEFQQEFQ
                     QWLNGIWHEKDQTLDQLLADKTPSTTPC"
     CDS             complement(124842..126356)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707862.1"
                     /locus_tag="NUITMVA1_01070"
                     /product="ATP-dependent protease"
                     /protein_id="BDC80164.1"
                     /transl_table=11
                     /translation="MSLAVVYSRASLGVAAPQVTVEVHLSNGLPAFNMVGLPETSVKE
                     SRDRVRSALLNGNFEFPSKHITVNLAPADLPKEGGRFDLAIAIGILAASKQIPAKYLL
                     DHEFLGELALTGEIRPVLGVLPAVLACRDAGRTLLVPRENGPEASLIQDAEVRTAHQL
                     LAVTAWLAGQYELPLPDPQTTEALPDVPDLQDVIGQSQAKRALEIAAAGSHNLLFIGP
                     PGTGKSMLASRLPGILPPLSEQEAQQTAAIHSIGGLTPRAGHWHHRPYRTPHHSASAV
                     ALVGGGSHPRPGEISLAHNGVLFLDELPEFERKVLDSLREPLETGHITISRAARQVDF
                     PARFQLVGAMNPSPCGHYGDGQTRSSPDQILRYLDKLSGPFLDRFDLTVEVPLLPKGS
                     LTGKAERGESSQQIRERVLGARERMLSRNGKLNNLLDSREIEEICRLSPQDAEFLENA
                     IQKLGLSIRAWHRILRVSRTIADLAGRQAIEKEHLIEALGYRAMDRLLSRLRSG"
     CDS             126740..128386
                     /codon_start=1
                     /gene="ilvB-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQS6"
                     /locus_tag="NUITMVA1_01080"
                     /product="acetolactate synthase"
                     /protein_id="BDC80165.1"
                     /transl_table=11
                     /translation="MNGAQFLVQALKQQGVTQVFGYPGGAIMPVYDALYDGGLAHQLC
                     RHEQGAAMAAVGYARASGQVGVCIATSGPGATNLVTGLAEALLDSVPLVAISGQVPCA
                     AVGTDAFQEVDVLGMSLSCTKHSFMVTDVADLPQVIAEAFAIASEGRPGPVLIDLPKD
                     VQLAKVPTQSPLFAVAEPEHLSQAELTAARTLLAAAERPVLYVGGGVGMANAERKLRE
                     FAAATGMPAVTTLKGIGALDPDSPVYLGMLGMHGTKAANYAVQQCDLLLVVGARFDDR
                     VTGKLEEFAPEAKVIHLDVDAAEFGKRRTAEVGITQDLKQVLPRLAMSLSIDPWREHC
                     ANMAREYAFRYDHPGQPIYAPALLKQLSARLPETSVVACDVGQHQMWVAQHMRFTSPR
                     NHLSSAGLGTMGFGLPAAIGAKMSRPEDEVVLVSGDGSFMMNVQELGTIRRAQLKVKM
                     VLLDNQRLGMVRQWQELFFDGRYSETILSDNPDFIALAAAFGIPGETITCKDQIAGAL
                     DRLLASESAYLLHVAISEEENVWPLVPPGVANHQMMEQRP"
     CDS             128383..128634
                     /codon_start=1
                     /gene="ilvM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015368897.1"
                     /locus_tag="NUITMVA1_01090"
                     /product="acetolactate synthase"
                     /protein_id="BDC80166.1"
                     /transl_table=11
                     /translation="MSQFNTLQIHAQPRPEVMERVLRVVRHRGFNLCALNMEQDCQQL
                     RITVTVESVRPIQQLWSQLVKLVDVSRVDALEQQPRIRA"
     CDS             128647..129591
                     /codon_start=1
                     /gene="ilvE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707859.1"
                     /locus_tag="NUITMVA1_01100"
                     /product="branched chain amino acid aminotransferase"
                     /protein_id="BDC80167.1"
                     /transl_table=11
                     /translation="MSQPSQSATHPQYIWFNGKLVPWQDAQVHVMSHALHYGSSVFEG
                     VRAYDTPKGTCIFRLQEHTRRLFDSAKIYWMDVPYSEADVNEACRTVVRENGLKSGYL
                     RPLAFVGNVGLGLHPPLDAKADLMVAALPWGAYLGEEGLKNGVDVCVTSWNRLAPNTI
                     PTGAKAGGNYLSSQLISREAKRNGFAEGLALDVNGYLSEGAGENLFLVKNGVLFTPPA
                     TAAILPGITRDTIMTLARDLGYEVREQALPREALYVADEIFMTGTAAEVTPVRSVDRM
                     KIGAGCRGPVTEQLQNAFFGLFNGQTEDKWGWLTPVND"
     CDS             129778..131577
                     /codon_start=1
                     /gene="ilvD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQS4"
                     /locus_tag="NUITMVA1_01110"
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="BDC80168.1"
                     /transl_table=11
                     /translation="MAGARALWRATGMTDQDFGKPIIAVVNSFTQFVPGHVHLKDLGQ
                     LVAREIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMVNAHCADAM
                     VCISNCDKITPGMLMAALRINIPVIFVSGGPMEAGKTKLSDQIIKLDLVDAMIQGADP
                     KVSDAQSEQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLLATHSDREQLF
                     KLAGQRIVTLAKRWYEQDDASALPRNIATKAAFENAMALDIAMGGSTNTVLHLLAAAQ
                     EAGVDFTMADIDRMSRKVPQLCKVAPSTQKYHMEDVHRAGGVVAILGQLEKAGLVHGD
                     TRNVLGTSLVELLAEYDVSRQPSQEVVDFYRAGPAGIRTTKAFSQDCRWPELDLDRAE
                     GCIRSLDNAYSLEGGLAVLAGNLALNGAIVKTAGVDEENLTFRGPARVFESQDTAVAG
                     ILDGTVKAGEVVVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKACALITDGRFSGGTSG
                     LSIGHVSPEAASGGTIGLVEDGDVINIDIPARSMVLEVADSVLAARRVAVEARGWKPL
                     DRQRQVSFALRAYAMFATSADKGAVRDRSMLGE"
     CDS             131581..133101
                     /codon_start=1
                     /gene="ilvA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQS3"
                     /locus_tag="NUITMVA1_01120"
                     /product="L-threonine dehydratase"
                     /protein_id="BDC80169.1"
                     /transl_table=11
                     /translation="MVSAADYLRKVLLSPVYEAARVTPLQTLKKLSERLGNHVSLKRE
                     DLQPVHSFKLRGAYHKIATLTEEQKARGVIAASAGNHAQGVSLSAAKLGIKAIIVMPK
                     TTPDIKIDAVRRQGGNVMLFGNSFDEAYGESRRLAELEGYTLIPPFDDVEVIAGQGTI
                     GKELLEQDTHLTHVFVPVGGGGLAAGVAVYIKQLLPDVKVIGVEAEGSACLKAALAAG
                     EPVNLERVSLFADGVAVKRIGEETFRLCNQYLDEVVTVSNDQICAALKDIFDDCRAIA
                     EPSGALSLAGLKAYSEREQVKGGRMAAILSGANVNFHSLRYVSERCEIGEKREGMLAV
                     TIPERKGAFLDFCRQLGPRMVTEFNYRYADAEQASLFVSVRLTGGDEELGQIIDQLGG
                     NGYPVVNMTESELAKNHVRYMIGGRPARPLGERLYSFKFPEQPGALMRFLETLGCRWN
                     ISLFHYRNHGADYGRVLCAFELPDEDVAAFHDYLHEIGYGWKEVSDDPAYRLFLAS"
     CDS             133349..134455
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707856.1"
                     /locus_tag="NUITMVA1_01130"
                     /product="porin OmpA"
                     /protein_id="BDC80170.1"
                     /transl_table=11
                     /translation="MNKSILAVLVSGLLVSGAVQAAAQDNTWYVGGKAGWSKFFDVDQ
                     KQVVSDTLGALQNTSTSKDTLGLGAFAGYQLNPNLGFEFGYDWFGKYTSSGELSGVRV
                     EGEAKSQMIQTTMKIGFPVNDALDLYGRIGGGYAWTNSELSAQTATDFIKDTGNKHGA
                     VFVGALGAEYAIDRDWAARLEYQYTTPLGDTSLDRSGIEMDNGMLAFAMLYRFGQQGG
                     EVAAPAPAPAAAPAPAVVVVPKTFSLSSDVLFEFNKATLKPAASQALDNLFSQIVAAN
                     PKDGVATVIGHTDRIGSDAYNQALSEQRARSVADYLIAKGLFADKVRVEGRGKSSPIT
                     GNNCSSGSKPALIACLAPDRRVEVRLEGVSQPAQ"
     CDS             134608..135732
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707855.1"
                     /locus_tag="NUITMVA1_01140"
                     /product="hypothetical protein"
                     /protein_id="BDC80171.1"
                     /transl_table=11
                     /translation="MYGAEGEDMRIDHYDLQGEVQYQQQQAQSRKVRRLGPVPAASQA
                     QSPATAPADSTPAAAGGSQLTFTRSSLLTLQMASRTAAGPVPAAPTPAPTKPAEAGKG
                     DQDGIPNDGLDNRQRLIKLMIEAMLGHEIELPDPIKPADQSAEGVPAPTGEGTQPAAE
                     PDQLVEVTDSLLQKEQLNVVAAANLQTQDGQTLQLDLGFVLDWRQLDISQRRTTLNAL
                     KDPLVLSLDGKIAGLTDARVNFDIDQDGKADSLPGLGEGSGFVALDRNGNGTIDDGGE
                     LFGARSGNGFGELATLDEDGNGVLDERDSQFSALQFWQPEQSPIALVELGIGAILLHP
                     LDTPFNHLGESGNQGVLRQSGLYVTEQGKGGWVQQVDLRV"
     CDS             complement(135812..138019)
                     /codon_start=1
                     /gene="priA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQS0"
                     /locus_tag="NUITMVA1_01150"
                     /product="primosomal protein N'"
                     /protein_id="BDC80172.1"
                     /transl_table=11
                     /translation="MNSSQTLDLVRVAVPVPLRRHFDYLSPLPLPAPGCRVEIPFGPQ
                     TLVGLVVDHPADSQVPRNKLKPIKRVLDSTPVLGPDILALMNWSASYYQHPLGEVLPH
                     ALTVLVRKGEPAAYRELEFWFATEAGMAVDLNELKRAAKQQQALALLRKGPQTPSALK
                     QEEIQSAALTALEKKGLLEKRSLEPSHDGDWVARFEPGEGLRLNGEQALAVSAITSQS
                     DQFGAFLLDGITGSGKTEVYLSILEPLLKAGKQALVMVPEIGLTPQTINRFRRRFNVP
                     VVAMNSAMNDRERLDAWLACRDGGAAILIGTRSAVFTPFHNLGIIIIDEEHDGSFKQQ
                     DGFRYHARDLAVMRAHRAGIPILLGSATPSLETLHNARTGKYHHLTLTRRAGNAQTAR
                     QVILDIKNVRLQAGLSPQLEQLMAEHLAAGNQVMLFLNRRGYAPALICHQCGWSAACE
                     RCDAWYTWHQAGRRLHCHHCDSVRPLPHHCPECGSNELIGSGVGTEQLEQLLGTVFPQ
                     YPVVRIDRDNTRRKGELETHLGDIKAGKYKILIGTQMLAKGHHFPDVTLVGLLDVDGA
                     LFSADFRAAEKLAQLYTQVAGRAGRASKPGLVVLQSHHPEHALLQDLTQNGYGHFADT
                     ALKERRLLGLPPFSYQGLFRAEANGRDEVQLFLSRLADTLRSARYPHVQVLGPISGFM
                     ERKAGKFRMQLLVQGPNRAPLAQLLDWAVKELEGWPETKRVRWSLDIDPTELN"
     CDS             138167..138382
                     /codon_start=1
                     /gene="rpmE-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQR9"
                     /locus_tag="NUITMVA1_01160"
                     /product="50S ribosomal protein L31"
                     /protein_id="BDC80173.1"
                     /transl_table=11
                     /translation="MKAGIHPDYVAITAKCSCGNVINTFSTLGKDLNLDVCSECHPFY
                     TGKQKEVSSGGRVDKFNKRFGAMTTKK"
     CDS             138550..139983
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707852.1"
                     /locus_tag="NUITMVA1_01170"
                     /product="nucleoside-diphosphate sugar epimerase"
                     /protein_id="BDC80174.1"
                     /transl_table=11
                     /translation="MRDCLVMGAAGYIGSYLVPHLQELGYRVIAGARRPCRLPPGVEF
                     RLADSLKPITLLPALVGIDTVFYLVHAMGAGADFHRLEQQGVKNFAAAARAAGVRRII
                     YLGAIQPEQCNSRHLNSRRYCGELFRGAGVPTVELRAGIIVGPGSAAFEVMRDLVFNL
                     PMMVTPKWVRSRTPPIALSNLLHYLGGLVEADGVDGQIFNAAGPELLSYQQQLQKFAA
                     HIGKRCPIIPLPFLSPRLSAWWLQFVTSVPQPVAKALVGGLKHDIPADDGPLRALLPQ
                     TLLSFDEALAESLSLEQQLGAEQQGEETPLGLRWRHPEYGFYDRTASGDAICLASPEV
                     VWQVLQQLGGEQRYFYMNQLWVVREWMDHLIGGPALTRGRTKPDRFVKGDMLDSWQIL
                     GVDEGRRLDLLFNMRAPGVGRLEFNILPEESGLTRLKVTAHWHPQGAWGLAYWLAMLP
                     FHLFIFQGMTEAIARQAEAKAGIPVMG"
     CDS             140165..141421
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707851.1"
                     /locus_tag="NUITMVA1_01180"
                     /product="malate dehydrogenase"
                     /protein_id="BDC80175.1"
                     /transl_table=11
                     /translation="MSDQRHDLRQQALDYHAQPVPGKIAIALTKPAETARDLALAYSP
                     GVAEPVREIAANPADAYRYTGKGNLVAVISNGTAILGLGNLGPLASKPVMEGKALLFK
                     RFAGIDAIDIEVKHETSAQFIDTVAAIADTFGGINLEDIKAPECFEIEQALIERCDIP
                     VFHDDQHGTAIVTAAGLLNALEVQGKQIGDSRIVCMGAGAAATACMELLIKCGAKPHN
                     IFMLDRQGVIHSGRTDLNQYKQRFANDTPLRTLMEVIDGADVFVGVSGPDVLPAEAVA
                     LMAPNPVIFACSNPDPEIKPALAHAVRGDLIMGTGRSDYPNQINNVLCFPFIFRGALD
                     ARASRINDAMKIAAVEAIRGLAKEPVPAEVLTAAGVSELAFGKEYVIPKPMDARLLPR
                     VARAVALAAVESGVARIALPADYMLG"
     CDS             complement(141498..141680)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_01190"
                     /product="hypothetical protein"
                     /protein_id="BDC80176.1"
                     /transl_table=11
                     /translation="MNKLIPLSLAAVFALTSGFTMAATPTKAAAPQATQTKVVKKHHK
                     AAHAKAPAVKVAPKTK"
     CDS             complement(141735..143060)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707850.1"
                     /locus_tag="NUITMVA1_01200"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BDC80177.1"
                     /transl_table=11
                     /translation="MRRLFIQFYLLLIGCFTLAILLVGMVYQVTAERAGDRYLERMMQ
                     GSLGLLTGELARLPPEHWPARMAEQSRQLTLPLQIGALANQPLANEDQAFLEAGNIVI
                     VEEDDTFLQRIPGTDQVLIVGPVPYLSYLHELHWVDVGLLLVIGLSLGLPILLWLRPH
                     WRGLQQLEQTARRVGDGDLSCRTRLPPGSSLGRVGRTFDQMTEQLQAMLASRKQLTDA
                     IAHELRTPLVRLRYRLAMLDPAPSAEEQQGLERDLGALDALIEEMLTYARLDRPELPL
                     QCSELELGSWAGSRLADWQALRPDKRLDFVRPAMALPWRGDTRLLDRALENLIGNALR
                     HAAGRVTLSMARQQDLYLLEVADDGAGIDPTLAPQIFEPFVRLDQSRDRRTGGAGLGL
                     AIVRSIARHHGGEVQLLPSSSGARFCLMLPVHLDTNRHQSLTEPQVEQP"
     CDS             complement(143170..143880)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707849.1"
                     /locus_tag="NUITMVA1_01210"
                     /product="DNA-binding response regulator"
                     /protein_id="BDC80178.1"
                     /transl_table=11
                     /translation="MQRILFVEDDPEIGQLISSWLARHDMEVLLEPRGDLALARVEAE
                     QPDLVLLDIMLPGQDGLSLCRDLRPRFAGPIVMLTSLDSDMNQILSLELGANDYILKT
                     TPPPVLLARLRVQFRQQGQQAPLPVVASTPPQRLQFGRLQIDGPGRDVRLDGDSIPLS
                     TADFDLLWELACHAGQILGREALFRSLRGRDYDGQDRSMDVAISRLRRKLGDDTSNPT
                     RIKTVRQKGYLLVPHAWE"
     CDS             complement(144030..145163)
                     /codon_start=1
                     /gene="trmA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQR3"
                     /locus_tag="NUITMVA1_01220"
                     /product="tRNA/tmRNA (uracil-C(5))-methyltransferase"
                     /protein_id="BDC80179.1"
                     /transl_table=11
                     /translation="MTQSQQVSADPAPLRTPADYQAQLDEKRERLCGLFADFTLPALE
                     VHASPAEHYRMRAEFRIWHDGDDLYHCMYAPATKEIIRVDQFPTASRLINRLMPVLLE
                     GLRPHPVLRRKLFQIDYLSTQSGQICVSLLYHRKLESEWQQAAEALQADLRAKGFDLQ
                     LIGRAHKQKICLGEEFVIERLNVQGRELVYKQVENSFTQPNAAINEQMLGWALDVTKG
                     SEGDLLELYCGNGNFSIALAQNFRKVLATEIAKPSVDSAQFNIAANGVDNLIILRMSA
                     EEFTMAMRGEREFNRLKGVDLGAYQCNTIFVDPPRAGLDDATVKLVQDYDNILYISCN
                     PETLQANMAVLGETHEIARFALFDQFPWTHHMEAGVYLKRKTG"
     CDS             145334..146476
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707847.1"
                     /locus_tag="NUITMVA1_01230"
                     /product="hypothetical protein"
                     /protein_id="BDC80180.1"
                     /transl_table=11
                     /translation="MQIDGVGAAQPKGVGVAPKSPQQADSKPVNSEDEVSLHKAPKWA
                     QVLVQQALQFALEINGQGYKAPKAQDQPEAVTPDTLFDFQSVADNVLQFVTGRLGAAR
                     VDGKSDDSLTGMMEQARKGVDKGFGDARKQLGDWADNSDIKTGMDQSYKLIQEGLDQF
                     EKEFFGKVSTTDMGQAEMASRQQGSLEIQTKDGDKVVLRFNDSWQTKSQKDDSGSQFS
                     LKSSQSFSFSLEGNLSSEEMDSIGKLVKGIDDLAGNFFSGNFDDLLKKAGELKLDDSQ
                     LASYSLKLKQSLKLSQTYQGAHSLQEMLKPLADYLPKLDQVQQQADALLPASQQQALT
                     PAVLAARGQSDPAQVGSFTSFNQRMLDALRMIGQFQPATDASSKSV"
     CDS             146564..147097
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707846.1"
                     /locus_tag="NUITMVA1_01240"
                     /product="ATP--cob(I)alamin adenosyltransferase"
                     /protein_id="BDC80181.1"
                     /transl_table=11
                     /translation="MNPKKPRDKRELCYPFIFETQFQCDYEIATDELCCQVGAVLSHL
                     DPDAEIAPMQADLAALQRLIYNLNGSVRGRLGIFEEDLAWLKGRYDHYNEASRGRVTG
                     FVLPQGPQPIPTLHLCRCGSKKVVRLLVRLEESGVRFDPILYRFANLLANFFFVLTVY
                     LKQLWQVDEVPYVSINY"
     CDS             147231..148877
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707845.1"
                     /locus_tag="NUITMVA1_01250"
                     /product="hypothetical protein"
                     /protein_id="BDC80182.1"
                     /transl_table=11
                     /translation="MPGNLAWRPLAEYGEVQVAPHGQWLQTLMHQSADAAAGTHIIIW
                     LWEDLVPARTLQEWGRLAQDEQQLAVAAFVDALCQPLLQHLQRRPQDHLLVGACSHAP
                     LCVYGPAPAVLAALASAFEQQMARLRLQQPGLDDLHLPLWLQQHGRQHCFDRRNLYLM
                     SCPFSMAGLASLAQWILPLLQRLQRPAHKVLVLDCDNTLWGGVVGEDGVGGVLLGQDG
                     MGRLYQAFQQAASHWHGQGIVLALCSKNLADDVWRLFDEHPGMVLTRAQIAAAEIGWE
                     PKSQGLRRLAARLNVGLDSLVFWDDSELERAEVRANCPEVMVMTPPADLWNWPDALLT
                     LPALCSRHQSRDDGLRQHSYQAQAEAEAVRRQLGDEHAFLRQLALQADWQPLSPGNQL
                     RAEQLSQKTNQFNLSGRRYQAAELARLAAEGGDVWLAGLRDRFADHGMTALLVVCPLD
                     EGRALLDTLAISCRVLGRGFEYWLLAQLANHLRAQGVTELVISLVATTRNQPARDFLA
                     SLPTRPITTPAGLLPLADEVFLSLDLCSLSLPFLEFYANE"
     CDS             148870..149094
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707844.1"
                     /locus_tag="NUITMVA1_01260"
                     /product="acyl carrier protein"
                     /protein_id="BDC80183.1"
                     /transl_table=11
                     /translation="MNDLIALAHQQFPQASVNAQSALGSFPEWDSLGHFNLLLLVEQH
                     YAVRFEPHELAELKSLADIQQALLRKGVAV"
     CDS             149091..149855
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707843.1"
                     /locus_tag="NUITMVA1_01270"
                     /product="AAC(3) family N-acetyltransferase"
                     /protein_id="BDC80184.1"
                     /transl_table=11
                     /translation="MKQALEQALTELGIPRGGALMVHSDAMVVAQFAGMGNAAGIAAF
                     WTCLEQWLGGHLLVPTFSYSPMADECFDPVQTPSKVGLMTELFRQREGVVRTRDPVFS
                     MAISGPQGPALVARECHDCFGQESPFGWLAEQDGWLLGLGCHPDRITFTHYVEQRLAV
                     SYRYHKMFAGRVCVDGGVREWQADYYVRDLSLASEIDLSRLVALLQERGAWRQTLCQR
                     VPVWAVSCRDFILAASELLAAAPYALIRAGGESHAV"
     CDS             149845..150249
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707842.1"
                     /locus_tag="NUITMVA1_01280"
                     /product="glyoxalase"
                     /protein_id="BDC80185.1"
                     /transl_table=11
                     /translation="MQFDHIGLVVPDLVSGVAYCRDVLGLSRFSAAVEDPLQRVWVQF
                     VHDDHGLCYELVAPAGEESPVAQVLKTRRNVINHLAYRVSNLQESAERLRAQRHLPLG
                     PSQPAIAFDGAHVQFFLSPLGHIVELIEASTP"
     CDS             150246..151607
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707841.1"
                     /locus_tag="NUITMVA1_01290"
                     /product="aminopeptidase"
                     /protein_id="BDC80186.1"
                     /transl_table=11
                     /translation="MSFSPKSGYLPTDWDDQAQVGEQLHRLLTLQFPLNRSLTGDGVR
                     QSLALWREHCLPELQIHEVASGTECFDWTVPDEWNVREAYIVGPDGRRVVDFQDHNLH
                     LVGYSEPVRCTLSLAELQPHLHSLPEQPDAIPYVTSYYKRRWGFCLPHRLREALPEGE
                     YQVVIDATLAPGSLTYGDWVLPGESEQEILLSSYTCHPSMANNELSGPCVGVFLMAWL
                     ASLPTRRYSYRLMLVPETLGAIVYLSRHLDQLKQRTLAGFNLTCLGDDRSYSFLPSRQ
                     GNTLADRIGRHVLAHLAPGYKAYSFLERGSNERQLCAPGIDLPVTSVMRSRYGCYAEY
                     HTSLDDLSLVTPAGLAGGFLVLRRAIECLELDERCEVTVLGEPQLGKRGLYPDLSTRY
                     SGWQVREMMNLLAYSDGKLTLFEIAETIGAPFWRVEPLARMLLEAGLLRRLSPQPDYS
                     ITR"
     CDS             complement(151589..152335)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_01300"
                     /product="hypothetical protein"
                     /protein_id="BDC80187.1"
                     /transl_table=11
                     /translation="MIKAISNASEQELSRRQTFSELLHASPLPAAELQNNLGLYLKRQ
                     SLSRILFMHELYQKIVPVHGVIMDFGTRWGQNLALFSSFRGMYEPYNYNRKLVGFDTF
                     SGFPSHAPQDGSDAAIQPGAYGVTPGYEQHLARLLAAHEAESPLDHIVKHELVKGDVT
                     ETLPAYLARQPETMIALAYFDFDLYEPTRRCLELIKPHLTKGSVLAFDELNWPAFPGE
                     TLALKEVLGLDRYAIRRTPHNPGPAYLVIE"
     CDS             complement(152335..152595)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707839.1"
                     /locus_tag="NUITMVA1_01310"
                     /product="hypothetical protein"
                     /protein_id="BDC80188.1"
                     /transl_table=11
                     /translation="MKNGQITRLTALAHQFRLGQSVAASQALPELLQEVLTEQGNLPP
                     GLVAALLQCQERQDWLGLADYLEYEVVHCLSTPAGDTTTGDH"
     CDS             complement(152592..153887)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707838.1"
                     /locus_tag="NUITMVA1_01320"
                     /product="hypothetical protein"
                     /protein_id="BDC80189.1"
                     /transl_table=11
                     /translation="MSDDLFNQHGKLISQRWPALWPRLLAQDVESLPAELTEGLGSTL
                     SLHGIQLTSRHDRVKEAELQAASLPEQPVLHLYGTGLGDLPRALLGRSSLKRLEVKIM
                     NGALFALVLRLLDQQDWLTDPRVELMMAGDEGEVRLPFFALPPELLLVEDAAARIRDR
                     LVSEIDLPFARARFDAEHPDITRRLAENRELLASDGDVASLFGLAQGKQALIVASGPT
                     LQHNLTTLQAQLQRRRQDYLLISVDTALAFLLGHGIRPDIVVTIDDAIDGNRLPAAQS
                     AQTTLVYYPTVPTAALLAWQGPRKTAYSRSPMYQQLRQTLPKGVLHSGGSVIHPAVDL
                     AVQMGCHQVILLGTDFAFPGELTHSGWADGALGPSAALALSWALDGHGRRVKTNPNFS
                     AYRTELERYIARHPEVQFWNCSREGAEIAGCRYHPEYVQ"
     CDS             complement(153880..154926)
                     /codon_start=1
                     /gene="nueB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707837.1"
                     /locus_tag="NUITMVA1_01330"
                     /product="pseudaminic acid synthase"
                     /protein_id="BDC80190.1"
                     /transl_table=11
                     /translation="MQIAHQSIGPAQAPYVIAELSANHNGNLERALAIMTAAKEAGAS
                     AVKLQTYRPDTITLNSDRPEFQIHGGLWDGHNLYDLYQWAHTPWEWHQALFAKGRELG
                     LTVFSSPFDFSAVDLLESLDCPAYKIASFELVDLPLIRYAAQTGKPLIMSTGMANEAE
                     IAAAVEMALKHGNGQLALLHCVSGYPAPAAEYNLRTIPMLRQRFGVEVGLSDHTLGSA
                     TAIAATALGATLIEKHFTLARADGGPDCAFSMEPAELTELVASVNTAHAALGVADYQL
                     TASEQGNRAFRRSLYLVKEMAAGEVLTAEHIKSVRPALGLPPADYDRLIGKRVNRSLS
                     ANQPLSWEWIDNDE"
     CDS             complement(154933..156189)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707836.1"
                     /locus_tag="NUITMVA1_01340"
                     /product="UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-
                     altropyranose hydrolase"
                     /protein_id="BDC80191.1"
                     /transl_table=11
                     /translation="MTFKVAFRLDAGAEIGLGHLMRCLAIADRLHAAGAECHFLCHDL
                     PVHLLSLLRPHHHHPLSAFDDACPLLGLQPDWLVFDHYQIDQRLETQLAAHCRRVLVI
                     DDLADRPHHCQLLLDQGPLRRAADYQPLTPADCRLLLGTDYALLRPVYRQLARPHTSQ
                     WQRGLVCFGGADPAGACLVTLNSLAKLPWARTIQWTLVAGGANPFWPELEQRVAKLSD
                     LNLVLLRQSDQMADLMSRHDFAIGAAGGMTWERACLGLPTLAVPIVDNQQFNDQVIAR
                     FQLAERLTLSELAEPERLLQALQRLEHQSDDYRRRGQQQVDGLGLDRLTARLLQQSDY
                     QLLPDGQHWQLRHDDQPLLTLTLNGQQLTWQAARPLQPAEWQELAHRLQTIFSQFPLY
                     LAEPPQIAPPAPWQPAPQGWQLGTGV"
     CDS             complement(156179..156874)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707835.1"
                     /locus_tag="NUITMVA1_01350"
                     /product="pseudaminic acid cytidylyltransferase"
                     /protein_id="BDC80192.1"
                     /transl_table=11
                     /translation="MAIAIIPARGSSKRIPRKNIRPFCGLPMIAYAIEAARDSGCFSR
                     VVVSTDDPEIAEVARRLGADVPFLRGAALADDHTGTTPVVIDTIQRLDQLGIQAEHYC
                     CIYATVPLIQAADLKAAYQRLIASKAPFVYTVAEFGFPIQRAVRMDAQGRVTPFWPEQ
                     MAKRSQDLEPAYQDAGQFYWGSRAAWLGGISPVGGEGIGHILPRHRVVDIDTPEDWHL
                     AELLYQVLAQDDV"
     CDS             157051..157575
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707834.1"
                     /locus_tag="NUITMVA1_01360"
                     /product="hypothetical protein"
                     /protein_id="BDC80193.1"
                     /transl_table=11
                     /translation="MSYGVELRPLQPWDLPTLRRWRNQDEVRLQMVEQTLISPRQQRQ
                     WFVSSLERSDQQHWVLWCRGLRAGYVNLKGETRQSLQGQPVADAGFYLGRSSVRHPML
                     AVAAALSQLDQGFDTFELGCIRTLVRTGNDAALRLNAQLGYRQQGQQGDFIALELQPA
                     DYYAARERLRRFFR"
     CDS             157572..157805
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707833.1"
                     /locus_tag="NUITMVA1_01370"
                     /product="acyl carrier protein"
                     /protein_id="BDC80194.1"
                     /transl_table=11
                     /translation="MTTALEQVFADALGIDVGSVSDQLAYNSIPQWDSVAHMGLIAQL
                     EDCYGVLLDTDDIIDMSSVAKAREILAKYGVAL"
     CDS             157805..158554
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707832.1"
                     /locus_tag="NUITMVA1_01380"
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="BDC80195.1"
                     /transl_table=11
                     /translation="MQGLLQGKRVLITGAGRGIGLAIARLFAAQGAELWLAGRDEAAM
                     SRLADELGAEFGVPCQPLCVDVAQPQAVKQAFQQLFAQTRQLDVLVNNAGMLEEGLLG
                     MVNQAQLEQTFSHNTFSVVYCSQYAARLMQRSGGGSIINLASLMGRVGAAGLCSYAGS
                     KAAVIGITQSLAKELAASRIRVNAIAPGFIDTEMAHAIPDDKFAERLASIAMGRIGTP
                     DEVAKVALFLASDLASYVTGQVIGVDGGMTV"
     CDS             158554..159924
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707831.1"
                     /locus_tag="NUITMVA1_01390"
                     /product="AMP-dependent synthetase"
                     /protein_id="BDC80196.1"
                     /transl_table=11
                     /translation="MDHAHALLAHLREDNPAPAWRDPQEGWLSYGELARRVARLAASY
                     PDERSLVYLPFFTRTAHLLHYLAALKLGHVVMLADPALPASQHDASCRQFGVSWRVND
                     AGELERLAATTPTLHPELSVLLPTSGSTGSAKWVRLSGRNLAANAASIADYLALTAAE
                     RAITSLPLYYSYGLSVLNSHLLVGASLVQHEGSVLERDFWQQVDLHEVSSFAGVPFTY
                     QMLARLRFDWARYPSLQTLTQAGGRLEPALVQQFAEQALRLERRFFVMYGQTEATARM
                     AWLAAPEVAAHPDAIGRAIPGGQFALRALEGGKPGEGELVYRGDNVMLGYAGTAEDLA
                     QGAQLQELATGDLARCDEAGRYYICGRLSRFLKLFGKRVSLAEVESQLHRWGWTGACG
                     GRDDCLLVAVEPRGDQMADGLQRELAQWLQAPPRAVQVVQVTQLPRTANHKIDYAALA
                     RLAGEA"
     CDS             159924..160982
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707830.1"
                     /locus_tag="NUITMVA1_01400"
                     /product="acyl-protein synthetase"
                     /protein_id="BDC80197.1"
                     /transl_table=11
                     /translation="MEHLLSVPVFALPQAAKQALLLARLNALTAHHRAHCTAYDNVLQ
                     AFGWTAAATDYDALPYLAARLFKLAQWQSVPQNEVFKVLTSSGTTGSPSRIVLDRETA
                     ALQSKVLVKILQEFVGKQRLPMLLVEQPALIQNRSGFSARGAGALGLSFLGRDHTYAL
                     DEQMRPNWPVIEAFCDKYAGQPVLLFGFTFMVWQCLLEPLRERGLQLPLTQGILFHSG
                     GWKKLQHLAVDNPAFKARCREQLGLGRVHNFYGMVEQVGSIFVECEQGHLHAPVFADV
                     QVRDPLTHQPLGIGSPGLLQVLSAIPGSYPGHSLLSEDLGVLLGEDDCPCGRHGRYFH
                     VAGRQHGAEVRGCSDTFQ"
     CDS             160979..162166
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707829.1"
                     /locus_tag="NUITMVA1_01410"
                     /product="acyl-CoA reductase"
                     /protein_id="BDC80198.1"
                     /transl_table=11
                     /translation="MTPSGATTGLWQEGPVVSFVAPTTGWQTFCPQPLPCFAPVICDF
                     VAALSTRLQQEGRRHPDLAAFGFWLRPRQLAREQQRLQGRGPLGVTFHLVPSNVPTVA
                     FYSWLVALLMGNPCVVRLSSRRDPQQEAMLAILNELFDLGEWQEIAARTRFIRYEHDE
                     GITAWLSARCRLRIIWGGDETIRQVRAIPLAPTAQEVVFPDRRSMAVLDCRWLAGLDP
                     QEWQRTLDALQQDCTRFNQQACASPTTLCWLGEPDEGLRRRLLEALFAPFAADPALAM
                     ERLIHSQQNAAEQGGMKVTSLPGVTLLTPTSTLRLTHVGGGTVAEFVADTLNELLAQP
                     WDMQTCVWVGGDRAGVEAVLPTAPTCRIDRVVAPGQALAFEWHWDGIDMLQLCSRGLS
                     RRE"
     CDS             162337..163308
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707828.1"
                     /locus_tag="NUITMVA1_01420"
                     /product="glycosyl transferase"
                     /protein_id="BDC80199.1"
                     /transl_table=11
                     /translation="MKVSVLVPVYNLARFIEPCLLSLLEQQTDFEFEVIAIDDGSSDD
                     TWSIMQRLARQWPTLRALQNEQNMGLARTQKRLLGEAKGAYLAYVDGDDLALPGKLQR
                     QADYLDTHPGCTLCYHEAEMFDDETDARIKLFTRDYYNARYLEPVMTREALIRFGVFV
                     NASSIMFRRYDGMADAIDEGCKIILDYPWHILNLSLNPGTLDFIPELLGRYRFHTQSF
                     GGQTRKSAERREQSLRDLLRACDNAAAFGADPMVIAQGRAHHYYSAALYFLRQDDVAR
                     FAQLIEQSVVEVAELAPGWFFDERHQLAWAQRAHPARVVQQLFGEAA"
     CDS             163305..165287
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_01430"
                     /product="hypothetical protein"
                     /protein_id="BDC80200.1"
                     /transl_table=11
                     /translation="MSYQAIVIGAGLSGAVMAERMASQLGWKVLVLEQRDHIGGNCFD
                     EYDEHGVLIHRYGPHLFHTDSKEVWDYLSQFTEWLPYEHRVLSRIDGQLVPIPFNLTS
                     IERCFPADKASAMIEALRTRFGDGARVPILELRKEQSPLLGELADFIYQKAFVNYTSK
                     QWGVPPEQISPEVTARVPVVVSRDDRYFTDPWQAVPAAGYTAMFERMLAHPLIDVRLS
                     TPMAEHVRLDWQQKRVLLDGEPFDGPLVYTGMLDHLSPAEGNYLPYRSLRFEHRHLVQ
                     EQFQPVTTVNYPNEEAFTRITEFKHFSGQQHPGTSIVYEYPCDYQPDQGLEPYYPLFT
                     DAAKQHYQACRDELTGFPQLIALGRLAEYRYFDMDDAVNNALQQFDRFLKGQAVGTVS
                     RPTLTALMTTYNTAPYVRATIDSVLAQSFADFELVIVDDGSSDETVEVIRSYQDSRIR
                     LYCREENKGVGYSLQEALQYVRSPYVIKVDSDDLSHPERFARQLEALQADTGLALVKC
                     YIEAFAESDDADTAERLATRQRDYAAANKIDTEILISQHLPRWLCIEHTSYCARTDAI
                     RAVGYPDQRLCEDYSLFYRLNEQGYRIGCVKETLVKVRVSQHSVTAQINHERLLSWFT
                     YLFANSTSKCDTRLCRLTVLFEYLDRLPESETFPRS"
     CDS             complement(165216..166163)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002221064.1"
                     /locus_tag="NUITMVA1_01440"
                     /product="IS30 family transposase"
                     /protein_id="BDC80201.1"
                     /transl_table=11
                     /translation="MSYQQLTEGQRYQLSVLRAQGMSILATARAIGVHRSTLYRELRR
                     NAGPQGYQPDNAHQHATHRRASAAKSRLSADVIQFVELTLAWWWSPEQISAVGKQIGL
                     MVSHEWIYRHVAADKARGGQLYRHLRQGHKRYRKGASSLRSPIKEARSIDERPAIVDS
                     RERLGDWEADTVLGKQGTGALVTLVERKSRLYLVKRVASKQAGVVRDAIIEMLTPYIE
                     QVHTITFDNGGEFAEHKAIEEALGAETYFAHPYSSWERGLNENSNGLLRQFIPKGTDL
                     REVTDEDVRRAEQWLNLRPRKCLGFRQPVKVFEEYRQAA"
     CDS             166300..166581
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_01450"
                     /product="hypothetical protein"
                     /protein_id="BDC80202.1"
                     /transl_table=11
                     /translation="MIGDAEGVAIYGSGGLARLMYQIFRQNNITVLNFIEQSEKPPVH
                     INGIDISVKALRDCLQQKIVVAAQPVRLEMVGQLTNLGLNEWRDFMVVA"
     CDS             166708..167655
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002221064.1"
                     /locus_tag="NUITMVA1_01460"
                     /product="IS30 family transposase"
                     /protein_id="BDC80203.1"
                     /transl_table=11
                     /translation="MSYQQLTEGQRYQLSVLRAQGMSILATARAIGVHRSTLYRELRR
                     NAGPQGYQPDNAHQHATHRRASAAKSRLSADVIQFVELTLAWWWSPEQISAVGKQIGL
                     MVSHEWIYRHVAADKARGGQLYRHLRQGHKRYRKGASSLRSPIKEARSIDERPAIVDS
                     RERLGDWEADTVLGKQGTGALVTLVERKSRLYLVKRVASKQAGVVRDAIIEMLTPYIE
                     QVHTITFDNGGEFAEHKAIEEALGAETYFAHPYSSWERGLNENSNGLLRQFIPKGTDL
                     REVTDEDVRRAEQWLNLRPRKCLGFRQPVKVFEEYRQAA"
     CDS             167938..168753
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_01470"
                     /product="hypothetical protein"
                     /protein_id="BDC80204.1"
                     /transl_table=11
                     /translation="MYDDNVISDVLAAFSSDAQYYLGSVLCENKETDVSYFTRPSNIN
                     QADYRPCHQGFFCRRELFNRFGNFNECFTIGADMYLMKVVMKQTTGIITSRPIARFSL
                     KGLSSSSHNQTIITRQHEMIDSLIDGHAAENKLPELLSHQRQINSELKNLLLNLLHGK
                     CHLNASVFKRVGIFGTRELSQVVSLILRHSNIDTICFIISEVNSEQASSEIPVVSIRD
                     IGKFTLDTVINCIEGPHESEINEKIQQSATGIKVISWRLFCHPQADIQLYRMV"
     CDS             168759..169877
                     /codon_start=1
                     /gene="gmd"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q3IV56"
                     /locus_tag="NUITMVA1_01480"
                     /product="GDP-mannose 4,6-dehydratase"
                     /protein_id="BDC80205.1"
                     /transl_table=11
                     /translation="MKKAIITGVTGQDGSYLAELLLEKGYEVHGIKRRSSLFNTQRID
                     HIYQAPNIDDRRFILHYGDLTDTSNIVRLVQQIQPDEIYNLGAQSHVAVSFDSPEYTA
                     DVDALGTLRLLEAIRLLGLEKKTRFYQASTSELYGLVQETPQRESTPFYPRSPYAVAK
                     LYAYWITVNYREAYGIYACNGILFNHESPRRGETFVTRKITRGFANIAQGLESCLYMG
                     NIDALRDWGHAKDYVYMQWLMLQQQQPEDFVIATGQQYSVRQFIHWATEELGIRLRFE
                     GEGVEEVGIVDAIIGEHAPALKIGDVILRIDPSYFRPAEVDTLLGDATKARDKLGWQP
                     HIKTLALCQEMVREDLAEAKRQAFLRCNGYGQTLSSEG"
     CDS             169879..170829
                     /codon_start=1
                     /gene="fcl"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3MFT8"
                     /locus_tag="NUITMVA1_01490"
                     /product="GDP-L-fucose synthase"
                     /protein_id="BDC80206.1"
                     /transl_table=11
                     /translation="MTKRIFVAGHMGMVGRALVRQLELLPDTELVVIGRSELDLTDQR
                     AVQEFFDRQKVDQLYIAAAKVGGIYANNIFPADFIYQNLQIESNLIHAAHQADIQQLL
                     FLGSSCIYPKLAPQPIPESALLTGPLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSA
                     MPTNLYGPYDNFHPQHSHVIPALIGKFNRAIEQDAKTVEIWGSGNVRREFMHVDDLAS
                     ACVHLMSIPEEKFWAYVPQRCSHINIGTGLDCSIRELAELLAQLTGFTGSLIYDPAQP
                     EGTPAKRLNVTRLRELGWQSKWTLRERLKDTIDWYHSHLE"
     CDS             170860..172203
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_01500"
                     /product="hypothetical protein"
                     /protein_id="BDC80207.1"
                     /transl_table=11
                     /translation="MNILIEKEIQFEATSIIDSAGRVFHYNNRIFRLITNKDSAVLYR
                     NLLHSNFIESLFNAGLVKTWVPDDIMVSSAELIIEHQRLPFVVHPAEMTNESLAASAR
                     MLIMLQRSLIAEGLQLKDSHPWNIMLDKGKPIYIDFGSIVEYSGVFCTGWYEELKRFI
                     LIPLWLHKLYGESFAQEYRREHLKGFGQLFVHSHLIKDCCFPPSVKLDANIEKILLLL
                     DDILIWIDLFNVKSEPKKWSDYQQSGDQHDPLLPVSDKHKFVFDWLKKIHPKTVLDMA
                     GNKGFYSEVSARLGGQVICFDNEEFNVDACNTLAFDRDLNITAVLMDFLHPTPASGIG
                     LTFPDAYQRFRADTVLVLGLIHHICVGLGIPLHVFISFVLRYHPTNIIIEFVFTDDIH
                     ISSWGKKSPDDYSIDNLKTIFFEAGFMLAEEKIIGVDGVHRAMLAFTTPDLVRGV"
     CDS             172205..173104
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011118889.1"
                     /locus_tag="NUITMVA1_01510"
                     /product="hypothetical protein"
                     /protein_id="BDC80208.1"
                     /transl_table=11
                     /translation="MDKSFFEEQVRHLRIAMFHQTNTTKLLLGKQLSWSVKTRNIDQL
                     TDAEFSVFSQFGDDGIIQYIISKVDINQEKFIEFGVENYIESNTRFLLENNNWSGMVI
                     DSNKNNIEYIKNSLNYWRYDLKVMCSFVTAENINNLIQDAGFEEDIGLLHIDIDGNDY
                     WLWKAITVVKPVIVIVEYNSLFGVDRSITIPYNPDFSRFNKHYSGLYAGASLKALCHL
                     ASEKGYKFIGTNSAGNNAYFIILEQADKFTSLTCEEGYTLAKFREHRNEQGELTFTSG
                     LDAIEEIRGMPVFNTLTKQLEDF"
     CDS             173106..174200
                     /codon_start=1
                     /gene="perA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7DBF3"
                     /locus_tag="NUITMVA1_01520"
                     /product="GDP-perosamine synthase"
                     /protein_id="BDC80209.1"
                     /transl_table=11
                     /translation="MHSMIPVYQPDLSGNEKKYVIECIDSSWISSKGEFIQKFEREFA
                     SFTGMAYAASVSNGTVALHLALLALDIGPGDEVIVPTFTYIASVNAINYVGAKPVFVD
                     IEPLGWQLDCDLVEDLITEKTKAIISVHIYGQPTDMIRLQSIAKKHKLFLIEDGAEAF
                     GSRIDGHHIGNLSDITTYSFFGNKTVTTGEGGMVTTNSAELDKRIRHLKGQGLMEGKE
                     YWHDVVGYNYRMTNICAAIGLAQLEKATAFINRKREIANFYIAHLQGLPLQFQKERPG
                     SCHSWWMFSILTDTREVRDTLRHYLNNAGIETRPLFPPIHCMPMYYQDGHSFPISEDI
                     SERGMNLPSWPSMTDEMLHYIVEKITGFYE"
     CDS             174197..174874
                     /codon_start=1
                     /gene="perB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7DBF7"
                     /locus_tag="NUITMVA1_01530"
                     /product="GDP-perosamine N-acetyltransferase"
                     /protein_id="BDC80210.1"
                     /transl_table=11
                     /translation="MNVNSKYKINNLYVFGAGSFSRCILPLIRKFCAQQGLEYCFVVE
                     DINGVYFPYGKLISDSYFEQNIKPGFFFTIAIADVVLRRKIAERCIRLGGVPINLMAD
                     EHLCYDNVRVGLGAILCAHSMATTDIVIGQFFHCNIYSYIEHDCIIGDFVTFSPRVSC
                     NGRVHISDDVFVGAGAIIRNGSLYRPLSIGRGAIIGMGAVVTKDVPPECTVVGNPARV
                     VTKSSGF"
     CDS             174887..176038
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000684824.1"
                     /locus_tag="NUITMVA1_01540"
                     /product="glycosyl transferase"
                     /protein_id="BDC80211.1"
                     /transl_table=11
                     /translation="MRKLKVALLPQHFCWSGGLEFIRHILNGLTAVVPLYEWQVVIAL
                     DEEFVKDDIYLQLQDYLANATIVPEQIFYSSCHNDLASTLEHNNVDIVLPVNSDLGAN
                     FPVPWLAYIPDFQHKYLHYYFTEHECFARETAFSARLRDCKAVVVNSMSVKSDIIKFY
                     PWINAARIKVLPFTPHPIPDWLAVDSLEIKKKYGLPQNYFLICNQFWIHKDHPTAFHA
                     FAQLASKDVHLVCTGTLSDYRHPDYVEEQKMLLDTLGISERVHFLGHIPKFDQIGLLK
                     GSIALIQPTLFEGGPGGGATYDAVSLGIPVLLSDIEVNQEIMTPEVYHFHQQNAEDLT
                     QLMQKVLVQKRKMPAADVLLAEGLIRQQQLGKALYEAITYTLGCYENSN"
     CDS             complement(176045..177472)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001103638.1"
                     /locus_tag="NUITMVA1_01550"
                     /product="phosphomannomutase"
                     /protein_id="BDC80212.1"
                     /transl_table=11
                     /translation="MLSTKTIIHQSGLGFGTSGVRGLVNQLTTEACQAFTYAFISVMR
                     DRFTFKHVALGIDNRPSSLGIAGACAAALQQLGVEPLFYGVLPTPALALQAMDCRIPA
                     IMVTGSHIPHDRNGLKFYGPGGEITKAEERQILEADIVFSKIMAQPMLQPSTEAAVRY
                     TKRYLQFFNKNALAHKRVGIYEHSSAGRDIYPSIFQALGATVVRLGRSDDFIPIDTEA
                     LSTEDEQRALSWTQQYSLDALFSTDGDGDRPMLADEQGHWLKGDILGLLCCQYLGIQS
                     LAMPLNCNSAVEQSGIATRVIRTRIGSPYVLEAMGGLAGKFAGFEANGGFMLGSSIDY
                     EGRHLAALPTRDALLPALAALILARETGLAAILATLPNRFTHSDRIKVNPTAFMQKAI
                     SDRLWLLETLGLAAGIDVDIDMTDGIRMQLPDHRIIHLRASANAPELRCYAEAKSQQE
                     ARTLVENTLYIAIETMNSWNNLNSQ"
     CDS             complement(177466..178803)
                     /codon_start=1
                     /gene="manB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000084309.1"
                     /locus_tag="NUITMVA1_01560"
                     /product="mannose-1-phosphate guanyltransferase"
                     /protein_id="BDC80213.1"
                     /transl_table=11
                     /translation="MPLLGEASMLLDTIGRVKELAAHPFTVVCNEAHRFIVAEQLREA
                     GIQNHILLEPSARNTAPAIAVAALHGMTIADDPVLLVLAADHAIKEPHAFRQAIEAAY
                     PFAANGKLVTFGIVPQTPETGYGYLRAGESLGGGVSRVDAFIEKPDLDTAKQYLSSGK
                     YLWNSGLFMFKASRYLEELKLYRPDILAACEKAFSTRKHDLDFIRVGSAAFEESPSES
                     VDYAVMEKTHDAVVVPMDAGWSDVGSWSTLWEVHEKDQQGNVLEGDILALETTDCYIK
                     SSNRLVTTIGLDKLVIVETKDAILVAAHDKVQDVKTLVSHLKSMHRPEVELHREVYRP
                     WGKYDAIDTGERFHVKRITVKPGAKLSLQLHHHRAEHWVVVSGTAKMTLNGVARFITE
                     NESVYIPIAAVHSLENPGRVDLVLIEVQSGSYLGEDDIVRLGEHYYKDEGEPC"
     CDS             complement(178971..180104)
                     /codon_start=1
                     /gene="flmB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707809.1"
                     /locus_tag="NUITMVA1_01570"
                     /product="UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-
                     altrosami ne transaminase"
                     /protein_id="BDC80214.1"
                     /transl_table=11
                     /translation="MIPYGRQSISEADIEAVVEVLRSDFLTQGPVVPRFEQAVVDYCG
                     ARFGVAVNSGTAALHIACLALGVGPGDWVWTSPISFVASANCALYCGAQVDFVDIEPD
                     TGNLCAMELERKLVAAKAQGCLPKVVIPVHFAGLPCDMKEIHRLGQEYGFRIIEDACH
                     ALGARYHGEPTGNGRYSDITVFSFHPVKIITTGEGGMAMTNNPAIAKTMSMLRSHGIT
                     RDPEDFINEPDGPWYYEQQMLGFNYRMTDIQAALGLSQMTNLEGWIAKRSEIARRYFE
                     ALSPERLPRYFGEQRRSAFHLYVHHVAPELRRNLFQRLRDHGIGANVHYMPIYKQPWH
                     QEGHQSALPMAEAHYYGAITLPLFPHLTTAEQHQVFTLVTADT"
     CDS             complement(180101..181105)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707808.1"
                     /locus_tag="NUITMVA1_01580"
                     /product="UDP-N-acetylglucosamine 4,6-dehydratase
                     (inverting)"
                     /protein_id="BDC80215.1"
                     /transl_table=11
                     /translation="MFDNKTLLITGGTGSFGKMLVKTVLERYKPKRLIIYSRDELKQF
                     EMQQVFNAPCMRYFIGDVRDANRLTMAMRGVDYVVHAAALKQVPAAEYNPMECIKTNI
                     HGAENVIQAALLNQVKKVIALSTDKAANPINLYGATKLASDKLFVAANNIAGQDPTRF
                     AVVRYGNVVGSRGSVVPFFQKRIDQGATTLPITHTEMTRFWITLQQGVDFVMNNFPRM
                     KGGEIFVPKLPSVRITDLATAMAPQLDQEIIGIRPGEKLHEVMCPCDDSYHTFEFDDF
                     FIIGPTINFNNRNNDFSVTASGEKGAMVAQGFEYNSRDNEDFLTVEQLKELNSKVVME
                     "
     CDS             complement(181255..182202)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002221064.1"
                     /locus_tag="NUITMVA1_01590"
                     /product="IS30 family transposase"
                     /protein_id="BDC80216.1"
                     /transl_table=11
                     /translation="MSYQQLTEGQRYQLSVLRAQGMSILATARAIGVHRSTLYRELRR
                     NAGPQGYQPDNAHQHATHRRASAAKSRLSADVIQFVELTLAWWWSPEQISAVGKQIGL
                     MVSHEWIYRHVAADKARGGQLYRHLRQGHKRYRKGASSLRSPIKEARSIDERPAIVDS
                     RERLGDWEADTVLGKQGTGALVTLVERKSRLYLVKRVASKQAGVVRDAIIEMLTPYIE
                     QVHTITFDNGGEFAEHKAIEEALGAETYFAHPYSSWERGLNENSNGLLRQFIPKGTDL
                     REVTDEDVRRAEQWLNLRPRKCLGFRQPVKVFEEYRQAA"
     CDS             complement(182414..184243)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707807.1"
                     /locus_tag="NUITMVA1_01600"
                     /product="maltodextrin glucosidase"
                     /protein_id="BDC80217.1"
                     /transl_table=11
                     /translation="MTHPFLFHPQVAPWFKESADALQLTLFSELDAPIREVWLRHEPD
                     NEEYLIPMTAVSTRDRLQVWQATLPLIKGQDIHLYCFKCLTDEEQWWLHGAGVSATMP
                     PREQHFRFNSLHQPPAWVQDQVFYQIFPDRFCNGDPSLSVKHHEYEYRGKAVISKAWG
                     EPVSRHEEGHGACEFYGGDLAGIDAKLHYLQSLGVTALYLNPIFDSPSNHKYDTQDYF
                     KVDAHLGTNAQFAELTRNLHQRGMKIILDAVVNHTSTEHPWFCPPLGAQRNPDSPWRS
                     FYTFDNEGDYVSWKGIRSLPKLDFSSEQVQDAVYRADDAILRYWMRAPYQIDGWRFDV
                     IHMLGERGTAEGNRGHVRAIRGAVKQENPDAYVLGEHFFEASQWLQGDQEDGAMNYYG
                     FAHPIRAFLAGQDIAYHPIKISAEELDRWLKLARAHIPFKNQLAQFNLLDSHDTARFL
                     HLLGEDKHRMRLAATLLLTYIGVPSIYYGDEVGLSGGNDPDCRRCFPWETTAWDHALH
                     DHYRRLIQIRRQRPALRRGDIQTLYAGPHSYVFARTLQSDQVVVACNRHPSEPRTISL
                     PLWQTASPASRFTDAFNGDKFEVVQGEVQLTIPANSARVLLSS"
     CDS             complement(184249..185079)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707806.1"
                     /locus_tag="NUITMVA1_01610"
                     /product="hypothetical protein"
                     /protein_id="BDC80218.1"
                     /transl_table=11
                     /translation="MSMDRLFDKIKQLPTIPQLLHELMQSFSDENARIDEIAAKIAMD
                     QVISVKVLRMANSAALRRGNEVTSIEQAVIRLGFNRLRSVVVASGIIGSFKAPPSFDK
                     NKFWTETFQVATIAKTLAQEAKVLDPETAFTCALIHNIGELLIQSTLPEEAELISLAI
                     QKGSSRVEAQREMLGYDYAQLGAELARRWNLSEAFVDAISQQLDPLSHDPVSKEAVLI
                     RLAVFISFAWNAGVPAQAIIARFPKPLADQLGLDPKSLAGQLETLHEQGNALADLLTQ
                     "
     CDS             complement(185168..185587)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_01620"
                     /note="frameshifted, deletion at around 185715"
                     /product="hypothetical protein"
                     /protein_id="BDC80219.1"
                     /transl_table=11
                     /translation="MPRFLLLLLALLLLSACSSTPRFASQDLQHHHWVLDKLDGQPVA
                     APRDNPPDFEIGEHFTVNGIAGCNRYFGQGHLEGNKFWVTSLGSTEMACLAPLDAVEQ
                     AVLTTLTEGATLDGTTQTLILQGKRHRLEYTLRDWVL"
     CDS             complement(185741..187120)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707804.1"
                     /locus_tag="NUITMVA1_01630"
                     /product="molecular chaperone"
                     /protein_id="BDC80220.1"
                     /transl_table=11
                     /translation="MFIGFDYGTSNCAVAVMEQGSPRLLNLSGAHYLPSTLHAPHRDA
                     IAGLLAEGLAPAQQSEYLKLRGPVVTRAQAVRRQMREEGLIDELSFGAAALERYLEEP
                     DDGYYLKSPKSFLGAYGLKAPQIALFEDIVCAMMLHVRREAEQQLGAPIRRAVVGRPV
                     NFQGLAGEESNRQAIAILSEAARLAGFEQVEFLYEPVAAGFEFEARLTEDAVVLVVDI
                     GGGTTDCSVLRMGPSHRDRLDRDGDLLGHSGQRIGGNDFDIRLTVEGMMPLLGMHETL
                     KTGKPLPHPLFWDAAAINDVSAQSRFYSLETARQLQDLQLDSQPGSKLGRLANLRAHK
                     LSHQLVWRAEQGKIALSTQESNHQSLSELEKGLEAELTREQLANASALLLEKIGELMD
                     EAIAAAGVQPDRVFITGGSARSPLIQAFIRQKLPQVPLEGGDDFGSVASGLARYAERL
                     FGSGQPTPI"
     CDS             complement(187212..188201)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707803.1"
                     /locus_tag="NUITMVA1_01640"
                     /product="lactate dehydrogenase"
                     /protein_id="BDC80221.1"
                     /transl_table=11
                     /translation="MRVAVFSTKSYDKEHFNQANSQYGYELEFFDVRLEAKTARLAHG
                     FPVVCLFVNDDADREVLTELATNGTKVIALRCAGYNNVDLAAAKELGLKVVRVPAYSP
                     EAVAEHAVGLMMTLNRRIHKAYQRTRDANFSLEGLVGFNMHGRTAGIIGTGKIGIATL
                     RILKGFGMRLLVSDPYPNQAAIDLGAEYVDLDTLFRQSDVISLHCPLFKENYHLLNKE
                     AFAKMKDGVMIINTSRGGLLDSNAAIEALKTARIGALGLDVYEEEEDLFFADKSNEVI
                     TDDVFRRLSACHNVLFTGHQAFLTREALHAIADTTLSNIRAIDSQGRCDNEVE"
     CDS             complement(188279..188758)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707802.1"
                     /locus_tag="NUITMVA1_01650"
                     /product="hypothetical protein"
                     /protein_id="BDC80222.1"
                     /transl_table=11
                     /translation="MRHPQILARTLPLLLGALIAGPALADKADPVGEVSTAFKLFGPN
                     HKILVEAFDDPRIDGVACYLARPKTGGVKGGLGLAEDPSHASLSCHQIGPITLPAKLK
                     AGEEVFDVSTSLVFKEQKVVRFYDQKRNALVYLTYSTKLVDGSYKSAVSAVPIMPWG"
     CDS             complement(188780..189226)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707801.1"
                     /locus_tag="NUITMVA1_01660"
                     /product="hypothetical protein"
                     /protein_id="BDC80223.1"
                     /transl_table=11
                     /translation="MKGIEEWFELYGQSHRHPVNVAIHKLAVPGIYLCALALLWCLPA
                     GPLPPSLNWAALVVIPVLAFYLRLSFALFVGMTVLTALGLVICHSWQGPLLWPALAGF
                     ALLWIAQFVGHQIEGKRPSFLADLQFLLIGPAWVLASLYRRLGIPY"
     CDS             complement(189278..190135)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707800.1"
                     /locus_tag="NUITMVA1_01670"
                     /product="hypothetical protein"
                     /protein_id="BDC80224.1"
                     /transl_table=11
                     /translation="MKWFLRLCLCLPLLAQAQTLTVKVPSRPINDLDKEYQLKLLELA
                     LTHAGQPFRIKQVELNLNQYSLQQQLSKGQTINVFWMGTSSALESSLIAVPIPLFRGL
                     EGLRLSFIHADAQEKFNQINSLADLKKLKAAQGVGWADNKILENAGIPTYSGRYSNLF
                     RLINDGDKLDFFPRNLVEIFAERSELVAQYPNLVIDQHLLIRYPFAEFFFVSPESPKL
                     AKAIQTGLERAYADGSFMKFFRENPKIREALASANLERRVTISLPNPDMTPLLKSIPA
                     QYWEYPPQG"
     CDS             complement(190306..190692)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010635769.1"
                     /locus_tag="NUITMVA1_01680"
                     /product="RNA polymerase-binding protein DksA"
                     /protein_id="BDC80225.1"
                     /transl_table=11
                     /translation="MCDFMTEDQLAFYKGQIERQILELEDRLNSQASQAIATDTNEMA
                     DEIDRASIEEARRLELNRIEHDKLHLRKLRGALKRISEGDFGYCESCGDEISLKRLQA
                     RPESRFCVECQSTKEFNDTHVYRRVA"
     CDS             191161..192492
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707799.1"
                     /locus_tag="NUITMVA1_01690"
                     /product="glutamine synthetase"
                     /protein_id="BDC80226.1"
                     /transl_table=11
                     /translation="MDSIKGWMESNRITEVECLFPDFTGNARGKIIPANKFLREGGMR
                     LPEVIFTQTVTGEYPDDDSMIDPLERDMQLYPDPNTIRFVPWALEPTAQVIHDCFDIN
                     GKLIDIAPRSVLRRVLSFYEKQGWKPVVAPELEFYLVKRNEDPDYPLVPPVGRNGRPE
                     TARQSFSIDAVNEFDPIFEDMYDYCEAQELEVDTLIHESGAAQMEINFLHGDAVDLAD
                     QVFLFKRTMREAAHRHGIYATFMAKPMSDEPGSAMHIHQSLEDVNGRNLFGTENGGHS
                     ELFMHFIAGLQKYTPAVTALLAPNVNSYRRLTFGESAPRNVQWGVENRTCGLRVPFSE
                     ASARRVENRFAGADANPYLALAATLACGYLGMMEKLEPLPEMKSSAYELPYSLPRSLE
                     EALSHLEQCDPIKEMLGERFTRAFVAVKRKEYETYFGVISRWEREFLLLNV"
     CDS             192680..194041
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707798.1"
                     /locus_tag="NUITMVA1_01700"
                     /product="aspartate aminotransferase family protein"
                     /protein_id="BDC80227.1"
                     /transl_table=11
                     /translation="MQHTTREWQQLEASHHLHPFTDFQALNKKGSRIITRAEGVYLED
                     SEGKRILDGMAGLWCVNLGYGRQELVDAATRQMQQLPYYNLFFQTSHPPAAELATLLA
                     EITPPHLNHVFFTGSGSECNDTVLRMVRHYWASKGQPDKQVIISRHNAYHGSTVAGAS
                     LGGMKGMHAQGGLPIPGIVHIDQPYHFGEGQGMSAHEFGLARARQLEEKILALGVEQV
                     AAFIGEPIQGAGGVIIPPDSYWPEIQRICDKYGILLIADEVICGFGRTGHWFASEGFG
                     IKPDLMCLAKGITSGYLPMGAVMVGDRVAKVLVEEGGEFNHGFTYSGHPVACAVAIAN
                     ITLMQNESIVKRVHDTIGPYLQRRWAELADHPLVGETRGKGLVAALEIVQDKQTNSRF
                     PAGLQAGMTCREFCFNNGLVMRAVGDTMIISPPLVITEEQVDELVNLARLSLDLTAAK
                     LRG"
     CDS             194096..195193
                     /codon_start=1
                     /gene="potF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQL0"
                     /locus_tag="NUITMVA1_01710"
                     /product="putrescine-binding periplasmic protein"
                     /protein_id="BDC80228.1"
                     /transl_table=11
                     /translation="MSFKTGMIAASVALVMMSTGAMAEDKVLHVYNWSDYIAPNTLED
                     FQKETGIKVVYDVFDSNEVLEAKLLAGSSGYDIVVPSNPFLAKQIKAGVFQKLDKSKL
                     SNWQNLDTSLLKALEPSDPGNQYSIPYLWGTIGYAYNPEKVKAVLGDKAPVDSWDLVF
                     KPENMAKLKECGVSFLDSPTEMLPAALQYLGFKPDSQKPDELKKAEELFLSIRPYTAY
                     FHSSKYISDLANGNLCVAVGYSGDLQQSKSRAIEAKNGVNLTYVIPKEGAGSFFDMLA
                     IPADAKNVEAAHVFLNYLMKPEVIAKISDAVSYPSGNKASVPLVSEKIRNDPGIYPSD
                     ETLAKIYTFPDLPAKVQRLMTRSWTKIKSGK"
     CDS             195335..196396
                     /codon_start=1
                     /gene="potD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQK9"
                     /locus_tag="NUITMVA1_01720"
                     /product="putrescine-binding periplasmic protein"
                     /protein_id="BDC80229.1"
                     /transl_table=11
                     /translation="MALALGLANVAQAAPVVHFYNWSDYIGETTLSDFQRATGIQTVY
                     DVFDSNETLEGKLLTGRTGYDLVVPSNNFLAKQIKAGAFQKLDPALLPNLANLDPVLL
                     KQLDKVDPGHQYAVPYLWGTNGIGYNIDKVKAVLGVDKIDSWAVIFEPENMQKLARCG
                     VAFLDSADEMIPAVLNYLGLNPNSQDPADLKRAEEQLLKVRPYVAYFHSSKYIGDLAN
                     GDICVAAGFSGDILQAAARADEAGKGIKIAYSIPKEGGNLWFDMMAIPADATNVKEAH
                     ALINYVLQPEVIAQISNHVGYANPNAKAGEFMEEHVRNDESVYPPQAVLERLYVQQAH
                     PRAVQRLITRSWTKIKSGT"
     CDS             196472..197626
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQK8"
                     /locus_tag="NUITMVA1_01730"
                     /product="polyamine-transporting ATPase"
                     /protein_id="BDC80230.1"
                     /transl_table=11
                     /translation="MAIASSAYKKALEGSQQRKEVLVKIDRVSKQFDETLAVDNVSLN
                     IHKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRLFLDGVDITDMPPYERPINMMFQS
                     YALFPHMTVAQNIAFGLKQDGLPKAEVDARVEEMLKLVQMTQYARRKPHQLSGGQRQR
                     VALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMT
                     MAERIAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGLLVEDEQDHATIACA
                     DLEQPIYVGHGISSRAENKKVTYALRPEKLLMSLQKPVEIEHPDFNWTKGEVYDIAYL
                     GGHSVYHIQLPSGKIVQAFIANAERHGKRPTWDDQVFLYWEDDSGVVLQS"
     CDS             197623..198528
                     /codon_start=1
                     /gene="potH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707794.1"
                     /locus_tag="NUITMVA1_01740"
                     /product="putrescine ABC transporter permease"
                     /protein_id="BDC80231.1"
                     /transl_table=11
                     /translation="MMALRRLKALGGRQLVIGIPFFWLFLFFLLPFIIVVKISFAEAD
                     VAIPPYTDVVSWADDQLTILLHMGNYLLLQEDELYIAAYLGSLKMAFISTVLCLLIGY
                     PMAYSIARANKETQTVLLLLIMMPTWTAILIRVYAWMGILSNNGLLNSLLMGIGLINE
                     PLQILNTNLAVYIGIVYSYLPFMVLPLYANLVKHDQSLLEAASDLGARNLTRFWQITV
                     PLSKNGIIAGCMLVFIPVVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASALAV
                     VMLAVLIIPIILFNRNQAKELEGKV"
     CDS             198525..199367
                     /codon_start=1
                     /gene="potI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707793.1"
                     /locus_tag="NUITMVA1_01750"
                     /product="putrescine ABC transporter permease PotI"
                     /protein_id="BDC80232.1"
                     /transl_table=11
                     /translation="MRRFGFAKLMLWLGLLFIYLPMIIMVIYSFNASKLVTVWGGWSL
                     KWYFGLLDNKQLIGSVLRSLEIAFYTAIAAVALGTVAAFVLTRIPHFRGRTLFGGMVT
                     APLVMPEVITGLSLLLLFVAMAQLVGWPAERGMVTIWIAHTTFCTAYVAIVVSARLRE
                     LDLSIEEAAMDLGAKPWKVFFLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGS
                     TTLPMEVFSAVRLGVKPEINAVASLILLSVSLFTFGSWYLMAKAEKRRRAEIAMTTQM
                     QAVA"
     CDS             199413..200123
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707792.1"
                     /locus_tag="NUITMVA1_01760"
                     /product="molybdenum cofactor sulfurase"
                     /protein_id="BDC80233.1"
                     /transl_table=11
                     /translation="MRISIFSGQGTELVPGLVSAIHKQATSIPLWCGANGLAGDEQCD
                     QRHHGGPDRALHYYPADHYPWWHNWQTALGLPAPRTPWQPAAFGENLSGIGLTEAQAC
                     IGDVYRLGEALIQISQPRSPCFKLNQRFGYGQMSQVMQLSGRCGWLLRVLEEGMVMPQ
                     ERLELVDRPYPELTVKRTADILFNQLRNEADLLLLLENPALSPNWRKHAADWLEHGVV
                     ADWRRRLLGPAEFQLASS"
     tRNA            200271..200347
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00080"
                     /product="tRNA-Pro"
     CDS             complement(200609..201079)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707791.1"
                     /locus_tag="NUITMVA1_01770"
                     /product="hypothetical protein"
                     /protein_id="BDC80234.1"
                     /transl_table=11
                     /translation="MLDEVQTPECRHWLEQELEGYSLCSPLPWYRIIACRQRGHFLDL
                     KTGKYLTCHINSQTLSQRDLAQIQFIYAREPAAHYLLQRNSGIEPWPEQLLEDYQEQL
                     IPGHLCLQAWHEPVSSLREQLMEGIEHFISEYPKHAALQPQHGFKALRHQHWHI"
     CDS             complement(201261..201716)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707790.1"
                     /locus_tag="NUITMVA1_01780"
                     /product="hypothetical protein"
                     /protein_id="BDC80235.1"
                     /transl_table=11
                     /translation="MLKKMALSGIANLFAERMPFNKLIGMQVTHYDFDKVELRIKMEE
                     KLIGNPFHNILHGGVTASLLDVAGGMIVAASCIDELEDFSPSYLKERFSRLGTIDLRV
                     DYLRPGRGNEFIATAHIIRAGSKVAVARMELHNEEGTHIAFGTGTYLVG"
     CDS             201859..203694
                     /codon_start=1
                     /gene="recQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707789.1"
                     /locus_tag="NUITMVA1_01790"
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="BDC80236.1"
                     /transl_table=11
                     /translation="MTAIAETLPDPQPENPLALLQAVFGYQQFRPGQLEIIEQIVAGR
                     DALVLKPTGGGKSLCYQIPALLRPGLGVVVSPLISLMKDQVDSLRANGVAAVYINSAL
                     SREEMIQNFAAMRRGEIKIVYVSPERLLQHEFMDRLAELPLGLFAIDEAHCVSQWGHD
                     FRPEYAALGRLKQWFPQVPVVALTATADEATRSDMLHRLELHDPFIHTASFDRPNIRY
                     SLVEKFKAAEQLLRYVQSQKGNCGIVYCSSRNRVEEVAERLSRHGCKAAPYHAGLPLE
                     LRQRTQESFLKDDIEIVVATVAFGMGIDKPNVRFVVHYDIPKNIESYYQETGRAGRDG
                     TPAEALLLYDPADIGRVRRLLDNIENPQQLQVEQYKLNVMAAFAEAQTCRRQVLLNYF
                     GEYNDKPCGNCDICLDPPQSYDGTEDAQKALSCVWRVGQNFGVGYVVEVLRGSLNQRI
                     KDHGHDKLSTYGIGKDQSHEYWMSVIRQLIHKGLLTQNITRNLVLQLTEAARPVLRGE
                     VRLDLAVPRLQPISSRKEKRNGLLDNANYDKRLFKELRALRKQIAEDEEVPPYVVFND
                     ATLVEMAQLMPMTEAEMLAVNGVGHRKLERFGEAFMDLIIDYCRR"
     CDS             complement(203741..204040)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707788.1"
                     /locus_tag="NUITMVA1_01800"
                     /product="cytochrome c"
                     /protein_id="BDC80237.1"
                     /transl_table=11
                     /translation="MQRWLGALPLLLLLWGPAQAADLEAGKAKAAVCAACHGAEGRAL
                     IPNYPHLAGQNAAYLVKQLKAFKDGSRKEPLMVPFMAPLTDADMENLAAYYASLK"
     CDS             204144..205571
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQK0"
                     /locus_tag="NUITMVA1_01810"
                     /product="UPF0061 protein"
                     /protein_id="BDC80238.1"
                     /transl_table=11
                     /translation="MKLINTFATELPWACEPVAPQPLHAPGLLHLNRALLGELGLGAV
                     SEADWLACCGHGQPLPGMQPVAQVYAGHQFGGYSPRLGDGRALLLGEQQAPDGSRWDL
                     HLKGAGKTPFSRFGDGRAVLRSSIREYLASEALHALGIPTTRALVLVGSQEPVYREQV
                     ETGATVLRTAPSHLRFGHVEYFAWSGQGERIPTLIDYLLRHHFPELADGAELFAEVVR
                     RTARLMAKWQAAGFCHGVMNTDNMSLLGLTLDYGPYGFIDAYVPDFVCNHSDPGGRYA
                     LDQQPAVGYWNLQKLAQALAGHVDGDALAAALAQYEHQLMLHYSELMRAKLGLAVWED
                     DDPALFRELFRLLAAHGVDYHLFLRRLGEVTGEGAWPASLLALLPEPAAWQGWLEAYR
                     ARLDREGSEDAVRKAQMDAVNPKYVLRNALAQRVIEAAEQGDMAPFERLFAALQHPYD
                     EQPEYEDLATPQPAWYCGGELSCSS"
     CDS             205582..205869
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707786.1"
                     /locus_tag="NUITMVA1_01820"
                     /product="hypothetical protein"
                     /protein_id="BDC80239.1"
                     /transl_table=11
                     /translation="MNWHIAQTDRDAGVVTLVNPALDWDSFPTLANTLLQEWELVALE
                     RECGADRHSWLLEFEGSRFRLEYEHYSGCWLAAEQPADAEVLFWLARQHQG"
     CDS             206003..206677
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707785.1"
                     /locus_tag="NUITMVA1_01830"
                     /product="hypothetical protein"
                     /protein_id="BDC80240.1"
                     /transl_table=11
                     /translation="MNLTPAQHQTALVRLSLFHILIIASSNYLVQLPITIFGFHTTWG
                     AFSFPFIFLATDLTVRIFGAGLARKIIQTVMLPALAISYALSVLFFEGSFQGVGNLAE
                     FNLFVARIALASFMAYLVGQFMDVVVFNRLRLLKAWWVAPAASTLFGNLVDTIAFFTI
                     AFWRSTDPFMAEHWVEIATVDYVFKLLISLGLFVPLYGVLLRYLSRKLVGEAGLAGLQ
                     TATRQA"
     CDS             complement(206947..207432)
                     /codon_start=1
                     /gene="rraA-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQJ7"
                     /locus_tag="NUITMVA1_01840"
                     /product="regulator of ribonuclease activity A"
                     /protein_id="BDC80241.1"
                     /transl_table=11
                     /translation="MEYNTSELCDIYQDMVDVLEPMLCSFGGRASFGGVITTVKCFES
                     NGLIRELVKENGVGRVLLIDGGGSMRRALIDSEIATTAAENEWEGIVCYGCVREVDIL
                     EDLDIGIQALAAIPVGADSKDVGETDLPVNFGGVTFLPDDHLYADTTGVILSPDTLDI
                     E"
     CDS             207579..209432
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707784.1"
                     /locus_tag="NUITMVA1_01850"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BDC80242.1"
                     /transl_table=11
                     /translation="MLIRHKLILNTALVAVAMLVLSGLFLYSNQVSRHLTEAQRNVDG
                     LEIAMLNLRRAEKDFLIRKDPAFVTRFNEVLANFHQLNQTLGQDDNLSAVQGELTRLD
                     QQMGAYGKAFNDLVAQQQIIGLGPEDGLYGRLRTAVHQVEEGLKQLDEQGLLITMLQL
                     RRAEKDFMLRSDIQYLERFQTLHKDFQQRLATLPEADRGKLEQASEQYRQDFVALVQG
                     MQVLGLSEDEGLRNEMRGLVHQTEQGFTAVGKHIADELVRQTSHLNTLMLVCGGIIIV
                     LIGIMSMLLGRSIDRPISRVNDTVNRIRQDNDLRLKIELQGADEMAQLAGNLDVMLGG
                     FRHLIGDVKQSVHTLTEAADHLSGNVRRTSEGAARQLQETDMVATASTEMGSTIEEIA
                     RNTEQAANNAQTTNNKAMEGRSAVENTVSQIRSLADNLENSSREVAQLQQESETIGSV
                     LDVIRGIAEQTNLLALNAAIEAARAGDQGRGFAVVADEVRSLAIRTQKSTQEIAGIIS
                     SLQKQTGNIVGMMATCREQGNSSSEQASMAGELLEQITQDVTHIMDMSTQIAAAIEQQ
                     SLVANEVNRNVNNIRDIAQESSLMAEENAKSSHGLTEQAKLLNQAVAKYRV"
     CDS             complement(209490..210914)
                     /codon_start=1
                     /gene="mgtE-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQJ5"
                     /locus_tag="NUITMVA1_01860"
                     /product="magnesium transporter MgtE"
                     /protein_id="BDC80243.1"
                     /transl_table=11
                     /translation="MSLPAKNSAKQREQDRSRILTLLLADDALTDSLLDPQGVQDATL
                     RDQTSELTRLVNSLPAADIADALESLPPDERHVLWQQVDEEKHGQILVEASETVWDSL
                     ISGMSDKELLHALRTLDIDDQIYLGQYLPRNLMGRLLTSMAPAQRDRVREVIRYGKHT
                     VGAMMDFELITVRAEVSLATVQRYLRLRGKIPANTDKLFVTDRRNRLQGELPLTTVLL
                     HKPETLVRDVMEKDPVTFDPEDNDEAAARTFERDDLVSAAVIDGRGKLMGRLTVAEVV
                     DLVYEESDTDLRRMGGISEEEDVFAPVSKAVKTRWAWLAINLCTAFVASRVIGLFEHT
                     ISQLVALAALMPIVAGIGGNTGNQTITMIVRALALQHIQTGNVSFLLWRELGVALING
                     LVWGGTMGVATYILYQDAALGAVMTLAMMLNLLVAALMGVIIPMTMSRLGRDPAVGAS
                     VMITAITDTGGFFIFLGLATLFLL"
     CDS             complement(211047..212453)
                     /codon_start=1
                     /gene="cysG3"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQJ4"
                     /locus_tag="NUITMVA1_01870"
                     /product="siroheme synthase 3"
                     /protein_id="BDC80244.1"
                     /transl_table=11
                     /translation="MDYLPIFCRLDNKPVLLVGGGEVAERKARLLLDAGAQLTVVAPE
                     LDPELAELAANGSIEWLAGEFAPQQLAGKWLVVAATDRREVNALVYQSANQARIFANV
                     VDDPKRSSFIMPSIIDRSPLMVAISSGGKAPVLARLLREKLEALLPQHLGAVAAFAGS
                     LRERVKARFASMGERRRFWERLLGADRLGQALARGDSASANQLADSLFADESQSGGEV
                     VLVGAGPGDPGLLTLHALRQMQQADVVVYDRLVSGEVMALVRRDAKRIFVGKQAGNHC
                     VPQEGINQLLLDEAKKGQRVVRLKGGDPFIFGRGGEELETLIGSGIGFQVVPGITAAS
                     GCAAYAGIPLTHRDHAQSVRFVTAHGKGGAQDLDWPLLAKDKQTLVFYMGLSSCATIR
                     EQLLTHGKAGDTPVALIERGTQPSQRVIRGTLDQLPELAMGVESPALIMVGSVVTLAD
                     QLAWFGQGCAADAALASA"
     CDS             complement(212466..213278)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707781.1"
                     /locus_tag="NUITMVA1_01880"
                     /product="nitrite transporter NirC"
                     /protein_id="BDC80245.1"
                     /transl_table=11
                     /translation="MYTDTINKCAANAARINRFERSDKLGFWLSSAMAGAYVGLGIIL
                     IFTLGNLVDPSIRPLVMGATFGIALTLVIIAGSELFTGHTMFLTFGVKTGKISMGDLL
                     RILPQTWAGNLLGSIAVALIYSYGGSLLPDAGSLAHKVALAKTQAPALTLFMKGVLCN
                     WLVCLAIWMALRTEGAAKFIAIWWCLLAFIASGYEHSVANMTLFALSWFGAHSEAYTL
                     GGIGHNLLWVTLGNTVSGALFMGLGYWYATPKAERPVAVSETTTTASQTQTA"
     CDS             complement(213413..213733)
                     /codon_start=1
                     /gene="nirD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707780.1"
                     /locus_tag="NUITMVA1_01890"
                     /product="nitrite reductase small subunit"
                     /protein_id="BDC80246.1"
                     /transl_table=11
                     /translation="MMKLACQLNDILPGTGVCALIEGRQIALFRPSAAAEVFAIDNRD
                     PFFAANVLSRGIVGEHEGELWVASPLKKQHFRLRDGHCLENAAMSVQSYPVEVRDQQV
                     WVAV"
     CDS             complement(213730..216276)
                     /codon_start=1
                     /gene="nirB-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707779.1"
                     /locus_tag="NUITMVA1_01900"
                     /product="nitrite reductase large subunit"
                     /protein_id="BDC80247.1"
                     /transl_table=11
                     /translation="MSKVRLVVVGNGMVGHRFIEELIERADPGRYEITVFGAEPRPAY
                     DRVHLSSYFSHHTSEDLSLVKPGFYDKHGIRLLLGEAVKKIDRANREVHSNKGTVVEY
                     DKLVLATGSYPWVPPIQGSQHHECFVYRTIEDLKAIRSAAKSGKSGVVIGGGLLGLEA
                     AGALKALGLETHVVEFAPVLMAEQLDGQGGQLLRRKIESMGVQVHTSKSTSEILMHGG
                     RDAQHRLAFADGSQLEVDVVVFSTGIRPQDTLGRYCELAIADRGGVLIDDHCLTSDPD
                     IYAIGECAAWQGRFFGLVAPGYKMAQITVDHLLGGDSRFEGADMSAKLKLLGVSVGSI
                     GDAHGRTPGSHSYVFQDDQAGVYKKIVVSEDNSRLLGAVLVGDVEDYGNLLQMMLNAL
                     PLPSHPDTLILPAYAGAKPTLGVDALPESAQICSCFDVSKGDIAKAVAEGHTTLAAIK
                     QHTKAGTGCGGCVPLISQVLNAELVKQGIEVNNHLCGHFPYSRQELFHLVKVEGIKSF
                     DELLAKYGHGHGCEVCKPTVGSILASCWNDYVLNPLNTQLQDTNDIFLGNMQKDGSYS
                     VIPRMAGGEVTPEGLLAVAEVARDYKLYTKITGAQRIGLFGAQKDDLPAIWRKLLAAG
                     FETGQAYAKALRMAKTCVGSTWCRFGVQDSVGLGVFLENRYKGIRTPHKMKFGVSGCT
                     RECAEAQGKDVGIIATDAGWNLYVGGNGGMKPRHADLLASDLDRETLIKLIDRFMMFY
                     VTSADKLQRTSVWLGNLEGGVDYLREVIVDDKLGLADTLERDIQTLIDSYECEWSRTL
                     NEEEALKRFSHFINSDKRDPDVQFVSERDQHRPATPAERIPVYQIEVETK"
     CDS             complement(216564..217481)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707778.1"
                     /locus_tag="NUITMVA1_01910"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BDC80248.1"
                     /transl_table=11
                     /translation="MHMSTPDLNLLITLDALLDEGSVAGAARRLGLSPSAMSRALARL
                     RETTGDPLLVRAGRCLVPTPRALLLREQVGRLVQEAEEVLRPRLEVDPARLERTFTLR
                     ASEGLVELFGAALLNRLAAEAPGVRLHFLAKPDKESGPLRSGELDFETGVISATTAPE
                     LRTQALFQDHFVAVLRPGHPLCDGPLTASHYAEARHVLVSRRGQPHSPVDEALAKLGL
                     TRTVSTLVPGFATALALVRGSDLVATVPEHHCAALLGDLVVRPLPFTLPGIRVALLWH
                     PRLDADPAHRWLRTLIRDICAQPPYRPLP"
     CDS             217644..219068
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707777.1"
                     /locus_tag="NUITMVA1_01920"
                     /product="MFS transporter"
                     /protein_id="BDC80249.1"
                     /transl_table=11
                     /translation="MSPFTHVLPPAARRLGLLALGLATLLPMLAGSMTSMLLPALGAD
                     FAVPFASLQWVLVAYLLGLTCLTVVAGRLGDRFGRRRLLLWGMGLFVLASLLCALAPT
                     IGWLLAARVLQGAGAACMLVLSLAMVGQLVSPTRRGRVMGLLGTLSACGTALGPSFGG
                     LLLDIAGWQPAFLALLPIGLLALVCGLFGLPRDAACTEGERLNLASLSLLLLALLCCG
                     LALTSTGALALWLGGGALLATAWLVRSELGAAVPLLPLALLGTRRLRGGLAASALVAG
                     IMVLTLLIGPFYLQGAFGLDPLTSGLLISGGPLLAALTGLPAGWLVDRVGAITVVRLG
                     LLLMSGAAALLAVLSPALGPLGYLLPILLLTAGYALFQTANNSAVMGGSGGQARGAVA
                     GLLTLARNLGQLTGAAGLGALFAGLAGGGDPAVASASELHFAMQASFALGGVLLLAAL
                     WLAGRDLCSTPGGTIRAGCESGGG"
     CDS             complement(219211..220539)
                     /codon_start=1
                     /gene="hslU"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQI8"
                     /locus_tag="NUITMVA1_01930"
                     /product="ATP-dependent protease ATPase subunit HslU"
                     /protein_id="BDC80250.1"
                     /transl_table=11
                     /translation="MSEMTPREIVHELDRHIIGQADAKRAVAVALRNRWRRMQLDEEM
                     RHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRD
                     LTDAAIKLVRETEMEKMKYRAEEAAEERILDALLPNPRNSWGEEEKADNSNTRQIFRK
                     KLREGQLDDKEIELELSASPMGVEIMTPPGMEEMANQLQGLFQNLGQNQKKKRKIKVK
                     EAMKALIEEEAARLVNPEELKQKAIAAVENNGIVFLDEIDKICKRGESSGPDVSREGV
                     QRDLLPLVEGCTVNTKHGMVKTDHILFVASGAFQIAKPSDLIPELQGRLPIRVELTAL
                     TTDDFERILTEPNASLTDQYQALMATEGVKIEFTKDGIRRLAEAAWQVNERTENIGAR
                     RLHTVMERLMEDISYDASEKSGETFVIDTDYVNAHLGKLIEDEDLSRFIL"
     CDS             complement(220632..221165)
                     /codon_start=1
                     /gene="hslV"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQI7"
                     /locus_tag="NUITMVA1_01940"
                     /product="ATP-dependent protease subunit HslV"
                     /protein_id="BDC80251.1"
                     /transl_table=11
                     /translation="MTTIVSVRRNGQVVIGGDGQVSLGNTVMKGNARKVHRLYNGKVL
                     AGFAGGTADAFTLLERFEAKLQAHQGNLERAAVALAKDWRTDRALRRLEALLAVADEH
                     KSFIITGNGDVVQPEHDLIAIGSGGNFAQSAAIALLENTELDAKSIVEKSLKIAGDIC
                     VFTNGNHTIEVLDYSAK"
     CDS             complement(221353..222192)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707775.1"
                     /locus_tag="NUITMVA1_01950"
                     /product="cell division protein"
                     /protein_id="BDC80252.1"
                     /transl_table=11
                     /translation="MATRDYVGSRPRRRAGGRNTKKAAPRRFPVIPALLAGALLAGFG
                     GFLYTISGKGHDAPTIEEQVKANKPKAQNNGLPQEKWSYIERLENKQVDITEPPPQPG
                     VLPPPPAETMTLQPEKLPQPVPTDIPQPGTPIGQVQPYKPQPVQPAKPATGAPVASAQ
                     EQVIDRKAERDRMERELRAELERERAEAAKAKAATPPATADNERYMMQCAALRSQDSA
                     ESLKARIAFTAGLSSSLQVVNGAGGAVYKVMVGPFSGKAAADAANRKLQGSGISGCIP
                     KKG"
     CDS             complement(222196..223941)
                     /codon_start=1
                     /gene="argS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQI5"
                     /locus_tag="NUITMVA1_01960"
                     /product="arginine--tRNA ligase"
                     /protein_id="BDC80253.1"
                     /transl_table=11
                     /translation="MKEHIHHLLEQTVANLKSAGVLPADLEARVQVDRCKEKAHGDLA
                     TNLAMLLAKPARKNPRELAAAIIEHLPASDLIAKVEIAGPGFINFFFDPSWLAGQVEA
                     MVASANANVKLPAPQTVVVDYSAPNVAKEMAVHHIRSTVLGDVAARALEFLGHKVVRA
                     NHIGDWGTQFGMLIAYLEKMANEHASDMELRDLEAFYTQAKRHYDEDEAFAERARNYV
                     VKLQGGDEYCRTMWKKLVDMTMEQNQRNYDRLNVSLTNKDIMGESMYNDMLPEIVADL
                     KARGLAVESEGATVVFLDEYKNKDGEPMGVIIQKSDGGFLYTTTDIACAKYRYETLGA
                     DRVMYFIDSRQHQHLMQAWTITRKAGYVPESVPLEHHAFGMMLGKDGRPYKTRSGGTV
                     KLVELLNEAEERASALLESRNSDLSAEEKAQVVHAIAMGAVKYADLSKNRTTDYIFDW
                     DLMLSFEGNTAPYLQYAYTRIQSIFRKAGVDADTLSGHVILNEEAEEVLAQKLIQFSD
                     AVNGVADKGMPHLLCTYLYELSGNFMTFYEACPINKDGVDEATRQSRLLLCAATAKVL
                     KLGLGVLGIHTLERM"
     CDS             224255..224821
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707773.1"
                     /locus_tag="NUITMVA1_01970"
                     /product="ATP-dependent protease"
                     /protein_id="BDC80254.1"
                     /transl_table=11
                     /translation="MKLALFPLSAHLLPGGIMPLRIFEPRYQRMIAQAGDQGFALCML
                     DPRQPDALRNMYPIATRVRIVDFDQLPDGLLGITVLGMERVRITDLWQEADGLRLGEV
                     EQLPAWRTGRLNADQHSLARALQEVFEDYPEYAALYRNPDWGDASWVAQRWLEVLPIP
                     VEQKQWLVAAEDNQPALSLLSGLLVASH"
     CDS             224954..225523
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707772.1"
                     /locus_tag="NUITMVA1_01980"
                     /product="RNA polymerase sigma factor"
                     /protein_id="BDC80255.1"
                     /transl_table=11
                     /translation="MDDPAGDLKSLLVRVAEHGDKAAFTTLFQHFAPRIRSYGLRHLG
                     SEANAMELVQETMLLVWQKAWLYHPDKGAATTWIYTVMRNQGFDMLRRRRASKEELCA
                     EELWPMLEFRAEEEHLSGGEDAVLTRQMAHYVGTLPEPQQQVVRGIYLQELSQQELAD
                     RLGVPLGTIKSRLRLALQKLKEQVEQGHD"
     CDS             225516..226181
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707771.1"
                     /locus_tag="NUITMVA1_01990"
                     /product="transcriptional regulator"
                     /protein_id="BDC80256.1"
                     /transl_table=11
                     /translation="MIKAHPVQAMLRAFAADELPLPLAVGVSAHCELCPDCAARLRAC
                     EEELARQYLAPAEECEPLPAAFDAMLAGILQQPVVSAAALSQSASVQPELQVAGQSYR
                     LPRVLARHHAPSWRHIGAIRQVSLPLNEQGARASLLHIEAGGRIPEHTHKGYELTLLL
                     AGTIEDGDTRYQAGDFIWRDASHAHSPHTPDGCLCYTVQDAPVQFTKGLSRLLNGISH
                     RLY"
     CDS             complement(226243..227058)
                     /codon_start=1
                     /gene="uppP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQI1"
                     /locus_tag="NUITMVA1_02000"
                     /product="undecaprenyl-diphosphatase"
                     /protein_id="BDC80257.1"
                     /transl_table=11
                     /translation="MTESYALFVAFVLGIVEGLTEFLPVSSTGHMIIVGHLLGFDGPK
                     AATFEVVIQMGSILAVVAVFWRRLFGLIGIHFGQKPAQGHATLSLVHIILGMLPAVII
                     GLAIHSWIKANLFGPQTVMYALVAGGILLIIAEKFRPAVRSETLDDISYKQALGIGLF
                     QCLALWPGFSRSGATISGGMLMGISRQAAAEFSFILAVPMMVAASGLDLYKSRDLLSM
                     ADFPMFAVGFITAFVVAMIAIKTFLALIRRLDFIPFAIYRFVVAFAVYLVFVA"
     CDS             complement(227251..228261)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707769.1"
                     /locus_tag="NUITMVA1_02010"
                     /product="glyceraldehyde 3-phosphate reductase"
                     /protein_id="BDC80258.1"
                     /transl_table=11
                     /translation="MDDHYLAAPDRYQRQPYRPAGRHGLRLPGIGLGLWHNFGAECDP
                     ATAKAMVHQAFDLGITHFDLANNYGPPPGSAELTFGKLLKGSLAPYRDELIIASKAGY
                     IMWDGPYGDGGSAKYLFASLHQSLRRLGLDYVDIFYHHRPDPRTPLEETCQALALMVR
                     QGKALYIGLSNYPAPLAAQAAARLAELGTPCLVNQLKYSLFQRDIEPETLPVCREHGM
                     GVVAFSPLAGGLLSDRYLAGIPADSRAASASPFLKPEQITAGKLATIRALHALAQQRG
                     QPLSQLALQWVLRDSVVSCALIGASSPQQIVSAVEAQAQPPLDAALLQQIEGILASQG
                     TA"
     CDS             complement(228447..229427)
                     /codon_start=1
                     /gene="galM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQH9"
                     /locus_tag="NUITMVA1_02020"
                     /product="aldose 1-epimerase"
                     /protein_id="BDC80259.1"
                     /transl_table=11
                     /translation="MIPFELENEEGLRLRGLDFGATLTSLTLPVAGGRREVLLGCADE
                     AYPAQQVWLGAVAGRFANRIGNAELLRDGQRWPLDANQSPHCLHGGRVGFHRQHWQIK
                     EREADRVRLTLLSRAGDQGFPGNLRVTLEYRLEQCDLVVDFVASTDAATPVSLTSHTY
                     FNLDGQATDGDVRDHLIRLNADRFLPTDPSGLPLAIAPVEGPFDLRHERLIGQDWLSH
                     PQQQQAKGYDHAFVLNGPSAEWAARVVSGDRQLAMEVYTNQPSLQFYTGNWLANTPAR
                     DGRLHQDHAGFCLEAQQLPDSPNRPELGDPWLLPGQTYRHQTRYRFIAAS"
     CDS             complement(229504..230652)
                     /codon_start=1
                     /gene="galK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQH8"
                     /locus_tag="NUITMVA1_02030"
                     /product="galactokinase"
                     /protein_id="BDC80260.1"
                     /transl_table=11
                     /translation="MTPSQRVSAVFAEQFEQQPDLLVRAPGRVNLIGEHTDYNDGFVL
                     PCAIDYETCVAIGLRDDSLVHVIAADYGNQRDLFDLDQPIGHHADQRWSDYIRGVVKY
                     LQERGYPLRGLNLVVSGNVPQGAGLSSSASLEVAIGQAFKEALGLAITQAEIALNGQQ
                     AENQFVGCNCGIMDQMISASGKQDHALLLDCRSLETRLIPMPTDLAVLIVNSNVRRGL
                     VDSEYNTRRQQCEAAARHYGVKALRDLDLAALEAGKAGLDEVCYRRARHVVGDNSRTL
                     AAADALAQGDLVRLGELMADSHAAMRDDFEITVPAIDGLVEIIKARIGTEGGVRMTGG
                     GFGGCVVALLHPDKVAEVIAAVDAEYPARFGLKADSYVCRASAGAGKL"
     CDS             complement(230649..231707)
                     /codon_start=1
                     /gene="galT"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQH7"
                     /locus_tag="NUITMVA1_02040"
                     /product="galactose-1-phosphate uridylyltransferase"
                     /protein_id="BDC80261.1"
                     /transl_table=11
                     /translation="MFNPVDHPHRRFNPLTGQYVLVSPHRAKRPWQGQVEKVSQAPSQ
                     AHDPDCFLCAGNKRVTGDQNPDYRDTFVFTNDFAALMQDTPAASGEQDPLLKLEAARG
                     TSRVICFSPDHGKTLPELPLPAIEQVITTWMEQVAELSAQWEWVQVFENKGAVMGCSN
                     PHPHGQLWGSDFLPNEIAREEQHQRDWLAEHGRPLLVDYVERELQDRSRIVVETAHWL
                     AVVPFWAAWPFETLLLPKRHVPSLLDLTPELQQDLAIALKELTSRYDNLFECSFPYSM
                     GWHFAPPRSDCPEAWQLHAHFYPPLLRSATVRKFMVGFEMLAETQRDLTPEQAAERLR
                     ALSPIHYNQTNQANEEAL"
     CDS             complement(231815..232828)
                     /codon_start=1
                     /gene="galE-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707765.1"
                     /locus_tag="NUITMVA1_02050"
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="BDC80262.1"
                     /transl_table=11
                     /translation="MKVLVTGGCGYIGSHTCLALQAAGMEPVVVDNLCNSKAGVLARI
                     AAISGREPRFYQGDIRDPALLDRIFSEQRIDAVIHFAALKAVGESTRLPLAYYENNLS
                     GTLVLLQAMKRAGVHNLVFSSSATVYGDPASTPIREDFPRSATNPYGRSKLIIEEILE
                     DLQRAEPHWSMTLLRYFNPVGAHESGTMGEDPQGIPNNLMPFLTQVAIGRRDCLSIFG
                     NDYPTVDGTGVRDYIHVMDLAEGHVKALQHCASKGGVHVYNLGTGQGQSVLQMVTAFE
                     TASGRPLPYRIEPRRPGDIAECWADPAKAERELGWRARRDLAAMCADSWRWQSANPQG
                     YEA"
     CDS             233033..234037
                     /codon_start=1
                     /gene="galR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707764.1"
                     /locus_tag="NUITMVA1_02060"
                     /product="transcriptional regulator"
                     /protein_id="BDC80263.1"
                     /transl_table=11
                     /translation="MSTIKDVARLANVSVATVSRVMNNSPKASAASREVVQKAMAELG
                     YTPNANARALVSQTCDTMGVLVGDVADPFFGALVKGVAAVAVEQGLHLLMGNGFHKAR
                     QERESIELLIGKRCEALVVHSKALSDEELIDYALRVPGMVLINRDIPALKGRCIALNN
                     RQGAATATRHLLELGHRHIAFLSSDHAIEDAILRLQGYQDALAEAGLRADPELVESGM
                     PNEEGGERAMLNLLAKGLPITAVVAYNDAMAAGAISVLADNGLKVPEEVSVVGFDDII
                     YARYLRPKLSTMRYPVELMAAQAAKLALQLAAGESEAVQSRIYTPTLINRHSVAPVRS
                     "
     CDS             234256..237330
                     /codon_start=1
                     /gene="lacZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQH4"
                     /locus_tag="NUITMVA1_02070"
                     /product="beta-galactosidase"
                     /protein_id="BDC80264.1"
                     /transl_table=11
                     /translation="MLREIVARQDWQTQAITAVNRLSAHTPLFSWRSEAAARDDLASP
                     SRTLLDGEWCFSFFAAPELVPEHWLVEDLPDACAIKVPGNWQLDAAYPGLRPATDVPI
                     YTNIKYPFPCDPPRVPAENPTGCYSREFSVPADWLASGQTRIIFDGVDSAFHLFCNGR
                     WVGYSQDSRLPAEFDLTSFLCGGDNRLAVLVLRWSDGSYLEDQDMWRMSGIFRSVSLL
                     HKPARHLVDIRVTPELDACYRDGRLKIALQAANGAGLSVAACLYDGVERVATLRQPIG
                     TQAIDEKGAYDDRAECWLEVAAPRKWSAETPHLYRLTLTLLDEQGEPIESEACDVGFR
                     AVEIRGGLLRVNGQPLLIRGANRHEHDAANGHVVTPAAIEQDLLLMKRHNFNAVRCSH
                     YPNHPELYRLCDRLGLYVVDEANLETHGMTPMGRLARDPAWSNAFLERVTRMVARDFN
                     HPSIIIWSLGNESGYGPAHDAMYGWVKRADPSRPVQYEGGGADTPATDIICPMYARTH
                     QDQPFPAVPKWALAKWIGLPGETRPLILCEYAHAMGNSLGGYAHYWQAFRDHPRLQGG
                     FVWDWVDQGLDKLTDDGRHFWAYGGDFGDTPNDRQFCCNGLVFPDRTPHPALFEAKRA
                     QQPFGLRLLERQPLTVEIRSEYLFRETDNERLQWRLCEDGVVVSQGECPLTLAPQGSM
                     TLTLLERLPAFAPGALAWLELAIVQPAATPWSVAGHEVARQQCMLPAPLALPVARTPA
                     TFIELADGWQIRAAASEWRLDKASGRVHSWCKLGREQLKEAIADHFYRAPLDNDIGTS
                     EADHADPNAWIARWQEAGLNELQHRCLDMVVSPDQGVVTVRHGYFVGDTLKLLTRWRH
                     EFDQDGAMRLAIEVQVAAEMPSLPRIGARLWLADEVLAAGEVSWLGRGPHENYPDRLL
                     AADLGRWQSSLDALHTAYVFPTDNGLRCDTRQLQLGSVEVEGLFHFSLSRFSQQQLAQ
                     ARHQTDLVTEGGLHLCLDGFHMGIGGDDSWSQSVRPEYWLQPGGYYWNCVLR"
     CDS             237565..238551
                     /codon_start=1
                     /gene="mglB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707762.1"
                     /locus_tag="NUITMVA1_02080"
                     /product="galactose ABC transporter substrate-binding
                     protein"
                     /protein_id="BDC80265.1"
                     /transl_table=11
                     /translation="MKKITTIAAVLMSLMAGATAHAETRIGVTVYKYDDNFMAVVRKA
                     IEKEAAANPGVELLMNDSQNDQSKQNDQVDVLLAKGVKALAINLVDPAAAPVVIEKAR
                     GEDVPVVFYNKEPSAADLASYDKAYYVGTDSKESGIIQGQLIAKHWKANPAWDLNKDG
                     VIQFVLLKGEPGHPDAEARTTYVIKTLNDGGIKTEQLHMDTGMWDTAMAKDKMDAWIS
                     GPNANKIEVVIANNDGMAMGAVESLKAQGKTAIPVFGVDALPEALALVKSGAMAGTVL
                     NDAANQAKATYELTKNLAEGKAAGEGTKWNIVNKVVRVPYVGVDADNLSKFE"
     CDS             238651..240126
                     /codon_start=1
                     /gene="mglA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQH2"
                     /locus_tag="NUITMVA1_02090"
                     /product="galactose/methyl galactoside import ATP-binding
                     protein MglA"
                     /protein_id="BDC80266.1"
                     /transl_table=11
                     /translation="MIDVSKSFPGVKALDNVNLRVRPHSVHALMGENGAGKSTLLKCL
                     FGIYEKDQGKIFFKGQEINFTSSKEALENGVSMVHQELNLVLQRSVMDNMWLGRYPTK
                     GLFVDHSKMYQDTKHIFDELDIDIDPRVKVGTLSVSQMQMIEIAKAFSYDAKIVIMDE
                     PTSSLTEKEVSHLFKIINKLKEKGCGIVYISHKMEEIFQLCDEITILRDGQWVATQPL
                     KGMTMDQIIGMMVGRELTQRFPEKTNQPKEVILEVEHLTAKNQPSIQDITFNLHKGEI
                     LGIAGLVGAKRTDIVETLFGIRDRSEGVIKLHGQPVANHNAHEAIRNGFALVTEERRS
                     TGIYSRLDIAFNSLIANMDNYKGSMGLLSDNKMKSDTQWVIDSMRVKTPTQQTQIGSL
                     SGGNQQKVIIGRWLLTQPEILMLDEPTRGIDVGAKFEIYQLILELAKKDKGIIIISSE
                     MPELLGITDRIMVMSNGRVAGIVNTKETDQSEILRLASLYL"
     CDS             240143..241153
                     /codon_start=1
                     /gene="mglC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707760.1"
                     /locus_tag="NUITMVA1_02100"
                     /product="galactoside ABC transporter permease MglC"
                     /protein_id="BDC80267.1"
                     /transl_table=11
                     /translation="MESAKNFNLMRALKENGIYVVLLVLLMIIVIKEPSFLSLTNFSN
                     ILTQSSVRVIIALGVAGIIITQGTDLSAGRQVGLAALIAATMLQALTNVNKVFPSLGE
                     VPIPAVILLVCVVGALIGLVNGLIVAYLNVTPFITTLGTMIIVYGINSLYFDSVGASP
                     VAGFDPRFSSFAQGFIKLGGFKLSYLTFYAAIASVFVWVLWNKTRFGKNIFAIGGNPE
                     AAKVSGVNVAVNLVMIYALAGVFYAFGGMLEAGRIGSATNNLGFMYELDAIAACVVGG
                     VSFAGGVGTVAGVITGVLIFTLINYGLTYIGVSPYWQFIIKGGIIILAVALDSMKYAK
                     KK"
     CDS             241205..242938
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707759.1"
                     /locus_tag="NUITMVA1_02110"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BDC80268.1"
                     /transl_table=11
                     /translation="MPFKVKIYVLLLLAILVTIGTAWFSVNHFISAYIRTQATQNINE
                     QISLVKEKLASDINQKILLAANLNFGVTNVKKTLEETGFHNIVKVIGDMAFDVSGVIN
                     DTAKVDALRKLIPAANNQITVSPLQQVDGKPVISILVPRGADSAYLYYLDMSEFKNLL
                     EKVSGEGRYFSLADGQGNVLYSSKPQGENEARPNPLDIRGSSWTLTGYIDLDYIRTMT
                     QALNGQIIMALLGVAVVVMVLAVLALNLAYRPILSLRDLVLELSRGSGDLTRRLAVTS
                     TDDLGQISAGINRFIERLQEMMNEVRQASGQLNSGIEGLASQTGAAQSLLADHVRETE
                     QVVTAINEMSRTAVSVSESAASTAQLTGQSQQLASQSRQVVDQAMASVMALVDEVEAT
                     ARSIEAMQQDVQQIGSVLGVIGSIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRS
                     LAARTQQSTAEIQTMLASLQRGTQTVVDAMSNTKQSCQGAAENTTRVNESLDLMAGEV
                     VEINDLISHIATAAEQQSAVAEEINRNMSAIAEVIRQLTHNGEETVASSAAMQQTYDR
                     LREIVGHFRLE"
     CDS             complement(243539..243907)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707758.1"
                     /locus_tag="NUITMVA1_02120"
                     /product="CopG family transcriptional regulator"
                     /protein_id="BDC80269.1"
                     /transl_table=11
                     /translation="MGLADLKKKHNLHHQKKFTIDEFIEDADFYAKGKPKVVSLELNL
                     HREEALTALAFIENGEHLKPSYKKATFSLSTTAIDELGSLTQQDGMNKSLLLRMFTHY
                     FSSLSPEERQTIYERLQEHN"
     CDS             complement(243909..244556)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707757.1"
                     /locus_tag="NUITMVA1_02130"
                     /product="chromosome partitioning protein ParA"
                     /protein_id="BDC80270.1"
                     /transl_table=11
                     /translation="MILLVGGEKGGSGKSCLAQNLAVYLRTQFHGEVLLVDCDPQRTT
                     SDWIQERNDNPDLPQINCVQLYGNIRNDLLSLKNRYDYLIVDCGGQDNRALRSTMAVA
                     THALIPLRPKRRDLKTLPHMEDLITTCKMVNPSLRAAVVLTQCPALPNQVKRILEAKE
                     VCSSFGVDVLNSITYGRNVYDDSEEKGLSVMEIEPDGKSAEEIRAIAKEFLELGV"
     CDS             complement(244657..244833)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_02140"
                     /product="hypothetical protein"
                     /protein_id="BDC80271.1"
                     /transl_table=11
                     /translation="MKIKSLLLFSSLLLPMTPALVSAEGAPAMPLVVCQVDKAPQMLV
                     PAYVCQWYGGSQHY"
     CDS             245579..246799
                     /codon_start=1
                     /gene="arcA-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQG6"
                     /locus_tag="NUITMVA1_02150"
                     /product="arginine deiminase"
                     /protein_id="BDC80272.1"
                     /transl_table=11
                     /translation="MSKFYVGSEVGQLRRVMLHRPNLSLKRLTPSNCQDLLFDDVLSV
                     ERAGQEHDKFAQVLRDQNVEVFLLTNLLAETLDVPEAKTWLLQHQVSDYRLGTSFAND
                     VRCFLADMPHRELARILSGGLTYSEMPYSGVNMVVGMHAPTDFIIEPLPNHLFTRDTS
                     CWVYGGVSINPMAKAARRRETNHVKAIYRWHPQFAGQDFIKYFGDEDRDYDNSTIEGG
                     DVLVIGRGSVLIGMSERTTPQGVEHLARGLFKHGQAKQVIAMQLPKHRSCMHLDTVMT
                     HMDIDTFSVYPEVIRKDVNCWSLTPGGATGMNIKEEGYFVTAIEKALGVDQLKLITTG
                     GDTFEAEREQWNDANNVLTVRPGVVVGYERNTYTNEKYDKAGITVLPIPGEELGRGRG
                     GARCMSCPMERDGI"
     CDS             246863..247789
                     /codon_start=1
                     /gene="arcC-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQG5"
                     /locus_tag="NUITMVA1_02160"
                     /product="carbamate kinase"
                     /protein_id="BDC80273.1"
                     /transl_table=11
                     /translation="MKKPTVVVALGGNALLRRGEPLEADIQRKNIATAAKTIALIAQE
                     YNVVLVHGNGPQVGLLALQNSAYTKVSPYPLDVLGAESQGMIGYMLIQELKNLMPSRN
                     VTALLTQVQVDPKDPAFANPTKFIGPVYEEAEARTLAEEKHWVVKADGKFFRRVVPSP
                     LPQRIVEGDAIETLIAQGHLIICTGGGGIPVTWDGQSLTGIEAVIDKDMSAAYLAKQI
                     KADALLILTDADAVYLDWGKPTQRPLRITSPDELAGVKFDAGSMGPKVEASCEFVKAT
                     GGMVGIGSLEDGLAILKGEAGTNIVATRTVNA"
     CDS             247891..248895
                     /codon_start=1
                     /gene="argF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQG4"
                     /locus_tag="NUITMVA1_02170"
                     /product="ornithine carbamoyltransferase"
                     /protein_id="BDC80274.1"
                     /transl_table=11
                     /translation="MAFNLRNRNFLKLLDFTPREIQYMIDLAIDLKKAKYGGYERKHL
                     TGKNIALIFEKTSTRTRCAFEVAAFDQGAQVSYLGPSGSQIGHKESMKDTARVLGRMY
                     DGIEYRGYGQEIVEELGAYAGVPVWNGLTNEFHPTQILADFMTMLEHGKGKRLDQIKF
                     AYLGDARNNMGNSLMVGAAKMGMDIRLVAPKAFWPEEDLVAKCRLIAEETGARITLTE
                     DVKEGVLGADFLYTDVWVSMGEAKEAWDQRVKLMTPYQVNMDVINATKNPDVKFMHCL
                     PAFHNDETTMGKEVADKYGMKGLEVTEDVFESEHSIVFDEAENRMHTIKAVMVATLGD
                     "
     CDS             249019..250422
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707752.1"
                     /locus_tag="NUITMVA1_02180"
                     /product="transporter"
                     /protein_id="BDC80275.1"
                     /transl_table=11
                     /translation="MTKFKFPSAYTILFVLIALVAALSWIVPAGKYEMTMNEALGKEV
                     PVAGTYKLVEGNPQGIVDVLLAPIDGLYNHDTYQAGAIDVSLFILIIGGFLGIVTKTG
                     AIDAGIERVTDRLRGREEWMIPILMALFAAGGTIYGMAEESLPFYTLLVPVMMAARFD
                     PVVAAATVLLGAGIGTLGSTINPFATVIAANAAGISFTDGIWLRVAMLVAGWLLCVAY
                     VMRYAKMVRNDPSKSLVADKWEENRAHFLGNKSDQMLEFTLTRKIVLGIFVAAFAVMI
                     YGVAVLGWWMAQISGVFLAAAIIVGVISRMSEEELTSNFIDGARDLLGVALIIGIARG
                     IVVVMDNGMITHTILHSAEGIVTGLSTVVFINVMFVLEVVLSFLVPSSSGLAVLTMPI
                     MAPLADFANVGRELVVTAYQSASGLVNLVTPTSAVVMGGLAIAKVPYVRWLKWVAPLL
                     GLLTVLIVVCLSLGAVL"
     CDS             complement(250595..251086)
                     /codon_start=1
                     /gene="argR_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQG2"
                     /locus_tag="NUITMVA1_02190"
                     /product="arginine repressor"
                     /protein_id="BDC80276.1"
                     /transl_table=11
                     /translation="MVKTLSRPVEQEPDLAQLDACRQIIGQHCYSTQEEIRRELSERG
                     FADISQSTISRLLRRLGVAKAQNANGKKVYTLVDEQLEPAGSTRSIHDMVREVVHNQQ
                     MVLIHTTPGAATVVARLLDRNANPEIMGAVAGNDVVLVAPRHISRTRQAHAAVVRTLA
                     QAR"
     CDS             complement(251304..251768)
                     /codon_start=1
                     /gene="pyrI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQG1"
                     /locus_tag="NUITMVA1_02200"
                     /product="aspartate carbamoyltransferase regulatory chain"
                     /protein_id="BDC80277.1"
                     /transl_table=11
                     /translation="MSEKNQLQVEAIRHGSVIDHVPAGQGIKILKLFQLIETQERITV
                     GFNLKSGALGKKDLIKIENTRLTEQQANQLALFAPKATVNIIEDFAVVKKHQLELPEF
                     IAGVFHCPNSNCISHNEPVDSYFRVREVKGVVRMKCKYCEKSFTQDIVSERY"
     CDS             complement(251785..252705)
                     /codon_start=1
                     /gene="pyrB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQG0"
                     /locus_tag="NUITMVA1_02210"
                     /product="aspartate carbamoyltransferase"
                     /protein_id="BDC80278.1"
                     /transl_table=11
                     /translation="MTNPLYKKHVISISDLTRPDMELVVATAQRLKAEPDTRLLKDKL
                     VASCFFEASTRTRLSFETAVQRLGGNIIGFADGGNTSAKKGETLADSIKIIGSYTDAV
                     VMRHPKEGAARLASEFSRVPVINGGDGSNQHPTQTLLDLFSIHETQGKLDGLNVAFVG
                     DLKYGRTVHSLAQALSLFNCRFFFISPEALAMPDYICEELEEKGIQFSVHETMEEVMP
                     ELDILYMTRVQKERFDETEYKHMAAKFVLEVATLEGAKPTMKILHPLPRVDEIDVAVD
                     KTPHAYYFQQAENGVYARQALLALVLNETV"
     CDS             complement(252980..253522)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707748.1"
                     /locus_tag="NUITMVA1_02220"
                     /product="hypothetical protein"
                     /protein_id="BDC80279.1"
                     /transl_table=11
                     /translation="MLNYRLLQQLAPLNFRDESKTEALPDYLARVAPLVPFIPDNVLS
                     QWVYRHWRGFESNWSFIDLARHQFECESWPTARIIEQTGSRHMEVVERWGEMLRHNRY
                     VRRSWLGEYMLSQGTWSEPIIVLASAAGSSYPDGHPLPQPYCLLEGHHRLAYLRSMAE
                     DAQPLQAEHQVWVCRPVHDS"
     tRNA            253731..253807
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00090"
                     /product="tRNA-Trp"
     CDS             254100..255470
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707747.1"
                     /locus_tag="NUITMVA1_02230"
                     /product="phosphatidylserine decarboxylase"
                     /protein_id="BDC80280.1"
                     /transl_table=11
                     /translation="MNKAVETRLNKSRPGGWIPRDGAHIERWIRRIKHYVTQQPRALV
                     PPIAELRDLVHADPALHAQAEAMFKEAWRHKHLTPLGQPEVRSFEEFLGLLNGIMTTA
                     PEAYQDIPSHEPSGLIGFPINALLDWPMATQSGYHFFANALINQQFKKILDYWAQFLQ
                     SPASRYVLNEPVSRLDQETLVVPWLGKVAKAEMVKVANEAVGEGPNPTPGSFEQIFEC
                     EPAAEYHGFSCWDDFFTRRFRAGVRPVSAPTDDGVIVNACESAPLQVRKEVSRSDQFW
                     LKGQPYSLDNMLDFDDLAPRFEGGTVYQAFLSALSYHRWHSPVSGTIRKVRIVNGTYY
                     LENQFEGFADPQGADPSAPNNSQPFLTSVATRALIFIEADNPKIGLMCVVPVGMAEVS
                     SCEITVQAGDRVQKGDPLGMFHFGGSTHCLLFRPGVRLEFDFHGQIPGLDATNMRLNT
                     AIARVK"
     CDS             255721..257613
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707746.1"
                     /locus_tag="NUITMVA1_02240"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BDC80281.1"
                     /transl_table=11
                     /translation="MTLSLRGKLLATSLGVVLLMASLLGIVAFHTLKSRTMSAIQSEA
                     VNYGHAYSVAIGDWMADRKNTVHALVNLIADNPQAELVPHLKQAYTSGGFGLTYFGST
                     QGVMTRQDPSLNTGNYDPRERPWYQDAVKAGQLIVTAPYVSVTMQKLVVTLSEPVLHQ
                     GELVGAVGANLALDKLIDEVLAMQVQGEGYAMLLDSSGLIVGHPNKELALKQIGELSP
                     DLSAATFQQWGRENNELHAATLDGRDVLLAVQPVAGTDWLLAMVMYRDVLEAPLASLL
                     WQLVGLTLVLMLVFSALLTAMFKYLFADLGRVAGALHDIAHGEGDLTVHINTRSKDEV
                     GQLAESFNQFVARLHGIVSRLRDVTVELAAQSRAQAAGAQSRSQRVRQQQDEIVMVAT
                     AVTEMASATQEIAGNAEFAATTSGDAVKLAVAGQSQVGQSQRSITGLADEVADASQII
                     VELDAHAQKISGILATISGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRVLSRR
                     THDSTDEIQQMIETLQQTTRRAVSGMETSRQLAGTSVEDAESANLSLGQINEAIGAIS
                     DMATQIAAAAEEQTSVTSEISRNTENIRHVSQELAEQANQEAAQAAELKGLTERLEQE
                     IGRFRL"
     CDS             complement(257679..258191)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005175561.1"
                     /locus_tag="NUITMVA1_02250"
                     /product="hypothetical protein"
                     /protein_id="BDC80282.1"
                     /transl_table=11
                     /translation="MRALLCLLTACLLTACTGLADGIRPITGFQLDRYLGTWYEIARL
                     DHGFERGLEQVSATYSLRDDGGVKVLNRGKQSDGSWREAEGKAYFVDKPDEARLKVSF
                     FGPFYGGYNVIELDPDYQLSLVTSYNHDYLWILARSPNPPKEKVDALVAKAKSLGFAT
                     DQLIWVKQTH"
     CDS             complement(258209..259111)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707745.1"
                     /locus_tag="NUITMVA1_02260"
                     /product="AraC family transcriptional regulator"
                     /protein_id="BDC80283.1"
                     /transl_table=11
                     /translation="MQTRYTDLAAKLARHVTAPGITPSPVDQVSLIYTTEYHGRTPVL
                     YQPRMIVILQGHKVGYLADQVFRYDPNHYLLMTLPLPCECECFASPEQPLIGFSLEIN
                     LVTLQELLLELGDALPAPTPQKSGVHSVPLSEAMFCAAERLIDLMDKPHHARVLGPQT
                     VREMLFYALHEGGGPALQALANRHNHVGQIARVLRMIESRYADNLTMEELAREANMSV
                     SAFHHHFKAVTATSPLQYIKSFRLHKARMMMLHDGIKAGTAATRVGYESNSQFSREYK
                     RFFGSTPTDQASRFREGQLRIIEG"
     CDS             259258..260421
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707744.1"
                     /locus_tag="NUITMVA1_02270"
                     /product="alcohol dehydrogenase"
                     /protein_id="BDC80284.1"
                     /transl_table=11
                     /translation="MNNFTLHTPTKILFGKGQVAQLREQLPRDARILITYGGGSVVRS
                     GLLAQIRSELAGMTLFEFGGIEPNPTYETLMGAVELARAERVDFLLAVGGGSVLDGTK
                     FIAAAAHYDESRDPWHILETVGNEVRSAIPLGAVLTLPATGSEMNMGAVVTRRSSGDK
                     VHFFSPFVMPRFAVLDPVLTYTLPARQVANGVVDAFIHILEQYLTYPVNAKVQDRFAE
                     GLLLTLLEEGPKALVEPENYEVRANIMWSATLALNGLIGAGVPQDWATHMLGHEITAL
                     HGLDHAQTLAVVLPALLQAKRQQKHAKLLQYAERVWDLRSGSEAERIDGAIAATRDFF
                     ERMGVKTRLRDYGVADAGIDTLLGKLAEHGMTAIGEHGDIDLVQSQHIYEAAW"
     CDS             260929..262455
                     /codon_start=1
                     /gene="pntA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQF4"
                     /locus_tag="NUITMVA1_02280"
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="BDC80285.1"
                     /transl_table=11
                     /translation="MQIGIPRESLAGETRVAATPATVEQLKKLGFEVAIEAGAGLLAS
                     FDDAAFEAAGASVVPSVWQADLIFKVNAPTDAEIAQIKDGATLVSFIWPAQNPELVKK
                     LSARNINVMAMDMVPRISRAQSLDALSSMANIGGYRAVVEAAHQFGRFFTGQITAAGK
                     VPPAKVLVIGAGVAGLAAIGTAGSLGAIVRAFDTRLEVAEQIESMGGEFLKLDFGGED
                     GSSSDGYAKVMSEEFIAAEMALFAQQAKEVDIIITTALIPGKPAPKLITKEMVDSMKP
                     GSVIVDMAAQAGGNCEYTVPGELHVTGNGVKVIGYTDLPGRLPAQSSQLYGTNLVNLM
                     KLMCKEKDGNVAINFEDVVQRNMTVIQAGEVTFPPPAISVSAAPQKPAAAKPAAKKEA
                     AKPSNKKFVFGALGIAAFGWVAAVAPAAFLSHFTVFILACVVGYYVVWNVSHALHTPL
                     MSVTNAISGIIVVGALLQIGQGSTLVTALAFVAVLIASINIFGGFTVTQRMLKMFRKD
                     "
     CDS             262467..263951
                     /codon_start=1
                     /gene="pntB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQF3"
                     /locus_tag="NUITMVA1_02290"
                     /product="NAD(P) transhydrogenase subunit beta"
                     /protein_id="BDC80286.1"
                     /transl_table=11
                     /translation="MSQGLVTASYIVAAVLFILSLAGLSKQETAKHGNLFGIAGMAIA
                     LLATVFNPETSGVHWIILAMVIGGAIGVRLALKVEMTEMPELVAVLHSFVGMAAVLVG
                     FNSFIDLHPSAPAEVVVSVGSNLDATLAAARAAFEQAASVAQVEHLSGAMLNIHLVEI
                     FLGVFIGAVTFTGSVVAFGKLRGLISSKPLMLPHRHKLNLLAVVASLALMVYFVNAGG
                     STFALLVMTLIAFAFGWHLVASIGGADMPVVVSMLNSYSGWAAAAAGFMLSNDLLIVV
                     GALVGSSGAILSYIMCKAMNRSFISVIAGGFGSDGVASTADQEMGEYRETSAEDVADL
                     LKNSSSVIITPGYGMAVAQAQYPVAEITQKLRDRGVKVRFGIHPVAGRLPGHMNVLLA
                     EAKVPYDIVLEMDEINEDFSDTDTVLVIGANDTVNPAAMEDPGSPIAGMPVLEVWKAQ
                     NVIGFKRSMNTGYAGVQNPLFFKENTQMLFGDAKASVEAILKAL"
     CDS             264048..264800
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707741.1"
                     /locus_tag="NUITMVA1_02300"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BDC80287.1"
                     /transl_table=11
                     /translation="MVWRKGWILLCLWWGWAAQASEPPTLTLLTELWPPYVMRLDDGS
                     LGGADLELARTVLKRMGYRTTVKVLPWKRVLQEARFQRGDAIVDAFFEERRLEWLHYP
                     DEPLSQSGEVLFFPFARPVDFQGLASLKGLRIGTQADYAYGEEFLTSALFTRVAMTGE
                     SNMIKQLHLMMAGRLDGVVMNQMVGRYLLKGQGLQDQVGHSEKLVSESNRNFLAFTHR
                     PGNERLAYQFSLALKAFKQTPEYQSLLTRYGL"
     CDS             265127..266419
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQF1"
                     /locus_tag="NUITMVA1_02310"
                     /product="UPF0597 protein"
                     /protein_id="BDC80288.1"
                     /transl_table=11
                     /translation="MKAQWTDFITLLKREVVPALGCTEPMSVALAAANCRKLLGQVPT
                     RVSVWVSGNLFKNGMGVGVPGTGMIGLPVAAAVGITGGNPDAGLEVLKTLTPDQVEAA
                     KALLPAIKVDVKDVPDVLYAEVLAQVEGHSARVVICTDHTRIILMERDGEVLMAQDSA
                     PGVQIQAAPLSKPAMTLREIVEFALQVPLAEIDFIREAATMNQALADEGLQGYGLRIG
                     KILTEQVERKLLSDDLMTLAMRLSSAASDARMDGAMLPAMSNSGSGNQGIAATMPVVA
                     AARFLQASDEQLTRALVMSHLVAIYIKTYQNKLSALCAASTAAMGAGAAITWLLGGQF
                     EQISHCINNMIGDVSGIICDGAGSACSMKVSTSTSAAVKSSLMAINNLHVPQSEGIVS
                     DDVDETIANLGRLSKQGMLDTDIEIINIMRAKQQGKAE"
     CDS             266585..267985
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707739.1"
                     /locus_tag="NUITMVA1_02320"
                     /product="L-cystine transporter tcyP"
                     /protein_id="BDC80289.1"
                     /transl_table=11
                     /translation="MTLSVIGNLAILVMLLLFLYRLQQTHVSFTRRVFSGLGLGILFG
                     AALQLLYGAGSDVLVQTGDYLDIVGSGYVKLLQMIITPLIMVSIIGAILKLNGGTALG
                     KISAMTIGVLIFTTMIAAGAGILMSNLFGLTAEGLTAGAAETARGAALQTTLGSVESM
                     SFAKMVLEFIPANPFLDMTGARKTSTIAVVIFSIFIGLSATGIARKKPEIFASFSHFM
                     QVAHVIVMRMVTLVLRLTPYGVLALMTKVVSGSNYADILNLLSFVMASYGAIAIMFAV
                     HLLLVSLVGINPARYLKKIMPVLAFAFTSRTSAGSIPMNVQTQTKALGIPEGIANFAA
                     SFGSTIGQNGCAGIYPAMLAVMIAPTVGVNPMDPGFIMTLIAIITVSSFGVAGIGGGA
                     TFAALIVLSALDFPVALAGLLISIEPLIDMGRTALNVSGSITAGTVTSRLLGETDMAV
                     FNSEHEVCLDGEESTI"
     CDS             268079..269407
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707738.1"
                     /locus_tag="NUITMVA1_02330"
                     /product="CoA-disulfide reductase"
                     /protein_id="BDC80290.1"
                     /transl_table=11
                     /translation="MRIVIIGGEAAGMSAAAKARRLAKEAEIVVYEASEVISFGACGL
                     PYFVGDEFQEPGYMAEFTPAQFAAKGIEVKTGHRVLGLDATAQTLTVEHKGDTFTDRY
                     DRLMIATGAREVMPPIPGLQQEGVFGLRRMADGLALKAAVQDKANSRALVIGSGFIGL
                     EVVEALVHQGKEVRLIELAERVIPDAFDGEITQHIETELREQGVSLHLGERVDALLGE
                     GRVTGVRTSHGEYEADIVVVCTGVKPNTEFLADTGIERLGNGAIKVDRQGRSSLANVW
                     SAGDCASVWHAVKQQQVYVPLATIANKLGRMVGENLAGAEQEFPGTLGSAALKVLGLE
                     AGRTGLSEQEAKAMGIDYRTVVIKDKCHTNYCPGQSDIHVKLVYEAGSKRLLGGQILG
                     RKGAVHRIDALAVAITMGVTTEQLGMLDFAYAPPFSRTWDVLNVAGNVAK"
     CDS             complement(269548..270303)
                     /codon_start=1
                     /gene="bamD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQE8"
                     /locus_tag="NUITMVA1_02340"
                     /product="outer membrane protein assembly factor BamD"
                     /protein_id="BDC80291.1"
                     /transl_table=11
                     /translation="MGKKSHLLMSLALVATLITGCSSTKPKVPDEPPETLYQKARLKL
                     DAGNYLNAIELLEALDSRYPFGAYSNQVQLDLIYAYYKQDDTAQAIANIDRFIRLNPA
                     HKNIDYVFYMRGLTNMAGDYNFFQDFLGINRDDKDPSYARQAFQDFKTLLQNYPNSVY
                     AADARARMIGLKNRLARYDLSVAEYYVKRDALIAAANRAKLIVETYPDTAETEKALEI
                     MINSYDSLKMPTLAQHAREVLAKNYPDNRLGRG"
     CDS             270421..271401
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQE7"
                     /locus_tag="NUITMVA1_02350"
                     /product="pseudouridine synthase"
                     /protein_id="BDC80292.1"
                     /transl_table=11
                     /translation="MSQHIELTGEFQDHQFGQRLDQALAELFPDYSRTRIKEWILQDR
                     VTLDGQVANTPREKVLAGQKVHVDVELADDTRWDAQNIELNIVYEDEHILVIDKPAGL
                     VVHPGAGTPDGTILNALLHRYPAIAEVPRAGIVHRLDKDTTGLMVVAKTIPAQTHLVE
                     ALQARQITREYEAIAIGHMTAGGTVDAPIGRHPTQRTHMAVVPNGRESVTHYRVHEKF
                     RGHTRLRLRLETGRTHQIRVHMAHIKHPLVGDPAYGGRLRLLRNATPELTEALRGFHR
                     QALHATMLKLAHPITGEVMEWHSPTPQDMLDLMEVLRADTLANPDDLVWN"
     CDS             271587..272324
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQE6"
                     /locus_tag="NUITMVA1_02360"
                     /product="laccase domain protein"
                     /protein_id="BDC80293.1"
                     /transl_table=11
                     /translation="MKWIEPDWPAPAKVSALSTTRDGGISEGVFAGLNLGAHVGDEPA
                     RVEANRTRLQQAAGIPGTLNWLNQVHGTAVHPVSRDYGCAPDADAACAREAGQACIVM
                     TADCLPVLFCDRAGTVVAAAHAGWRGLQGGVLEASIAAMGCEPGEILAWLGPAIGPTA
                     FEVGGEVREAFMAEQAEAAAAFVPSPNEGRWLADIYQLARLRLARAGVTAVYGGEYCT
                     FSDSEQFYSYRRNGQTGRMASIIWLAE"
     CDS             complement(272360..272539)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_02370"
                     /product="hypothetical protein"
                     /protein_id="BDC80294.1"
                     /transl_table=11
                     /translation="MKDEARTDYFKGRGWLFFLQSGKQAGSPPGKLQGGERRQGASQI
                     IEAMRPVWPLRRHEQ"
     CDS             272598..275171
                     /codon_start=1
                     /gene="clpB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQE5"
                     /locus_tag="NUITMVA1_02380"
                     /product="chaperone protein ClpB"
                     /protein_id="BDC80295.1"
                     /transl_table=11
                     /translation="MRLDRLTSKFQIAISDAQSLALGRDHQFIEPVHLMTALVNQDGG
                     SIRPLLTLTGMDINSLRSRLGEELDRLPRVSGVEGDVQLSNGLGRLLNVCDKLAQQRK
                     DQFISSELFVLAALDEKGTLGELLRAQGLTKEKLEAAIDKVRGGKKVEDANAEENRQA
                     LEKYTIDLTERAEIGKLDPVIGRDDEIRRTIQVLQRRTKNNPVLIGAPGVGKTAIVEG
                     LAQRIINGEVPEGLKNKRVLSLDMGALVAGAKYRGEFEERLKAVLNDLAKEEGNVILF
                     IDELHTMVGAGKGEGAMDAGNMLKPALARGDLHCVGATTLDEYRQYIEKDAALERRFQ
                     KVLVEEPSVEDTIAILRGLKERYELHHHVQITDPAIVAAAQLSHRYIADRQLPDKAID
                     LIDEAAASIRLQIDSKPESLDRLERRIIQLKLEQQALMKEDDDASRKRLELINQEISE
                     KDREYNELDEVWKAEKAALAGTQHIKAALEQARQDLDVARRAGDLGRMSELQYGRIPE
                     LEKQLDLATQAEMQETSLLRNRVTDVEIADVLARWTGIPVARMLEGERDKLLRMEDQL
                     HSRVIGQEEAVEAVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKALAEFLFD
                     TQDAMVRIDMSEFMEKHSVARLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKA
                     HPDVFNILLQVLDDGRLTDGQGRTVDFRNSVVIMTSNLGSDLIQEHHSEKDYDEMKGM
                     LMEVLTRSFRPEFINRIDETVVFHPLGEEHIKSIARIQLKSLMGRLEAQGYEVEVSEA
                     LLEKLVHAGFDPVYGARPLKRAIQHKVENPLAQALLSGRIVPGKKLVLGADSNGLTMT
                     Q"
     CDS             275232..276056
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707733.1"
                     /locus_tag="NUITMVA1_02390"
                     /product="MBL fold hydrolase"
                     /protein_id="BDC80296.1"
                     /transl_table=11
                     /translation="MLKFSVLVDDDVHLPGCLPERGLALLLECDGLRVLFDSGRGRAL
                     CHNATVMGIDLASLTHVVLSHGHYDHVGGVGSLPAYPRPIPLIACPDVFCERGYFLSL
                     PFWRRNLYHLSGELARESLPAKGLLPHCSAEPVWLSDRLVFLGSIVRRDRAAPSLLGY
                     IVRGGRVEKDLISDDSALAYKSEQGLIVFIGCGHAGVENIVEWAKEVCGDERIHAVIG
                     GLHLKFSGPQRAVALGAYLREEAVDQLFACHCTGSRKAGLPRQRQIGAGFEHSFSA"
     CDS             complement(276267..277259)
                     /codon_start=1
                     /gene="asnA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQE2"
                     /locus_tag="NUITMVA1_02400"
                     /product="aspartate--ammonia ligase"
                     /protein_id="BDC80297.1"
                     /transl_table=11
                     /translation="MKQHYIRSQQQISFVKEMFSRQLAQQLGLMEVQAPILSRVGDGT
                     QDNLSGHENAVQVKVKTLPEHSYEVVHSLAKWKRQTLGRFGFGPGEGIYTHMKALRPD
                     EDRLTPIHSVYVDQWDWEKVMPSERRDLAYLQETVRGIWAAIKATERAVCAEHELTPF
                     LPAEIHFLHSEELLTRYPDLDAKGRERAIAKELGAVFLIGIGGALSHGERHDVRAPDY
                     DDWSSHSELGLAGLNGDILVWNPVLQDSFEISSMGIRVDAEALRRQLAITGDEDRLQY
                     DWHQDLLAARMPQTIGGGIGQSRLAMLLLQKEHIGQVQVGVWPAEMKAAVQGML"
     CDS             277413..277874
                     /codon_start=1
                     /gene="asnC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707730.1"
                     /locus_tag="NUITMVA1_02410"
                     /product="transcriptional regulator AsnC"
                     /protein_id="BDC80298.1"
                     /transl_table=11
                     /translation="MPENYRIDNLDQAILTALMENARIPYAELAKQLLVSPGTIHVRV
                     EKMKQAGIIEGTRVQVNPKKLGYDVCCFIGINLKSAKDYPSALAKLQALDEVVEAYYT
                     TGHYSIFMKVMTRSIDELQTVLIHKIQTIDEIQSTETLISLQNPILRDVKP"
     CDS             complement(278054..278818)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707729.1"
                     /locus_tag="NUITMVA1_02420"
                     /product="glutamine transporter substrate-binding protein"
                     /protein_id="BDC80299.1"
                     /transl_table=11
                     /translation="MRRFILLCLLFPLWLQAKELIIGGTLEPPLKFLDAQGVPHGLDV
                     DVVSTIFGKLRIPIRIELTDSGARLTRNAETGVYDLVMTHSYKPERERYLLYPQQAHL
                     RHSWHFFVRKADLLKIRYDTLSDLKPWRIGITKDFSYTPELTAALADPAYHFQEIPIN
                     QLQLRKLIAGRIDVVPMPLVTAFAQIKEEGLEGKLDYLPKPLKASPYYTVWTKAKADA
                     TTPALMAAYDAELLRMKRDGRLKAIYDHYGIPYIEP"
     CDS             278904..279440
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707728.1"
                     /locus_tag="NUITMVA1_02430"
                     /product="hypothetical protein"
                     /protein_id="BDC80300.1"
                     /transl_table=11
                     /translation="MANPEIESELDGIDRVSVCLYRLGLSLAALLLLCRGASLLLGQD
                     FLAPASWLVALAVASGVCGLCLHVYDKRIRFVLQGLGWGALLLSASGALDVLVLGAAL
                     ATLAGLAFKEQFCFAIPGIRAVPLLLPLLWLLELAGIGWAAALVALVCGLLLCLLSLA
                     KWRMPLHFDIGDKRRYQI"
     CDS             complement(279437..279841)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707727.1"
                     /locus_tag="NUITMVA1_02440"
                     /product="CBS domain-containing protein"
                     /protein_id="BDC80301.1"
                     /transl_table=11
                     /translation="MLQIRDHMSRSTHSLTPQLGLAEALDRLHDSGLSGLPVLDPQQR
                     LIGFLSEQDCIPSLLTGSYHCDTRTRVEDLMSRTPLSVSPDDSILDLARQMTEARPKV
                     YPVLEGNRVVGIISRRQVMQALNAQMKGCLPT"
     CDS             279962..280666
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707726.1"
                     /locus_tag="NUITMVA1_02450"
                     /product="pteridine reductase 1"
                     /protein_id="BDC80302.1"
                     /transl_table=11
                     /translation="MRALVTGCGRRLGFYLCEQLVAAGWQVTGSYRSERPELARLRAL
                     GVELVQADFAREEEVGTLIEALAVHQDLALVIHNASAFEPQAADPAAQLAQFDQFYRV
                     HMAAPFQLNRALAPQLAHNANAGIIHITDIYIHAPAPQFASYVATKAGAHSLAMSFAR
                     ELAPAVRVNTIEPGPILFLDEHGEAWRQQVLAKTPLAREGGLAPIWQAVQLLMQNDYM
                     TGASIRVDGGRGLAVI"
     CDS             complement(280670..281185)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707725.1"
                     /locus_tag="NUITMVA1_02460"
                     /product="7,8-dihydro-6-hydroxymethylpterin-
                     pyrophosphokina se"
                     /protein_id="BDC80303.1"
                     /transl_table=11
                     /translation="MFYLCSIGSNLDPHQHVSQAVGELLVHFGRLQLSSVIQTKPVGM
                     HSSHDFLNCLFVAESELAPHQLKAHFVAMELAHGRDRSDPRCKVLDRPLDIDILASSQ
                     SDDFSTARVDAYLDELLAELYGRGQVHDRKVTLPLHTRLMAGKVIEERQVGLAPIALQ
                     QEMATPAALLR"
     CDS             281506..282906
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707724.1"
                     /locus_tag="NUITMVA1_02470"
                     /product="sensor histidine kinase"
                     /protein_id="BDC80304.1"
                     /transl_table=11
                     /translation="MTKVRPRSLLQVVLMGFVLVLMPLGGMIWHDSQSLEHLSQLTSD
                     ELERAVRDTRRATLLTTQAIDLERTLRRYAVLGDERILASYQQQLASYRSLLAAHQSS
                     IPDAEAYTGLEQALAWLDSLQDLARAKAESNSPKFDEFNQVNQQLEIITRSQVDEHVS
                     RVRATIAALMTEIWWVSGFVAVLSLLLVLLFTYLIIHPVRQIESRILSLGAGVEPDKR
                     PVDGPAELVLLGERIVWLHDKLKELEQQKYQFLRHVSHELKTPLAVLREGADLLSEQL
                     VGPLTPDQQEICQMLEENSRRLQTLIERLLDFNRLSQQEVFTLTPVALAPLLSELSAE
                     YRLALESKQISVHLPTDPITLQAEPYRLRLILDNLFSNAVSYGASGGQIWIRAGQDGN
                     GSWLEVANEGPAIPLAERERIFEPFEQGSIVRQGLLKGSGMGLSIARESAMSLGGELV
                     LVEDEQADVCFRLTLK"
     CDS             282945..283430
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707723.1"
                     /locus_tag="NUITMVA1_02480"
                     /product="hypothetical protein"
                     /protein_id="BDC80305.1"
                     /transl_table=11
                     /translation="MSLLTGCSLLPARDPAASPDLALAKRMEFANKEMQVRLQYSDWL
                     LASHAQQRAQERQRLKGATDIESRVSLAMVNTHPSESVASRRAGLDKLKSLLPELGLD
                     AQAFLRSWIALGEELLARDSRRDDQSQEVQRLRRQIEQLSAIDDQLNQRKLNGNGEAL
                     K"
     CDS             283427..284707
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707722.1"
                     /locus_tag="NUITMVA1_02490"
                     /product="two-component system response regulator GlrR"
                     /protein_id="BDC80306.1"
                     /transl_table=11
                     /translation="MSRILLVDDDASLLKLMSMRLRSQGYEVDTADSAEGALDRLRQQ
                     RADLVLSDLRMAGMDGLALFERIQSQWLGLPVIIMTAHGTIPDAIQATRSGVFSFLTK
                     PIDKDELFATIEHALSLTRPKQRQDWQSLILTRNPQMEQLLIQAGSIAAMEVPVLIMG
                     PSGSGKGVMTQALHQASSRRDKPLHVINCAALPWAALDLQLFGEDGQSGLFEQAKGAT
                     LFLDEIGDLSESLQAKLLQVLQEYGQGTPEVRVISSSHQDLVAAMEEGRFREDLFYRL
                     NVANITLPPLSARSEDIPLLARQALDDYRSRHGDCAALGFSPEALALLAAAGWPGNVR
                     QLCSVVEQLASLCCSPVIGAAMVESALSGGSGGIPSFNEARAEFEKEYLIRLLRTTEG
                     NVTLAANMAGRNRTDFYKLLNRHGIEAANFKSKG"
     CDS             complement(284780..285262)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707721.1"
                     /locus_tag="NUITMVA1_02500"
                     /product="hypothetical protein"
                     /protein_id="BDC80307.1"
                     /transl_table=11
                     /translation="MSPLIAIAITTGILSAVWGWVAVTLGLISWVGFLGCTSYFASSG
                     GYKALLQTLLCNASGMLWALLLIHGDAWWGAGVAGYLMTGVVATLMCVQAKQQWLGYI
                     PGTFAGCCATFGAAGEWRLILPSLVIGALFGYLMKASGLWLSHKTQKTQATAGVTDPA
                     "
     CDS             285633..286634
                     /codon_start=1
                     /gene="msrP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQD0"
                     /locus_tag="NUITMVA1_02510"
                     /product="protein-methionine-sulfoxide reductase
                     catalytic subunit MsrP"
                     /protein_id="BDC80308.1"
                     /transl_table=11
                     /translation="MLLKRRSAHHLTEQDVTPEAVYQDRRLILKGLGLGAATLAFPTQ
                     AGVLDLFSGDKPAPVATRALNIHAATRPEGLILTPEEKATTHNNFYELGTDKGDPARN
                     GHYLKPEPWTLKVEGEVAKPFTLDVWDLINKSTLEERIYRLRCVEAWSMVLPWSGIAL
                     ADLIRRAEPTSRAKFVAFETLYDPEQLPGQASRSLGGGIDYPYVEGLRIDEAMHPLSF
                     LAMGLYGKALPAQNGAPIRLVVPWKYGFKSIKSIVSIRLVEEMPPTTWNLLAPNEYGF
                     YANVNPAVDHPRWSQASERFIGEGGIFGAKRQPTLPFNGYADEVASLYQGMDLRKWY"
     CDS             286654..287286
                     /codon_start=1
                     /gene="msrQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQC9"
                     /locus_tag="NUITMVA1_02520"
                     /product="protein-methionine-sulfoxide reductase
                     heme-binding subunit MsrQ"
                     /protein_id="BDC80309.1"
                     /transl_table=11
                     /translation="MTLRLTARHITLLRALVHLASLGFLLWLLVAVPGGLLGGDPVQG
                     LTHYLGKGALNLLLLTLLVSPLAKRWRQGQLIKLRRPLGLWCAAWAGLHFMVWLGLDL
                     QFDWGLIGGELVKRSYIVVGMVALLLLVLLSLTSIPALLRRMGPAWQKLHNWIYAVAL
                     LVPVHYWWSLKSGWQEPLIYLLLACALLVPRRDKLLRPWRRLRPQKLREA"
     CDS             complement(287331..287576)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010635834.1"
                     /locus_tag="NUITMVA1_02530"
                     /product="hypothetical protein"
                     /protein_id="BDC80310.1"
                     /transl_table=11
                     /translation="MNMIRRSFLLILCLFSTLGWAAESRLDMAGLVKLLVAQGYHDIR
                     EVELEGDKFEVETLDAQGQRVRLLVDAHTGDIKKEAD"
     CDS             287640..287972
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707718.1"
                     /locus_tag="NUITMVA1_02540"
                     /product="hypothetical protein"
                     /protein_id="BDC80311.1"
                     /transl_table=11
                     /translation="MNRALSLLGLLLPALAQAATPNEALLQQAVSEGRVRPFHEVMEV
                     ASRLPVRVLRVDLGEEDGIWLYELKLIDSENSVIKVGYRADNLEMVWLKGHHLERLFE
                     PRPPPEEE"
     CDS             288060..288716
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707717.1"
                     /locus_tag="NUITMVA1_02550"
                     /product="DNA-binding response regulator"
                     /protein_id="BDC80312.1"
                     /transl_table=11
                     /translation="MRILIVEDEKTLAGQLAEQLRLSGFVTDLCHDGNEAGFLGETEP
                     YDAIILDLGLPGRDGLSVLKEWRSKGIDTPVLVLTARGQLHEKIEGLNAGADDYLTKP
                     FQVAELVARVHALVRRAAGNASSILEIGGVRLDMAASQVWYEGTPIKLTAHEFRVLGY
                     LMQHRGKVVSRSELIDHIYAQDFDRDSNTVEVFIGRIRKKTHSDLIETVRGLGYRINE
                     "
     CDS             288754..290103
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005306363.1"
                     /locus_tag="NUITMVA1_02560"
                     /product="sensor histidine kinase"
                     /protein_id="BDC80313.1"
                     /transl_table=11
                     /translation="MRLVRTLRGRLVVIAMVWCGLFLFATGFSLQTMMRNYWQEAEAD
                     GLRLQLYDLLSRLEIQPDGLPVVTEPMADPRFRQPYSGYYWQLELGESVVSRSRSLWD
                     VHLDVHGLKSAFGDPDLFVGKGPNKEPLLIMTRTVLLPGSDRVFTLVMAKDSSALTQT
                     LKKTRISLFLGLGFAATGLVLGFMFQIVYGLRPLHLLRRELSRVHQGHQEGFRLRYPL
                     EIQPLVEDINRLLHHYGELLQRARSHTGNLAHALKTPLSIMRNQVAQLPPEDQAALGE
                     QLDQIQRHIDYHLGKARVTGAAKILGVSTPVRARVEYICRAFSRLYPGREVDLQVPAT
                     LAVGVEEQDFDEMVGNLLENAFKWSAGRLRISSAELGGWITLRIEDDGPGMSEDQIAK
                     AVLRGVRLDEKVPGSGLGLNIVSDLAEAYRGSLIMGRAELGGLAASLSLPKVARVES"
     CDS             290145..290606
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010635837.1"
                     /locus_tag="NUITMVA1_02570"
                     /product="hypothetical protein"
                     /protein_id="BDC80314.1"
                     /transl_table=11
                     /translation="MTDDPWALCHLDDSFDASVLGTKGAQIQWFEDRDSLIAFLLEDF
                     VDLLADVGELDEDQTERARERFTLLVEQSFDDRGLMDAINDLASGLRRIAWLGPLSEL
                     AELSDDFASGLRRYFWSQYDGDEDDPDAWVPEELWPQLVECAEEYMVEGDF"
     CDS             complement(290749..293229)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707716.1"
                     /locus_tag="NUITMVA1_02580"
                     /product="trimethylamine N-oxide reductase I catalytic
                     subunit"
                     /protein_id="BDC80315.1"
                     /transl_table=11
                     /translation="MTFFTDKQTNLSRRNLLKGLGACAALPLLAGVFPKSALAQAIST
                     ALEQFPTLVPAQKGILTGAHWGAFEAIVEEGRMVRVQPVADDPAPNDLIDMAPFQVHA
                     KNRIKYPMVRKSWLEQGPGAKPELRGADEWVRVSWEKAIALVAGEIGRVQRDFGPQAI
                     HAGSYGWKSVGMFHNSRTLLHRLMNLAGGFTGYAGDYSAGAAQVIMSHVMGSIEVYEQ
                     QTAWPNVIEHAELVVLWGVNAQVTLKNSWNMPDHEGQAGFKALKEKGTRIISIDPVYN
                     ETAKLAGAEWIAPNAYTDVAMMLGVAHTLYSEQKHDQAFLDRYTTGFDKFLAYLLGQE
                     DGQPKSAEWASTICGVDAKVIRQLALDMASKRTMIMAGWGMQRQQHGEQPNWMLVTLA
                     AMLGQIGLPGGGYGFSYHYSSGGSPTAKGGILAGISAGNAPKNGPAPIPVARIADCLA
                     NPGKTIDFNGRKVTYPDIKLVYVAGGNPFHHHQDTNNLVKAWRKPQTVIVHEPYWTAT
                     AKHADIVLPATTSYERNDLEMGGDYSQRYVFPMHQCVPPQFEARNDFDIFRDVAAKLG
                     LQEQYTEGKDEMLWLKQMYDGMAAQARGARVALPPFNMFWESNNYIRFPVPEANRQWI
                     RHADFRENPLLNPLGTPSGKIEIFSSTVAGMGYADCAGHPKWYEPKEWIKSKEATRYP
                     LSLNTSHPTQRLHSQLDNTPLRDKFAVADREAILIHPDDAKARGIQDGDLVRAFNDRG
                     QILVGALLSTDIRPGVVRVCEGAWFDPAKPGEAGSLCKNGNVNCLTFDEGTSSLAQGN
                     CGHMAQLQIEKYQGPAPVNTAHAVPANA"
     CDS             complement(293252..294382)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQC2"
                     /locus_tag="NUITMVA1_02590"
                     /product="cytochrome c-type protein"
                     /protein_id="BDC80316.1"
                     /transl_table=11
                     /translation="MLGKLLRKTWFWLLLLGALLGVAALGVTVTVMHKTSSTEFCVSC
                     HSMQTPLAEYQGSVHFQNVKGIRAECADCHIPGDPTSYLWTKIRAVKDIYHEAMGTLD
                     TPEKYEAHKLRMAQSVWDELKANDSATCRSCHSYAAMDILAQRPNARAEHPVAIKEGQ
                     TCIDCHRGVAHIMPDMSGLAAAGASELAQAAAQTPASVTTRYAIATTPLYLDAGAKTD
                     EGTLMPSTKVEVLANDNGRAQVRIDGWQQDGVSEVFYAAPGKRILSTLLGDKAKGQLT
                     TGKSETDSATNLTWHQVSLTAWVDQSQLIGDQGKLWQYASTLMSNNCTGCHGLTALDH
                     FNANQWIGVIKGMESRTSLTPEQARMLTQYVQKHASDMNAAH"
     CDS             294748..296715
                     /codon_start=1
                     /gene="topB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQC1"
                     /locus_tag="NUITMVA1_02600"
                     /product="DNA topoisomerase 3"
                     /protein_id="BDC80317.1"
                     /transl_table=11
                     /translation="MRLFIAEKPSLGRAIVDVLPKPHKKGDGFIETAQGDVVTWCIGH
                     LLEQAEPDAYDAAYKQWRMESLPIVPAQWQLVAKPKTKTQLTVIKRLIKQADCVVNAG
                     DPDREGQLLVDEVIDFLGYGKTRPVLRCLISDLNPPAVRRALDKLRDNKEFVPLAVSA
                     LARSRADWLYGINMTRAYTLLGRKGGCSELLSVGRVQTPLLGLVVRRDLEIEAFVPKP
                     FFEVLAHLQTEGNERFSAKWLPSEACLPWQDEEGRVLNRALAAKVVERIQGEPALVEE
                     VEEQARKQAAPLPYNLSSLQIDAAKRFGMDAKRVLDVCQGLYERHKLITYPRSDSRHL
                     PSDHFNRAGQVREAIASTAPALAKAVSEADGKIRSKAWNDSKVDAHHAIIPTEKQGNP
                     ATLGADEAKLYGLIARQYLLQFYPPFEYNDSKVLLRIAGGLFQAKARRILKAGWKALL
                     GVEEDDEEEAGTLPALRKGEQLLCERGELQEKMTQPPKSFTDATLLAAMTGIARYVQD
                     PEIRKTLRETDGLGTEATRAGIIDLLFKRRFLVRQGKSIKATPTGRALIQALPATATT
                     PDMTALWEQHLGRIAERQTSYQQFMGPLTEQLNGLIDGARQDSGASFSALPKAAPGAD
                     KRRFTKRKRSTAAGGTSGTAKRGSKRPAKAA"
     CDS             complement(296757..297191)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707713.1"
                     /locus_tag="NUITMVA1_02610"
                     /product="membrane protein"
                     /protein_id="BDC80318.1"
                     /transl_table=11
                     /translation="MERHDRGFLIALAGVVLTLLWIGVFKFTPTEAAAIRPLVASHPL
                     MSWLYAVLSEQAVSNLIGLVEILIAGGLIAGLWRPRLGYWSSLGAILTFLVTLSFLLT
                     LPGVWKLVDGVPVTEFFIFKDLVLLGVAWHYLNLSRARQADA"
     CDS             complement(297205..297738)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQB9"
                     /locus_tag="NUITMVA1_02620"
                     /product="alkyl hydroperoxide reductase AhpD"
                     /protein_id="BDC80319.1"
                     /transl_table=11
                     /translation="MSRIHPVSQPKPAAAPTFAALKSSLGKVPNLYATLAHSPAVLNG
                     LLGFADALGKGRLSARQRELLALAIGQANACQYCLSAHTLLAGRAGFDDDAIRAARLA
                     QAADPLDHALLQLAVALVTQRGVISDQQLAAARAAGVDDELAMEVLGQVVINTLTNYG
                     NHLAATDIDFPPVTLAP"
     CDS             complement(297834..298055)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_02630"
                     /product="hypothetical protein"
                     /protein_id="BDC80320.1"
                     /transl_table=11
                     /translation="MSPPTGKQDQGRFGQQQGLAPLLAQQQFATAQQVQVATCRIVMA
                     VGVLAQVAGKEEIGPGCGMGQQYREWIHV"
     CDS             297957..298667
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707711.1"
                     /locus_tag="NUITMVA1_02640"
                     /product="AraC family transcriptional regulator"
                     /protein_id="BDC80321.1"
                     /transl_table=11
                     /translation="MLRRGELLLREEGGEPLLLTEPTLILFPRGRGHRLEPRQLAGCD
                     LVCASVLFGPTGDSPLQLALPDTLVLPLQTIPAMAPVLTLLFEEAFADRYGQPPILSR
                     LLEVLLILLLRHLVEQGHCRQGMLAALSDPRLARAVTAMHQRGDEPWTVETLAREAGM
                     SRARFAAHFQALTRQTPLGYLTRWRMMLASQQLLAGESITQVALGVGYSGGTAFGRAF
                     EREFGMSPGRWLKTRQCK"
     CDS             complement(298695..300050)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707710.1"
                     /locus_tag="NUITMVA1_02650"
                     /product="Ktr system potassium transporter B"
                     /protein_id="BDC80322.1"
                     /transl_table=11
                     /translation="MTRWRSNYAFALHRDDESRWSEAKLILGSFLIILLVGTLFLVQP
                     SSHNGEVSFINALFTATSAISVTGLGVVDTGTAFTLQGQIFLLMLMEIGGLGQMTMTL
                     LLIAMFSKRVGLRQQVLAKEALGQEGSVNIIQLVKRIVLFAFIAQLIGTGLMAIRWVP
                     ELGWERGLYVSFFHAVSAFNNAGFSLFANNLIDYRDDPIISLTIAALIILGGIGFTVI
                     VDLVRNRRWRKLKLHSKLMLIMTPGLLLLGTLMFWLLEHNNSGTLGKASFGGQWLAAF
                     FQSTSARTAGFNSIDIGQMVPASLLFMMMLMFVGAGATSTGGGIKVTTFAVVLLATKA
                     FLTKRPHVTAFGRTLSPQIVTRSLAIIIVSTMVLMLAMFLLMLTEQQSFDKIMFETIS
                     AFATVGLSTGITAGLSEPGKLILVLVMICGRLGPLTLAFMLARPSETRIKYPEEAVYT
                     G"
     CDS             complement(300047..300700)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707709.1"
                     /locus_tag="NUITMVA1_02660"
                     /product="potassium transporter KtrA"
                     /protein_id="BDC80323.1"
                     /transl_table=11
                     /translation="MNNQFAVIGLGLFGSALCEELQRQDAEVLAIDIDESKTRQIATL
                     CNHVIVADATDEATVAELGLADFDIVFVAIGDNLETSILTTLVLKEAGVKKVWVKARD
                     KFHAKILQKVGADKVINPEWDMGRRVAQSMLDNRLFDYLELGHDMVLTEFVIGLPQNG
                     RTLADLHLLQQTELQLLAIKRGQVLHNVLTGKMELQLGDILILAGNKHAIDHWLETL"
     CDS             300828..301865
                     /codon_start=1
                     /gene="murB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQB5"
                     /locus_tag="NUITMVA1_02670"
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="BDC80324.1"
                     /transl_table=11
                     /translation="MKLTPYASLLTLNTLALDAHCRWLAEVERIDDLPQLVANPELAD
                     LPRLVLGGGSNVLFCDDFSGVVVLNRLKGITLHDEGDHWLLHVAAGENWHELVCHSLQ
                     QGWFGLENLALIPGTVGAVPVQNIGAYGVELASVCAYVEAFNWQSGQLERIEAAACEF
                     GYRDSIFKHACQDSHFITAVGLRLAKAWQPVAGYGPLAALGEQPTAQAIFDTVCATRM
                     AKLPDPAVLGNAGSFFKNPVVTAAQADQLKQQYPHMPCYPTADGQAKLAAGWLIDHCG
                     LKGFAIGRAAVHQEQALVLVNLGGASAMELIALAAHVRDSVEQKFGVLLEHEVRFMGR
                     SGETWLDEVLS"
     CDS             301862..302827
                     /codon_start=1
                     /gene="birA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQB4"
                     /locus_tag="NUITMVA1_02680"
                     /product="bifunctional ligase/repressor BirA"
                     /protein_id="BDC80325.1"
                     /transl_table=11
                     /translation="MTLTPIRQTLITLLSDGQFHSGEQLGEQLGISRAAVSKHMAALK
                     ELGLDLFSLTGKGYRLAVPMALYDEAQLQALAPMAPVHCFPVIDSTNQYLLERVNQLS
                     SGESCLAECQTAGRGRRGKPWVSPFGCQLILSMYWRLEQGMAAAMGLSLAVGVAVVQA
                     LESLGYPGVELKWPNDLYYQGRKLAGILVEMSGSAGASCHLVIGVGLNLAMPSREGER
                     IDQAWSELRHIQPELVDRNLLAGRVLDRLQQAMLTFEQSGLASFVADWNRLDHFAGRP
                     VRLLMGEQEIRGVARGIDDRGALRLETAEGIKFYLGGEISLRRGD"
     CDS             complement(302904..303842)
                     /codon_start=1
                     /gene="coaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQB3"
                     /locus_tag="NUITMVA1_02690"
                     /product="pantothenate kinase"
                     /protein_id="BDC80326.1"
                     /transl_table=11
                     /translation="MTTEHNPYLQFTREQWALLRDSVPLTLTEHDLQTLRGINEKVSL
                     QEVEEIYLPLSRLLNLYVKAKQRRSRVLEQFLGQSRGKGTYIISIAGSVAGGKSTTAR
                     ILQALLERWPEHPRVELVTTDGFLYPNKVLEERGLMRRKGFPESYDIRHLVEFVANIR
                     AGHEKVEAPVYSHLIYDIIPDEKKVVEQPDILILEGLNVLQSGMDYPQEPHRVFVSDF
                     VDFSIYVDAEADLLRTWYIERFLKFRSGAFSDPDSYFHHYAKLAESEATKIANNIWQD
                     INYLNLKENILPTRERANLILTKGNEHAIEQIKLRK"
     tRNA            304105..304189
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00100"
                     /product="tRNA-Tyr"
     tRNA            304228..304302
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00110"
                     /product="tRNA-Gly"
     CDS             304474..305658
                     /codon_start=1
                     /gene="tuf-1_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_858446.1"
                     /locus_tag="NUITMVA1_02700"
                     /product="elongation factor Tu"
                     /protein_id="BDC80327.1"
                     /transl_table=11
                     /translation="MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITNVLAKHFGGKA
                     FAFDQIDKAPEERERGITINTSHVEYDTATRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVAATDGPMPQTREHILLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSE
                     YDFPGDDLPVVRGSALKALEGEAQWEEKILELAGHLDTYIPEPERAIDLPFLMPIEDV
                     FSIAGRGTVVTGRVERGIVKVGEEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENIG
                     ALLRGVKREDVERGQVLAKPGTIKPHTKFESEVYVLSKEEGGRHTPFFKGYRPQFYFR
                     TTDVTGTIELPEGVEMVMPGDNIKMVVTLIAPIAMDDGLRFAIREGGRTVGAGVVAKV
                     IA"
     tRNA            305712..305788
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00120"
                     /product="tRNA-Trp"
     CDS             305849..306220
                     /codon_start=1
                     /gene="secE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQB1"
                     /locus_tag="NUITMVA1_02710"
                     /product="protein translocase subunit SecE"
                     /protein_id="BDC80328.1"
                     /transl_table=11
                     /translation="MSVSSESQGGSKDTLLWGLVFIILAAAVVGNYLLNDVVAAVRAL
                     GVVVVIAAAGAVALQTTKGKATLAFARESRLEVRKVVWPTRQEAIQTTLIVLAVTAVM
                     GLLLFILDGALVWLVNLITGV"
     CDS             306230..306781
                     /codon_start=1
                     /gene="nusG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQB0"
                     /locus_tag="NUITMVA1_02720"
                     /product="transcription termination/antitermination
                     protein NusG"
                     /protein_id="BDC80329.1"
                     /transl_table=11
                     /translation="MTEQREQRMRWYVVQAFSGYEGRVAKSLREHIKMHGMEDMFGEV
                     LVPTEEVVEMRAGQKRKSERKFFPGYVLVQMIMDETTWHLVRNVPRVMGFIGGTSDRP
                     APISDKEADAILNRLQDAHDKPRPKTLFEPGEMVRVADGPFADFNGTVEEVDYEKSRV
                     KVSVLIFGRSTPVELDFGQVEKG"
     CDS             306915..307343
                     /codon_start=1
                     /gene="rplK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQA9"
                     /locus_tag="NUITMVA1_02730"
                     /product="50S ribosomal protein L11"
                     /protein_id="BDC80330.1"
                     /transl_table=11
                     /translation="MAKKVTAYIKLQVKAGSANPSPPVGPALGQHGVNIMEFCKAFNA
                     RTEKLEKGSPTPVVITVYSDRSFTFETKTPPAAFLLKKAAGIQSGSAKPNKDKVGKVT
                     VAQLQEIAKTKEPDMTGADLDAKVRCIAGSARSMGLVVED"
     CDS             307348..308049
                     /codon_start=1
                     /gene="rplA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQA8"
                     /locus_tag="NUITMVA1_02740"
                     /product="50S ribosomal protein L1"
                     /protein_id="BDC80331.1"
                     /transl_table=11
                     /translation="MAKLSKRMRVIREKVDGTKEYSINEAIALLKELATAKFVESVDV
                     AVNLGIDARKSDQNVRGATVLPHGTGREVRVAVFTQGANAEAAKAAGAELVGMDDLAD
                     LVKKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQ
                     VRYRNDKNGIIHTTLGKVSFNEVQLKENLEALLVALKKAKPSSAKGVFIKKVSISTTM
                     GAGVAVDQASLEAQA"
     CDS             308306..308806
                     /codon_start=1
                     /gene="rplJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQA7"
                     /locus_tag="NUITMVA1_02750"
                     /product="50S ribosomal protein L10"
                     /protein_id="BDC80332.1"
                     /transl_table=11
                     /translation="MALGLEDKKAIVAEVNEAAKGALSAVIADSRGVTVDKMTVLRKT
                     AREAGVYMRVVRNTLLRRAVEGTEYECLNNAFTGPTLIAFSNEHPGAAARLFKEFAKA
                     NQKFEIKAGAFNGEFIAAAQIDRLATLPTYEEAIAKLMATMKEASAGKLVRTIAAVRD
                     QKQAAA"
     CDS             308858..309223
                     /codon_start=1
                     /gene="rplL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQA6"
                     /locus_tag="NUITMVA1_02760"
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="BDC80333.1"
                     /transl_table=11
                     /translation="MSITKDQIIEAVASMSVMEVVELIEAMEEKFGVSAAAAVMAGPA
                     AAEAVEEKTEFDVVLTAAGANKVAVIKAVRGATGLGLKEAKDLVEAAPANLKEAVSKD
                     EAEALKKELEAAGASVEIK"
     CDS             309448..313476
                     /codon_start=1
                     /gene="rpoB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQA5"
                     /locus_tag="NUITMVA1_02770"
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="BDC80334.1"
                     /transl_table=11
                     /translation="MVYSYTEKKRIRKDFGKRDQVLDTPYLLSIQLDSFKQFIEADPE
                     GEYGLEAAFRSVFPITSYSGSAELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRM
                     VLYDREAAAGTVKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDHD
                     KGKTHSSGKVLYNARVIPYRGSWLDFEFDAKDNLFVRIDRRRKLPASIILRALDFSSE
                     QILATFFETIGFEVKDGKLMMDLVPERLRGETATFDIVANGAVVVETGRRVTARHIRQ
                     LEKDSVTQIEVPVEYVVGKVAAKDYAHPQTGEMVVTANQALSLEAVANLSQAGFKHFE
                     VLFTNELDHGAYMSETLRIDSSSSRLEALVEIYRMMRPGEPPTREAAEQLFENLFFSS
                     ERYDLSTVGRMKFNRRLAREDETGVGTLTKDDIVDVMKRLIDIRNGNDEVDDIDHLGN
                     RRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDLINAKPISAAVKEFFGS
                     SQLSQFMDQNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRLCPIETPEG
                     PNIGLINSLSVYSRTNEYGFLETPYRKVIDGVITDEVDYLSAIEEGKYVIAQANAATT
                     EDGRLKDELIPCRHKGESTFMNADQIQYMDVSPQQIVSVAAALIPFLEHDDANRALMG
                     SNMQRQAVPTLRADKPLVGTGMERAVAVDSGVTVVAKRGGMIDYVDASRIVIKVNEDE
                     LLPGEAGIDIYSLTKYTRSNQNTCINQRPCVMLGEPVMAGDVLADGPSTDLGELALGQ
                     NLRVAFMPWNGYNFEDSILVNERVVQEDRLTTIHIQELACISRDTKLGPEEITADIPN
                     VGEAALSKLDESGIVYVGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVK
                     DSSLRVPNGVYGTVVDVQVFTRDGVEKDKRAKEIEEMQLKEAKKDLTEEFKILEDGIF
                     GRSRNLLLAAGYSEDRLNKLDRSKWFELAIEDEAKQIELEQIAEQHVELKAEFDKKFE
                     NKRRKIIQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKICPVEDMPHD
                     EYGRPVDIVLNPLGVPSRMNIGQILEVHLGLAAKGIGEKIDRMVKEQRELHEMRDFLQ
                     QVYDLGEKDTQQVNVAELSDDDVRTLVGNLRKGLPVATPVFDGAKEREIKALLKLADL
                     PESGQIALFDGRTGNAFERKVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGK
                     AQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGDHRMEPGMP
                     ESFNVLLKEIRSLGINIELDEE"
     CDS             313557..317861
                     /codon_start=1
                     /gene="rpoC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQA4"
                     /locus_tag="NUITMVA1_02780"
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="BDC80335.1"
                     /transl_table=11
                     /translation="MKDLLKFLKAQTKTEEFDSIKIGLASPDMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERM
                     GHIELASPTAHIWFLKSLPSRIGLLLDMTLRDIERVLYFESYVVIEPGMTNLERSQML
                     SEEQYLDALEEWGDEFDAKMGAEAILALLRAIDLEGEVRTMREELDQTNSETKRKKTT
                     KRLKLMEAFLQSGNKPEWMIMTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLDLAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIYGKLESRGLAT
                     TIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPTLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPASGEPIIVPSQDVVL
                     GLYYMTRARINAKGEGMVLSGPKEAEKVYRAGLADLHARVKVRITEYLRQEDGSLRAH
                     TEMKNTTVGRAILSLILPKGMEYALIDEPKVLTAAEQADLDANPQNWIKSVSNKALGK
                     KLISRLLNTCYRKQGLKDTVIFADQLMYTGFHYAALSGASVGIDDMVIPDAKKDIIAA
                     AEAEVAEIQDQFLSGLVTAGERYNKVIDIWASANERVSKAMMENLSKERNVNSLGEEE
                     EQASFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPIVANFREGLNVLQY
                     FISTHGARKGLADTALKTANSGYLTRRLVDVAQDMVITEDDCGTTEGLWMTPLIEGGD
                     VVEPLRERVLGRVVADDVIKPGTEDEVLVARNTLLDEQLCDLLERNSVDRVKVRSAIT
                     CETDFGNCAHCYGRDLARGHLVNKGEAVGVIAAQSIGEPGTQLTMRTFHIGGAASRAA
                     AESSIQVKNTGSIKLQNAKFVHNSDDKLVITSRSTELTIMDEMGRTKESHKLPYGSVL
                     EVKDGQAVNAGETVANWDPHTHPIITEVAGRLHFEHMIDGVTITRQTDELTGLSSIVV
                     LDVNERPSAGKEMRPTVKLVDLNGKDVMIPGTDVAAQYFLPGKAIVNLEDGANVGVGD
                     AVARIPQESGGTKDITGGLPRVADLFEARQPKEPAILAEISGTISFGKETKGKRRLVI
                     TPTDGGDVYEEMIPKWRNLNVFEGEKVEKGEVLADGPESAHDILRLRGISPVANYIAN
                     EVQDVYRLQGVKINDKHIEVIVRQMLRKCEILSAGDTDLIEGEQVEVARVKIANRKLV
                     AEGKTPATFRHILMGITKASLSTESFISAASFQETTRVLTEAAVGGKRDELRGLKENV
                     IVGRLIPAGTGFAYHHGRINQRAAAARAVGVPQVTADEAQQNLADLLNAAGSFDEE"
     CDS             318059..318775
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005306294.1"
                     /locus_tag="NUITMVA1_02790"
                     /product="hypothetical protein"
                     /protein_id="BDC80336.1"
                     /transl_table=11
                     /translation="MTVGIEEVMLPEEQLIGRTFTDEDRELLRSYDGLIDGLAELFGK
                     HCEVVLHSLENLHESVIKIANGFNTGRNEGAPITDLALRMLKDIENTGQDYTQSYFAR
                     SRTGALMKSSTIAIRNSDKQVIGLICINLHINAPFHEFVAEFFPTPQQVERQSPETFA
                     NSVEELVAQTVDNTIDEINRDPTVANNAKNRFIVTQLFEKGIFDIKDSINLVADKLNI
                     SKHTVYLYIRQRKQGEDENE"
     CDS             318801..319181
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707699.1"
                     /locus_tag="NUITMVA1_02800"
                     /product="endoribonuclease L-PSP"
                     /protein_id="BDC80337.1"
                     /transl_table=11
                     /translation="MAKEVIATDKAPAAIGPYVQATKLGELVFTSGQIPLDPATMEIV
                     AGGIEAQAEQVMKNLVAVLKEAGADTGKVLKTTCFLSDMNNFVAFNQVYARYFGDAAP
                     ARSCVEVARLPKDVLVEVEAIAYV"
     CDS             319268..319660
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707698.1"
                     /locus_tag="NUITMVA1_02810"
                     /product="sulfurtransferase TusD"
                     /protein_id="BDC80338.1"
                     /transl_table=11
                     /translation="MSLNFALLVTGPAYGTQSASTAYRFALSLIEQGHRLSHLFFYQD
                     GVCNGNGLHAPASDESNLVALWRELANQQGIRIDVCVAAAMRRGVLDEQEAKGLGRAH
                     FNLEPPFCLSGLGQLAEASLTADRFVQF"
     CDS             319670..320026
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707697.1"
                     /locus_tag="NUITMVA1_02820"
                     /product="sulfurtransferase TusC"
                     /protein_id="BDC80339.1"
                     /transl_table=11
                     /translation="MHKIAFICRRGPHGTAAGREGLDALLATSAMTDSLALFLIGDGV
                     LQLLREQQPQAILQRHYAPTFKLLELYDIEEVYVCTDSLAERGLTVADLLIPVTGLSR
                     TDIRHQWDACATHICF"
     CDS             320034..320312
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707696.1"
                     /locus_tag="NUITMVA1_02830"
                     /product="sulfurtransferase TusB"
                     /protein_id="BDC80340.1"
                     /transl_table=11
                     /translation="MIQLILTSPFQSQDLEQALTYRQPEDVLVLMQDAVVAATAPQWC
                     ARLAGVPLYVMREDLQARGLQQRIGLDLDMAGLVALIAEKGSPQTWAG"
     CDS             320496..320870
                     /codon_start=1
                     /gene="rpsL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ98"
                     /locus_tag="NUITMVA1_02840"
                     /product="30S ribosomal protein S12"
                     /protein_id="BDC80341.1"
                     /transl_table=11
                     /translation="MATINQLVRKPRIKLVVKSNVPALEACPQKRGVCTRVYTTTPKK
                     PNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGAL
                     DCAGVKDRKQARSKYGVKRPKA"
     CDS             320964..321434
                     /codon_start=1
                     /gene="rpsG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ97"
                     /locus_tag="NUITMVA1_02850"
                     /product="30S ribosomal protein S7"
                     /protein_id="BDC80342.1"
                     /transl_table=11
                     /translation="MPRRRVVGQRKILPDPKFGSELLAKFVNVVMVDGKKSVSEAIVY
                     GALDIIATKTGKEHLAVFEEALDNIRPAVEVKSRRVGGATYQVPVEVRPVRRNALAMR
                     WLVDAARKRGEKSMAQRLAGELLDAADNKGSSVKKREDVHRMAEANKAFAHFRW"
     CDS             321510..323615
                     /codon_start=1
                     /gene="fusA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ96"
                     /locus_tag="NUITMVA1_02860"
                     /product="elongation factor G"
                     /protein_id="BDC80343.1"
                     /transl_table=11
                     /translation="MARTTPIERYRNIGISAHIDAGKTTTTERVLFYTGVSHKIGEVH
                     DGAATMDWMEQEQERGITITSAATTAFWSGMGKQFQPHRINIIDTPGHVDFTIEVERS
                     MRVLDGAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRTGANFLRCVEHIKT
                     RLKGNPVPLQLNIGSEENFKGVIDLVKMKAINWSEADQGVSFDYEDVPAELLEKAQEM
                     RMTLVEAAAEASEDLMEKYLGGEELTEEEIKKALRQRVLNNEIILVTCGSAFKNKGVQ
                     AMLDAVVDYLPAPTDVAAIDGLKLDGETKDERHASDDEPFAALAFKIATDPFVGNLTF
                     FRVYSGVVNSGDSVLNSVKEKRERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVTT
                     GDTLCDEKAPIILERMEFPEPVISIAVEPKTKADQEKMGLALGRLAQEDPSFRVWTDE
                     ESGQTIIAGMGELHLDIIVDRMRREFKVEANVGKPQVAYRETIRNTVKDIEGKHAKQS
                     GGRGQYGHVVIDMYPLEEGKAYEFVNDIKGGVIPGEFIPGVDKGIREQLKSGPLAGYP
                     VMDLGVRLHFGSYHDVDSSELAFKIAASMAFKAGFMKANPVLLEPIMKVEVETPEDYM
                     GDVIGDLNRRRGLIEGMEDGPSGKIVRALVPLAEMFGYATALRSATQGRASYAMEFAK
                     YHDAPTNVAQAVIEERKSK"
     CDS             323670..324854
                     /codon_start=1
                     /gene="tuf-1_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_858446.1"
                     /locus_tag="NUITMVA1_02870"
                     /product="elongation factor Tu"
                     /protein_id="BDC80344.1"
                     /transl_table=11
                     /translation="MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITNVLAKHFGGKA
                     FAFDQIDKAPEERERGITINTSHVEYDTATRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVAATDGPMPQTREHILLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSE
                     YDFPGDDLPVVRGSALKALEGEAQWEEKILELAGHLDTYIPEPERAIDLPFLMPIEDV
                     FSIAGRGTVVTGRVERGIVKVGEEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENIG
                     ALLRGVKREDVERGQVLAKPGTIKPHTKFESEVYVLSKEEGGRHTPFFKGYRPQFYFR
                     TTDVTGTIELPEGVEMVMPGDNIKMVVTLIAPIAMDDGLRFAIREGGRTVGAGVVAKV
                     IA"
     CDS             324967..325509
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ94"
                     /locus_tag="NUITMVA1_02880"
                     /product="D,D-heptose 1,7-bisphosphate phosphatase"
                     /protein_id="BDC80345.1"
                     /transl_table=11
                     /translation="MSKPAIFLDRDGVINEDTGYVSKVDDFHFLPGVIEALQLMKKKG
                     YLLVVVTNQSGIARGYFSEDDFMNLTEWMDWSLADRDVDLDGIYFCPHHPEHGAPCDC
                     RKPEPGMLLLAKQELNIDMSRSYMVGDKPSDLKAAINAGVGHKIMVRTGKPVTDAGVE
                     LADAIYDNLHDFAVAAPTAA"
     rRNA            325913..327453
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="NUITMVA1_r00040"
                     /product="16S ribosomal RNA"
     tRNA            327527..327603
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00130"
                     /product="tRNA-Ile"
     tRNA            327614..327689
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00140"
                     /product="tRNA-Ala"
     rRNA            327931..330816
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="NUITMVA1_r00050"
                     /product="23S ribosomal RNA"
     rRNA            330899..331007
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="NUITMVA1_r00060"
                     /product="5S ribosomal RNA"
     tRNA            331108..331184
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00150"
                     /product="tRNA-Asp"
     CDS             complement(331277..331609)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707692.1"
                     /locus_tag="NUITMVA1_02890"
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /protein_id="BDC80346.1"
                     /transl_table=11
                     /translation="MHTRNLLNDIPSPLPTELFQDLVSTNHLRIERILSHGHQTAPGE
                     WYDQDEHEWILVVQGEASLLFIDPQTQQQQLVQLGPGDHINIPARQKHRVEWTHPDMT
                     TVWLCVFY"
     CDS             331851..333194
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707691.1"
                     /locus_tag="NUITMVA1_02900"
                     /product="permease"
                     /protein_id="BDC80347.1"
                     /transl_table=11
                     /translation="MAAQSGNGGFLDSYFSISARGSSVRQELLAGLTTFLAMVYSIIV
                     VPNMLGAAGFEQGPVFVATCLIAAFGSLLMGLWAKLPMAIGCAISLTAFTAFSLVLGQ
                     GLSIPVALGAIFLMGVLFTLISVTGVRQWILDNLPSGIAHGTGIGIGLFLLLIATNGV
                     GMVIKNEGAGLPVQLGEVTAFPVIMTVLGLAAIFGLERRKVPGGILMVIIAISILGLV
                     FDPKVTWQGFFAIPSLTGEKGSLVGSMDLLGALNPVVIPTVLALVMTAVFDATGTIRA
                     VAGQAGLINERGHIISGGKALTADSVSSMVAGAVGGAPAAVYIESAAGTAAGGKTGLT
                     AALVGVLFLLMIFLSPLSYLVPAYATAPALMYVGLLMLGNVTKLDFNDSVDALSGMLC
                     AVFIVLTCNIVTGIMLGFVALVVGRLFAAEWKKLNIGTVIIAVALVIFYAGGWAI"
     CDS             333426..334496
                     /codon_start=1
                     /gene="dhaK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707690.1"
                     /locus_tag="NUITMVA1_02910"
                     /product="dihydroxyacetone kinase subunit DhaK"
                     /protein_id="BDC80348.1"
                     /transl_table=11
                     /translation="MKKLINAVDAVVREQLMGMAAAHPELKVRIEPHYITRADSPVMG
                     KVALVSGGGSGHEPMHGGLVGKGMLDGACPGEIFTSPTPDQMYECGQAVDGGAGVLFL
                     VKNYTGDVLNFETAVELLHGDGVKVGFALIDDDVAVKDSLYTAGRRGVATTVLCEKLV
                     GAAAEAGYDLARCEALARRINNQSRTIGVATHACTVPAAGKPSFTLADNEMEFGVGIH
                     GEPGIARRPFTNLDTLVGDMFNELADNTPYGRTLRHWDRTSGSWQEEHTFIEPFNKGD
                     RVIALVNSLGGTPISELYGVYGRLATLCEEAGIHLVRNLIGTYCTSLDMTGISITLLK
                     VDDELMTLWDAPVHTPALRRGC"
     CDS             334512..335141
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707689.1"
                     /locus_tag="NUITMVA1_02920"
                     /product="dihydroxyacetone kinase subunit DhaL"
                     /protein_id="BDC80349.1"
                     /transl_table=11
                     /translation="MLSKHQIVNWLLDCEHIFTEQRDYLTALDTDIGDGDHGLNMQRG
                     FTKVAEKLPAVADKDIGQVLKTTGMTLLSSVGGASGPLYGTFFIRAAASSDACQSLTL
                     GQLGKMLSDGVEGIVSRGRAEPGDKTMCDAWWPALAALQQAEQQGLPLPEALDKAVAA
                     AAAGTEATIQMQARKGRASYLGERSIGHQDAGATSTLLLLTALRDRARL"
     CDS             335143..335859
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707688.1"
                     /locus_tag="NUITMVA1_02930"
                     /product="dihydroxyacetone kinase"
                     /protein_id="BDC80350.1"
                     /transl_table=11
                     /translation="MIGIVVVSHSAMLAAGLKALADQLGSPAKLLLAAGVDDPDHPIG
                     TDAIAVMSAIEEADDGSGVLVLMDLGSALLSAETALELLPPQLSARVRLCPAPLVEGT
                     LAAVVAAGSGLTLDEVAAEALGALGPKQAMLTGKAEPQDVEAAPAPDDGWLRCEVVVD
                     NPHGLHVRPAARLVAALKPFAAELRLQKEEKEANPRSLTRLTMLNVRQGDRLTLLARG
                     EDAEAALACFQQLAAERFGD"
     CDS             335997..337079
                     /codon_start=1
                     /gene="gldA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707687.1"
                     /locus_tag="NUITMVA1_02940"
                     /product="glycerol dehydrogenase"
                     /protein_id="BDC80351.1"
                     /transl_table=11
                     /translation="MDRIIISPSKYVQGNGALANIGNYVKALGAKPLILADAFVTKLV
                     GDTVATSFHGAGIQPEFDCFNGECSRPEIDRLLARCKQTPFDVIIGIGGGKTLDTAKS
                     VAFYQQVPVVIVPTIASTDAPTSALAVIYTPEGQFSEYLMIPTNPNMVIMDTGVVARA
                     PVRLLVSGMGDALSTYFEARANKVSGCQTMAGGASTLAAQAIAELCYKTLLADGYKAK
                     LAVEQGLCTKAVENIIEANTYLSGIGFESSGLAAAHAVHNGLTQLAECHHLYHGEKVA
                     FGTLVQLVLENAPMAEIETVLGFCRSIGLPTNLHMMGVKELDMARLMDVAKASTAEGE
                     TIHNMPFKVTAEDVLAAIVTAHQLGL"
     CDS             complement(337174..339084)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707686.1"
                     /locus_tag="NUITMVA1_02950"
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="BDC80352.1"
                     /transl_table=11
                     /translation="MTILSASMPPARAWPDYLQASWLRCAHQTSATLWHPPHSAKGQT
                     LQSLRQRKRDLLTTGEMALEDLYEFMEGRPCALLLTDESGCLLARTGHPDTLAELEAL
                     GFGPGAFFSEGRIGTNAINLAALEGMPLCISGTQHFNQTLHPWHCCASPVYNSNGRQV
                     AIMALTCKVEEASAGDLALTVSAGRELAHLLQMETLMQESQHHLSELYALLDGMDDGV
                     LAWDPQGRLRYLNALAARRLRLDPDLCLGQPLEQHLLLPQRLQLAIKGQTTLSHVEVT
                     LERVGGQEAEFISALVSLKPLPGPDGVSFIVLLHPVDRLRAIHQLRQTVPELSALVGE
                     SSAMRKLLRYARQAAQSPGPILLRGEEEVGKAQLAEAIHFGSEQAAGPLVTLNCQALP
                     SERMALELMGSDEAGQERAGKFELAHGGTLVLEQVECLSSPMQAALLQLLKTGRLQRF
                     DSARILPLKVRIIATSSAALEQKVQEGHFGRQLLYALQACELWLPSLRERTADLPGLI
                     SQQLGAQGREPGRQFSPAALDCLLAYPWPGNLGELRSAIEHALLHSSQSQIPPEALPA
                     AIRHGHQLVADEVVGQPLLTLAELEHQAILRCAHACKGQVSQMAQQLGIGRTTLWRRL
                     KLLEIDPADYHG"
     CDS             complement(339152..340045)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707685.1"
                     /locus_tag="NUITMVA1_02960"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BDC80353.1"
                     /transl_table=11
                     /translation="MVFKQWPPLNVLRGFEAAARLGSFHQAAQALHLTQSAISQQIRS
                     LEELLGQPLFHRQGRSVTLTDAGQDLLETTQSVLLQLAMGIQRLEQYRKPNQLVLNTS
                     TALARHWLLPRLGAFHRAHPEVDLWLFTSDEEPIMAEQTIDLALRWELAPQAECRHQL
                     LLADHLLPVAAPAVLALPAAERTTLHGERELDWHHWTLKGGEDLHLQTRGLNFSDPGL
                     LLDAACQGLGIALVSERLSRPARQQGQLLPLSTHRVKGPQWHLLVHQESETMPECRAF
                     CRWLELQFADPVPAEDGLPSL"
     CDS             340213..341331
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707684.1"
                     /locus_tag="NUITMVA1_02970"
                     /product="agmatine deiminase"
                     /protein_id="BDC80354.1"
                     /transl_table=11
                     /translation="MSSRRHVLKQLAALGALVGLGTLPKAQAAATVASPADPRFYMPE
                     ESTFQTRVWVAFAASEAIWGSDYPAVQATIGRLVQAMVSYTQVNVLCREAEQALARQL
                     CGEQNTRFVVAELDDIWLRDTGGVFVQNEEGELALVDFNFNGWGDKQEHEQDAGVAEL
                     VSQQAKVRYLQSKLTGEGGGIEVDGNGTAILTESCWLNSNRNPEVSKAQLEAELKANL
                     GLRKIIWLPGIKGRDITDAHVDFYARFVRPGVVVVNLDNDPQSHDYEVTRRHLAILKQ
                     ATDADGNKLELHVLPPPLDGRDNRFSRSRDFAAGYINYLPINGAVIAPEFGDKAADSY
                     CHELLTRLYPGREIVQINIDPVAAGGGGIHCITLHQPA"
     CDS             341742..342374
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_02980"
                     /product="hypothetical protein"
                     /protein_id="BDC80355.1"
                     /transl_table=11
                     /translation="MNKSQIIKSVSLFETGLSAAEWAWRIFTVVFIGGSGAITGILAK
                     ADPVLKGLGPIYWVVIGIITAVFVALVLFLIKSSILKQSLADYHAALSVPKNSVNPLQ
                     DSFTDTIIPLEDLRLPTLQLHEHKHFKRCKFVGPGALAIMGGSYVNSGFHDCGDVIAL
                     PENVYLTGIVVFRSCTVESCEFIRTTVFVDQNTGLGFKNVPGISVKGLHK"
     CDS             complement(342674..343759)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707682.1"
                     /locus_tag="NUITMVA1_02990"
                     /product="membrane protein"
                     /protein_id="BDC80356.1"
                     /transl_table=11
                     /translation="MNMKKVDLAKITLGVLFLSLLIVSCFMVLRPFLPALVWATMITI
                     ATWPLMLMVQRLLWGKRALAALSMTLVLLLMFVIPLFMALANVAEKAPMLIELGTTIS
                     HSPPPELLWLQQVPLVGGKLYDFWQQILASGGQVLFAKLAPYFGQTARWLASQAGNLG
                     LLFVHFLLTVGICGLLYHSGEVVATGIRRFAHRLAGERGDNATVLASQAIRAVAMGVV
                     VTALVQSSVAGLGLLIAGIPYTMILVVVMFLLIVAQIGPFPVLLACVGYLYWSGDTTW
                     GTFLLVWSLLAGTMDNFLRPFLIKRGADLPLILILVGVIGGLLAMGIIGLFIGPVVLA
                     VGYTLLDAWIKEDDQPAAAAVEPPKAE"
     CDS             complement(343756..345135)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707681.1"
                     /locus_tag="NUITMVA1_03000"
                     /product="phosphatidic acid phosphatase"
                     /protein_id="BDC80357.1"
                     /transl_table=11
                     /translation="MSRYCFLLFCLLLAGLPALAVPSAAVCVVKHQQQLLLVQDRVSS
                     RYSLTGGYIDAGETPQQAALRELYEETGLRGRVIAELGSWQRALLFACQTLEPIRAQA
                     GSGFVSLLRAPNLGGEILNARLIAPARLPDDQRRFPAQLDWLAPQLATIPDSPVLWQP
                     DFRGEGNALHQMEVPLIHQLQTWLGAQVRWLEVSNLFGSAAFQLALLPLLLPWLGWPR
                     VRQLLLAMLTLTLLVQVAKEGIGWPRPFHLDPTLAQGSAQGFGMPSSHAASALLFWGV
                     LLRGCWPANPWCSTALALLLATLTGLARVWLGVHFLSDVAAGLLLGALLLALHPRLAN
                     LAAKSWIWAGLTLACALAAGWSQSSALAGLATFSLGLTLGMMLPLPRTTQTGWRPPLL
                     ALLGGLPLGALWWALPLWLTSSWLILLGQWLLYCCLGLWLSAGLWWILSLVNNDPLPK
                     GPGPDKGLL"
     CDS             345333..345713
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707680.1"
                     /locus_tag="NUITMVA1_03010"
                     /product="hypothetical protein"
                     /protein_id="BDC80358.1"
                     /transl_table=11
                     /translation="MKQFGFFLGIAIGVILILFGSIVIFQALPAALDVLEMPSRIPFV
                     REVYTWLMTSASGLTGQLEQNFLEAFQTVLKLILLITFMWVCVKLVNMGVLIIRAGVD
                     LIRTAIEHSESAQTKKSDHDHHFQ"
     CDS             complement(345768..346541)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707679.1"
                     /locus_tag="NUITMVA1_03020"
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="BDC80359.1"
                     /transl_table=11
                     /translation="MSRLLSLMICCCLGTALPASAFTYYSEQNMPFNGQDEQGNSTGL
                     AVELLRLMWQEMGEPEQPIHFMPWAKAWYLLTQQPDAVLFTTAHTQARDPHFLWVCPI
                     SHSRVSLVGRKRDAPKVTGKADLTKLQIGVMQADVGEQLLLNRGISPANLMSVERMDQ
                     VVRQLIMARTDLVAGNEVMLFHQARQLGFSSDTFVTVATLADQDNCFAFNPAADKQQV
                     ARLQQALDKVRQGEAFKRLIARYQDVVQSPPADHLPTIE"
     CDS             complement(346700..347797)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707678.1"
                     /locus_tag="NUITMVA1_03030"
                     /product="hypothetical protein"
                     /protein_id="BDC80360.1"
                     /transl_table=11
                     /translation="MMSPTSQLMWALLKPLVGFDPNEANLFEQPMIKDRMTSILGPNY
                     DSTMQLLKTANELQQEGPLFYVVSRYAPVPDVAKQAGMVWNSQTNQMSVMLLKGDGTP
                     QVFGENLAAGAPSWPTEMQSWQTQGNPATSALTGATNSLTGSATKSLTGAATTSSVFG
                     SVLGSLQQGASKTMADTTKQVVNGAATSAQQQAGKAASSATATVQQQATKAVTEPAKQ
                     AASNATATMQQQATKAVTEPAKQAASSATATVQQQATKAVTEPAKQAASSANATVQQQ
                     ATKAVTEPAKQAASSATATAQQQATKAVTEPAKQAASGATATVQQQATKAVTEPAKQA
                     VSSATATATDAAAKAEAARAAAEAEMEALLK"
     CDS             347733..347888
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03040"
                     /product="hypothetical protein"
                     /protein_id="BDC80361.1"
                     /transl_table=11
                     /translation="MGSKPTSGLSRAHISWLVGLIINRGATQADNIRLRQAAWSNGMI
                     RIGIISK"
     CDS             348085..348411
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707677.1"
                     /locus_tag="NUITMVA1_03050"
                     /product="hypothetical protein"
                     /protein_id="BDC80362.1"
                     /transl_table=11
                     /translation="MYLGKRVGGWLWLALLGGATGTGVAAEPKRAEVGAELVLPLGSL
                     PERVCWYQDQRYSLGARIQQGDSWLECAPQNELESNGPLAWREPERASDAAGKATKSG
                     TISVGQ"
     CDS             complement(348803..350251)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ77"
                     /locus_tag="NUITMVA1_03060"
                     /product="catalase"
                     /protein_id="BDC80363.1"
                     /transl_table=11
                     /translation="MNDKTLHSANGAPVVDNNNSLTAGPRGPVLMQDIWLMEKLAHFD
                     RERIPERVVHAKGSGAYGTFTVTHDISAFSKADLFNAVGKQTPVFLRFSTVAGEKGAA
                     DAERDVRGFALKFYTEQGNWDLVGNNTPVFFIRDPLKFPDFIHTQKRDPRTNLRSATA
                     AWDFWSRHPESLHQVTILFSDRGIPKSLREMNGYGSHTFSFINDANERFWVKFHFKTE
                     QGHSFYTDEEAATAVGQDRETSQADLFNAIERGDFPRWKVYVQVMPEAEAQTYKIHPF
                     DLTKVWPHSDYPLIPVGVLELNQNPDNYFAHVEQAAFTPANVVPGIGFSPDRMLQGRL
                     FSYGDTQRYRLGVNHGLLPVNAPRCPFHHGAHRDGAMRADSNGGASPNYQPNRFGTQQ
                     PSEQHEPALSLEGAALHYDFRDYDSDYYSQPGNLFRIMDEGQRSRLAANLARSLINVE
                     DDAIVAAQLKHFEQADPEYAKRVELALAALQR"
     CDS             350416..350901
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707675.1"
                     /locus_tag="NUITMVA1_03070"
                     /product="acetyltransferase"
                     /protein_id="BDC80364.1"
                     /transl_table=11
                     /translation="MQITIRHAEPADAPALRDLYAMPNAQAGTLQLPYPTLGVWQKRL
                     ESGSVVALVAEVDGLLVGQLSLHMEPNPRRKHVACIGMGVRDDWAGKGVGSVLLGAAL
                     EMADNWLNLQRVELTVYTDNQGALALYRKFGFVEEGLARGYAFRQGEYVDALYMARIR
                     P"
     CDS             350898..351755
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707674.1"
                     /locus_tag="NUITMVA1_03080"
                     /product="DNA gyrase inhibitor"
                     /protein_id="BDC80365.1"
                     /transl_table=11
                     /translation="MIDYRRRLIPVLRALEQDPDLSIEALAERACLSLYHFHRVFTAV
                     AGEEPGEMCRRLRMQRAAWQLCYTDASITAIALGAGLGSSQAFAKAFRRYYGCTPGAF
                     RSNKSKNGHLESKDGHAWDGPSPYAEGHSSARSNTMKTVEMDARTLAYIRVTGPYGEG
                     YDAVCGRLHQWAAARGLEGGEWIFIYHDNPEVTPPAQCRTDIGITVPPQTRGEGEVET
                     QLIPAGRYAQSRYLITDRNQYGPRWQEHVGDIVAAGLEFGSGPCFELYHSVSNDPLRD
                     DVSFCSSVR"
     CDS             complement(351834..352709)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707673.1"
                     /locus_tag="NUITMVA1_03090"
                     /product="transporter"
                     /protein_id="BDC80366.1"
                     /transl_table=11
                     /translation="MAAAIWGLGFVAQRLGMDHMGPYTFNGLRFLLGAASLLPLLWWL
                     KSRQPTAQPGDRRLLLTGGLIAGTVLFSAASLQQVGLLYTTAAKAGFITGLYIILVPV
                     IGLALRHKTGANTWVGALIAMAGLYYLSVTEDFTIGYGDLLQVVGALFWAVHLLVLDH
                     YSSRVAPIRLAGVQFVVCGLLSLGTALVIETPSLSGAVAGWQALLYAGLVSVGVGYTL
                     QVVGQRGAHPAHAAIILSLETVFAAIGGVLLLGETLDERAVMGCALMLAGMLISQIRL
                     RWWWKSRRDKVPSQH"
     CDS             complement(352882..353322)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707672.1"
                     /locus_tag="NUITMVA1_03100"
                     /product="membrane protein"
                     /protein_id="BDC80367.1"
                     /transl_table=11
                     /translation="MLNPDLLMALHYCAVITLTGAITSEYFLFRRGMSIEQVRKLLLA
                     DGLAALALLLIFITGVLQVLAHPDEPSVLLANPGYRTKLLLFCVMAISFGYPSRLFYR
                     WRRSLRQGRAPMVSIQQQFWVIWILRGNLLLLALIPLLAGIANG"
     CDS             353432..355042
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707671.1"
                     /locus_tag="NUITMVA1_03110"
                     /product="sensor domain-containing diguanylate cyclase"
                     /protein_id="BDC80368.1"
                     /transl_table=11
                     /translation="MDKRAVSKKTWSLVARMRLGLLLLFIPVLMLGGIYYLHMERSLQ
                     SELQQRLLATNHQLRHVFIEPYLHEMERQFTLIYDQVQVADISGPRLHNTETYLKEWQ
                     LYKGVMADLVYIYIGTAERQMLIYPAWQADANFDPRVRPWYQLASQHVGKMVWTEPYY
                     DYTNGNLVIALARALTDREGKVRGVFAMDAILAPFSAQLNRQLGDGYQMVVNQSGKVL
                     AHPDTAQLLKPMAHPEWLSRFSQEDGIFLDKVSSQFVAYSKLPERNWVLISVQPAASV
                     MAVVERVSLNVQLMVALACVLYVMLALVWSRYFRRMLDEISSMIRASRMQPDDVPQGG
                     MRELRHVYAELAEVSKDYHEARQQANLDKLTGLYNRRFFDERVNRLLFEHQPFCLAMV
                     DLDDFKRVNDTFGHQTGDVVLKRVSKLGMRLLGDHGWVCRYGGEELVVLLVNPDIHFC
                     QMLLEQFRKGVESLDWREPELRITFSGGLVASQAGMDGKTLLEIADAEVYRAKRDGKN
                     RIYLGRPEARRQEDAPPADDALLSKEEA"
     CDS             complement(355058..355717)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707670.1"
                     /locus_tag="NUITMVA1_03120"
                     /product="haloacid dehalogenase"
                     /protein_id="BDC80369.1"
                     /transl_table=11
                     /translation="MALALFDLDETLIAGDSASLWLAYMVAEELAPASMIAEEQAMMS
                     LYHQGKMDMHQYMAFTLQPLAGKTRQWLDSLCTRFAEQVLRDRIYPEGLARIEWHRQR
                     GDELVLISASGEHLVAPMAQMLGMDHCVAILLDEEAGMLTGQTRGTLSFREGKVARIN
                     QLFAASTNPWQESHGYSDSHNDLPLLQAVAHPHAVNPAPGLRQIAIEQAWPTLDWQLA
                     S"
     CDS             complement(355757..356764)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707669.1"
                     /locus_tag="NUITMVA1_03130"
                     /product="spermidine/putrescine ABC transporter
                     ATP-binding protein"
                     /protein_id="BDC80370.1"
                     /transl_table=11
                     /translation="MFHLEVNQLHKSYGDTRVFEGIEFGIRKGELVTLLGPSGCGKST
                     LLRALAGLTPVDGGQVRVAGEDITWQEPQKRGIGMVFQSYALFPNMTVRDNVAFGLKM
                     KPQPGRDLAVSVLEALELVELTGFERRYPAELSGGQRQRVALARALVVQPRILLLDEP
                     LSALDARIRRSLRQQIREIQQRLELTTIFVTHDQEEALTMSDRIFLMNKGSIVQSGTP
                     EEIYTHPASEFVASFIGNYNLLDGEQASALFGPRFQGKLALRPESLSLLPADARSDEP
                     HLPGVISGQQLLGNVIRYQVSCAAGLLTVDCLNRCAGDLLAVGSAVTLVVARDQLCEV
                     A"
     CDS             complement(356771..357547)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707668.1"
                     /locus_tag="NUITMVA1_03140"
                     /product="ABC transporter permease"
                     /protein_id="BDC80371.1"
                     /transl_table=11
                     /translation="MRDLQPSWPRWVLGALVATLLLPLLATFLYSISTRWGATLLPDG
                     FTLDWYLKLWGDPRFLAAFGRSLLVCFATLLLGTLVLVPTVLVVAYYFPRLDPWMNLL
                     ILLPFAVPPVVSSVGLLQIYADGALPIIGTPWILIGTWFTVVLPFMYRALANSLQGVP
                     LKDLMDAAHLLGASSARAFLLVVIPCLRKGLLAALFLSLSFLLGEFVFANMLVGTRYE
                     TLQVYLYNMRATSGHFTSALVMSYFLLTLLLTWAANRFHR"
     CDS             complement(357540..358439)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707667.1"
                     /locus_tag="NUITMVA1_03150"
                     /product="ABC transporter permease"
                     /protein_id="BDC80372.1"
                     /transl_table=11
                     /translation="MMPATTEILADQPAITRHRLRRHWLPALVLLPFVLLMLLFQLAP
                     MVWVLVGSFQTPDGWGLDYYREILSSPFYLQSFGNSLRIAGIASLAGLAIGTLGAAAL
                     RHSGERVKRVLLAFVTMTGNFSGVPLAFAFIIILGINGAVTLLLKSWGLIDGFNLYSG
                     SGLILIYTYFQSPLALLLLYPAFDALQDEWPQAAALLGASKGQYVWHVALPVLTPALL
                     GTLIILFANAVGAYASAYALTTGNFNLVTIRVASLVSGDIFLEPNMAAALAVILMVLL
                     GVVTAANQWLLKKSYVNKGQSHA"
     CDS             complement(358439..359272)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707666.1"
                     /locus_tag="NUITMVA1_03160"
                     /product="hypothetical protein"
                     /protein_id="BDC80373.1"
                     /transl_table=11
                     /translation="MQHKVIVVLVDGLSAEVAHCMGYLAGMVEAGQGLQATLSCALPS
                     LSRPLYECILTGSTPVESGITHNGVSRLSRQESIFHLARAGGKRTAAAAYYWVSELYN
                     QSPWQAARDRFTHDERLPIQHGCFYWDDGYPDSHLLMDGEWLRSQYDPDFLLIHPMGV
                     DDAGHQFGLDSRQYRNQARRMDSLLADLLPQWLAEGYQVVITSDHGMNNDLSHGGTLA
                     EERRVPLWLFGDAFVAQWPAGPAMQQTQLCALMADLLGVPHDKPSGPPLLKAGNQPEV
                     H"
     CDS             complement(359283..360329)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707665.1"
                     /locus_tag="NUITMVA1_03170"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BDC80374.1"
                     /transl_table=11
                     /translation="MKSVIASALALVAISQPLFAAENIADLEKAARGEGQLSSIGMPD
                     SWANWKDTWQQLGSIYGIKHQDTDMSSAQEIAKFAAEKANATADIGDVGGAFGPVAVK
                     QGVTQPYKPSTWADIPNWAKDADGHWMLAYTGTIAFLINKDLVKAAPTSWQSLLAGDY
                     KVTLGDVGVASQANNGVLAAAYATGGSEKNLKPALDLFGKLAKQGRLSLNDPTIANIE
                     KGEVEVGVLWDFNALNYRDQIDSKKFDVVIPSDGSVIAGYTTIINKWAKNPNAAKLAR
                     EYILSDAGQINLARGYARPIRSNVTLPDDVKAKLLPAEQYANAKPVQDHAAWEQSSKA
                     LPRQWQETVMINMQ"
     CDS             360565..361362
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707664.1"
                     /locus_tag="NUITMVA1_03180"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BDC80375.1"
                     /transl_table=11
                     /translation="MSVIESRLSERVTADGRASKCEQICQTLRRYIGSGQLAAGQQLP
                     AERALSERFATTRITIKEALSSLEADGLIYRAERRGWFVAPPRLTYDPAIHTHFHQWI
                     GEQQRTAETRVLAHGSELASSELCRWMGLDPFTPLYEIRRLRLIDGRPVLHVSHHLLA
                     SRFPDIASAPLASSLTELYQQRYGIGQGGASLEITPSAARGAIARALNLAEGSAVLRL
                     VRVNYDERGALVDCDIEHWRPDAIRICLDTRVLQPLAGKLQQTRLAD"
     CDS             complement(361550..362314)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707663.1"
                     /locus_tag="NUITMVA1_03190"
                     /product="transcriptional regulator"
                     /protein_id="BDC80376.1"
                     /transl_table=11
                     /translation="MTYSQTLANNILDTLKKTLTDKGIRYQTLAEAMGVSIATVKRMM
                     NKPSLPFDTLLEICHLVGLSFEELLDRTQDAQSRRAVFTQEQDEAFHKEPGLYAFLAN
                     IFWRDKTLIDLKREYGLTDASCYLYLRKLEKLGILQLGIDNSYHFLISERISFEQHSR
                     FARQQARQAMSVLGDYLVENMHKSNNYMALCQLHLDESEAMALIERMKEYWHQELKLN
                     RPAIGQREGSKTYTMSLQLADCGYQSFDDLIPNIDN"
     CDS             complement(362766..363680)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707662.1"
                     /locus_tag="NUITMVA1_03200"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BDC80377.1"
                     /transl_table=11
                     /translation="MAKELNKERALTLEAIRVLDAIDRRGSFAAAADELGKVPSALSY
                     TVQKLEDELDAMLFDRSGHRTKFTPAGRMLLERGRVLLEAAEHLVGETRALARGWETD
                     ITIAVDALVPLQALYPLVERLAELTDTRLRLRAEVLAGSWECLEDGRADLLISSLNPD
                     IMMTGIKHQPLQEEVMLYVAHPDHPLHQEPEPLADDTLRRYRAIAVADTALRKPVLTY
                     RLLDKQPRLTVSTMGEKRDALLAGIGVGTMPLSWIEEDIRAGRLKVISPEYRHQIQVV
                     LAWRRDTMGKAKSWLIREIPKLFPCKGE"
     CDS             363938..364270
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707661.1"
                     /locus_tag="NUITMVA1_03210"
                     /product="hypothetical protein"
                     /protein_id="BDC80378.1"
                     /transl_table=11
                     /translation="MNMKNVIKMLAVAGLMTAGFAQASVPADLNAAPGVLFVNWHATA
                     AVEGKGNPMLEVRDESGDLVASVHANLMGSQQVQIPSRTQGNLTVSLGEQSSDYRIPF
                     GIGSGKQR"
     CDS             364301..364987
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707660.1"
                     /locus_tag="NUITMVA1_03220"
                     /product="hypothetical protein"
                     /protein_id="BDC80379.1"
                     /transl_table=11
                     /translation="MMKLRAAEARGKANFGWLDARHSFSFGHYYDPDWMGHSVLRVIN
                     QDLVAPGGGFATHPHANMEILTCVLQGTIEHKDSLGHAEQIPAGDFQLMSAGSGIRHS
                     EYNPSQTEPLSLLQIWIEPNEHGTTPGYQQKKIEANPGMTLVASPDGEAGSFRIRQQA
                     RVWRLQLEPGESLTWELAGRHGYLQMISGELAANGLAAQPGDGVLSRDEPKWDLVAAS
                     ASQALLFDLP"
     CDS             365004..365420
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707659.1"
                     /locus_tag="NUITMVA1_03230"
                     /product="membrane protein"
                     /protein_id="BDC80380.1"
                     /transl_table=11
                     /translation="MTQNEDIEMDKMKDLALLVGRVLLALMFVIAGWGKIGGYAGTQG
                     YMEAMGVPGFILPLVILLELGGGLAIMLGLFTRSLSVLMAGFTLMAAFIFHYQPADQM
                     QMLMFMKNVSVAGGFLALAAAGAGAFSLDARFGKNW"
     CDS             365647..369000
                     /codon_start=1
                     /gene="recC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ59"
                     /locus_tag="NUITMVA1_03240"
                     /product="RecBCD enzyme subunit RecC"
                     /protein_id="BDC80381.1"
                     /transl_table=11
                     /translation="MFTLYHSNQLDLLKELLVSRIRQAPLSHPFEREQILVQSPGMAQ
                     WLKLELAKAFGIAANIDFPLPASFIWEMFTQVLADVPRQSPYNKGSMSWQLMTILPAL
                     LDRPAFAPLAAYLGGGDEEDPAKDPEQVRLWQLCQKVADLFDQYLVYRPDWIARWEEG
                     EGLGPELAGVSGQDWQPELWRELVARTLALSPSGYHRANLYEEFIHELERTATLPGKL
                     PQRVFVFGISALPPRYVEALLALGSRPEVEVHLFVTNPCRYYWGDLLDRKTLAHLENK
                     LKPGTDIETLQGPANPLLASMGKLGRDYLHQLMELEVPQIEAFVDIDELDAKGNIKLL
                     HAIQKDVLELAERGAGQFDLDASHHKSPLDPADGSLQIHACHGPMRELEVLHDRLLAL
                     FEQDPSLTPKDVVVMMPDVNSYGPYIQAVFGARGQIPFAVSDRAASQESPLLQSFLAL
                     LRLPNARFGAGELLAILEVPAVLRRFELDDEEFNQLRVWVQETGIRWGLDDGYPERFD
                     LPRLSGNSWLFGLRRMLLGFAMGDGEPVAGILPYADIEGQQGLALGKLAWFVDSLAEF
                     LPRLQQAQPLGEWVACLNALLERFYLADEDEERQLQLIRSQLADWLAQLGEARFEQPI
                     SADLLQDYLGSVLGESRSSQRFLAGQVNFCTLMPMRSIPFKQVCLLGMNDGVYPRTLP
                     PMGFDLMAVAGRRGDRSRRDDDRYLFLEALLSAQQGLYISYQGFSAQDNSDKVPSVLL
                     AELIDYVRQGFVLAGDEKLDDESSGKRLLAHLITQHPLTPYSHAYFYPAAGSGLFTYA
                     ADWLPALHPQRGAANFQSGELPLPPEWGKEQGLELAELLRFYRQPARYFLNRRLKVWF
                     ELNEANIEESEPFELDGLQHYQLKDLLLDAHLTEGDSAVRRERLQLTGLLPQGWFGSL
                     LLEDLDEQMGKLADRLRPWVAANETEKQAVEVDIALAQGQLQGWIDTQKGRLLVVKPG
                     SFNGKDLLLGWIQHLCLSLSDAPGDTLLFDAKQSLRLARLPADEARPKLAALVALWMQ
                     GMKRPLPFFPSTAWDWLKAIEKDPEKPEAADKAALTRFNGGYMAKGEGEDAYVARCFP
                     ELDEAVLAQLQALAREHLTPLLKSLEELQ"
     CDS             369000..372617
                     /codon_start=1
                     /gene="recB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ58"
                     /locus_tag="NUITMVA1_03250"
                     /product="RecBCD enzyme subunit RecB"
                     /protein_id="BDC80382.1"
                     /transl_table=11
                     /translation="MANPLNTLRFPLYGERLIEASAGTGKTYTIAGLYLRLLLGHGPL
                     IEEGEDAGQPSAHERPLSVTEILVVTFTEAATAELRGRIRGRIHEARLAFMRGESKDA
                     LLSQLLAEVEDHELAARRLLAAERQMDEAAVFTIHGFCQRMLKQNAFESGALFETEFL
                     TDDSQLRLQAVSDYWRSEFYPVDKPLASAVRALWPSPAALLREMGSWLDNSELEMRPP
                     AGDETLAARHQAAMARIEAVKREWLAQGDEIRRQTDGQVSRYTGKNYEGWLAKIADWA
                     QDEHSGYAIPKELERFGQTVLEENLKKGGAVPTLPLFSQIDQLLASRPGIRDLILQRA
                     AVVVRSRMQASKRQAHQLSFDDLLKDLDGALGSGLGERLCERIRATYRVAMIDEFQDT
                     DPQQYRIFHRLYGGHTDTALLMIGDPKQAIYGFRGADIFTYIQARRNVSAHYTLGRNW
                     RSSRALVAAVNGLFERAKDPFIYEADIPFLPVEAQGKSKALQLDGEAAPVLHCWQLSG
                     QPTFNKGDYQSRMARATAVEIHRLLTLARAGKAQIGDQPVKAGDIAVLVRTGAEGKLV
                     QQELARLAIASVYLSNRESVLAQVEAREILLILHACQNPGEERSLRAALATGLFDLDA
                     KALDELASDERAWESAVQEFMEYRKIWHKRGVLAMLRALLHRRNLASSLLASPNGERR
                     LTNFLHLGELLQQVSCELDGEYALLRWLGEAASRPDGQDAEQVLRLESERKLVQIVTI
                     HKSKGLEYPLVFLPFICSHRAADTPLFHEADGAGNRTVLDLTGAEASLAEADRERLAE
                     DLRLLYVALTRGVYATWLGLAPVRSGNGKSEQTDLHQTAIGYLLQKGEEGDATTLATA
                     LTELAQALPGVAVGEPSLTRPAPMAAEEEQPGEPQVRHFTGTLERDWWISSYSGLAAQ
                     GHGHSKGVLANPGFDDEVVTEAAALASDLSTAQQEEAPLPSIFTFPKGARPGTLLHSL
                     FETIDFQSAGGEPLAEHIATLLAQDGFDESWASVLQQQVEAVLDTPLETGFGEPVRLR
                     DLAPERKQVELEFFLPMGRVTAPALTALCQQHDPLSRGNKPLSFATVQGMLKGFIDLV
                     FEWQGRWYLLDYKSNHLGMSPADYSRPALEQAMAEHRYDLQYQLYSLALHRLLALRLP
                     GYDFEQHFGGAFYLFLRGMPQGGIFHTRPSRELVLGLDRLFGEGAAPALAGVSDNGVE
                     A"
     CDS             372614..374668
                     /codon_start=1
                     /gene="recD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ57"
                     /locus_tag="NUITMVA1_03260"
                     /product="RecBCD enzyme subunit RecD"
                     /protein_id="BDC80383.1"
                     /transl_table=11
                     /translation="MNGTMMIERLKALALAGRIRQLDVQFARLVADLGGSPELVLGAA
                     LACFELGRGHVCLPLEMLTHSGNEKGSLRPFGLDPDQSRDLLADLADPARWPALFAES
                     PLVGTEQHDGEAPRWPLRLWHGRLYLTRYHDHEQGVARHLRALSERAEWPEIAPALSR
                     LFARDYGLVFGALLKARLAPDFSPRHFIEKYLDLVFPNEVDWPAIEGLLASAQAASDL
                     SVLDALVPEALCCNGQKLAAATAAARPFAVISGGPGTGKTTTVAKLLAILVETGLQAG
                     KAPAIRLVAPTGKAAARLTESIGSALQALDLPPEWVEAIPTEAGTLHRLLGVIPGRSQ
                     FRHHAGNPLHLDLLVVDEASMVDLPMMARLLDALPSYARLILLGDKDQLASVEAGAVL
                     GDICSFIEQGISPAQADWLSRQTGYRLQGTPAGAPVRDSLCLLAKSWRFDQHSGIGQL
                     ARACNSGDATAVEAVWGAGFADISLHPWAGEAYDALIAQGVAGYGSYLQAARAGEAPA
                     AVFKAFSSFQILCALRDGPFGVLGLNERLELALSRAGLIARDGDWYAGRPVMVVRNDH
                     GVGLYNGDMGLCLPDESGRLKVWFEQPDGTLRALLPSRLPPHETVYAMTIHKSQGSEF
                     AHTVLVLPDSPSPLLTRELVYTGITRAKARLDLYGDRALLAQAVRKKTERYSGLAERL
                     GE"
     CDS             375051..375761
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03270"
                     /product="hypothetical protein"
                     /protein_id="BDC80384.1"
                     /transl_table=11
                     /translation="MQLSWTKMPSKWISSGKLKDLNANKNIAVNIAAIKIYILICIRL
                     APSDNPRNSCVITYDEISSVANLSRTVISGALKWLIANNIIEANGKRVRVYNIPNYNN
                     PGWCKFPIKDVVDKGGDINFFKMISNRHPVELHALKLVVYLLAIRGNDDEHSEVSLSK
                     IISKTGINYKDIFPALTLLKVLGLVSDFQRETLPQRGIRVSLMEYKQDEVLNVYFPYG
                     SYLPKSTRRSISMPAITV"
     CDS             complement(376065..376463)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707654.1"
                     /locus_tag="NUITMVA1_03280"
                     /product="lactoylglutathione lyase"
                     /protein_id="BDC80385.1"
                     /transl_table=11
                     /translation="MHIHHVAIWAQDLEALKAFYCTLFGGQANERYHNPSKQFSSYFV
                     RFEGGASLELMHTPILFPADLHLPHPLQGLAHIAFSLGSTEEVDKMTARLKLLKGAEV
                     KHLDGPRWTGDGYYESTFLDPEGNRLELTI"
     CDS             376539..377459
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707653.1"
                     /locus_tag="NUITMVA1_03290"
                     /product="AraC family transcriptional regulator"
                     /protein_id="BDC80386.1"
                     /transl_table=11
                     /translation="MMSETANTDLVDVSPDCREQICCDSLLPALAQEQVWLAGYSRLK
                     TRYRIARRFADVHCFLLTLGGEGEVQVGDRRERLQVGEWALIPAGEPLCYQLSEQLSE
                     QVNEPLDQPLSETGEWELVWLLLHKDSPWDAFASHPRLGCTSQQATVLRTLENLYAEQ
                     ERHQDPLLSALLVEQLGFYLRRLLQKGEGQRRGERLALRLELLLKETLIEPWDIARMA
                     GALHLSERQLYRLCQQHFALAPMALLQRLRLQRAALLLASRADPVKLLAEQCGFKNEY
                     HFSTAFKRQHGLAPSHYRSLHHPAFKTGQG"
     CDS             377648..378649
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707652.1"
                     /locus_tag="NUITMVA1_03300"
                     /product="diguanylate cyclase"
                     /protein_id="BDC80387.1"
                     /transl_table=11
                     /translation="MLQDSDTIRISDVSEAVIHGILAVVSDGIWDWNANTGFVYRNPG
                     WYQMLGYEAHTLGNNVFTWESVIHPDDMDRVMASFDAYLSGAAPDYRVEYRCRSRGGD
                     YIWIEDCGRVIARNPDGSVARMIGAHRNIHAQKLLLEQLERRNHSLEQQIAERTAELV
                     RLNEALQQKAEENRQLAETDALTGAASRYRLERAIRQECERAKRFHQPFSVIAMDVDD
                     FKQINDNHGHHAGDQTLINIVALVRSHIREIDLIARWGGDEFMVVLPNTGRCDGRLVA
                     DKLRELLVQSRVCQHFDITMSFGLAEYQPDEPMSQLMVRVDRALYQAKLTGKNQICE"
     CDS             378804..379223
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707651.1"
                     /locus_tag="NUITMVA1_03310"
                     /product="hypothetical protein"
                     /protein_id="BDC80388.1"
                     /transl_table=11
                     /translation="MKKSILVALTALPLMANAGLMDSLTDTVTSSVTSTAKEMAGTAM
                     DSASNEAIKKALDIKEGGSNKQAIKDKLGAPASTKTEAGLEVWTYDLGALNKVSPMLA
                     ETSKTLFKDAEAAQKNVLIKFEGETVKTLNLVDKTKA"
     CDS             complement(379282..379632)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707650.1"
                     /locus_tag="NUITMVA1_03320"
                     /product="hypothetical protein"
                     /protein_id="BDC80389.1"
                     /transl_table=11
                     /translation="MKKLTKTLLTATLILGLPLGAYAASEAVTTAQPGMMTDCPMDGS
                     GMMGGKHHGGRHDKMARMQNMTPEQIQTHLQQRYDKIEDPAKKAEFVKNLSLRADGMT
                     KHAEAMKQFAEAHQ"
     CDS             complement(379852..380151)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707649.1"
                     /locus_tag="NUITMVA1_03330"
                     /product="hypothetical protein"
                     /protein_id="BDC80390.1"
                     /transl_table=11
                     /translation="MLAGLAHTGLAQAALPADVSAAPGLLFVNWHDAVSSNEAHPTLV
                     IRNATGDVLKRVPAELQGMQQVRLPMRAQGDLTLSLDGESSSYRMPYSVGSGRQR"
     CDS             complement(380255..380434)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03340"
                     /product="hypothetical protein"
                     /protein_id="BDC80391.1"
                     /transl_table=11
                     /translation="MLALTTPLLLAFAASEALARKASGSSPQPASSPNHKQTSPADRA
                     PGRGDVKGATESPSS"
     CDS             380615..381337
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707648.1"
                     /locus_tag="NUITMVA1_03350"
                     /product="DNA-binding response regulator"
                     /protein_id="BDC80392.1"
                     /transl_table=11
                     /translation="MNQSSTHILVVDDHSEIRDLLKRFLEQHGLRVSCARDGKEMKRL
                     LEEREFDLLVLDLMMPGEDGLTLCRELRAKSSLPIIMLTAMGEETDRIIGLEMGADDY
                     LAKPFNPRELLARIKAVMRRTQVEPQPAAETLTRDLRFDRWLLDINRRELVDEEGVGL
                     SLSTAEFDLLRVFLERPQRVLSRDQLLDLARGREAVAFDRAIDTLVSRLRRKLERDPK
                     NPELIKTIWGGGYLFAADVTQV"
     CDS             381342..382733
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707647.1"
                     /locus_tag="NUITMVA1_03360"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BDC80393.1"
                     /transl_table=11
                     /translation="MGILKRGWSKLWPKGLTGQIILVALAGLVLIQLLSIQIYRTDRE
                     EALGYINSRNAMQRIVSVVRLLALSPPSLYDEIIKASRSETLLLRIADEPLQPDNRSP
                     RFEQLVRSRLGYPSTLMVEISAELKQDAQRSRAWQHHSRMMKDRKGMPPPQDMRLYGS
                     IQLPRGGWLQFSSLVDKESASWSWQTTLNLMLVASLVIGLMIWLFRRATLPLKQLAAN
                     ADRLGRGEDIEPLREEGPTEVRESIQAFNRMHTRLDRFVQDRTRMLAAISHDLRTPIT
                     SLRLRTEFLDEGEDKERIQQTLQQMEQMLAATLSFAREEGQQEATRELDLVSLLESLC
                     DDYADTGQPVTCLAEGKQVYACRANTLRRVLQNLIGNAIKYAGSAEVSLERTDSELVI
                     RVCDQGPGIDPARLEDVFKPFVRLDEARNTESGSVGLGLSIARTLVHQHGGELTLHNR
                     EQGGLEARISLPL"
     CDS             382984..384324
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707646.1"
                     /locus_tag="NUITMVA1_03370"
                     /product="sensor domain-containing diguanylate cyclase"
                     /protein_id="BDC80394.1"
                     /transl_table=11
                     /translation="MLANTPIKPLIVTNSKAWQPFSYLNEEGQPDGLLIDLWREYGRV
                     TGRPIQFKLVDWQASLDLVRNGQADVHGGLLWSPERNLVYDYGQALSHVDSQLFFANS
                     LRGSDVNYYLLHESVGVVTGGYEEYYARKHFPTTRLRTFDDNDAMLRAAFSGELDAFI
                     ADLQVANFYIYTSADPTRFIPVRHLYSDEIRFAVAKGNQVLQQELEQGFSRIGEADRE
                     RIVRKWMHIETVYPAHLWPWLLAIGGLVLMAYIIQLRRAVASRTAELIQANARLERLA
                     GTDSMTGILNRRAFLPLLDQRLASGQASALLLFDLDRFKGINDHFGHGVGDEVLSAMV
                     AQVQRVLPASALFARIGGEEFCISLLVADMATLQQWAARIGREVNSHKLPTSAGALGI
                     SISTGAVWVPAGGGAEGRRVLLQADQLMYGAKSQGRNTWQAASYVKEAAGEAGK"
     CDS             complement(384359..386314)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707645.1"
                     /locus_tag="NUITMVA1_03380"
                     /product="ligand-gated channel protein"
                     /protein_id="BDC80395.1"
                     /transl_table=11
                     /translation="MITMHRNKLTTLILAALASHAYAAEQEVMVVTASGFQQKIEDTA
                     ASISVVTREQLEKRAYRDVTDALKDVPGVVITGGGSSSDISIRGMGSKYTLMLVDGKR
                     VDSRGTRPNSDGPGIEQGWLPPLQAIERIEVVRGPMSSRYGSDAMGGVINVITRKTAS
                     MTAWQGSLHADSTFQENKESGDIFQTNAYTAGALVDGLLGVRVNGQLSHRGEDQFQNG
                     FAEQEMRSGTAVFSLTPDEHNRFDFEASRGLQDRNRTPGESLSAKSKPSLSTYERTNF
                     AITHDGRYDFGSSTSYLQREENTNPGRQMQLINTIADTHTQFELGAHYLSVGGQYRYE
                     DLQDQGNQLNVANRANQLTRWSWAMFVEDEWSLTDTFALTGGVRMDQDQNYGTHWSPR
                     LYGVWHLADSWTLKGGVSTGYRSPDLRMSAANWGQATGGGTQDGMLVGSPELKPETSV
                     SQEIALLWDGQQGLNTGLTLFNTDFEDKISEIRRCESKSNPSCTLNGHTYDFISDRIN
                     VDKANMRGVEGTANWTINDAWSLASSYTFTQSEQKSGAMEGKPLNQMPRHMFNTTVDW
                     QTTETVSLWSRVNFRSKTSDYLSRVKMAEGTPSYTFFDTGLVYKANEHLDVTAGVYNL
                     FDKTVDYSSFGTVLDGRRYTLGMTYNF"
     CDS             complement(386714..386926)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707644.1"
                     /locus_tag="NUITMVA1_03390"
                     /product="cold-shock protein"
                     /protein_id="BDC80396.1"
                     /transl_table=11
                     /translation="MSNKMTGTVKFFNAEKGFGFISPTDGSKDVFVHFSAIQTPGFKT
                     LDEGQRVEFTIEQGQKGPAAANVVAL"
     CDS             complement(387326..387640)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707643.1"
                     /locus_tag="NUITMVA1_03400"
                     /product="hypothetical protein"
                     /protein_id="BDC80397.1"
                     /transl_table=11
                     /translation="MDYSRHQEHAVKKLEMKDLTDAEKAEITLLLQKAQANADHQLSN
                     AERNRIREEGRLKIVADRAAAAKVAAKLAREKAKERASKQVLPETFSWVDSVSNKFRS
                     KR"
     CDS             complement(387760..388578)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707642.1"
                     /locus_tag="NUITMVA1_03410"
                     /product="cation transporter"
                     /protein_id="BDC80398.1"
                     /transl_table=11
                     /translation="MKIFAGILSGSVSIISEAIHSAMDLVAALIALVAVRKSDIPPDQ
                     RHPYGHDKIENVSGVIEALLILLAAGWIIFEAVGKLITPTPIEGVGLGVLVMLFSALV
                     NSGVSAYLYRVAKEEESVALAADALHLKADVLTSLGVAVGLLGIWIAARLGYNLYLLD
                     PIVAICVALFILKEAIAMLKQAFQPLLDHSMDEEELAITTRVIEECCPEHGGFHDLRS
                     RQAGRRRHIDFHLTLPKEMSIEHSHAICDRIEQGIMRHLPHAVVLIHVEPSGHG"
     CDS             389092..389214
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707641.1"
                     /locus_tag="NUITMVA1_03420"
                     /product="hypothetical protein"
                     /protein_id="BDC80399.1"
                     /transl_table=11
                     /translation="MSNKEHHNGKDAKKKPQMSLKEKREAKRQKADLKNGGAMK"
     CDS             complement(389295..390053)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707640.1"
                     /locus_tag="NUITMVA1_03430"
                     /product="polar amino acid ABC transporter"
                     /protein_id="BDC80400.1"
                     /transl_table=11
                     /translation="MGSWYRILLCVAACATLLLPSLLLAGEPLRVGVSFAIPPYVIEE
                     EGRGIELDLMREAFRDSGYEPQFEYLPLERTFRMLESGKLDAIINVKPGMLHDVFLSQ
                     PVIAFHNRVFTLGKTHISTLDDMKTLRVSAFQRARQVLGGAFASMADQNPRYEEVAKQ
                     QGQVHRLMLGRVDAVILEQRVFYYYLAQLANSKYGAELYAPGRVRQYDLFAPTHYHFA
                     FRQAAQQRWFDRRLDAMRADGRYQRIFARYGATP"
     CDS             390787..391224
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03440"
                     /product="hypothetical protein"
                     /protein_id="BDC80401.1"
                     /transl_table=11
                     /translation="MPPEERIITIEDVHELFLPNHPNRVHMLYGYGAGRVSADECLAA
                     CMRQSPDRIFLAELRGNEAWEYLNSLNTGHPGSITTTHANNALQTFERCATLIKKSDV
                     GRQLEMEMIKLVLYTTIDVVLFFKDRKLVEVFYDPIFSKSKMA"
     CDS             complement(391358..394243)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001138082.1"
                     /locus_tag="NUITMVA1_03450"
                     /product="transposase"
                     /protein_id="BDC80402.1"
                     /transl_table=11
                     /translation="MPRRVTLTDRQKDALLRLPTSQTDLLKHYTLSDEDFGHIRLRRR
                     AHNRFGFALQLCVLRYPGRVLAPGELIPAEVIEFIGAQLGLGADDLVDYAAREETRHE
                     HLAELRGLYGFRTFSGRGASELKEWLFREAEMAVSNEDIARRFVAECRRTRTVLPATS
                     TIERLCAAALVDAERRIETRIASRLPMSIREQLLALLEETADDRVTRFVWLRQFEPGS
                     NSSSANRLLDRLEYLQRVDLPEDLLAGVPAHRVTRLRRQGERYYADGMRDLPEDRRLA
                     ILAVCVSEWQAMLADAVVETHDRIVGRLYRASERICHAKVADEAGVVRDTLKSFAEIG
                     GALVDAQDDGQPLGDVIASGSGWDGLKTLVAMATRLTATMADDPLNHVLDGYHRFRRY
                     APRMLRLLDLRAAPVALPLLEAVTALRTGLNDAAMTSFLRPSSKWHRHLRAQRAGDAR
                     LWEIAVLFHLRDAFRSGDVWLTRSRRYGDLKHALVPAQAIAEGGRLAVPLRPEEWLAD
                     RQARLDMRLRELGRAARAGTIPGGSIENGVLHIEKLEAAAPTGAEDLVLDLYKQIPPT
                     RITDLLLEVDAATGFTEAFTHLRTGAPCADRIGLMNVILAEGINLGLRKMADATNTHT
                     FWELIRIGRWHVEGEAYDRALAMVVEAQAALPMARFWGMGTSASSDGQFFVATEQGEA
                     MNLVNAKYGNTPGLKAYSHVSDQYAPFATQVIPATASEAPYILDGLLMNDAGRHIREQ
                     FTDTGGFTDHVFAACAILGYRFAPRIRDLPSKRLYAFNPSAAPAHLRALIGGKVNQAM
                     IERNWPDILRIAATIAAGTVAPSQILRKLASYPRQNELATALREVGRVERTLFMIDWI
                     LDAELQRRAQIGLNKGEAHHALKRAISFHRRGEIRDRSAEGQHYRIAGMNLLAAIIIF
                     WNTMKLGEVVANQKRDGKLLSPDLLAHVSPLGWEHINLTGEYRWPKP"
     CDS             394369..394983
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000904906.1"
                     /locus_tag="NUITMVA1_03460"
                     /product="multiple promoter invertase"
                     /protein_id="BDC80403.1"
                     /transl_table=11
                     /translation="MLIGYARVSKADGSQSLDLQHDALRAAGVERDNIYDDLASGGRD
                     DRLGLTACLKSLRDGDVLVVWKLDRLGRSLAHLVNTVKELSDRKIGLRVLTGKGAQID
                     TTTASGRMVFGIFATLAEFERDLIRERTMAGLASARARGRKGGRKFALTKAQVRLAQA
                     AMAQRDTSVSDLCKELGIERVTLYRYVGPKGELRDHGKHVLGLT"
     CDS             395049..395852
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001082319.1"
                     /locus_tag="NUITMVA1_03470"
                     /product="aminoglycoside O-phosphotransferase APH(3'')-Ib"
                     /protein_id="BDC80404.1"
                     /transl_table=11
                     /translation="MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASR
                     RGELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAW
                     PSMGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPQLDLL
                     ARVERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLA
                     LMIANAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG"
     CDS             395945..396688
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000480968.1"
                     /locus_tag="NUITMVA1_03480"
                     /product="aminoglycoside O-phosphotransferase APH(6)-Id"
                     /protein_id="BDC80405.1"
                     /transl_table=11
                     /translation="MPDGTPAIVKGLKPIEDIADELRGADYLVWRNGRGAVRLLGREN
                     NLMLLEYAGERMLSHIVAEHGDYQATEIAAELMAKLYAASEEPLPSALLPIRDRFAAL
                     FQRARDDQNAGCQTDYVHAAIIADQMMSNASELRGLHGDLHHENIMFSSRGWLVIDPV
                     GLVGEVGFGAANMFYDPADRDDLCLDPRRIAQMADAFSRALDVDPRRLLDQAYAYGCL
                     SAAWNADGEEEQRDLAIAAAIKQVRQTSY"
     CDS             396999..397658
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3EUC4"
                     /locus_tag="NUITMVA1_03490"
                     /product="chloramphenicol acetyltransferase"
                     /protein_id="BDC80406.1"
                     /transl_table=11
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAF
                     LKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETF
                     SSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNV
                     ANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGG
                     A"
     CDS             complement(397859..398302)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000656305.1"
                     /locus_tag="NUITMVA1_03500"
                     /product="N-acetyltransferase"
                     /protein_id="BDC80407.1"
                     /transl_table=11
                     /translation="MVGIFTEMEEHYYGEGIIQEALMKDYLCKKLFNRLSGTLVIRAR
                     CGNNITGLACCNILYPSPRYSGQLHIKELYVSQCDRNKGTGKAIMRFIARLALEQECL
                     SLSWNAEKSNPGANRFYQALGGRINDHIVNYYLHGESLSKLASGI"
     CDS             complement(398338..398715)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03510"
                     /product="hypothetical protein"
                     /protein_id="BDC80408.1"
                     /transl_table=11
                     /translation="MDEQWGYVGAKSRQRWLFYAYDRLRKTVVAHVFGERTMATLGRL
                     MSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSL
                     SFSKSVELHDKVIGHYLNIKHYQ"
     CDS             399317..400021
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001313567.1"
                     /locus_tag="NUITMVA1_03520"
                     /product="IS6 family transposase"
                     /protein_id="BDC80409.1"
                     /transl_table=11
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     CDS             complement(400211..400972)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010970345.1"
                     /locus_tag="NUITMVA1_03530"
                     /product="aminoglycoside phosphotransferase APH(3')"
                     /protein_id="BDC80410.1"
                     /transl_table=11
                     /translation="MDADLYGYKWARDNVGQSGATIYRLYGKPDAPELFLKHGKGSVA
                     NDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQVLEEYPDSGENI
                     VDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQV
                     WKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCL
                     GEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     CDS             complement(401134..402081)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002221064.1"
                     /locus_tag="NUITMVA1_03540"
                     /product="IS30 family transposase"
                     /protein_id="BDC80411.1"
                     /transl_table=11
                     /translation="MSYQQLTEGQRYQLSVLRAQGMSILATARAIGVHRSTLYRELRR
                     NAGPQGYQPDNAHQHATHRRASAAKSRLSADVIQFVELTLAWWWSPEQISAVGKQIGL
                     MVSHEWIYRHVAADKARGGQLYRHLRQGHKRYRKGASSLRSPIKEARSIDERPAIVDS
                     RERLGDWEADTVLGKQGTGALVTLVERKSRLYLVKRVASKQAGVVRDAIIEMLTPYIE
                     QVHTITFDNGGEFAEHKAIEEALGAETYFAHPYSSWERGLNENSNGLLRQFIPKGTDL
                     REVTDEDVRRAEQWLNLRPRKCLGFRQPVKVFEEYRQAA"
     CDS             402264..402968
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001313567.1"
                     /locus_tag="NUITMVA1_03550"
                     /product="IS6 family transposase"
                     /protein_id="BDC80412.1"
                     /transl_table=11
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     CDS             403600..404337
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001366550.1"
                     /locus_tag="NUITMVA1_03560"
                     /product="resolvase"
                     /protein_id="BDC80413.1"
                     /transl_table=11
                     /translation="MRRTKPVAAPMVARVYLRVSTDAQDLERQEAITTAAKAAGYYVA
                     GIYREKASGARADRPELLRMIGDLQPGEVVIAEKIDRISRLPLPEAERLVASIQAKGA
                     RLAVPGVVDLSDLAAEAQGVAKIVLEAVQIMLFRLALQMARDDYEDRRERQRQGIELA
                     RQAGRYKGRRADPKRRAQVVALRKSGYSINKTAELAGYSAAQVKRIWAEVSQAEAKQH
                     GAFVEDALTEADALAAVGQDERQEERA"
     CDS             404334..404558
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000743213.1"
                     /locus_tag="NUITMVA1_03570"
                     /product="hypothetical protein"
                     /protein_id="BDC80414.1"
                     /transl_table=11
                     /translation="MKKPNQDDEPFFITEEIAAEMIAGGYEFELPPIPCTIRLRDVLE
                     RMTDAELALQPGEIADQERERCRRKPCSTS"
     CDS             404769..406262
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001120888.1"
                     /locus_tag="NUITMVA1_03580"
                     /product="IS91 family transposase"
                     /protein_id="BDC80415.1"
                     /transl_table=11
                     /translation="MPHVAARTASRDRDTGRYQSHRPEQTLLYQIVDEYYPAFAALMA
                     EQGKELPGYVQREFEEFLQCGRLEHGFLRVRCESCHAEHLVAFSCKRRGFCPSCGARR
                     MAESAALLVDEVLPEQPMRQWVLSFPFQLRFLFASRPEIMGWVLGIVYRVIATHLVKK
                     AGHTHQVAKTGAVTLIQRFGSALNLNVHFHMLFLDGVYVEQSHGSARFRWVKAPTSPE
                     LTQLTHTIAHRVGRYLERQGLLERDVENSYLASDAVDDDPMTPLLGHSITYRIAVGSQ
                     AGRKVFTLQTLPTSGDPFGDGIGKVAGSSLHAGVAARADERKKLERLCRYISRPAVSE
                     KRLSLTRGGNVRYQLKTPYRDGTTHVIFEPLDFIARLAALVPKPRVNLTRFHGVFAPN
                     SRHRALVTPAKRGRGNKVRVADEPATPAQRRASMTWAQRLKRVFNIDIETCSGCGGAM
                     KVIACIEDPIVIKQILDHLKHKAETSGTRALPESRAPPAELLLGLFD"
     CDS             407046..407891
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001290782.1"
                     /locus_tag="NUITMVA1_03590"
                     /product="carboxylesterase"
                     /protein_id="BDC80416.1"
                     /transl_table=11
                     /translation="MKEKIIKTNGIELCTESFGNKKNPAILLVAGATVSMLYWDTEFC
                     QQLSEKGFFVIRYDNRDVGKSTNYEPGSAPYDIVDLTNDAIAILDGYEIDKAHFVGMS
                     LGGLITQIAAIKFADRVSSLTLMSTGPWGDSDPTIPEMDTRILDFHGKAGTVDWSNED
                     SVVNYLIQGAELMCGKKQFDKQRSEKLIRAEFNRANNYISMFNHATLQGSEEYWNRLN
                     EVNQPTLIIHGTDDKIWHYKNAGVLIEKIQNTKLITLEGTGHELHFEDWTTIIDGIEK
                     HINEQ"
     CDS             407902..409038
                     /codon_start=1
                     /gene="tetX_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011963656.1"
                     /locus_tag="NUITMVA1_03600"
                     /product="tetracycline resistance protein"
                     /protein_id="BDC80417.1"
                     /transl_table=11
                     /translation="MNLLSDKNVAIIGGGPVGLTMAKLLQQNGIDVSVYERDNDREAR
                     IFGGTLDLHKGSGQEAMKKAGLLQTYYDLALPMGVNIADEKGNILSTKNVKPENRFDN
                     PEINRNDLRAILLNSLENDTVIWDRKLVMLEPGKKKWTLTFENKPSETADLVIIANGG
                     MSKVRKFVTDTEVEETGTFNIQADIHHPEVNCPGFFQLCNGNRLMAAHQGNLLFANPN
                     NNGALHFGISFKTPDEWKNQTQVDFQNRNSVVDFLLKEFSDWDERYKELIRVTSSFVG
                     LATRIFPLGKSWKSKRPLPITMIGDAAHLMPPFAGQGVNSGLMDALILSDNLTNGKFN
                     SIEEAIENYEQQMFIYGKEAQEESTQNEIEMFKPDFTFQQLLNV"
     CDS             409377..410870
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001120888.1"
                     /locus_tag="NUITMVA1_03610"
                     /product="IS91 family transposase"
                     /protein_id="BDC80418.1"
                     /transl_table=11
                     /translation="MPHVAARTASRDRDTGRYQSHRPEQTLLYQIVDEYYPAFAALMA
                     EQGKELPGYVQREFEEFLQCGRLEHGFLRVRCESCHAEHLVAFSCKRRGFCPSCGARR
                     MAESAALLVDEVLPEQPMRQWVLSFPFQLRFLFASRPEIMGWVLGIVYRVIATHLVKK
                     AGHTHQVAKTGAVTLIQRFGSALNLNVHFHMLFLDGVYVEQSHGSARFRWVKAPTSPE
                     LTQLTHTIAHRVGRYLERQGLLERDVENSYLASDAVDDDPMTPLLGHSITYRIAVGSQ
                     AGRKVFTLQTLPTSGDPFGDGIGKVAGSSLHAGVAARADERKKLERLCRYISRPAVSE
                     KRLSLTRGGNVRYQLKTPYRDGTTHVIFEPLDFIARLAALVPKPRVNLTRFHGVFAPN
                     SRHRALVTPAKRGRGNKVRVADEPATPAQRRASMTWAQRLKRVFNIDIETCSGCGGAM
                     KVIACIEDPIVIKQILDHLKHKAETSGTRALPESRAPPAELLLGLFD"
     CDS             411654..412295
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001290782.1"
                     /locus_tag="NUITMVA1_03620"
                     /note="frameshifted, deletion at around 412292"
                     /product="carboxylesterase"
                     /protein_id="BDC80419.1"
                     /transl_table=11
                     /translation="MKEKIIKTNGIELCTESFGNKKNPAILLVAGATVSMLYWDTEFC
                     QQLSEKGFFVIRYDNRDVGKSTNYEPGSAPYDIVDLTNDAIAILDGYEIDKAHFVGMS
                     LGGLITQIAAIKFADRVSSLTLMSTGPWGDSDPTIPEMDTRILDFHGKAGTVDWSNED
                     SVVNYLIQGAELMCGKKQFDKQRSEKLIRAEFNRANNYISMFNHATLQGSEEY"
     CDS             412292..412498
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03630"
                     /note="frameshifted, deletion at around 412292"
                     /product="hypothetical protein"
                     /protein_id="BDC80420.1"
                     /transl_table=11
                     /translation="MNRLNEVNQPTLIIHGTDDKIWHYKNAGVLIEKIQNTKLITLEG
                     TGHELHFEDWTTIIDGIEKHINEQ"
     CDS             412488..413120
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03640"
                     /note="frameshifted, deletion at around 413093"
                     /product="hypothetical protein"
                     /protein_id="BDC80421.1"
                     /transl_table=11
                     /translation="MSNKEKQMNLLSDKNVAIIGGGPVGLTMAKLLQQNGIDVSVYER
                     DNDREARIFGGTLDLHKGSGQEAMKKAGLLQTYYDLALPMGVNIADEKGNILSTKNVK
                     PENRFDNPEINRNDLRAILLNSLENDTVIWDRKLVMLEPGKKKWTLTFENKPSETADL
                     VIIANGGMSKVRKFVTDTEVEETGTFNIQADIHHPEVNCPGFFSYAMETG"
     CDS             413120..413644
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03650"
                     /note="frameshifted, deletion at around 413099"
                     /product="hypothetical protein"
                     /protein_id="BDC80422.1"
                     /transl_table=11
                     /translation="MAAHQGNLLFANPNNNGALHFGISFKTPDEWKNQTQVDFQNRNS
                     VVDFLLKEFSDWDERYKELIRVTSSFVGLATRIFPLGKSWKSKRPLPITMIGDAAHLM
                     PPFAGQGVNSGLMDALILSDNLTNGKFNSIEEAIENYEQQMFIYGKEAQEESTQNEIE
                     MFKPDFTFQQLLNV"
     CDS             413983..415476
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001120888.1"
                     /locus_tag="NUITMVA1_03660"
                     /product="IS91 family transposase"
                     /protein_id="BDC80423.1"
                     /transl_table=11
                     /translation="MPHVAARTASRDRDTGRYQSHRPEQTLLYQIVDEYYPAFAALMA
                     EQGKELPGYVQREFEEFLQCGRLEHGFLRVRCESCHAEHLVAFSCKRRGFCPSCGARR
                     MAESAALLVDEVLPEQPMRQWVLSFPFQLRFLFASRPEIMGWVLGIVYRVIATHLVKK
                     AGHTHQVAKTGAVTLIQRFGSALNLNVHFHMLFLDGVYVEQSHGSARFRWVKAPTSPE
                     LTQLTHTIAHRVGRYLERQGLLERDVENSYLASDAVDDDPMTPLLGHSITYRIAVGSQ
                     AGRKVFTLQTLPTSGDPFGDGIGKVAGSSLHAGVAARADERKKLERLCRYISRPAVSE
                     KRLSLTRGGNVRYQLKTPYRDGTTHVIFEPLDFIARLAALVPKPRVNLTRFHGVFAPN
                     SRHRALVTPAKRGRGNKVRVADEPATPAQRRASMTWAQRLKRVFNIDIETCSGCGGAM
                     KVIACIEDPIVIKQILDHLKHKAETSGTRALPESRAPPAELLLGLFD"
     CDS             416260..417105
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001290782.1"
                     /locus_tag="NUITMVA1_03670"
                     /product="carboxylesterase"
                     /protein_id="BDC80424.1"
                     /transl_table=11
                     /translation="MKEKIIKTNGIELCTESFGNKKNPAILLVAGATVSMLYWDTEFC
                     QQLSEKGFFVIRYDNRDVGKSTNYEPGSAPYDIVDLTNDAIAILDGYEIDKAHFVGMS
                     LGGLITQIAAIKFADRVSSLTLMSTGPWGDSDPTIPEMDTRILDFHGKAGTVDWSNED
                     SVVNYLIQGAELMCGKKQFDKQRSEKLIRAEFNRANNYISMFNHATLQGSEEYWNRLN
                     EVNQPTLIIHGTDDKIWHYKNAGVLIEKIQNTKLITLEGTGHELHFEDWTTIIDGIEK
                     HINEQ"
     CDS             417116..418252
                     /codon_start=1
                     /gene="tetX_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011963656.1"
                     /locus_tag="NUITMVA1_03680"
                     /product="tetracycline resistance protein"
                     /protein_id="BDC80425.1"
                     /transl_table=11
                     /translation="MNLLSDKNVAIIGGGPVGLTMAKLLQQNGIDVSVYERDNDREAR
                     IFGGTLDLHKGSGQEAMKKAGLLQTYYDLALPMGVNIADEKGNILSTKNVKPENRFDN
                     PEINRNDLRAILLNSLENDTVIWDRKLVMLEPGKKKWTLTFENKPSETADLVIIANGG
                     MSKVRKFVTDTEVEETGTFNIQADIHHPEVNCPGFFQLCNGNRLMAAHQGNLLFANPN
                     NNGALHFGISFKTPDEWKNQTQVDFQNRNSVVDFLLKEFSDWDERYKELIRVTSSFVG
                     LATRIFPLGKSWKSKRPLPITMIGDAAHLMPPFAGQGVNSGLMDALILSDNLTNGKFN
                     SIEEAIENYEQQMFIYGKEAQEESTQNEIEMFKPDFTFQQLLNV"
     CDS             418591..420084
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001120888.1"
                     /locus_tag="NUITMVA1_03690"
                     /product="IS91 family transposase"
                     /protein_id="BDC80426.1"
                     /transl_table=11
                     /translation="MPHVAARTASRDRDTGRYQSHRPEQTLLYQIVDEYYPAFAALMA
                     EQGKELPGYVQREFEEFLQCGRLEHGFLRVRCESCHAEHLVAFSCKRRGFCPSCGARR
                     MAESAALLVDEVLPEQPMRQWVLSFPFQLRFLFASRPEIMGWVLGIVYRVIATHLVKK
                     AGHTHQVAKTGAVTLIQRFGSALNLNVHFHMLFLDGVYVEQSHGSARFRWVKAPTSPE
                     LTQLTHTIAHRVGRYLERQGLLERDVENSYLASDAVDDDPMTPLLGHSITYRIAVGSQ
                     AGRKVFTLQTLPTSGDPFGDGIGKVAGSSLHAGVAARADERKKLERLCRYISRPAVSE
                     KRLSLTRGGNVRYQLKTPYRDGTTHVIFEPLDFIARLAALVPKPRVNLTRFHGVFAPN
                     SRHRALVTPAKRGRGNKVRVADEPATPAQRRASMTWAQRLKRVFNIDIETCSGCGGAM
                     KVIACIEDPIVIKQILDHLKHKAETSGTRALPESRAPPAELLLGLFD"
     CDS             420868..421713
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001290782.1"
                     /locus_tag="NUITMVA1_03700"
                     /product="carboxylesterase"
                     /protein_id="BDC80427.1"
                     /transl_table=11
                     /translation="MKEKIIKTNGIELCTESFGNKKNPAILLVAGATVSMLYWDTEFC
                     QQLSEKGFFVIRYDNRDVGKSTNYEPGSAPYDIVDLTNDAIAILDGYEIDKAHFVGMS
                     LGGLITQIAAIKFADRVSSLTLMSTGPWGDSDPTIPEMDTRILDFHGKAGTVDWSNED
                     SVVNYLIQGAELMCGKKQFDKQRSEKLIRAEFNRANNYISMFNHATLQGSEEYWNRLN
                     EVNQPTLIIHGTDDKIWHYKNAGVLIEKIQNTKLITLEGTGHELHFEDWTTIIDGIEK
                     HINEQ"
     CDS             421724..422860
                     /codon_start=1
                     /gene="tetX_3"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011963656.1"
                     /locus_tag="NUITMVA1_03710"
                     /product="tetracycline resistance protein"
                     /protein_id="BDC80428.1"
                     /transl_table=11
                     /translation="MNLLSDKNVAIIGGGPVGLTMAKLLQQNGIDVSVYERDNDREAR
                     IFGGTLDLHKGSGQEAMKKAGLLQTYYDLALPMGVNIADEKGNILSTKNVKPENRFDN
                     PEINRNDLRAILLNSLENDTVIWDRKLVMLEPGKKKWTLTFENKPSETADLVIIANGG
                     MSKVRKFVTDTEVEETGTFNIQADIHHPEVNCPGFFQLCNGNRLMAAHQGNLLFANPN
                     NNGALHFGISFKTPDEWKNQTQVDFQNRNSVVDFLLKEFSDWDERYKELIRVTSSFVG
                     LATRIFPLGKSWKSKRPLPITMIGDAAHLMPPFAGQGVNSGLMDALILSDNLTNGKFN
                     SIEEAIENYEQQMFIYGKEAQEESTQNEIEMFKPDFTFQQLLNV"
     CDS             423199..424635
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001120888.1"
                     /locus_tag="NUITMVA1_03720"
                     /product="IS91 family transposase"
                     /protein_id="BDC80429.1"
                     /transl_table=11
                     /translation="MPHVAARTASRDRDTGRYQSHRPEQTLLYQIVDEYYPAFAALMA
                     EQGKELPGYVQREFEEFLQCGRLEHGFLRVRCESCHAEHLVAFSCKRRGFCPSCGARR
                     MAESAALLVDEVLPEQPMRQWVLSFPFQLRFLFASRPEIMGWVLGIVYRVIATHLVKK
                     AGHTHQVAKTGAVTLIQRFGSALNLNVHFHMLFLDGVYVEQSHGSARFRWVKAPTSPE
                     LTQLTHTIAHRVGRYLERQGLLERDVENSYLASDAVDDDPMTPLLGHSITYRIAVGSQ
                     AGRKVFTLQTLPTSGDPFGDGIGKVAGSSLHAGVAARADERKKLERLCRYISRPAVSE
                     KRLSLTRGGNVRYQLKTPYRDGTTHVIFEPLDFIARLAALVPKPRVNLTRFHGVFAPN
                     SRHRALVTPAKRGRGNKVRVADEPATPAQRRASMTWAQRLKRVFNIDIETCSGCGGAM
                     KVIACIEDPIVIKQILDHPRCQNSCRLI"
     CDS             424678..425178
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_002346868.1"
                     /locus_tag="NUITMVA1_03730"
                     /product="hypothetical protein"
                     /protein_id="BDC80430.1"
                     /transl_table=11
                     /translation="MARYSSERKAALLKKLLPPINMSVAELARQENISEVTLYNWRKH
                     AKDGGSPVPGDNKLTDEWPAEAKFAVVLETAALSEIELSEYCRRKGLYPEQVQQWRQA
                     CILGQQSARTLQQAEKAQAKADKKRIRQLEQELRRKDKALAEAAALLILQKKLDAYWS
                     NVDEDN"
     CDS             425184..426239
                     /codon_start=1
                     /gene="tnpA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002213218.1"
                     /locus_tag="NUITMVA1_03740"
                     /product="transposase"
                     /protein_id="BDC80431.1"
                     /transl_table=11
                     /translation="MPERQQYVAWWREALEAGARKHPAAEVLGLSLRTLQRWLAGPEL
                     SADRRPDAVRSIPAHALSPEERQAVLDVCNSQEFASLPPSQIVPRLADQGRYLASESS
                     FYRILRAADQQHRRGRSQPPRHVPVPTSHTATGPNQVWSWDITYLPSLVRGQYYYLYL
                     IEDIYSRKGVGWEVHEQECGERAAALLQRSIIREQCWKQPLVLHSDNGAPMKSVTLLT
                     KMHDLGVTPSRGRPRVSNDNPYSESLFRTLKYCPQWPSDGFASLEAAREWVRDFMAWY
                     NEEHRHSRIRFVTPNERHRGDDKALLAKRDAVYQAARAQHPARWSGKTRDWTPIGAVM
                     LNPERPEKPEPEQKEAA"
     CDS             426572..427285
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03750"
                     /product="hypothetical protein"
                     /protein_id="BDC80432.1"
                     /transl_table=11
                     /translation="MGEKGVYSSYTCRVPGGDYEGYVDAHVRRLEALRRAGIVERIDA
                     DQWRIPDDLVSRAAAHDAGRDSQASVRVLSPVDLNKQIGSDGATWLDRRLIHGETADL
                     APTGFGQQVREAMDQRREHHIEQGDATRSRDSRVFYRRNLLAILREREVAGVGSDMAL
                     SKGLPFRAATDGESVSGKFTGTVHLSSGKFAVVEKSHEFTLVPWRPIIDRQLGREVMG
                     IVQGGSVSWQLGRQRGLER"
     CDS             427502..428716
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010970086.1"
                     /locus_tag="NUITMVA1_03760"
                     /product="chloramphenicol efflux MFS transporter"
                     /protein_id="BDC80433.1"
                     /transl_table=11
                     /translation="MTTTRPAWAYTLPAALLLMAPFDILASLAMDIYLPVVPAMPGIL
                     NTTPAMIQLTLSLYMVMLGVGQVIFGPLSDRIGRRPILLAGATAFVIASLGAAWSSTA
                     PAFVAFRLLQAVGASAMLVATFATVRDVYANRPEGVVIYGLFSSMLAFVPALGPIAGA
                     LIGEFLGWQAIFITLAILAMLALLNAGFRWHETRPLDQVKTRRSVLPIFASPAFWVYT
                     VGFSAGMGTYFVFFSTATRVLIGQAEYSEIGFSFAFATVALVMIVTTRFAKSFVARWG
                     IAGCVARGMALLVCGAVLLGIGELYGSPSFLTFILPMWVVAVGIVFTVSVTANGALAE
                     FDDIAGSAVAFYFCVQSLIVSIVGTLAVALLNGDTAWPVICYATAMAVLVSLGLVLLR
                     LRGAATEKSPVV"
     CDS             428744..429049
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03770"
                     /product="hypothetical protein"
                     /protein_id="BDC80434.1"
                     /transl_table=11
                     /translation="MRRTNHRNLVNVGILSGRIPLISLVQFIAVAEHLNFRHAAKALG
                     ISQSSVSARVKALEDNLGVLLFERHARGVRLTDAGRHFMERVTAGVDQLDHAVKTAE"
     CDS             429161..429385
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03780"
                     /product="hypothetical protein"
                     /protein_id="BDC80435.1"
                     /transl_table=11
                     /translation="MPHVAARTASRDRDTGRYQSHRPEQTLLYQIVDEYYPAFAALMA
                     EQGKELPGYVQREFEEFLQSPRRSAGRQSK"
     CDS             complement(429316..430515)
                     /codon_start=1
                     /gene="tetA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000804064.1"
                     /locus_tag="NUITMVA1_03790"
                     /product="tetracycline efflux MFS transporter Tet(A)"
                     /protein_id="BDC80436.1"
                     /transl_table=11
                     /translation="MKPNRPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAH
                     YGILLALYALMQFACAPVLGALSDRFGRRPVLLVSLAGAAVDYAIMATAPFLWVLYIG
                     RIVAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMGGFSPH
                     APFFAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAV
                     FFIMQLVGQVPAALWVIFGEDRFHWDATTIGISLAAFGILHSLAQAMITGPVAARLGE
                     RRALMLGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQG
                     QLQGSLAALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWRN
                     SSNSRCT"
     CDS             430621..431271
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000470728.1"
                     /locus_tag="NUITMVA1_03800"
                     /product="TetR family transcriptional regulator"
                     /protein_id="BDC80437.1"
                     /transl_table=11
                     /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWH
                     FRNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAG
                     TRPGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGG
                     TVEQAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD"
     CDS             complement(431336..433885)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014966190.1"
                     /locus_tag="NUITMVA1_03810"
                     /product="transposase"
                     /protein_id="BDC80438.1"
                     /transl_table=11
                     /translation="MQHRIILPGATTLTRLISEVREKATLRLWNKLALIPSAEQRSQL
                     EMLLGPTDCSRLSLLESLKKGPVTISGPAFNEAIERWKTLNDFGLHAENLSTLPAVRL
                     KNLARYAGMTSVFNIARMSPQKRMAVLVAFVLAWETLALDDALDVLDAMLAVIIRDAR
                     KIGQKKRLRSLKDLDKSALALASACSYLLKEETPDESIRAEVFSYIPRQKLAEIITLV
                     REIARPSDDNFHDEMVEQYGRVRRFLPHLLNTVKFSSAPAGVTTLNACDYLSREFSSR
                     RQFFDDAPTEIISQSWKRLVINKEKHITRRGYTLCFLSKLQDSLRRRDVYVTGSNRWG
                     DPRARLLQGADWQANRIKVYRSLGHPTDPQEAIKSLGHQLDSRYRQVAARLGENEAVE
                     LDVSGPKPRLTISPLASLDEPDSLKRLSKMISDLLPPVDLTELLLEINAHTGFADEFF
                     HASEASARVDDLPVSISAVLMAEACNIGLEPLIRSNVPALTRHRLNWTKANYLRAETI
                     TSANARLVDFQATLPLAQIWGGGEVASADGMRFVTPVRTINAGPNRKYFGNNRGITWY
                     NFVSDQYSGFHGIVIPGTLRDSIFVLEGLLEQETGLNPTEIMTDTAGASDLVFGLFWL
                     LGYQFSPRLADAGASVFWRMDHDADYGVLNDIARGQSDPRKIVLQWDEMIRTAGSLKL
                     GKVQASVLVRSLLKSERPSGLTQAIIEVGRINKTLYLLNYIDDEDYRRRILTQLNRGE
                     SRHAVARAICHGQKGEIRKRYTDGQEDQLGALGLVTNAVVLWNTIYMQAALDHLRAQG
                     ETLNDEDIARLSPLCHGHINMLGHYSFTLAELVTKGHLRPLKEASEAENVA"
     CDS             434027..434359
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03820"
                     /product="hypothetical protein"
                     /protein_id="BDC80439.1"
                     /transl_table=11
                     /translation="MLTAGIFPLTVFCKNGDITNPELSGGKMPDAGRNMIHVSKKSAQ
                     KTHTPDLQGNTKSIVITPAFPDKFFIRFIKMKITRQLKFIGFASEPAITLNLLSGQKI
                     NGHIGLPA"
     CDS             434503..435060
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001235713.1"
                     /locus_tag="NUITMVA1_03830"
                     /product="transposase"
                     /protein_id="BDC80440.1"
                     /transl_table=11
                     /translation="MRIFGYARVSTSQQSLDIQIRALKDAGVKANRIFTDKASGSSTD
                     REGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVAVRFIDDGISTDGD
                     MGQMVVTILSAVAQAERRRILERTNEGRQEAKLKGIKFGRRRTVDRNVVLTLHQKGTG
                     ATEIAHQLSIARSTVYKILEDERAS"
     CDS             435243..436103
                     /codon_start=1
                     /gene="bla"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:B7NGN0"
                     /locus_tag="NUITMVA1_03840"
                     /product="beta-lactamase"
                     /protein_id="BDC80441.1"
                     /transl_table=11
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY
                     IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVE
                     YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
                     DRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
                     LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA
                     EIGASLIKHW"
     CDS             436265..437080
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3CN56"
                     /locus_tag="NUITMVA1_03850"
                     /product="dihydropteroate synthase"
                     /protein_id="BDC80442.1"
                     /transl_table=11
                     /translation="MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADV
                     IDLGPASSNPDAAPVSSDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAY
                     LNDIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAA
                     LTGAGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRA
                     LTGRGPGDVGAATLAAELAAAAGGADFIRTHEPRPLRDGLAVLAALKETARIR"
     CDS             437141..437944
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001082319.1"
                     /locus_tag="NUITMVA1_03860"
                     /product="aminoglycoside O-phosphotransferase APH(3'')-Ib"
                     /protein_id="BDC80443.1"
                     /transl_table=11
                     /translation="MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASR
                     RGELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAW
                     PSMGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPQLDLL
                     ARVERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLA
                     LMIANAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG"
     CDS             438037..438780
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000480968.1"
                     /locus_tag="NUITMVA1_03870"
                     /product="aminoglycoside O-phosphotransferase APH(6)-Id"
                     /protein_id="BDC80444.1"
                     /transl_table=11
                     /translation="MPDGTPAIVKGLKPIEDIADELRGADYLVWRNGRGAVRLLGREN
                     NLMLLEYAGERMLSHIVAEHGDYQATEIAAELMAKLYAASEEPLPSALLPIRDRFAAL
                     FQRARDDQNAGCQTDYVHAAIIADQMMSNASELRGLHGDLHHENIMFSSRGWLVIDPV
                     GLVGEVGFGAANMFYDPADRDDLCLDPRRIAQMADAFSRALDVDPRRLLDQAYAYGCL
                     SAAWNADGEEEQRDLAIAAAIKQVRQTSY"
     CDS             complement(439077..440051)
                     /codon_start=1
                     /gene="int"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P62592"
                     /locus_tag="NUITMVA1_03880"
                     /product="integrase/recombinase"
                     /protein_id="BDC80445.1"
                     /transl_table=11
                     /translation="MKTATAPLPPLRSVKVLDQLRERIRYLHYSLRTEQAYVHWVRAF
                     IRFHGVRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGKVLCTDLPWLQ
                     EIGRPRPSRRLPVVLTPDEVVRILGFLEGEHRLFAQLLYGTGMRISEGLQLRVKDLDF
                     DHGTIIVREGKGSKDRALMLPESLAPSLREQLSRARAWWLKDQAEGRSGVALPDALER
                     KYPRAGHSWPWFWVFAQHTHSTDPRSGVVRRHHMYDQTFQRAFKRAVEQAGITKPATP
                     HTLRHSFATALLRSGYDIRTVQDLLGHSDVSGVLGIFRPNATFRLLSD"
     CDS             440403..441059
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261921.1"
                     /locus_tag="NUITMVA1_03890"
                     /product="Qnr family quinolone resistance pentapeptide
                     repeat protein"
                     /protein_id="BDC80446.1"
                     /transl_table=11
                     /translation="MDKTDQLYVQADFSHQDMSGQYFKNCKFFCCSFKRANLRDTQFV
                     DCSFIERGELEGCDFSYSDLRDASFKNCSLSMSYFKGANCFGIEFRECDLKGANFAQA
                     SFMNQVSNRMYFCSAYITGCNLSYANFERQCIEKCDLFENRWIGANLSGASFKESDLS
                     RGVFSEGCWSQCRLQGCDLSHSELYGLDPRKVDLTGVKICSWQQEQLLEQLGLIVVPD
                     "
     CDS             441142..441780
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011142411.1"
                     /locus_tag="NUITMVA1_03900"
                     /product="aminoglycoside N(6')-acetyltransferase"
                     /protein_id="BDC80447.1"
                     /transl_table=11
                     /translation="MVTAVVFGFSVMRCQPLRRALGITKYSIVTNSNDSVTLRLMTEH
                     DLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGY
                     AQSYVALGSGDGWWEEETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVT
                     KIQTDPSPSNLRAIRCYEKAGFEKQGTVTTPDGPAVYMVQTRQAFERTRSDA"
     CDS             442595..443254
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03910"
                     /product="hypothetical protein"
                     /protein_id="BDC80448.1"
                     /transl_table=11
                     /translation="MQWSQLLLPVKCLNFWLYTLCYAAGMGSFFVFFSIAPGLMMGRQ
                     GVSQLGFSLLFATVAIAMVFTARFMGRVIPKWGSPSVLRMGMGCLIAGAVLLAITEIW
                     ASQSVLGFIAPMWLVGIGVATAVSVSPNGALRGFDHVAGTVTAVYFCLGGVLLGSIGT
                     LIISLLPRNTAWPVVVYCLTLATVVLGLSCVSRVKGSRGQGEHDVVALQSAESTSNPN
                     R"
     CDS             443519..444319
                     /codon_start=1
                     /gene="blaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EIK2"
                     /locus_tag="NUITMVA1_03920"
                     /product="beta-lactamase"
                     /protein_id="BDC80449.1"
                     /transl_table=11
                     /translation="MKTFAAYVIIACLSSTALAGSITENTSWNKEFSAEAVNGVFVLC
                     KSSSKSCATNDLARASKEYLPASTFKIPNAIIGLETGVIKNEHQVFKWDGKPRAMKQW
                     ERDLTLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGIDKFWLEGQLR
                     ISAVNQVEFLESLYLNKLSASKENQLIVKEALVTEAAPEYLVHSKTGFSGVGTESNPG
                     VAWWVGWVEKETEVYFFAFNMDIDNESKLPLRKSIPTKIMESEGIIGG"
     CDS             444312..444905
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011142411.1"
                     /locus_tag="NUITMVA1_03930"
                     /product="aminoglycoside N(6')-acetyltransferase"
                     /protein_id="BDC80450.1"
                     /transl_table=11
                     /translation="MAKTKLGITKYSIVTNSNDSVTLRLMTEHDLAMLYEWLNRSHIV
                     EWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWE
                     EETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIR
                     CYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA"
     CDS             444987..445766
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3EQ55"
                     /locus_tag="NUITMVA1_03940"
                     /product="streptomycin 3''-adenylyltransferase"
                     /protein_id="BDC80451.1"
                     /transl_table=11
                     /translation="MIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPHSDI
                     DLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAKRE
                     LQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLFE
                     ALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
     CDS             445816..446274
                     /codon_start=1
                     /gene="dhfR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:NP_569370.1"
                     /locus_tag="NUITMVA1_03950"
                     /product="dihydrofolate reductase"
                     /protein_id="BDC80452.1"
                     /transl_table=11
                     /translation="MAAKAKNGVIGCGPDIPWSAKGEQLLFKALTYNQWLLVGRKTFE
                     SMGALPNRKYAVVTRSGWTSNDDNVVVFQSIEEAMDRLAEFTGHVIVSGGGEIYRETL
                     PMASTLHLSTIDIEPEGDVFFPSIPNTFEVVFEQHFTSNINYCYQIWKKG"
     CDS             446486..446761
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03960"
                     /product="hypothetical protein"
                     /protein_id="BDC80453.1"
                     /transl_table=11
                     /translation="MNRMPVLTDEEVNTVRESCRQLGAIGRNLNQVARALNIEFRESD
                     KLKQEAIEKLAERIDQHLDHVSELFDKTWSRWHDCHFQKTTAPVDWA"
     CDS             446874..447668
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001389365.1"
                     /locus_tag="NUITMVA1_03970"
                     /product="IS6 family transposase"
                     /protein_id="BDC80454.1"
                     /transl_table=11
                     /translation="MLGGDWTDGTMTDFKWRHFQGDVILWAVRWYCRYPISYRDLEEM
                     LAERGISVDHTTIYRWVQCYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYR
                     AVDKRGDTIDFYLSPTRSAKAAKRFLGKALRGLKHWEKPATLNTDKAPSYGAAITELK
                     REGKLDRETAHRQVKYLNNVIEADHGKLKILIKPVRGFKSIPTAYATIKGFEVMRALR
                     KGQARPWCLQPGIRGEVRLVERAFGIGPSALTEAMGMLNHHFAAAA"
     CDS             448202..449773
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011706811.1"
                     /locus_tag="NUITMVA1_03980"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BDC80455.1"
                     /transl_table=11
                     /translation="MTHIACHINTLQLPFVACTVPLTFTLPAAGCTLIGRNGIGKSLL
                     LELLAGQRRADSGKIEWLTPISWLSQFAPAQDHDCAASVADLIGWGEPLRALERIEQG
                     SCAQDDFELLADRWNLRSDLADLLAEAGLRLDPHVPVSTLSGGQLTRLRLLALFARPA
                     HFLLLDEPDNHLDASGIDWLSQQLARHRGGYLLVSHDRRLLNQTSQILELSEQGLQSA
                     RLSFDEFLAQQAEVQAARSTSLAQAVRGEKAAARSLQKVREQAARRASQGRRERGSQA
                     KILLDFKAEQAGKSLGRVLDRHERGHSAQVEARTEAAAALAAVQPLIMQWPEEIERKG
                     AAQPLVITAASHVRWHGQRVDLVLQRGERCLLGGRNGCGKSSLLQMLRGVLEPETGSF
                     RINGKMACLDQGLSLIARDLSPLANLLTVAPTLAESDARTRLAGIALRGDRALTPCHG
                     LSGGERLKLGLLMVLAQLPDLLLLDEPDNHLDHPSRQLLTQVLADYPGTLLLVSHDPD
                     FVAGVGVGKELNLSE"
     CDS             449822..450571
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_03990"
                     /product="hypothetical protein"
                     /protein_id="BDC80456.1"
                     /transl_table=11
                     /translation="MTEISAVPAYNPFFAAAALNGLNFLTGCFLLPESHKGERRPLRR
                     EALNPLASFRWARGMTVVAALMAVFFIMQLVGQVPAALWVIFGEDRFHWDATTIGISL
                     AAFGILHSLAQAMITGPVAARLGERRALMLGMIADGTGYILLAFATRGWMAFPIMVLL
                     ASGGIGMPALQTMLSRQVDEERQGQLQGSLAALTSLTSIVGPLLFTAIYAASITTWNG
                     WAWIAGAALYLLCLPALRRGLWSGAGQRADR"
     CDS             451010..451363
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_04000"
                     /product="hypothetical protein"
                     /protein_id="BDC80457.1"
                     /transl_table=11
                     /translation="MSHLDGKSLEPQEGTIFRVVTDRMMSGEWLSSTRLLSGHLDKPF
                     DVQFEQDCVAFLQQRDSYRISEILALAQQRGLNPQALLPVLYRMVARGQLSLDRGQPI
                     GPQTWVAVVGSQKRL"
     CDS             451413..453074
                     /codon_start=1
                     /gene="tniA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000179844.1"
                     /locus_tag="NUITMVA1_04010"
                     /product="transposase"
                     /protein_id="BDC80458.1"
                     /transl_table=11
                     /translation="MDEAQVAEAERRRDIIARLEAGGRFDSATVEAAAAEFGASKRQF
                     NRYRKSLRNTGALTCLLPRGRSGGRGRLRLDLRVEEVITEVRLEFSRHRKEAKNHHAF
                     AEIRNRCVRRGLIPPSHNTLRSRFAGVPARERVGLKYGKKVARERYEHIRGKTPETTF
                     PLERIQIDHTLVDVVCASAFDREHVGRPWITIALDECTRAVLAFVLTWEYPNASTVAQ
                     CMTRVMTPKDEWLERVGVPLPWPMYGTPNSVYLDNAAEFWSRALFYGCREYGIAPPEH
                     RPPGLVHFGGIIERFMGTAMDQMRLLPAATARDRGFDKVKTRNPNEAAEMTLDELEVW
                     MLEFICGQYHVRPHSTTKQRPDLAWERGIYGTEKRAGAGLPPIIADKQKLYLDFADIE
                     DRTIERYGMRWDNIEYWDEVLRPFLDAGEQRKFVVRRNPYDASRIYFLHPIEGTYCEL
                     RCEQITLPNVSVWEFNETRKRLVAQIGDKPDMATIMASMERQRLLEQDAQNAKKRHRS
                     RLKQERRRVGEQVTAELTPHAPISEDAPPAPQAPVRRDIFYEIDE"
     CDS             453071..454003
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003465065.1"
                     /locus_tag="NUITMVA1_04020"
                     /product="transposition protein TniB"
                     /protein_id="BDC80459.1"
                     /transl_table=11
                     /translation="MILISQDRRLTKAAREALEADNTAQRLNLIRQKVFIRYAAADAI
                     TERLQEALEDYPTEGDSHILIWGPSGIGKSQIVKRFAKLQNLPDDPRASKANVPVLVV
                     SMGPTGSARGLLVRILGQLNAPYGKSASTDTLYPDVLRLLRTSGVKILVIDELHHIEK
                     GNRKQREEALATIKLLGNDLGITIVGCGTIAALRTLRWDPQIERRFEPHRLEVWGHNE
                     QTYGLLNSLETCLPLRHASGLSDDKIATWIINESEGTTREIAYLVRRAALMAIRSEKE
                     RIDLPLLRSLNHVRPSVRRQREDVLLRAASLPPL"
     CDS             454005..454970
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_04030"
                     /product="hypothetical protein"
                     /protein_id="BDC80460.1"
                     /transl_table=11
                     /translation="MSDLRLWPWRPRPQADELLSSWLRRIALGNSAKLHSFCHAVWPG
                     LQIWNRDIDGLAPPRLMEGLVAHTGVDAQVAELTTFRPWVGTLFEEVRVTGATQWLLP
                     VGIHHRTRRRPGQQWCPLCLTEDAEPYYRRRWRLAIASTCPRHGLVLADSCHDCGAPA
                     VPHRGADPWCHICTADRRDHPVMAAESQALQFEFRLSEMLAPDVVPRTDLEAIHPLAY
                     FGLVRQVMTVLSGGERSQGLRDEVARSWGGDPAPYAAKQIETASAADRHRLSGLTARA
                     MRGWPWLFVGHCADARVWKSWAFADRRYGRSPFAYADPVIRYLTP"
     CDS             455349..456188
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3ERE4"
                     /locus_tag="NUITMVA1_04040"
                     /product="dihydropteroate synthase"
                     /protein_id="BDC80461.1"
                     /transl_table=11
                     /translation="MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDV
                     GPAASHPDARPVSPADEIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLND
                     IQGFPDPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSAL
                     RRSGVAADRLILDPGMGFFLSPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGAT
                     VGLPVKDLGPASLAAELHAIGNGADYVRTHAPGDLRSAITFSETLAKFRSRDARDRGL
                     DHA"
     CDS             456315..456557
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_04050"
                     /product="hypothetical protein"
                     /protein_id="BDC80462.1"
                     /transl_table=11
                     /translation="MDSEEPPNVRVACSGDIDEVVRLMHDAAAWMSAKGTPAWDVARI
                     DRTFAETFVLRSELLVASCSDGIHVSTMPAECLSYS"
     CDS             complement(456641..456940)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_04060"
                     /product="hypothetical protein"
                     /protein_id="BDC80463.1"
                     /transl_table=11
                     /translation="MQQGTLFTRRTVERHFRKHQARCPPEYREILIERILAKRWTEAS
                     LGKVVGIVASTFARHQLTDYDRLLAISGMARAEARLIVSREVSDILESWRSTALP"
     CDS             complement(457054..457224)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_04070"
                     /product="hypothetical protein"
                     /protein_id="BDC80464.1"
                     /transl_table=11
                     /translation="MDCVNSQADNFDDDQEATAEGIADIEAGRTISHEAVKAWLLSWG
                     TPNELPPPKVGD"
     CDS             complement(457542..459788)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014966190.1"
                     /locus_tag="NUITMVA1_04080"
                     /product="transposase"
                     /protein_id="BDC80465.1"
                     /transl_table=11
                     /translation="MDQFSVGVDTKLKRQTVGSQWLYLLCYLQTRWQQALERIADGFV
                     HHVRQTKQKAKDYAQEAVFKDWQKAAKNVSKAAEVLHLFIDDSIDLQLPFATVRQQAL
                     SLLTKRDLESVCLFLNEQRRSVDEAMWQYCDEKESLRKGLLRELFLCLRFEGCDGTQH
                     LAAALAKTQNELNGQDAQLQTADTRLLSKKSREFLLDGEGNILIDRYEWFLYQQIPDR
                     LNGQLTLPDITKYRALDADLIDGEHWRKNKYTLLQQSHFTKLAEEPEKLIKQMAMELD
                     TRLYEVGEYLEQEDNRNIILRNPQGKRFWRLPSASKHHLVNNPFFQQIPTTGIADVLR
                     MVDRDTGFIDCFAHVLGSQSRSRSHEYDLLAILVGNATNQGIYGMAQISDRTYDQLST
                     IQANYLRLETLNAANDNINNATAKLPIFRYYNIQEDVIHASADGQKFEARRETFKTRY
                     SSKYFGTQKGVSAMTLIANHAAINARVIGANEHESHYIFDLLMSNTSDIIPDVLSTDT
                     HGVNHVNFALLDLFGYQFAPRYAQVGKVINDMFDVKEDKEHRIQLCLKKPINTHRIAQ
                     HWDTIQRIAVSLKQRKTTQATLVRKLSEYKRNHPLLEALTEYNRLVKANYLLCYIDDA
                     SLRNYVQRALNRGEAYHQLRRAVSSVNGDQFRGSSDEEIQLWNECARLVTNAIVYFNS
                     RILSQLLTSFEYQGDTKRIDIVKQASPVAWHNINLKGTYHFELSEKLPDLEELMRSIE
                     GYLPVSEK"
     CDS             complement(459835..460605)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005741073.1"
                     /locus_tag="NUITMVA1_04090"
                     /product="transposase"
                     /protein_id="BDC80466.1"
                     /transl_table=11
                     /translation="MNLQHERLMALSQALRLEGIAAQWSALAQKAANEEASFADYLEW
                     LLHAEQTLRTERTRQTLLKLATLPVVKTLEQYDFGFASGAPRSQLQELASLAFIERSE
                     NIVLLGPSGVGKTHLAIALAYRALMAGIKTRFISAADLMLQLQAAQRQERLNAYFSRV
                     VMGPRLLVIDEIGYLPFGREEANLFFNVIAKRYEKGSLILTSNLPFSQWASTFADDQT
                     LTAAMLDRLLHHAHIVQISGESYRLKEKRKAGATPKTN"
     CDS             complement(460602..461615)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002551322.1"
                     /locus_tag="NUITMVA1_04100"
                     /product="IS21 family transposase"
                     /protein_id="BDC80467.1"
                     /transl_table=11
                     /translation="MLTQELSVEIRVLARQGMSIRAIAQQLRVSRNTVRKYLRNPGLP
                     IYPSRAARPTKLDPFKPYLQARIQAAKPHWIPATVLLRELREHGYTGGLSQLKAWLSP
                     LRHDASGTVVRFETAPGKQMQVDFTIIRRGNRPLKAFVATLGFSRASYVRFFDHERND
                     AWLTGLREACHFFGGVPQEVLFDNASTIIRERDAYGEGDHRWHPALLALAEEFGFRPR
                     VCRPYRAQTKGKVERFNGYLKRSFVTPLAATLKQAGLALDVSTANAHIGPWLQDIANQ
                     RSHGTTGEVPAIRLQQELPHFLPLPQALPVSPGTTATARPMPLESLQHPLSVYQDLLE
                     VNV"
     CDS             complement(461685..462506)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_04110"
                     /product="hypothetical protein"
                     /protein_id="BDC80468.1"
                     /transl_table=11
                     /translation="MAFEERVQILSEAEQDELYGPPAFTSADQRFFFSLNDKELAIAK
                     SLRHRGQRYMLVVLLGYFKAKPVVLNPGFHQIKQDLKYVYQTVLPGPGCRPFNLTPKE
                     NERIYQRVFQLCNYQRWNVKDHGAALRDYLSQQARAWTAPRHLFDAAIEYCSGQKIAI
                     PAYSTLQKIISQVVGDEQEHMAAHLERAMSRGLKQALAELVNGTGPLPFRQLRQSARN
                     FTGTELEKELIVYRHIQHWMPEVDLLLSTLSLSQKNLQHLAEKVDYYGAKLSPPM"
     CDS             462684..462935
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005172325.1"
                     /locus_tag="NUITMVA1_04120"
                     /product="plasmid stabilization protein"
                     /protein_id="BDC80469.1"
                     /transl_table=11
                     /translation="MSYQILSAAAASITELKRNPMGTVKKGNGSAVAILKHNEPAFYC
                     VPPELFAYYIELAEDAELNRIADERMALLDKVSVSLDDL"
     CDS             complement(463136..464035)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_04130"
                     /product="hypothetical protein"
                     /protein_id="BDC80470.1"
                     /transl_table=11
                     /translation="MATGLKPRTAAGYSQDVTSACEMTLLTLLSAFGHLKETLRLVGG
                     LVPRYLTPENLPDVPMHAGTSDVDIVLNLEVLAADNEYASLADQLKARGFIRWVEEGK
                     PASWRWRRKVDDHIEVVVELLRDAGAEEPGRTISVDGERVSALTIKHARIVHDWYQEK
                     IVSAQLLGGDGLSVDTVRFADVPAFVILKALALDQRQERKDAADLIHVIQYSGSVKEV
                     AALFVERIRSQQHQEAMQDGLAALARRFGDDEHGEGYEKVGAVAYARFHGGDNEDELV
                     GRQRFAAGLVQSLLAEVERQRVI"
     CDS             complement(464020..465156)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_04140"
                     /product="hypothetical protein"
                     /protein_id="BDC80471.1"
                     /transl_table=11
                     /translation="MGAKVMERYSHHSGFEFERQMLDALVEALAGAFGPEASVHNASH
                     ELRGVGVELDGMIEIKAPSKTLLVFVEVKREVYPRDLRNAVYQLHRRIRDTHHSHDAI
                     GLLAAGVLSSGAKQELREQNIASFELGGSLYLKHDGWLINIEKPSHRTKKNTQGIALF
                     TGARESVIHSLLMNSHGWLTGRELAEQAETSAYTCSLVLQELTLREWVKSTGGGPSKR
                     RMLTHPDKLLDAWSEQWRHRKEQKSKWYTFVENPKHLLAHLAERIDHQKVDYPWAFTG
                     AAAANILAPLLTSTEGAEIIVPKGYADRMADVLGLKPVSKGANVTLIEREPASLLYRD
                     VSPNHPIFFASPYILYLDLLDGRGRNKELAEHIREQLESLWQRD"
     CDS             467320..467793
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003380356.1"
                     /locus_tag="NUITMVA1_04150"
                     /product="antitoxin"
                     /protein_id="BDC80472.1"
                     /transl_table=11
                     /translation="MSIMTYSAYNQGHVKPHCARLVMSLGIPSDPLSVHSWIVAGIPP
                     EIIIRLVESVRSDMKTICHLVGISKRTITRKLKNGTPLTPEQGSRVYSVIQALDATIS
                     LHNDDLAMAMAMAMAWLHCPAKGLGGEIPMNILTTPSGVQAVVDLIGRIEHGVIA"
     CDS             complement(467878..470097)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005477330.1"
                     /locus_tag="NUITMVA1_04160"
                     /product="ATPase AAA"
                     /protein_id="BDC80473.1"
                     /transl_table=11
                     /translation="MNDFGQERFFRITRSPYSSRKGRSFHAVQIDPDTLRNCNYKQNY
                     IIHINEHNSERLSLILAKGALVKLAVKKQYSRRVEHGGILTVITPQYLDLIRPSGEQI
                     ALMLGSHTRFKGVGPVKARKLWSTFGESLFEILDNGDIVSLRKILSENTAKNTADAWR
                     SYININAMRFCNANLGLSVSTSFLVSDYYQQETISKISEDPYRLLAFGVDFNECDRIS
                     LALGFQLDAPIRFAAAAEEALYCHLSNGSTLATRYDLDIWLKQLLHIPMNPEKTECYV
                     NQAFALATSCENILEVGDNELQSAGAFTMEAYVAQRLVNLITTPSKLSLDEKRINFYI
                     NQYESKKCFHLSSLQKEAIFGAIKHRFLIINGGAGVGKTTLLDALYSVLHKLDIIPVQ
                     VALAGKAAKRMAEATNQEAYTIARFIRNFNAKDYEGRQLVIVVDESSMVDLPSMYRLL
                     RCVPNSAHVIMLGDIGQLPPVDFGLVFHELVPMHDIPKITLTEVRRQDRLSNIPAISA
                     AIRNGVLPTFSYDDVVHIDINGTNAIQRRAVSIYLEKPDETQIICATTKMVNDINKRC
                     VAFNKSKPLRVFIEEVNRYLDTEFKLHDKVMCCSNLYDHDLMNGSTGHICQVYNVMKI
                     LKNDDNDESLTSFGKILWDDGIEREISLDIINALRHAYAMTIHKSQGSQFKQVIIVLD
                     KAPNIDRTMCYTAITRAVEKVYLIGPLNILSQALTHESASKRNVDLGHKVKALLLKK"
     CDS             complement(470094..470600)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_04170"
                     /product="hypothetical protein"
                     /protein_id="BDC80474.1"
                     /transl_table=11
                     /translation="MNRAFSISRELEDFDLDRMHAKARENLVKVANLVGPLDLAEWQN
                     FIENGSLNATAIIKEIGISRSSYYQNKYIVAYLKSKAQWLAEQNTLQELPYQARDTSK
                     TPANRYSPLEKSIQEKDKMIRQLQLRVAELESHLEGLKQEYKSLQSNSHRDQHRMELL
                     EIFKRVPR"
     CDS             complement(470597..471016)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_04180"
                     /product="hypothetical protein"
                     /protein_id="BDC80475.1"
                     /transl_table=11
                     /translation="MKKEQKQITAALEQDFCKLIVILAARSGRNKVTWKELEQETGFT
                     RQALSKKESIVKAYKEANQSSNIIENIGRRAEETQSKLDKVKEENIKLKKLLADYDET
                     FVRWFANATSHGMSIEELEAPLPHSMKTKARLKDLKK"
     CDS             complement(471013..473076)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_04190"
                     /product="hypothetical protein"
                     /protein_id="BDC80476.1"
                     /transl_table=11
                     /translation="MNTSLQLLPSIGVDSDSNLAQLVHFYKKNTPFAKIESWEWDDIS
                     WDAKGICKTQARKSGYNISVNFSRDNKLGKKVKSSYNDIKPFHNLDLSDIAKCHISAL
                     QIEKAKDVGTLNFYIVAYRYLDNAMLKRNITASNLTTYDFKVAEAEAHDRLESSTFYR
                     IGQKLESIATFINKKKLSIQKIVFKKSAKRGDTHTASDSRIDFESTTKRHEKLPTHES
                     LIAVATLSNSNLEGDDALFQAIVEIMFATGLRFDEVICLDVECLQAREVEELNVFTGE
                     IDIVCINEIRYRAKKGAAYQTKAIASSLLPILQKGLTSALEILAPVRDTIKCVINGKY
                     DFFPIITEDCELFVTDIWERLNWSSRSNLLSYLKKRNVNLTNKLNPNTGKNAAAFHSV
                     DLKEKTFSLAKKSIDELWKQMSVLSVADCPDKLIFVTQHQRHHSDKSTEPWEFTMITH
                     TQISDYISGRPELGIKNIFERKHLCYQGEQIRLTSHQFRHFLGTMLEISDSVTPIEVA
                     RYFGRKYTPDNIAYDHTNPAKRVMDNADILFAASNITPEQAKEASVIFTLVDRDEVLE
                     TIEDIGTTLITAIGLCKHDYSDSPCGKYYACVRGCSEYYRIKGKQGEIIHLQKLQDEQ
                     ETRIQHVKAAVDAEYHGSNNWLRSHEELLNGCRIALAIEQDNSISDGERVQVFPNGNN
                     GCVAI"
     CDS             complement(473073..474554)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_04200"
                     /product="hypothetical protein"
                     /protein_id="BDC80477.1"
                     /transl_table=11
                     /translation="MPTKKLDKNEIMLVQIDQHPQFSYDPYPVSQSGQQLDLTQSKVV
                     LEPERETLFFEKISPQLREHARAWISYACHIYSNYALFSQQHCWRLLKIPDDTVAEDI
                     AEKIQEIYRELLSSERSPSTKSALRILYKWCVEEGLPHFDEDFYDYYLASIKFGTAEG
                     KGLDVIMEIPDRGPLTIKEERIFISTLNSVLPETLTTHELQGLVSLKCAQVLGMRNIQ
                     VMRLKFSDLQISDKGVHTLKVLRAKQRGRTNNNVYKIRPITKTLAKLISSMKSRYEDI
                     LGTKITDDWPVISEYYSLRDELVKQQVKITKITYITNQFRMAVGLDFKVTNRRLRKTF
                     CSRLIAKGTPMTVVAELMDHSDLQQLDVYYRQSHNVAKKLDDILRSQAIDIIDVFAGK
                     VVTPDYASQRGQGIFAPSKNLNLVKIGSCGSTTPCSLQPPLSCYNCSSLEAFEDVDHK
                     EVVDTMVEEIKEVFGDAHAINILQHKDFLAARKFADMFDRGEL"
     CDS             complement(474576..475769)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_04210"
                     /product="hypothetical protein"
                     /protein_id="BDC80478.1"
                     /transl_table=11
                     /translation="MKLRTVNMKQYNERKYLIVDERGLPIPRLCEFTLTHLYGAEKTQ
                     ENNANHLIHIERWAAMLKVDLAEIVAGTGFADTGLYQSFLKHLEHRSYDINGARPLRP
                     DIVSPDYFNQRLDLVLVYFQFLADKAISKRRNTDPLFSQIPEMMRRLQVKLVKLRRPK
                     TAPGRILGLSLVQQATLYDIMEIPSSLGWNKSTQLRNKLILRLLLETGIRKSELLSLT
                     TSNCHTSKLVHGVYPFILTQQNIEHNDPRNRVPREKTVGRIIPISFPLASLIDEYKQA
                     RKSLGDSAMKSPYLLLSTTKPHNPLSIAALDDIFSSIKNKILELSDIHPHKLRHTLFE
                     NIDRMLTKMGIDAAQQKKIKNNVGGWKYNSDSSLIYETGSIMEQCNLVLNQLHAEMEL
                     HRKIS"
     CDS             complement(475930..476508)
                     /codon_start=1
                     /gene="ssb"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ40"
                     /locus_tag="NUITMVA1_04220"
                     /product="single-stranded DNA-binding protein"
                     /protein_id="BDC80479.1"
                     /transl_table=11
                     /translation="MASRGINKVILIGNLGQDPEVRYMPSGGAVTNITLATSDTWRDK
                     QTGEQKERTEWHRVVFMGKLAEVAGEYLKKGSQVYVEGKLQTRKWQDQSGQERYTTEV
                     LVDGFSGVMQMLGGRPQGGAGQGMGGQSQGNWGQQQGMQSQQPMNQARPAQAPQQNMQ
                     QQGGYTRPAQQPQSAPPVYNEPPMDFDDDIPF"
     CDS             477031..477690
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707638.1"
                     /locus_tag="NUITMVA1_04230"
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="BDC80480.1"
                     /transl_table=11
                     /translation="MFKDQRFMITPYPIVLVTEDNAQATSFQSYLAEQLALPILLVSA
                     LEALPQVDELEPHPLFLVDLDYLKSSQQTGWPREISSRFGEANTVLLNAPTSTDRELL
                     LMWPHISGLFFCQDPLDRLVLGIRKVLEGEYWIPRHLLCDLVNYYRKGGEHHLRNQTL
                     LTVREQEIIRYLMTGASNTEIADSLFVSEHTIKSHLYNVFKKLNVKNRLQAVSWAKEY
                     L"
     CDS             477786..480614
                     /codon_start=1
                     /gene="uvrA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ38"
                     /locus_tag="NUITMVA1_04240"
                     /product="UvrABC system protein A"
                     /protein_id="BDC80481.1"
                     /transl_table=11
                     /translation="MEKIVVRGARTHNLKNINLTLPRDKLIVVTGLSGSGKSSLAFDT
                     LYAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTIT
                     EIYDYLRLLFARVGEPRCPTHAIPLAAQTISQMVDQVLAQPEGSKLMLLAPVVRDRKG
                     EHTKLLENLAAQGYIRARIDGEVCDLSDPPALELHKKHTIEVVVDRFKVRDDLALRLA
                     ESFETALTLSGGIVLVVPMDGEEGVAPMTFSANFACPECGYSMSELEPRIFSFNNPAG
                     ACPTCDGLGVQQYFDPAKVIGDPAISLANGAIRGWDKRSFYYFQMLKSLSEHYKFNLE
                     TPWEDLPIKTQEVILRGSGRTEIEFRYMNDRGDVVVRKHPFEGILHNMERRYRETESN
                     SVREELSKYIANKSCTSCGGSRLREEARHVFVDNRNLPAIAEQSIGDALAFFEGLNLT
                     GQRAQIAEKILKEIVERLGFLVNVGLNYLSLSRSAETLSGGEAQRIRLASQIGAGLVG
                     VMYVLDEPSIGLHQRDNERLLKTLTHLRDLGNTVIVVEHDEDAIRLADHVLDIGPGAG
                     VHGGAIVAQGTPEEIINNPESLTGDYLSGRKQIAIPAERTPLTGKWLKLKGASGNNLR
                     NVNLDLPIGVMTCVTGVSGSGKSTLINDTLFRIAHRELNKATESTPAPYRSVEGLEHL
                     DKVVDIDQSPIGRTPRSNPATYTGLFTPIRELLSGTQEARSRGYQPGRFSFNVKGGRC
                     EACQGDGVIKVEMHFLPDVYVPCDVCKGKRYNRETLEVKYKGKNIHEILEMTVEDARE
                     FFDPVPAVARKLQTLMDVGLSYIRLGQSATTLSGGEAQRVKLARELSKRDTGQTLYIL
                     DEPTTGLHFHDIQQLLKVLHQLRDRGNTIVIIEHNLDVIKTADWIVDLGPEGGAGGGR
                     ILVTGTPEQMSRCEDSHTARFLAPVLAR"
     CDS             480755..482440
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707636.1"
                     /locus_tag="NUITMVA1_04250"
                     /product="diguanylate cyclase"
                     /protein_id="BDC80482.1"
                     /transl_table=11
                     /translation="MAQPSRSIDHLLAYSMFPVWAGAILMLLIVIALAQVPAAQRVEE
                     RRMQDHLQRVVRAVQGDINAINAFTRDWGIWDESYHFLARPNQGYIHSNLLVDTPMRD
                     FELNVLSYMDLQGSEIWTRTLLPEAPDTDTTLLPFFLDDLKLQLLRESRQGGIHSLSG
                     VRGSLWGPLIFSLQPVTNTLGDAKPNGYLLATRWLDERYLDDLAARTALALTIAQPRT
                     GEHQGSFKPFKPYMSYRLVDLGLQRVRGEGLLLDNDGTPVLTLIVEEERDVLRGAMEG
                     AIWTFIGMLLISFACILMALARLRAIVLGPIGELVGALHKFAEKQDVSVLPIIDSSQE
                     MALLSRKFREMAARISLHHSALQAYSSRMETAAYTDPLTHAFNRRYLDEWLLNRDALA
                     AGRVLLILDLDHFKQVNDRFGHDIGDLLLCQLAELLRGALAEEEPLIRLGGEEFLLLL
                     VGDEPTRVAQRVERLRRKIADCRFGREELPLWMTASLGFCDYPLHRELEDSFWNLSFK
                     LADMALYRAKQEGRNRWRGYSGELGPAQWDLNPVQIVAGEWLRCQASHTSQSA"
     CDS             482887..483498
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707635.1"
                     /locus_tag="NUITMVA1_04260"
                     /product="outer membrane protein W"
                     /protein_id="BDC80483.1"
                     /transl_table=11
                     /translation="MKKILPLMIAAALASPVAMAHQAGDILVRGGLAFVSPQTSSDNV
                     LGTGELEIDSNMQLGLTLSYLITDNWGVELLAATPFSHSVSTAGLGEVAKVKHLPPTL
                     MAQYYFGDANSKVRPYIGAGINYTTFFDEQGRGALDGTDVSVDSSWGMAGQVGLDMAI
                     NDRWFVNASAWIMDIDTDVHTAVGTINTSIDPMAFMFGVGYRF"
     CDS             483717..485696
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707634.1"
                     /locus_tag="NUITMVA1_04270"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BDC80484.1"
                     /transl_table=11
                     /translation="MGLSIVQRIIAGFVLMLLLLILLGVISTLKIRGINDGLSQVSDR
                     ATPLVIAVAGLKGALQDSNRWVLVYRTNEDASQLPQLASQFKEQQARFSQLSQEMEKF
                     SGVAEAGSRFQQVDTATKQFYGLAEQVLSQHSQWVNAQDQRHKLEIAFIRLEDTYQWA
                     ADLLLQQTASKRSMRNKAELITSGIARDLKNIRRADAKTDLNELEKVLSKDIEMARKR
                     LDRVLVPDDVKQRFVSNLDRMQELALGQQGLLATMRNAQQLAASLQTLNQQLDASLIN
                     SLGLLDEMGQSAGSIASQSRTTADDAVSSASFWILVVAAISAAAALIIGYTTARSIQR
                     PLQMINKELDYMAAGDMTRRINYRSSCEFGALSRSIDTLAGKTGELLSQINAGSRHLV
                     EEASRAAEISERAVSRVQDQKSQTDQVAAAITELEVSATEVARSTDGTKREVDLADDE
                     ARSGRQKVATTRRITEQLAGAMEEAVGITYKLGEFSNNIGSILDVIRSIAEQTNLLAL
                     NAAIEAARAGDAGRGFAVVADEVRALANRTQTSTEEIQAMIENLQSSSKLVVEVMGRS
                     QEQTHNCVEQTREMDAALQSIADRMSAIKAMADQVAHAAQEQISVSQGVARHISGIAE
                     VAYETEREARESAGSSEVLAELVAKQQQLIAHFKV"
     CDS             485705..487189
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707633.1"
                     /locus_tag="NUITMVA1_04280"
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="BDC80485.1"
                     /transl_table=11
                     /translation="MSNKWIGALSLLLCGQLMASELVIESWRIDDKALWEQKIIPAFE
                     ASHPGIQVKFNGVQNVDYMPTLWASLKEGKAGDLITCRPFDDSLALFKAGHLAELTEM
                     SGMENFPSFAQSPWQTDSGAQTFCVPMASVIHGFFYNKKIFSELGLSVPQTRDAFFAA
                     LDKVKADGRYVPLAMSGSESWVSSELGFQNIGPNYWKGEDGRLALIGGQERFDNPPYV
                     KVFEELARWRPYLGEGGESRDYAATNELFTSGKAAFYVAGSWEIAPFTGKVDFGVMRP
                     PVAKQGDGCFFTDHTDIGMGMNPASKNKEAAMAFLQWLTTPQFAELYTNSLPGFFSLS
                     NHFFEVTNPAAKEMMEWRDQCDSTIRVATQILSRGTPKLGDELAEVSQAVLLGKMEPK
                     AAADRLEQGLKGWYPPHQGNKVKGADCQCDAPDAAPAVSAAAATTEPPAAASTATPAM
                     IETPATPAPSATPAAAASAAAAPLPAPSAEVEQALSNELETPQQ"
     CDS             complement(487253..488044)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707632.1"
                     /locus_tag="NUITMVA1_04290"
                     /product="N-acetyltransferase"
                     /protein_id="BDC80486.1"
                     /transl_table=11
                     /translation="MDTHPGFATDLLFDRYQGNVVDHEQFWAVRTPDAPDYYFGNYLL
                     LPFPPSDHDKGWLEASFDKLIGQDPRVRHRTFQWPLAAGQNSRVAGFVAAGYQYMECV
                     VLALEATDWQPPAATVAARPFTPADWDEWLAFELEERDPGHSEQSYLPYLQSRRQLYE
                     AMIGDGLGQWWGIWQQEQLVASCGLFFTDTLGRFQLVRTRQAWRNQGLCRQLLSQVAR
                     HGLTRVDRLIIVADEHYHAQRVYRSLGFAPVARIGSLCRWPHPVQ"
     CDS             488373..489269
                     /codon_start=1
                     /gene="metF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ32"
                     /locus_tag="NUITMVA1_04300"
                     /product="methylenetetrahydrofolate reductase"
                     /protein_id="BDC80487.1"
                     /transl_table=11
                     /translation="MGFHSARQVEALNQSLADLSGDISVSFEFFPPNSEGMENTLWQS
                     IERLKVLEPKFVSVTYGANSGTRDRTHKVIKDIKERTGLIAAPHLTCIDASRDELRTI
                     ARDYWNSGIRHIVALRGDLPQGLEKPEMYATDLVALLKAEADFDISVAAYPEGHPEAR
                     SAQSDLLNLKRKIDAGANRAITQFFFDVETYLRFRDRCAAIGIDAEIVPGILPVSNYQ
                     TLAKFAGFTNVKIPRWMHQRFEGLDDDQMTRNMVGASIAIDQVRVLSQEGVKDFHFYT
                     LNRSELTYAICHTLGVRPKGQP"
     CDS             complement(489332..490396)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707631.1"
                     /locus_tag="NUITMVA1_04310"
                     /product="hypothetical protein"
                     /protein_id="BDC80488.1"
                     /transl_table=11
                     /translation="MRNQAVILLLALLGATTAHAADTDRELARQLALQQKNLLPLLSN
                     QEYQSPLPNLLQKASPRLKRQARDANQAAISRQGLDGEVKELMQLRLANPEQATALQQ
                     GVEPLVAYVPSGDEKSWSAIEAFDSAGNPVYLDVDKAPARPVLVVEADPVKAKNAGLK
                     VIRKALAAADMQVAPRAAASTAPLKTSILKKIRLKDDQEPWLLGAAEVYAVVAGVNPS
                     RDEPVVDIVDMPYLDYDNTDYTPNQILVYWDRYRWGAVDIVMMEQDDNVNYKELSGLF
                     IDALKLAFTAGGVPEALPFLDLGGRIVKALPDSWMTNNDDYLDTFYTLEQDQSYHQYP
                     GAAGNAVIDLEPKEIAPTRP"
     CDS             complement(490547..491698)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707630.1"
                     /locus_tag="NUITMVA1_04320"
                     /product="benzoate transporter"
                     /protein_id="BDC80489.1"
                     /transl_table=11
                     /translation="MPFALPHLVAGFIAVMVGYTSSVILIIQAATAAGADAAQLASWL
                     WTLGIGMGISCIGLSLYYRIPVLTAWSTPGAALLITSLGDFTLAEAIGAFVISSLLIT
                     LCGISGWFDRLMRHIPAQLAAAMLAGVLLKFGLDLFKVAPADPLLLGSLLLAFLLGRH
                     LWPRYTMVLVLATGILICLLRGQLQLDTIHWRLAGPVMTWPEFSLGALFGIALPLFIV
                     TMTSQNMPGITILRAHGYQPATSSLITWTGLTGLLLAPFGGYAFNLAAITAAICMGKE
                     VDPDANRRWPAAVWAGGFYLLTGCFGATVAALFTAFPATLVTCVAGLALLGTIGSSLH
                     TALQHDDTREAALLTFIITASGISLLGIGAACWGLLVGIILYQVNQRRN"
     CDS             491820..492389
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707629.1"
                     /locus_tag="NUITMVA1_04330"
                     /product="DNA-binding protein"
                     /protein_id="BDC80490.1"
                     /transl_table=11
                     /translation="MQEMNQHLAQRLKGLRSKLGWSLDVAARETGVSKAMLGQIERGE
                     SSPTVATLWKIATGFRVSFSSFIEPTPAEQGEVLYRTADAIRQQPAGEGMQVAPLFPY
                     EERFGFELFELTLLPGYQRESEPHEPGVTEHVIVISGLMEVLVEGEWRSLTQGEAVRF
                     AADRPHGYRNLGVAPAIFHNLIHYPASRS"
     CDS             complement(492400..493617)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707628.1"
                     /locus_tag="NUITMVA1_04340"
                     /product="heme transporter CcmB"
                     /protein_id="BDC80491.1"
                     /transl_table=11
                     /translation="MFNLGFIMHQILDSRKEEKIVPLFRLGFRPFFLLGALFSALAML
                     GWLGQLNGWFVLPGIGNPIWWHAHEMLFGFGAAIVAGFLLTAVQNWTAHPGVRSWPLV
                     LVVLLWALPRALLPWLGEHNTFLMAADLLWLPLCAWYLAKPIVVTRQWRNLFFVPLLV
                     VLTLLNAASWLWQAQWADMEHLLITTVLLFTTLIAVMGGRVIPFFTARATGMEKAVPI
                     LWLERAALATLWLTLVSWLLLPTPWVTSLYLLPLYIVAAVLHLSRQWRWRLPSTLGQP
                     LLWSLHLAYLFIPLGLLALGALAAGLPISLSLASHLLSAGCMGTMILGMIARVSLGHS
                     GRALQVGRRIQCAFALVIMAALLRVLIPLLWPAYTLHGWNLSGLAWSLAYALFVWVYA
                     PILTSPRADGRPG"
     rRNA            494092..495630
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="NUITMVA1_r00070"
                     /product="16S ribosomal RNA"
     tRNA            495831..495906
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00160"
                     /product="tRNA-Glu"
     rRNA            496147..499031
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="NUITMVA1_r00080"
                     /product="23S ribosomal RNA"
     rRNA            499141..499249
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="NUITMVA1_r00090"
                     /product="5S ribosomal RNA"
     CDS             499509..499865
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ27"
                     /locus_tag="NUITMVA1_04350"
                     /product="UPF0265 protein"
                     /protein_id="BDC80492.1"
                     /transl_table=11
                     /translation="MACFYQPYVSGIDMEQVNKSTFSDVLEYVRMSRRQNKLKREIAD
                     NEKKVRDNQKRVLLLDNLSDYIKPGMSIDEVQAIIANMRADYEERVDDHIIKNAELSK
                     ERKELSTKLKAMSSSK"
     CDS             500082..503165
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707626.1"
                     /locus_tag="NUITMVA1_04360"
                     /product="glycosyl transferase family 51"
                     /protein_id="BDC80493.1"
                     /transl_table=11
                     /translation="MGASEQTDLNKVASQDSSVPSADGKYKRKRRSWWRWLFCFFFLL
                     CLAAVIALVGYEMQTSRLQSQEISRYAAKLTYQVEPGPSKQIAFPEDGPFDKRLGYVL
                     LPMMQERLLQRGYQVSEQVHFSDALYDYASRGFFVPYTEKVQAGLTLHDCRAEPFYQF
                     KYPTHYYPDFASIPPLVIQSLLFIENRDLLSNEQPLANPAVDWPRFAKAAMSQVGKAL
                     DMQDQSAGGSTLATQVEKYRHSPDGLTLSPTEKIRQMASASVRAYRLGPKTLEARKLV
                     AWAYLNSVPLSAAPGYGEVHGLGDGLWVWFGANVDEVNRLLDPARNQDASLAEQGLAL
                     RQVVSLMIAHRRPSYYLAQGRDALATLTDSYLRLFVQEGMITPPLMEAALKAKISFRD
                     FLQSPAVTKVNNNKGLQVARTRLSRQLGVQLYDLDRLDLTADTSLNMPLQNEVSRYLQ
                     QLADPTFAAQVGLFGERLLSPEKTGDVKYSFTLFEKSPQGFKVRVQTDNTDQPFDINE
                     GSKLELGSTAKLRVLTTYLEIVSELHDNYADMSAESLRKIEVSEQDNISRWAVSYLMT
                     AKDKSLPPMLEAALDRKYSASPNEGFFTGGGMHTFNNFRREDNGRIPAIRDALRESIN
                     LPFVRLMRDIVRYSLYREGNRAQLLKDDKDPRRTEYLAKFADKEGQTYLLRFWRKYRG
                     KTADEQLDTFLDGLKPSAVRLAAVHRYLMPDASQETFAAFLAKRLPREKLSDRRIEQL
                     YTSYGPGKYSLPDQGYIARVHPLELWLLSYLKEFDKATFADAVEASRDERQEVYSWLF
                     KTRHRSARDSRIRTMLEVEAFLDIHQRWARLGYPFDHLVPSLATALGSSGDRPAALAE
                     LMGIIQNGGIRAPTLRIEHLSFAKGTPFETEFQPAQTEGTRVLPVEVATALRNALSKV
                     VEGGTARRIAGAFALPDGTVLQMGGKTGTGDNRIETVGRYGNVTSSLARNRTATFVFY
                     LGEDHFGTLTAYVPGSQSDKFRFTSALPVQVLKGMAPLLMPYLQPGTHTQCMAGS"
     CDS             complement(503252..503776)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ25"
                     /locus_tag="NUITMVA1_04370"
                     /product="UPF0307 protein"
                     /protein_id="BDC80494.1"
                     /transl_table=11
                     /translation="MSQYQDDNEWEDWGPSKSQLKRDAEALQKMGEEIVSLSHSELEK
                     IPLDEELAEAVELGRKLKPKKDESFRRHLQFIGRLMRSRDVEPIVEALSIIKNRHSTV
                     NARLHRLEQWRERLINEGDSALNELMSQFHALDRQKLRQLIRTANKERELNKPPVAYR
                     EMYQYLRGEIEDLL"
     CDS             503890..505233
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707624.1"
                     /locus_tag="NUITMVA1_04380"
                     /product="peptidase PMbA"
                     /protein_id="BDC80495.1"
                     /transl_table=11
                     /translation="MDQQDQIRQDQAHLEAVVAEALEIAKGLGAGLAEVSISKQTGLS
                     VNTRGCELESIEFNKDGALGIAVYRDGCKGSSSTTDLSPSAIRAAVEAAMEIARHTSP
                     DACAGLADAELLAWDAPDLQLCHPIELDPQRGIELAIECERLALGRDTRIKHSDGAGF
                     SSHLGIKVYGNSHGFVKGYAASRNSLSCVLIGEQDGDMQRDYGYSSSRTLDGLWSPQR
                     IADEAVERTLSRLGARKISTRHAPVLFHPDTAAGLWGHLVMAISGGNLYRKSSFLLDK
                     LGKQILPEWLTIQEFPHLLGGLASTPFDGEGVLTRDMDIVRNGELMSWLLTSYSARKL
                     GLTTTGHAGGIHNWQVSNTGQDFNGMLKEMGTGLLVTELMGQGVNIVNGDYSRGAAGF
                     WVENGEIAYPVEEITIAGNLAEMFSHIVAVGSDEDERSSLKTGSVLVESMKLAGH"
     CDS             complement(505319..506575)
                     /codon_start=1
                     /gene="murA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ23"
                     /locus_tag="NUITMVA1_04390"
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="BDC80496.1"
                     /transl_table=11
                     /translation="MDKFKIDGRCTLNGEVTISGAKNAALPILFATLLCDEEIHLSNV
                     PRLKDVGTTIKLLEMLGATTKVNGNVTVLTGAVNNHVAPYELVKTMRASILALGPLAA
                     RFGAADVSLPGGCAIGARPVNLHVHGLELMGAKIAIEDGYIKARVDGRLKGAHILMDM
                     VSVTGTENLMMAATLADGRTVIENAAREPEVVDLANFLNALGAKIQGAGTDTLTIDGV
                     ERLHGGSYSVQPDRIETGTFLVGAAVTGGKITCRKTDPTLLEAVLVKLEEAGALIEKG
                     EDWITLDMTGRTLKPVTIKTAPYPAFPTDMQAQFTVLNAVAKGTGMVTETIFENRFMH
                     VPELVRMGADIELQGNVAICRDTQQLKGAQVMATDLRASASLVLAGFVAEGSTIVDRI
                     YHIDRGYEDIEHKLQGLGGRIERIKG"
     CDS             complement(506593..506850)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005306001.1"
                     /locus_tag="NUITMVA1_04400"
                     /product="hypothetical protein"
                     /protein_id="BDC80497.1"
                     /transl_table=11
                     /translation="MQVSEIEAILLEALPLSEVHVKGDGSHYQVIAVGDMFDGMSRVK
                     KQQAIYAPLMDKIASNAIHALSIKAFTDAEWKRERKFLLPS"
     CDS             complement(506850..507122)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_04410"
                     /product="hypothetical protein"
                     /protein_id="BDC80498.1"
                     /transl_table=11
                     /translation="MRLSGELQAAQVVELWQRRADWWQEDQIELSDVSTLDSAGLALL
                     VKWAKAALARGATPQLVGASTDFYTLANLYGVAGLFQSTPLTTEDA"
     CDS             complement(507119..507751)
                     /codon_start=1
                     /gene="ttg2D"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707621.1"
                     /locus_tag="NUITMVA1_04420"
                     /product="organic solvent ABC transporter
                     substrate-binding protein"
                     /protein_id="BDC80499.1"
                     /transl_table=11
                     /translation="MFKKIALLLGLMTSMLFSLTAQATDATDPYALVDQAAKQTFARL
                     KADQAQVKSNPDHLRVIIREELLPYVDNRFAAYKVLGNQIKQTTPAQRDAFVEVFTEY
                     MVSSYADALAHFDKQTVKVEPGKAAGDSNITAVNVSVKEAGKPDIFLEFKLRKNNKTG
                     EWKAFDMVAEGISLLSAKQNELGGLIRQNGIDAVIAQLRAHNAKPLVLKS"
     CDS             complement(507761..508252)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707620.1"
                     /locus_tag="NUITMVA1_04430"
                     /product="outer membrane lipid asymmetry maintenance
                     protein MlaD"
                     /protein_id="BDC80500.1"
                     /transl_table=11
                     /translation="MKFSKVEFLVGAFMLAGIGAILALALQVAGLSFKPEGETYTLRA
                     HFDNIGGLKVRSPVKVGGVVVGRVSDITLDAKSQVPIVSLQMQKSAGEFSETSTLSIL
                     TSGLLGEQYIGLMPGFTDEEMGTSMLKDGDMIEDTKSAIVLEDLIGKFLYSQSSDTKS
                     DSK"
     CDS             complement(508260..509039)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707619.1"
                     /locus_tag="NUITMVA1_04440"
                     /product="ABC transporter permease"
                     /protein_id="BDC80501.1"
                     /transl_table=11
                     /translation="MLTSQVSKLGRSGVRFISAIGRATIMLFHALAGKPAPRKHFPLL
                     VQQLYVVGVQSVAIILVSGLFIGMVLSLQGYNVLKDFGAEQSLGPLVSLSLLRELGPV
                     VTALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVVAPRFWAGVISMPLLAF
                     MFSLIGIFGGKLVGVDWLGVDEGSFWSAMQASVDWQDDIMQGAIKSLIFALVVTWIAL
                     FNGYDAKPTSAGISQATTRTVVHSSLAVLGLDFILTAVMFG"
     CDS             complement(509039..509839)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707618.1"
                     /locus_tag="NUITMVA1_04450"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BDC80502.1"
                     /transl_table=11
                     /translation="MDNCLNDDLITISDLTFSHGDRLLYDGINLTIPRGKVTAVMGPS
                     GIGKTTLLRLIGGQLKPESGHILFDGEDIPTLSRSRLYEVRKRMSMLFQSGALFTGMT
                     VYDNVAFPLREHSGLPEELIHTIVMMKLQAVGLRGAARLMPSELSGGMARRAALARSI
                     ALDPDLIMYDEPFVGQDPITMAVLVKLIKDMNDALGITSVIVTHDVKEVLSIADYAYI
                     IANRKVVAHGTPAQLREEHNPEVEQFLKGLPDGPVPFHFPAGDLLQDL"
     CDS             510047..511042
                     /codon_start=1
                     /gene="kdsD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ16"
                     /locus_tag="NUITMVA1_04460"
                     /product="arabinose 5-phosphate isomerase"
                     /protein_id="BDC80503.1"
                     /transl_table=11
                     /translation="MSVKSEKVSELFDFRRSARTVLDIEKQAIDGLYQYLNDAFDQAC
                     EMILRCSGKIVVTGMGKSGHVGSKIAATLASTGTPAFFLHPGEASHGDLGMISGGDLI
                     IAISNSGESDEILALLPVLKRRGIPLICMTGNPASTMAKEANVHLCIKVEKEACPLGL
                     APTSSTTATLVMGDALAVALLEARGFTADDFALSHPGGSLGKRLLLRVGDLMHSGELL
                     PQVGIDATISQALLEVSRKGLGMTAVADADGRLAGLFTDGDLRRILDLQVDIHHTPIS
                     RVMTVNCVTVGPEMMAAEAVKLMETRKINGLLVVDGDKRPLGAFNMHDLLKAGVI"
     CDS             511042..511596
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707616.1"
                     /locus_tag="NUITMVA1_04470"
                     /product="3-deoxy-D-manno-octulosonate 8-phosphate
                     phosphatase"
                     /protein_id="BDC80504.1"
                     /transl_table=11
                     /translation="MQNVPTLYGPVTRSQYDRAAQIRLLVCDVDGVLSNGLIYMGNDG
                     EELKTFCTRDGAGMRALLNAGIEIAIITGRNSRIVSDRMKSLGVQHLVQGADQKLPHF
                     EALLTKLALTPEQAAYIGDDTIDLPVMQACGLGIAVADAHPLVLARADMVTRLAGGVG
                     AVREVCDLILQAQGLGDYQPEASV"
     CDS             511593..512153
                     /codon_start=1
                     /gene="lptC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ14"
                     /locus_tag="NUITMVA1_04480"
                     /product="lipopolysaccharide export system protein LptC"
                     /protein_id="BDC80505.1"
                     /transl_table=11
                     /translation="MNRQTLLFALLFLVALAAWQLGDIELAPEPTTKVENYQPDFTAK
                     NLVTTRFDVEGRRTERLESRYAEYYQILEQATFDKPVVYMFDKQGEAEWKVTADTGVL
                     NTDDNVILRDKVHLDGLLPTSFISTLDTPYLELDLVTQNVRSNQQVSIVGKDFQTEGV
                     GLKGHLERKYFELLDQGHAIYFNEKR"
     CDS             512140..512667
                     /codon_start=1
                     /gene="lptA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ13"
                     /locus_tag="NUITMVA1_04490"
                     /product="lipopolysaccharide export system protein LptA"
                     /protein_id="BDC80506.1"
                     /transl_table=11
                     /translation="MKNANLAFAALLLCGTVSAKESDFAEKVYVDAVKQVAEMQDNRI
                     TFEQDVTITQGTIKIKADKVVVIRSGEKGAEVMTAYGKPATFFQILDNGKPVNAHGNS
                     IRYELKNRLVTITGNGQLKQEDSQVNGDLIRYDIVKQKMIAESKTPNQRVKTVFLPDQ
                     VENFDKPADQKKQGK"
     CDS             512671..513396
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707613.1"
                     /locus_tag="NUITMVA1_04500"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BDC80507.1"
                     /transl_table=11
                     /translation="MAVLKAAGLQKSYKRRMVVSDVSLEVGTGQIVGLLGPNGAGKTT
                     SFYMIVGLVQSDAGLITIDDQDISLQPMHIRARNGIGYLPQEASIFRRLSVFDNLMGV
                     MQTRKGLSREEREDKVQQLLEEFNITHIRDSLGQSLSGGERRRVEIARALAAEPRFIL
                     LDEPFAGVDPISVIDIKKIIQHLKDRGLGVLITDHNVRETLDVCEKAYIVSHGKMIAE
                     GAPADILADEQVKRVYLGDQFSL"
     CDS             513462..514901
                     /codon_start=1
                     /gene="rpoN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ11"
                     /locus_tag="NUITMVA1_04510"
                     /product="RNA polymerase sigma-54 factor"
                     /protein_id="BDC80508.1"
                     /transl_table=11
                     /translation="MKPTLQLRLGQSLTMTPQLQQAIRLLQLSTLELQQEIQQALDNN
                     PLLEQEENDVQETSPEEPVDASQLDSSDAMSQDNMPDELPVDTTWEEVYSAGTAQSAG
                     PIHDGEDSIYQGETTENLQDYLLWQMRLTPFSDVDAAIALAIIDAIDESGYLTVSLED
                     IQTAVSSEDVEVELDEVEAVLKRVQHFDPVGIAARSVQECLLIQLGQYSPDLPWLNEA
                     KEVILEHMDLLGNRDYRTLARKTRLKESDLKEVLDLIQQLEPRPGNGVIQSESQYVIP
                     DVSVVKKGNKWVVELNPDSAPRIRVNETYAAMARQARTSQDTQFIRSHLQEAKWFIKS
                     LESRNDTLLKVASCIVEQQQGFFEYGEEAMKPMVLNDIAEAVEMHESTISRVTTQKYM
                     HTPRGIFELKFFFSSHVNTEGGGECSSTAIRALIKKLVTAENPAKPLSDSKIADLLAE
                     QGIMVARRTIAKYRESLLIPPSNQRKRLV"
     CDS             514923..515210
                     /codon_start=1
                     /gene="yfiA-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005305957.1"
                     /locus_tag="NUITMVA1_04520"
                     /product="ribosomal subunit interface protein"
                     /protein_id="BDC80509.1"
                     /transl_table=11
                     /translation="MQINLTGHHVEITEALRDYVNNKFAKLERHFDHINNVHVVLSVE
                     KLNQIAEAKLHVSGGEVFANSQHADMYAAIDTLLDKLDRQIIKHKDKLNQK"
     CDS             515213..515659
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005305951.1"
                     /locus_tag="NUITMVA1_04530"
                     /product="PTS IIA-like nitrogen-regulatory protein PtsN"
                     /protein_id="BDC80510.1"
                     /transl_table=11
                     /translation="MQLEHILSRDCTKSAVPCTSKKRALEIISELAAERLGTSRQVLF
                     ECLLAREKMGSTGIGAGIAIPHGRIGDEFPPTAILMTFAEPIPFDSIDNQPVDLLFAL
                     LVPESECKQHLKTLSLMASKLGDKAVCRQLRQATSDEELYQIMTSA"
     CDS             515702..516568
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ08"
                     /locus_tag="NUITMVA1_04540"
                     /product="nucleotide-binding protein"
                     /protein_id="BDC80511.1"
                     /transl_table=11
                     /translation="MQLIVVSGRSGSGKTVALRVLEDLGYYCVDNLPVNLLPQLIVSV
                     ESQYDKLAVSIDVRNLPASPDKLETLLAQVRNEGRVEFSSFFFDAENSTLLKRYGESR
                     RLHPLSRNQLSLDEAIREETHLLAPLSSTADLRIDTTNLSIHDLSELIKTRVLGKKEN
                     ELVLVFESFGFKYGIPKDADFVFDARFLPNPHWIPELKPFTGKDEPVARYLSSQPDVM
                     QFILQIENMLATWLPHLERNNRSYVTVGIGCTGGQHRSVFIAEQLAGAFRLLGKNVQI
                     RHRTLDKSAPQF"
     CDS             516589..516861
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005305943.1"
                     /locus_tag="NUITMVA1_04550"
                     /product="phosphohistidinoprotein-hexose
                     phosphotransferase"
                     /protein_id="BDC80512.1"
                     /transl_table=11
                     /translation="MTVSASVEVKNKLGMHARPAMMLFELVQGFDAHVLLRNEEGVEA
                     DADSVIGLLMLDSAQGKQVEVQVEGPEEVEALAAVVALFTSGFNEE"
     CDS             complement(516877..518781)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707610.1"
                     /locus_tag="NUITMVA1_04560"
                     /product="transcription antiterminator BglG"
                     /protein_id="BDC80513.1"
                     /transl_table=11
                     /translation="MIKLPHPRLHQLLTLLHAEPLPQEELARRLNVSTRTVRTDVATL
                     NEIIATRGAHLIHQRGSGYQLKIYNQELFAALLAAQEQESGLPRTSRERVLHLQILLL
                     TAEQGIKLDELADTWYLSRAALQGDMAEVRERLAHFGLAIDSKPRLGMRIQGGETAIR
                     ACLTQLLYQELLHSNPLQSLLPNLCPSKTLEVVGNHIHEQLGRHQLRLADESLQQLAI
                     YCAVALLRQAAGHELCHFASEDLTAPLLAVARGIYGELPTLTPPGEEEIACLAIQIQA
                     RLTADAPQLSPAMAAESEHLVEHLLAYIHQHYPYDLRGDLQLRADLQTHISAMLLRVK
                     YQIGSHNPLADHIKQYYPLAYDITLAAISEWIRQTPYRLTHHEIGYLVIHIGVGLERH
                     YDIGYTRRPQALLLCDAGNATFRVLEARIKREYPQLQLTTLESVRDYEGLARIEQDFV
                     ISTVKAGEKNVPVVQVAPFPTQYQLEQLGKLVLVDRTRPYLLDKYFDADHFMVATEPL
                     SQAALFDRICSQLEAEDLVESGFRGSLQERERIVSTMLGDGIALPHSLGLLARRTLVY
                     TVLAPQGIDWGNGESATLVFVLAIAKADYEEAMGLYDLFLALMNEKASRSLLACRDFA
                     AFKALARSAP"
     CDS             complement(518886..519626)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707609.1"
                     /locus_tag="NUITMVA1_04570"
                     /product="2-dehydro-3-deoxyphosphooctonate aldolase"
                     /protein_id="BDC80514.1"
                     /transl_table=11
                     /translation="MSLTPNYYRDRVCLNVLAGSRQNAVDIYEAAEGHVLVGVLSKNY
                     PDVPSAVADMQAYAQLIDNALSIGLGAGDPRQSAMVAELARQLQPQHVNQVFTGVGAS
                     RALLGQSDTLVNGLVSPTGTPGMVKISTGPLSSQQPDGIVPIDTAIALLKDMGGSSVK
                     FFPMGGLACRAEYQAVAEACARHGFWLEPTGGIDLDNFEEIVRIALDAGVEKVIPHIY
                     SSIIDSASGQTRPEDVRTLLATVKRLLA"
     CDS             complement(519626..520741)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707608.1"
                     /locus_tag="NUITMVA1_04580"
                     /product="L-seryl-tRNA selenium transferase"
                     /protein_id="BDC80515.1"
                     /transl_table=11
                     /translation="MPSVYEKYQLKPVINASGRMTILGVSTPEQEVVDAVNFGLGHYF
                     EVKDLVNKTGAYLAGLLDVEDAVVVSCASAGIAQSVAAVIVRGDPYRLEQLHAHAHDV
                     PSEIVLPKGHNVNFGAPVGTMVNLGGGKVVEAGYANECSAAQLAAAINANTAAILYIK
                     SHHCVQKSILSVAEAAEVAKAHGLPLIVDAAAEEDLRLYYNQGADLVIYSGAKAIEGP
                     TSGLVLGKRQYVEWVKQQANGIGRAMKVGKEGILGLTHAIERYLLKEKESGAAMVAKM
                     TPFIERLNQLPGVSAKVVWDSAGRDIARTDIAFDHQQIGMTTVQVVARLQQSTPAIYC
                     RGYKANEGHIEIDVRSVTLPQLDQIHSAIAHLVQENN"
     CDS             complement(520725..521864)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707607.1"
                     /locus_tag="NUITMVA1_04590"
                     /product="dihydroorotase"
                     /protein_id="BDC80516.1"
                     /transl_table=11
                     /translation="MYDIIIRAGRQGDGQLIDIAIQQGKIATIGTLPETVAAQQILDL
                     DGRVHVSAGWIDGHTHCYPTSPLYHDEPDKVGVESGVTTVIDAGSTGADDVDDFQRLA
                     AGCKTRVHALLNISRIGLLRQNELADSRDLDMDLASAAIRRHPGFIVGIKARMSGSVV
                     GENGLQPLRMAKALQQAHGRLPLMVHVGNTPPDLDEIVALLGDGDLLTHCFNGKPNRI
                     LTPAGELRQAVREAMQRGLLLDIGHGGASFSFEVAELAIAQGILPRTISSDIYCKNRI
                     KGPVYSLAHVMSKFLAIGMTLEQVLACVTHHAADALRLSGKGRLEVGAAADLTLFEVS
                     SGPTLFTDTEAGARNGDRQLLPLAALVGGELVLTHYGKSHHAFCV"
     CDS             complement(521908..522558)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707606.1"
                     /locus_tag="NUITMVA1_04600"
                     /product="membrane protein"
                     /protein_id="BDC80517.1"
                     /transl_table=11
                     /translation="MDEKLKNNFWYADWSFPIFVGLLSAGVFAGTHMFYLYGVGAFNE
                     VAFVAMLKAGMDTGAYGAVAAFGASFLFARIIEGSLVGILDIGGAIQTGVGLGVPALL
                     LGAGIVYPVENFGASLATGMGIGLAIGYVIILARKFTINQSNSTYGADVMMGAGNSSG
                     RFLGPLIILSAMGASIPIGIGSLLGALLFYVWGKPITGGAILGAMLLGTFFPVALA"
     CDS             complement(522570..523346)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006810337.1"
                     /locus_tag="NUITMVA1_04610"
                     /product="membrane protein"
                     /protein_id="BDC80518.1"
                     /transl_table=11
                     /translation="MFLIIFIKSLIIGGLVGVGVGAGAARMFHAPTVQGMGAFRTLGE
                     LNSCEGDPASHFSFGLGFFFNAWASTVAAGAFTQDVDHRIIPHWATAALLFKNRDLAT
                     TLHDPKKMAIAGGIIGAIVVAFLNSTAAAVPAALQVTAVKVLVPAANLLVNTVMPVIF
                     WLAAIEAGKKSGFWATIFGGLAQLIMGNAVPGLVLGILIGKGVEESGWNHVTKVMMAA
                     IVLLFVLSGFFRGFDMKLIESFHLGVPLWLENVHNLLSGK"
     CDS             complement(523387..523683)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707604.1"
                     /locus_tag="NUITMVA1_04620"
                     /product="hypothetical protein"
                     /protein_id="BDC80519.1"
                     /transl_table=11
                     /translation="MKEDFTTQVMVSGKGPTRQQAFAAALSQVQPTLLKDNPRVMLRI
                     EPLEVQVLKAEESVRVEKFLFFFLPRQRREFRVQLAITVKVTSLDAEQVTFTLV"
     CDS             complement(523683..524048)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707603.1"
                     /locus_tag="NUITMVA1_04630"
                     /product="transcriptional regulator"
                     /protein_id="BDC80520.1"
                     /transl_table=11
                     /translation="MTAIKLVIGDRLGKGQKVGAGAETAGASVTIIPGMAADMKLGDV
                     MNKEQADLGISFCGSGGAGAITAQTKYGYKCRYGMRSIEEGVTAINEGCVVLGFGFMD
                     KEELGQKLIEAFAKKHGRA"
     CDS             complement(524049..524411)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707602.1"
                     /locus_tag="NUITMVA1_04640"
                     /product="transcriptional regulator"
                     /protein_id="BDC80521.1"
                     /transl_table=11
                     /translation="MHTETHDQNLTPDSPALLRQTDHTLARIHTLLGEQGIRPNEVQR
                     QMLASHVKAMVWRSYSGESLPEVDLSLFEEISPLSLRLAEQVVAWLDKLAYEEAHLLS
                     VHFEVAKENELSSVKGES"
     CDS             complement(524723..525844)
                     /codon_start=1
                     /gene="degS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707601.1"
                     /locus_tag="NUITMVA1_04650"
                     /product="outer membrane-stress sensor serine
                     endopeptidase DegS"
                     /protein_id="BDC80522.1"
                     /transl_table=11
                     /translation="MKIPPLVSYLGKSVGFGLTVAALLLLLFPNFRGGAQLPGLITNA
                     RELSFSYAAHRAGPAVVNIYTRSFARNQGNQAELRPQGLGSGVIMSQRGHVLTNYHVI
                     ADADQIIVALQDGRVFSAELVGSDQLTDLAVLYIESDNLPVIPQDPERLPDVGDVVLA
                     IGNPYNVGQTITQGIISATGRIGLSSMGPDSNGRQDLLQTDAAINEGNSGGALVNARG
                     DLVGINTAAYHLNGNQESYGISFAIPYKLAKRIMDELIANGRVIRGYLGISSVEINPI
                     VARMMNLGDLRGLVVESLDPNGPATRGGLKRGDVLLKINGEAISGVRTAMDKIVESRP
                     GTKLTISVIRDGKPLEVEVTIEEDLRYQNRASASAATAS"
     CDS             complement(525934..527295)
                     /codon_start=1
                     /gene="degQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707600.1"
                     /locus_tag="NUITMVA1_04660"
                     /product="serine endoprotease DegQ"
                     /protein_id="BDC80523.1"
                     /transl_table=11
                     /translation="MRKPLSVLSVLALSVGIAMSAAPVQAALPSLLANNQEMPSLAPV
                     LEQVTPAVVNISVSGKKITRQRLPEQFRFFFGPNMPDEQVSEQPFQALGSGVIIDAKK
                     GYVITNAHVVHEADEIKVNLKDGREYAAKKIGEDKQSDIALLQIKAEDLVQIKFADSD
                     ELRVGDYALAIGNPFGLGQTVTSGIVSALGRSGLNIENLENFIQTDAAINSGNSGGAL
                     LNLRGELIGINTAILGPNGGNIGIGFAIPSNMVRDLSEQIVKYGEVRRGQLGITGTEL
                     TSEIAKTFGYNKKDGAFVNQVMPDSAAAKAGIKAGDIIISIDGKAIRSFGELRAKIAT
                     MGADKQVALGLIRDGKEQTVKVTLKKADDSEILASALHPALEGAKLSTTAEPVTGVAV
                     ADIDPRSPAAASGLQKGDIIIGVNRLRINSLEELSKALKNKPDVLALNIQRGESSLYL
                     VIR"
     CDS             complement(527377..527757)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707599.1"
                     /locus_tag="NUITMVA1_04670"
                     /product="membrane protein"
                     /protein_id="BDC80524.1"
                     /transl_table=11
                     /translation="MSLLNGILLAVAALIIGVIIGRFTVRSRDAGRLEQELKKAHKEL
                     ESYQGQINTHFADSAALMEQLAEQYQTLYRHMAEQSKFLAKAQEPLFRETLLDESSDV
                     PANEEPGVPPRDYAGASGLLKQSS"
     CDS             527898..528992
                     /codon_start=1
                     /gene="zapE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPZ4"
                     /locus_tag="NUITMVA1_04680"
                     /product="cell division protein ZapE"
                     /protein_id="BDC80525.1"
                     /transl_table=11
                     /translation="MTPQQKYQQDLQRPGFVADPAQAMAVARLERLYQDLCQTPTPTR
                     SRGLLGWLQKPKPRTPILGLYMWGGVGRGKTWLMDTFFDSLPGERKLRIHFHRFMHRV
                     HDELKGLTGQADPLKLIASKLAGETDVICFDEFFVSDITDAMLLGTLFQELFGHGVVL
                     VATSNIPPQDLYRNGLQRARFLPAIALIERHCEILNVDGGTDYRLRTLEQAEIYHFPL
                     DQQAKSNLDRYFRQLTGLEEAQAGSVEINHRQLASLGMGEGVLYMEFEQLCCTPRSQG
                     DYIELARLFHTVLLANVQPMGAGTDDAARRFIAMVDEFYERHVKLIISATVPMQELYG
                     NGLLNFEFKRCLSRLQEMQSHEYLARVHLP"
     CDS             529259..529687
                     /codon_start=1
                     /gene="rplM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPZ3"
                     /locus_tag="NUITMVA1_04690"
                     /product="50S ribosomal protein L13"
                     /protein_id="BDC80526.1"
                     /transl_table=11
                     /translation="MKTFVAKPETVKRDWYIVDAEGKTLGRIATEIAARLRGKHKAEY
                     TPHVDTGDYIIVVNAEKVHVTGKKFTDKMYHAHSGFPGGIKSISFDKLIQRKPEMVIE
                     AAVKGMLPKGPLGRAMFRKLKVYAGAEHAHAAQQPQVLDI"
     CDS             529703..530095
                     /codon_start=1
                     /gene="rpsI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPZ2"
                     /locus_tag="NUITMVA1_04700"
                     /product="30S ribosomal protein S9"
                     /protein_id="BDC80527.1"
                     /transl_table=11
                     /translation="MAENQYYGTGRRKSSTARVFIKAGSGKIVINQRSLEQYFGRPTA
                     RMVVRQPLELVEMTEKLDLYITVNGGGISGQAGAIRHGITRALMQYDETLRSELRKAG
                     FVTRDARKVERKKVGLHKARKRPQYSKR"
     CDS             530481..530981
                     /codon_start=1
                     /gene="petA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPZ1"
                     /locus_tag="NUITMVA1_04710"
                     /product="ubiquinol-cytochrome c reductase iron-sulfur
                     subunit"
                     /protein_id="BDC80528.1"
                     /transl_table=11
                     /translation="MPFIKSWNPSAKAKAAGAPVEVDISKLEPGQLIRVEWRGKPVWV
                     VKRTKQTLDALAAHDDKLRDPASDEPQQPDYAHNGYRSIKPEIFVAVGICTHLGCSPS
                     YLPDSFGEQVQGVTSGFFCPCHGSKFDMAGRVFQGVPAPLNLVIPPYKYLSDTTILVG
                     ADGKEA"
     CDS             530984..532201
                     /codon_start=1
                     /gene="petB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPZ0"
                     /locus_tag="NUITMVA1_04720"
                     /product="cytochrome b"
                     /protein_id="BDC80529.1"
                     /transl_table=11
                     /translation="MFAKLMGWIDYRFPLTAMYNDHMAKYPAPKNLNFWYFFGSLAML
                     VLVNQIITGIWLTMNYNPSAEGAFASVEYIMRDVDYGWLLRYMHSTGASAFFIVVYLH
                     MFRGMIYGSYQKPRELLWIFGMLIFLCLMAEAFMGYLLPWGQMSFWGAQVIISLFGAI
                     PVIGDDLTLWIRGDYVISGATLNRFFALHVIALPLVLVMLVAMHILALHEVGSNNPDG
                     IDIKKHKDENGWPLDAVAFHPYFTVKDMIGVAGFLFLFCAIIFFKPDMWGYFLEKPNF
                     EVANGLKTPAHIAPVWYFTPFYAILRAVPDKLLGVIMMGLSIVVLFLLPWLDRCKVRS
                     VRYRSTLHKLNIAQFVVCFIILGVLGVLPSTPTLTLIAQICTLGYFGFFVLLFFYSKN
                     ESTKPLPERVTFK"
     CDS             532198..532932
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707595.1"
                     /locus_tag="NUITMVA1_04730"
                     /product="cytochrome c"
                     /protein_id="BDC80530.1"
                     /transl_table=11
                     /translation="MKRIIFAVLTLLPSLVFGNTGAVHLDKANYDLNDKASLQRGAAT
                     FMNYCFGCHSTQYQRYNRVAADIGIPEDLMAANLIVNGAKIGDLMENSVPDKDAAKWF
                     GAPPPDLTLVARVRGADWIYTYLRSFYVDETRPFGVNNVVFPSVGMPHVLEPLQGTPR
                     AEFATHTVDGVEVQQVVSVKSDGNGEMNNEEYDQTVLDLVNFLVYSAEPVQQERERMG
                     FWVLGFIVIFFIFTVLLKKEFWRDVH"
     CDS             533020..533649
                     /codon_start=1
                     /gene="sspA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707594.1"
                     /locus_tag="NUITMVA1_04740"
                     /product="stringent starvation protein A"
                     /protein_id="BDC80531.1"
                     /transl_table=11
                     /translation="MAVAANKRSVMTLFSGANDMFSHQVRIVLAEKGVSVDICQVDPS
                     NLPDELAELNPYNTVPTLVDRELALYTSRIIMEYLDERFPHPPLMPVYPVARGNSRLM
                     MHRIELDWYSLADKIMAGTDVDAARAELRDNLLAIAPIFGEMPYFMSEEFGLVDCYMA
                     PLLWRLPSLGIDFTGRGAKELKAYMVRLFERESFQASLTEAEREIRAGV"
     CDS             533664..534071
                     /codon_start=1
                     /gene="sspB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707593.1"
                     /locus_tag="NUITMVA1_04750"
                     /product="stringent starvation protein B"
                     /protein_id="BDC80532.1"
                     /transl_table=11
                     /translation="MTPSRPYLLRAFFDWLLDNDLTPHLVVNVNIPHVMVPMQFVQDG
                     QIVLNIAPRAVGQFHMDNEAISFSARFGGVSQQVYIPMAAVLAIHARENGVGTLFPPE
                     PGYDLWLEQAEAPVEPEPEPPRPSGRPTLKVIK"
     CDS             complement(534124..534702)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707592.1"
                     /locus_tag="NUITMVA1_04760"
                     /product="BON domain-containing protein"
                     /protein_id="BDC80533.1"
                     /transl_table=11
                     /translation="MNKQMLLLGLLAGTLLLQGCAAVVVGGAAGTAKASGDRRTLGAQ
                     WDDQAIELKAANLLADNKPLSAASKISVYSNNGRVLLVGQTPSDAYKLEAGKIVARIE
                     GVRHVYNELRLGQPVSIGVRSNDSWITSKVRADMLGAKNFDSAKVKVVTENGEVFLIG
                     LVTRQEGDHAVEIARHVSGVKRVIKAFEFAQN"
     CDS             complement(534707..535297)
                     /codon_start=1
                     /gene="gmhA-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707591.1"
                     /locus_tag="NUITMVA1_04770"
                     /product="DnaA initiator-associating protein DiaA"
                     /protein_id="BDC80534.1"
                     /transl_table=11
                     /translation="MTDRIKENYTESIQTKIAAAEALPDAIHTAAQMLTICLLNGHKV
                     MACGNGPSAALAQLFISELVNCYETERPSLPGMALTPDMATISAIATDHGFEEVYAKQ
                     IRALGQPGDILVVITTTGNSRSLIKAAEAALSRDMTIVVLGGGDGGEIAGLLGPNDVE
                     IRVPSARRPRILEVNLLTLHCLCDLIDQTLFPQQED"
     CDS             complement(535307..535699)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPY4"
                     /locus_tag="NUITMVA1_04780"
                     /product="UPF0102 protein"
                     /protein_id="BDC80535.1"
                     /transl_table=11
                     /translation="MKGLLARMHQQWQNLFPSAQSKGQHFELLAERWLQARGLQPVTR
                     NYRCRGGEIDLIMRQGETLVFVEVRYRAQTSHGGAAASVTRRKQHKIVLAARHYFKQH
                     AINEASQACRFDVIAFEGDQPDWIQNAF"
     CDS             complement(535620..537407)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707589.1"
                     /locus_tag="NUITMVA1_04790"
                     /product="penicillin-binding protein activator"
                     /protein_id="BDC80536.1"
                     /transl_table=11
                     /translation="MPSAFSDLTKNAQWYLAQVDPAKPAEAFTWQVMAARSYLALGQA
                     KPAAALFQQLQKQGQSAEQKAQLQLLQAHLLLAQGNANQALILLEGKPEVALDADTQK
                     DWYRQRVVLQLDINNKFGAAKSLILLEPYLAQNELATNHQQIWSLLKSMTPSTLQALE
                     EAPAPDVTTGWLRLAALVNEFGAQPNQLARQLAGWKQAFPNHPAQKDMPAGLGDLATS
                     NVNTLQQIAVFLPLSGNLEPQGAAIRNGMLMSYKENQGQFTLNFYDTQTKAMGELYKQ
                     AIQEGANMIIGPLLKDRVEELLKSNPTVPVLALNELDKPIVNDNTFYFSLSAAADAAQ
                     AAQYLYGQGYRKPLLIAAQGRIGYGSIKAFEQAWATVSQDKPVVATFGARNEVQGMVK
                     NALSGRSTARAGEVVQLADTAPRSIDVVYVVANSLETRMIKPYVDISVNPMGSLPIYS
                     SSRSYDSATTEVASELNGMHISDMPLLLGGYEKQREQIALLWPQTQGDLLRLFALGYD
                     AVALAENLQQMRKVNAMQQPGMSGQLSVDASGNIVRVLDWATYQNGKLVSDSAMPQLE
                     GAPHEGSIGTDAPAVAEPVPVSTEQGTAL"
     CDS             537607..538440
                     /codon_start=1
                     /gene="rsmI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPY2"
                     /locus_tag="NUITMVA1_04800"
                     /product="ribosomal RNA small subunit methyltransferase I"
                     /protein_id="BDC80537.1"
                     /transl_table=11
                     /translation="MSDIPTLYIVPTPIGNLADITQRALDILRSVDLVAAEDTRHTGI
                     LLSHYQISVHTFALHDHNEQQKADVLIGRIKEGKSVALVSDAGTPLISDPGYHLVTRC
                     REAGVKVVPLPGPCAAITALSAAGLPTDRFAFEGFLPAKSKGRDDRLQAVIEDTRSLV
                     FYESPRRVQDTVEAIARILGERQVVVCRELTKTFESIHGLPASEMLVWLGEDENRCRG
                     EIVLVVAGANKTEEELPAEAIRTLGLLVAELPLKKAAALTAEIHGVKKNALYKYGLEH
                     Y"
     CDS             539391..539849
                     /codon_start=1
                     /gene="mraZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPY1"
                     /locus_tag="NUITMVA1_04810"
                     /product="transcriptional regulator MraZ"
                     /protein_id="BDC80538.1"
                     /transl_table=11
                     /translation="MLRGAHAISLDSKGRLAIPTKYRDWLRDESEGQLVCTIDIAHPC
                     LLLYPLNEWEEIERKLKTLSSMNPLERRLQRLLLGHATECELDGNGRLLLSQPLRSHA
                     GLDKKIMLVGQLNKFELWDEARWQQQVNDDIQGLPEDDWASSPRLQDFSL"
     CDS             539850..540788
                     /codon_start=1
                     /gene="rsmH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPY0"
                     /locus_tag="NUITMVA1_04820"
                     /product="ribosomal RNA small subunit methyltransferase H"
                     /protein_id="BDC80539.1"
                     /transl_table=11
                     /translation="MTQAAEHITVLLHEAVEGLAIKPDGIYVDGTFGRGGHSRLILQQ
                     LGPNGRLIAIDRDPQAIAEAAKIQDPRFEIVHGPFSGIASYLDERGLLGKVDGFLLDL
                     GVSSPQLDDAERGFSFMKDGPLDMRMDPTSGQSAAEWLARADVDDIAWVLKTFGEERF
                     AKKIARAIVHDRVTEPYVRTRQLAEMIARVNPSKEKGKHAATRSFQAIRIYINSELDE
                     IETALNGALQVLAPEGRLSVISFHSLEDRLVKHFIRKHEKGPEVPHGIPLTEAQLAGG
                     RKLKSVGKALKPSEHEVSENSRSRSSVLRVAQRLAE"
     CDS             540792..541106
                     /codon_start=1
                     /gene="ftsL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPX9"
                     /locus_tag="NUITMVA1_04830"
                     /product="cell division protein FtsL"
                     /protein_id="BDC80540.1"
                     /transl_table=11
                     /translation="MSEVRVHLAREILGDLWRHKLQVVLAIAVLITAFAVILVTNMTR
                     GLTAKQNDLMAEEDRLNIEWRHLLLEQGTLAEHSRVASLAMDKLQMARPLVTTEKVIT
                     QP"
     CDS             541103..542857
                     /codon_start=1
                     /gene="ftsI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707586.1"
                     /locus_tag="NUITMVA1_04840"
                     /product="peptidoglycan glycosyltransferase FtsI"
                     /protein_id="BDC80541.1"
                     /transl_table=11
                     /translation="MKRKASAKAQPKVKAPSLYPWRFRTLVFFIGIAFAGLILRLAWI
                     QVIDPDRLRQEGDMRSLRTTATQAVRGMITDRNGEQLAVSVPVEAVWADPKTVHESGA
                     IHNERAWLALSAVLKLDINTLKHRISNPSKRFVYLQRQVTPAVAEYIKGLKLGGIYLR
                     PEARRFYPTGEISAHLVGVTNIDGSGIEGIERSYNEWLTATPGEMRVRKDRQGRVIER
                     LGLVKEGKNANDLQLSIDQRVQALAYRALKRATDENKATSGSMVMLDVKTGEVLAMVN
                     TPSYNPNNRGQYQSFRVRNRVVTDTYEPGSTVKPLILLSALQAGVTSWKDTIPGGPLF
                     IGAKQIRDVSIHKATNLYDILRYSSNIGMSRIALRMPAQEMINTLSMVGFGMDTGSGL
                     MGESSGMLPQRRRWSDIERATLSFGYGLRVTPLQLASAYATLANKGKRVPLSIVKVTE
                     PPKGEQVIDHNNATAMLQALEYVVSNAIPKAQIPGYRVGGKSGTAKVAVAGGYGKDYM
                     AWFAGFAPASNPRFVMVVVINEPKGDAYYGGAVATPPFAEAMGGVLQLFNIRPDAVPP
                     AVPTKLARTEASNVVPRT"
     CDS             542838..544322
                     /codon_start=1
                     /gene="murE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPX7"
                     /locus_tag="NUITMVA1_04850"
                     /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-
                     diaminopimelate ligase"
                     /protein_id="BDC80542.1"
                     /transl_table=11
                     /translation="MLSRALDQLMRPFGITAPALALTDIQLDSRRVGPGCLFVAIRGH
                     QVDGRRFIEQAVAQGATAVLFEEDGEFVAPALSVPCLGIPDLPARLSELAGYCYDQPA
                     SKLDLVGITGTNGKSTTALLVANWRTLLGGKAGVMGTIGNGLFGELVEAENTTGSAVQ
                     VQANLAALQAQGADLVAMEVSSHGLVQHRVAALPFAAAVFTNLSRDHLDYHGTMEAYG
                     AAKEELLKLVDEPCAVLNADDRLGRQWLAAYPAAVAFSVHGPVAGHPGRQLTAQDPHF
                     HQQGFRTQINSSWGNGVLSAPLLGRFNVSNVLAAMGAMLVLGYDFDELLASAPQLQPV
                     TGRMECFGGGKAPLAVVDYAHTPDALEKALQALRVHCEGRLWCLVGCGGDRDRGKRPM
                     MAAMAELHADRVILTDDNPRTEEPARIMADMVAGLRDPGAVQIEHDRTKAIQLALSQA
                     SKQDIILVAGKGHEDYQIIGTDKRHYSDRETVAAALHTLLESFT"
     CDS             544319..545674
                     /codon_start=1
                     /gene="murF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPX6"
                     /locus_tag="NUITMVA1_04860"
                     /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-
                     alanine ligase"
                     /protein_id="BDC80543.1"
                     /transl_table=11
                     /translation="MMTLRLAELAQVLDARLIGEDGAITAVSTDTRTLGAGALFVALR
                     GERFDAHDFCEQAVAAGASALLVERELPLAIPQLVVTDSLKGLGRLGRLVRERINPKV
                     LAITGSCGKTTVKEMATAILRQEGEVLATAGNFNNEVGVPLTLLRLEPQHRFAVMELG
                     ANHPGEIAWTTSLAKPDAAIINNVAAAHLEGFGSLEGVFHAKSEIFEGLGEGGCAIVN
                     ADNEFWPKWQARGIQCAFSIEDQRQPFHASNVVINQQGCAEFVMVTPQGEVSLTLAIP
                     GRHNVANALAAAAGTLALGASLASVKAGLEQMAPVKGRFCVQRWGGLTLVDDTYNASV
                     ESVLAGIDALTAMSGYKVLVFGDMKELGEESAEQHARVGRHASERGLDAVLTVGEQSR
                     HTADAAAGRHFDNKASLFEVLAQMINTHQEIAILVKGARGSRMEDIVEMVKDRQESAT
                     C"
     CDS             545668..546750
                     /codon_start=1
                     /gene="mraY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPX5"
                     /locus_tag="NUITMVA1_04870"
                     /product="phospho-N-acetylmuramoyl-pentapeptide-
                     transferase"
                     /protein_id="BDC80544.1"
                     /transl_table=11
                     /translation="MLVWLAELLTPHFTFFNVFSYLTFRAILSIITGLVVALWMGPRL
                     IRRLQILKFGQVIRNDGPESHLSKKGTPTMGGLMIIAAIFISVLLWCRLDNPYVWLVL
                     FVLGAYGAIGFADDYLKVVRKNTDGLIARWKYFWQSAVALGVAVFLYATATHDGQTQL
                     VVPFLKDVMPQLGLMFIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVMVAGGFAFIAWA
                     TGNVNFANYLHIPYVPYTSELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGA
                     LGTIAVLVRQEFLLVIMGGVFVMETVSVILQVGSYKLRGVRIFRMAPIHHHYEKKGWP
                     EPRVIVRFWIITLMLVLLGLATLKVR"
     CDS             546754..548037
                     /codon_start=1
                     /gene="murD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPX4"
                     /locus_tag="NUITMVA1_04880"
                     /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
                     /protein_id="BDC80545.1"
                     /transl_table=11
                     /translation="MVIIIGLGKTGLSCVDYFLGRGVTPLVMDTRANPPGRDQLPAEV
                     ELIHGLDGELLKQAHMIVASPGIALATPELQAAAEFGVRIVGDIELFVRETQVPVIAI
                     TGSNGKSTVTTLVGEMIAEAGLKVGVGGNIGTPALELLKQPMDLCVLELSSFQLETTH
                     SLRAAASVVLNLSEDHMDRYQGMADYRAAKMEIHQHSQHILINRDDAQTLPDVGQVWQ
                     SFGLDCNGYGRCELDGRHWLTLHGEPLLAVDEMKIVGAHNQANALAAMALCDAVGIPR
                     EPQLRVLRRFEGLPHRARFVREVNGVRWINDSKATNVGATLAAVAGVRESVKGRLLLL
                     AGGQGKGQDFGPVQALLGSQIDHMYCFGQDAEVLLALGEQTERVADLDAAVAKAAADA
                     RPGDWVLLAPACASLDQFKSFEARGDRFTELVQKL"
     CDS             548034..549215
                     /codon_start=1
                     /gene="ftsW"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPX3"
                     /locus_tag="NUITMVA1_04890"
                     /product="putative lipid II flippase FtsW"
                     /protein_id="BDC80546.1"
                     /transl_table=11
                     /translation="MNALRAVAGFLQRWLLPARPAGLYDRQLVVLALALMAVGLVIVA
                     SASIPEGIAINNDPFMFVKRHGLFLLMALGISWFVLQVPMARWQHYNGPMLLLAIVML
                     VLVLLVGRSVNGSVRWLPLGPFNLQPAEFGKLALFVYLAGYLVRRQSEVRERFIGFMK
                     PMAVLFVVAILLLAQPDLGSVVVMFVTSLGMLFLAGARLVQFIGLILVGVSAVVTLII
                     AEPYRMRRVTSFLDPWADPFGSGYQLTQSLMAFGRGSWFGEGLGNSIQKMEYLPEAHT
                     DFVFAILGEELGYVGVLGALFLIFALAIKALKLGHQALVAERLYEGYLAIGIGIWFSF
                     QTFVNVGAASGMMPTKGLTLPLVSYGGSSLIIMMVAVSMLIRIDFELRQASAQARVRE
                     V"
     CDS             549215..550300
                     /codon_start=1
                     /gene="murG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPX2"
                     /locus_tag="NUITMVA1_04900"
                     /product="UDP-N-acetylglucosamine--N-acetylmuramyl-
                     (pentapeptide) pyrophosphoryl-undecaprenol
                     N-acetylglucosamine transferase"
                     /protein_id="BDC80547.1"
                     /transl_table=11
                     /translation="MSKTLLVMAGGTGGHVFPGLAVADRLKAQGWTIHWLGTADRMEA
                     ELVPAHGYPISFIDIQGVRGNGIKRLLVAPYRIVKSVLQARRVLKTIRPDVVLGMGGF
                     ASGPGGVAAWLSGIPLLLHEQNAAAGLTNKLLARLAKRVLMAFPGAFAPSRRTAVVGN
                     PVRPEVVALPDPQLRSGAEPLRLLIVGGSLGARVLNEQVPPAVAAAGVPIEVRHQCGK
                     GNRDAVAEAYAKQGVAAEVSEFIKDMADAYAWADLVVCRAGALTVSEVAAAGVAAIFV
                     PLPHAVDDHQTRNALTLVDGGAAEFLPQSELTTASLAARLSWLAGRRETLLNMAQAAR
                     RVAITDAAERVADECKRLATGQIEREL"
     CDS             550297..551751
                     /codon_start=1
                     /gene="murC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPX1"
                     /locus_tag="NUITMVA1_04910"
                     /product="UDP-N-acetylmuramate--L-alanine ligase"
                     /protein_id="BDC80548.1"
                     /transl_table=11
                     /translation="MTKVELAKLRTVIPEMRRVRRIHFIGIGGAGMGGIAEVLANEGY
                     QVTGSDLARNAVTERLESLGAHIFVGHSAEHVNEASVVVVSTAIKQDNPELLAARELR
                     IPVVRRAEMLAELMRFRHGIAIAGTHGKTTTTSLVASIYAEADRDPTFVIGGLLNSAG
                     TNARLGSSRYLIAEADESDASFLHLQPMVSIVTNIEADHMDTYGGDFSKLKATFIDFL
                     HNLPFYGLAVVCVDDPVIRGMLPEIARPTITYGLSDDADVQVLDFVQTSNRSRFRVRR
                     KDAGELEVTLNLPGIHNALNAAAAIAVATEDGIGDDAIIRALAKFEGVGRRFQQYGEF
                     ETGRGKAMLVDDYGHHPSEVKVTINAARAGWPEKRLVMVFQPHRYTRTRDLYEDFADV
                     LSKVDVLVMLEVYAAGEEPIPGADGRALCRSIRSRGSLEPIFVATPDDVPAVLAGLVG
                     EGDLVLTQGAGNVGALARRLGEMKLSIESMKSGA"
     CDS             551849..552601
                     /codon_start=1
                     /gene="ftsQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPX0"
                     /locus_tag="NUITMVA1_04920"
                     /product="cell division protein FtsQ"
                     /protein_id="BDC80549.1"
                     /transl_table=11
                     /translation="MEARAQGRTKGGFIAGVGFFILVMWGLYQTALDVKDWLTDANRL
                     PMSELLLQGQHQYLQTDELRSAVLDGAELRNFFELDVNELQARLNALPWVAQVSVRKK
                     WPNKIKVYLTEQAVAARWNGNRFVNTKGEVFSAPDRVKTPLMQLSGPEDQAVKVLEAS
                     RQYEAQLAARGYKLLGVNLTPRHAWELTLDGNIQLFLGRSDIALRLQRFIDAFPVIEP
                     RERVAYVDLRYDTGMAVGWKKNEEKVNDQNRR"
     CDS             552582..553841
                     /codon_start=1
                     /gene="ftsA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPW9"
                     /locus_tag="NUITMVA1_04930"
                     /product="cell division protein FtsA"
                     /protein_id="BDC80550.1"
                     /transl_table=11
                     /translation="MTKTADRNLIVGLDIGTTKVAVLVGEVLPDGELNVIGMGSHASR
                     GMDKGGVNDLDSVVKSLRRAVEEAEMMADCQISSVYLGLSGKHIDCRNETGMVPISDE
                     EVTQEDVDNVIHTAKSVRLSDELRVLHVLPQEFAIDYQEGIKNPVGLSGVRMAAKVHL
                     ITCHNDMARNIEKCVEKVGLRVDQLIFSALASSYAVLTEDEKELGVCVVDIGGGTMDM
                     SLFTGGALRHTKVIPYAGSTVTSDIAYAFGTPPLDAEAIKVRYGCALGRLVSKEDNIE
                     VPSVGGRPARSLQRQTLAEVIEPRYTELLSMVNDELVRVQSELKAQGVKHQLAAGVVL
                     TGGAAQIEGIVECAEQIFQSQVRVGEPMNIRGLSDYVQAPVYSTAVGLLQYGRTHQST
                     GSSKEYAAKASVGGLVKRVSNWLRGEF"
     CDS             553882..555033
                     /codon_start=1
                     /gene="ftsZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPW8"
                     /locus_tag="NUITMVA1_04940"
                     /product="cell division protein FtsZ"
                     /protein_id="BDC80551.1"
                     /transl_table=11
                     /translation="MFEFMDSHTDEAVIKVIGVGGGGGNAVEHMVRQNIEGVEFITVN
                     TDAQALRNSSANTTLQIGGGITKGLGAGANPEVGRDAAMEDREALRELLTGSDMVFIA
                     AGMGGGTGTGAAPIVAEVAREMGILTVAVVTKPFSFEGKKRMGFAAHGIEELSKNVDS
                     LITIPNDKLLKVLGRGISLLDAFKAANDVLLGAVQGIAELITRPGLINVDFADVRTVM
                     REMGTAMMGTGSASGDDRAEEAAEKAISSPLLEDVDLAGARGILVNITAGMDMTIEEF
                     ETVGNAVKAFASENATVVVGTVIDPEMHDELRVTVVATGIGAERKPDITLVKNNMVQE
                     RPARQPLISEALQSRVMEEAPAKVVNAEPQARREPDYLDIPAFLRKQAD"
     CDS             555252..556058
                     /codon_start=1
                     /gene="lpxC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPW7"
                     /locus_tag="NUITMVA1_04950"
                     /product="UDP-3-O-acyl-N-acetylglucosamine deacetylase"
                     /protein_id="BDC80552.1"
                     /transl_table=11
                     /translation="MRTDLNPAVELPANADQVRDTVLCTALVNEAGVRVSTIEHLSAA
                     LAGMGIDNLYVEVDAPEIPVMDGSAHPFIYLLQEVGIREQNAPKQFVRIKQSIRVEDG
                     DKWAEFHPYRNGFKMDLEIDFQHPVFEGRNQRCVLDFSGASFVKEISRARTFGFMRDI
                     EYLRSQNLALGGSLENAVVLDDYRVLNEDGLRYEDEFVKHKMLDAIGDLYMCNRSIIG
                     EFRAYKTGHALNNKLLRALLAKQEAWELVTFEGEGDKAPIAYYDNGLVLA"
     CDS             556199..557104
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707577.1"
                     /locus_tag="NUITMVA1_04960"
                     /product="peptidase M23"
                     /protein_id="BDC80553.1"
                     /transl_table=11
                     /translation="MSITLILNGKQRRKLHLPKQRLAWVGGIFFTVLALSGGWLWQSW
                     HQKMEALEVALAMAEQQKSTQGADEAREQLAMLAAQVGTMQGQLGRLNALGERLTEKA
                     DLDPEEFNFKELPPMGGPSYDADLEVSLNELQDSMKHLSQQLSSREEQLSVLESFIMN
                     HHITDAGFISGTPVKQERVWVSSGFGGRVDPFNGRAKMHKGVDFRGKPGTPILATGPG
                     VVSWAGRHPEFGNMVEINHGNGLVTRYAHNSKLLVEVGTLVDEGQKIALMGRTGRATG
                     VHLHYEVLKDGRQVDPARFLNARRG"
     CDS             557155..559884
                     /codon_start=1
                     /gene="secA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPW5"
                     /locus_tag="NUITMVA1_04970"
                     /product="protein translocase subunit SecA"
                     /protein_id="BDC80554.1"
                     /transl_table=11
                     /translation="MVPMISTLLTKIIGSRNDRTLKALRKIVKQINAMEPQFEALSDA
                     QLQAKTAEYRQRLEQGETLEQLLPEAFATVREASRRVFGMRHFDVQLIGGMVLNSNRI
                     AEMKTGEGKTLTATLPAYLNALSGRGVHVVTVNDYLAKRDAEANRPLFAFLGMTVDCN
                     VPGMDASQKRDAYAADITYGTNNEFGFDYLRDNMAFSPEQRVQRPLNYALVDEVDSVL
                     IDEARTPLIISGPAEDSSELYIRVNKLIPLLVKQDKEDSEEYTGDGHYTVDEKNRQAL
                     LTENGQIFVEELLKKEGLLAEDDSLFSATNISLLHHVNAGLRAHTLFERNVDYIVQKD
                     EIVIVDEHTGRTMPGRRWSDGLHQAVEAKEGVKIQNENQTLASITFQNYFRLYDKLAG
                     MTGTADTEAFEFQQIYGLDTVVIPTNKPMVRKDMGDLVYLTANEKYAAIIEDIRGCVE
                     RGQPVLVGTVSIENSELLSGILTKENIPHKVLNAKFHAMEAEIVAQAGQTGAVTIATN
                     MAGRGTDIVLGGNWQAEIAQLENPTEAQIAELKAAWQVRHDAVLAAGGLHIIGTERHE
                     SRRIDNQLRGRSGRQGDPGSSRFYLSMEDTLMRIFASDRVTGMMKKLGMEEGEAIEHP
                     WVTKAIENAQRKVEGRNFDIRKSLLEFDDVANDQRKVVYEQRNELLDTSDISETIHVI
                     RDDVYGAIIDEYIPPQSLEEMWDVPGLEARLKSDFALDLPLQQWLAEDDKLYEEKLRE
                     RILDEATKLYAHKEELVGKEVLRNFEKAVMLQTLDGLWKEHLAAMDHLRQGIHLRGYA
                     QKNPKQEYKRESFDLFTQMLETLKRDVVSILSRVQVQERDVEAMEEQQRQQAETAPRT
                     YTHAAADNQLADGEAQAEAAPVTFVRDEQKVGRNDPCPCGSGKKYKHCHGQLT"
     CDS             559959..561143
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707575.1"
                     /locus_tag="NUITMVA1_04980"
                     /product="hypothetical protein"
                     /protein_id="BDC80555.1"
                     /transl_table=11
                     /translation="MSKMPTGWDTTAHNSWLAGQRQVAIQQLLARLNGSAAKPIALQL
                     QFAYYLFLCDDPASAAQVLEMAHKAKPANDEVLRNLCACLSRAGQYELAVTRLQTLLQ
                     RVPDDFHALDALCASLAKLDRYDEAAQAGTRSLTLKARSAGKAPPSWALPTAEPAVWL
                     ADGSRKPDVIAFSLWGSEPRYLRGAIDNVLAAAYLYPGWRVRFYVDESVPAELLAALR
                     ELGAELLLQPAGQTLRPRLCWRFQVANDPLVGRFLVRDVDSVLGVRERLAVQEWLAST
                     RWFHIMRDWWSHTDLVLAGMWGGVAGVLPPLAPLLEGYQPDVMETPNIDQWFLRDRLW
                     GYLSQSCLVHDRCFTPPGAIPWPQPAPGGSEHVGQDIFTAQREPQARRLAPWIARLPC
                     LR"
     CDS             561152..561565
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707574.1"
                     /locus_tag="NUITMVA1_04990"
                     /product="7,8-dihydro-8-oxoguanine-triphosphatase"
                     /protein_id="BDC80556.1"
                     /transl_table=11
                     /translation="MEQKKRIWVAVGVIENERGDIFIAKRSADRHQGDRWEFPGGKVE
                     AGEDLLTALDRELWEEIGIRVQDCAPFMELHHDYPDKQVLLDIWKVTRFSGEPFGKEG
                     QECRWVPLASLHEYHFPDANGPIVTRLQASLAAQG"
     CDS             complement(561626..561820)
                     /codon_start=1
                     /gene="yacG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPW2"
                     /locus_tag="NUITMVA1_05000"
                     /product="DNA gyrase inhibitor YacG"
                     /protein_id="BDC80557.1"
                     /transl_table=11
                     /translation="MVTKVKCPTCQTELEWGPQSPFRPFCSKRCQLIDLGEWADEEKR
                     IPGEIDPELLPYPEEGEPWQ"
     CDS             complement(561830..562552)
                     /codon_start=1
                     /gene="zapD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPW1"
                     /locus_tag="NUITMVA1_05010"
                     /product="cell division protein ZapD"
                     /protein_id="BDC80558.1"
                     /transl_table=11
                     /translation="MIYDFPLNEKSRTYLRLESLFSQIRDNLESDQSWAHIAFFKGLF
                     DLQELLERGDLRADLIKDLERLGQRLSHWASLPDVDLEQISQMQQESAQLSRNLLSAP
                     RPGARLKEDRLLGSIRQRFSIPGGLCAFDVPQLHHWLATPAIARHQQMQLWLSDINLL
                     MNAISLLLRLWRESGNFSEQVAVNGFFQDTAESAELIRIRLTGTQQCYPTLSGHKNRF
                     ALRFLPTTEQQIGDVPFQLACC"
     CDS             complement(562590..563204)
                     /codon_start=1
                     /gene="coaE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPW0"
                     /locus_tag="NUITMVA1_05020"
                     /product="dephospho-CoA kinase"
                     /protein_id="BDC80559.1"
                     /transl_table=11
                     /translation="MYVVAITGGIGSGKTTVANQFAELGIEVVDADVIAREVVEPGTP
                     ALAAITAHFGSAVITPAGQLDRRRLRERVFTDPQAKGWLNALLHPLIRTEMQRQCAAA
                     RSPYCLLVVPLLVENRLTALANRVLVIDVDEATQIERTCRRDGVSREQAQAILAAQAS
                     RAERLAAADDVLDNQNGTPEAIKSRILTLHETYLAFASQQARQL"
     CDS             complement(563224..564096)
                     /codon_start=1
                     /gene="gspO"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPV9"
                     /locus_tag="NUITMVA1_05030"
                     /product="type 4 prepilin-like proteins leader
                     peptide-processing enzyme"
                     /protein_id="BDC80560.1"
                     /transl_table=11
                     /translation="MLLITDVFHSLPWLYFSLVFLFSLMIGSFLNVVIHRLPIMLERE
                     WQAEYLGYFNPETQPQQEDRYNLMVPRSACPHCGHAITAMENIPLLSWLWLKGRCREC
                     QAPISARYPLVELLTALLSLVVAATFAPGWGLLAALLLTWVLVALTFIDLDKMLLPDQ
                     LTLPLLWGGLLFNLAGGFAPLADAVIGAMAGYLVLWSLYWAFKLLTGKEGMGYGDFKL
                     LAALGAWLGWQALPIVLLLSSLVGAFIGIGLILLHNHHQNKPIPFGPYLAIAGWIALL
                     WGDTITRWYLTTFL"
     CDS             complement(564119..565360)
                     /codon_start=1
                     /gene="pilC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707570.1"
                     /locus_tag="NUITMVA1_05040"
                     /product="type II secretion system protein F"
                     /protein_id="BDC80561.1"
                     /transl_table=11
                     /translation="MATLTQKQNAPKKVFAFRWSGVNRKGQKVSGELQADSINTVKAE
                     LRKQGVNVTKVSKKSQGLFSKGGAKIKPMDIAVVSRQITTMLSAGVPLVQSLQIIARS
                     HEKAAMRELMGQIAADVETGTPMSEALRRHPRHFDDLYCDLVEAGEQSGALETIYDRI
                     ATYREKSEALKSKIKKAMFYPTMVILVAIVVTSILLLFVIPQFEDIFKSFGAELPIFT
                     QFVIGISRFMQNWWYVIFGGIALAIFLYVRAWRASQKVKDNTDKFILTIPVVGMILHK
                     AAMARFARTLSTTFSAGIPLVDALVSAAGASGNYVYRTAVMAIRNEVVAGMQINVAMR
                     TVDLFPDMVIQMVMIGEESGAIDDMLSKVATIFEQEVDDLVDGLTSLLEPLIMVVLGV
                     LVGGMVVAMYLPIFKLGSVIH"
     CDS             complement(565476..567182)
                     /codon_start=1
                     /gene="pilB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707569.1"
                     /locus_tag="NUITMVA1_05050"
                     /product="type IV-A pilus assembly ATPase PilB"
                     /protein_id="BDC80562.1"
                     /transl_table=11
                     /translation="MTSSPNSGLALSLAASSLLSESDSQRYLSQAKAQRKPFVTFLIE
                     NEILDSKALADFCELEYGVPLLDLAAFDLAEIPQKYLNQKLIEKHHVLPIYTQGHTLY
                     IAMSDPTNVSALEDFGFSFGLHTEALLVEENKLTTAIGKLMESDQDALGMEDIDESEI
                     SELEVSDEGSRLDESVNTADDDAPIVKYINKIMMDAIKRGASDLHFEPYETKYRIRFR
                     IDGILHEIATPPVNLANRFSARLKVMARLDIAERRLPQDGRIKLKLSRNKSMDMRVNT
                     LPTMWGEKIVIRLLDSSAARLNIEQLGFDDRQKAQYLRALSKPQGMILVTGPTGSGKT
                     VSLYTGLNILNTTEVNISTAEDPVEINLPGVNQVQVNPKAGLTFASALRSFLRQDPDV
                     VMVGEIRDLETAEIAIKAAQTGHLVLSTLHTNSAAETLTRMMNMGVPAFNIASSVTLI
                     MAQRLARKLCDHCKAPEVVPEAELLELGFTQQQLAAGLRLFKPVGCKECSGGYKGRVG
                     IYEIMLMSENIAKLIMQGANSLQIAAIAQKEGMRTLRTSGLEKARLGVTSLAEINRVT
                     TN"
     CDS             complement(567186..567608)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707568.1"
                     /locus_tag="NUITMVA1_05060"
                     /product="pilin family protein"
                     /protein_id="BDC80563.1"
                     /transl_table=11
                     /translation="MKKQSGFTLIELMIVVAIVAILAAIALPAYQTYTKKAKFTEVVA
                     ATGSLKTAVEVCFNASGDMTQCLTAGSNGIPAIAGYPKGFVESLTLAAAPSNASAAAI
                     TATATSALDSDTYIITGENDNGAVKWTKSGTCTTSGLC"
     CDS             complement(567931..568788)
                     /codon_start=1
                     /gene="nadC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707567.1"
                     /locus_tag="NUITMVA1_05070"
                     /product="nicotinate-nucleotide diphosphorylase"
                     /protein_id="BDC80564.1"
                     /transl_table=11
                     /translation="MLQQDIRRAVRAALLEDLGDALTPLDQPDAGADITAQLIPADRL
                     ASARVITREAGVFCGQPWVDEVFVQLGGEVRVEWLVQDGEVLSPNQELFRLHGPARML
                     LTGERNALNFVQTLSGVASLTARYVAELADTDCRLLDTRKTLPGLRSAQKYAVTCGGG
                     KNHRIGLFDAYLIKENHILACGGIAEAINEARRLNPGKPVEVEVESLVELEQALAAGA
                     DIVMLDNFDIPMMREAVALNQSRAKLEVSGNVTLDTLADYAATGVDFISVGALTKHVR
                     ALDLSMRFI"
     CDS             complement(568794..569255)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707566.1"
                     /locus_tag="NUITMVA1_05080"
                     /product="hypothetical protein"
                     /protein_id="BDC80565.1"
                     /transl_table=11
                     /translation="MARRFWLLAWLSLMGLLTLYFHAREQPSVTASGDLLLKADASGH
                     YRLEGAINGQPVQLLLDTGATRITVPQQVAERLGLTARGSSQVNTAAGFIRVGNGTIE
                     TLAMGPLTLYDLAIFINPAAAGDEVLVGMNALGRLELVQKERQLLLRPLQE"
     CDS             569411..569983
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707565.1"
                     /locus_tag="NUITMVA1_05090"
                     /product="N-acetyl-anhydromuranmyl-L-alanine amidase"
                     /protein_id="BDC80566.1"
                     /transl_table=11
                     /translation="MTQPKIVFSIDSDGWCEQARKVPSPHYNERATPNDISLLVVHGI
                     SLPPGEFGGPFIDDLFLGRLDPDAHPYFAGIHQLRVSAHCLIRRDGELVQYVPFGARA
                     WHAGVSSWQGREACNDFSIGIELEGTDEQPYTDAQYEVLVGLSRTLSSHYPAITADRI
                     VGHCDIAPGRKTDPGGSFEWPRYRQALNFK"
     CDS             570259..571023
                     /codon_start=1
                     /gene="pdhR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707564.1"
                     /locus_tag="NUITMVA1_05100"
                     /product="transcriptional regulator PdhR"
                     /protein_id="BDC80567.1"
                     /transl_table=11
                     /translation="MPYLKITQPKLADAIVAELEQMILEGSLQPGQKLPPERELAIQF
                     QVSRPSLREAIQRLEARGLLYRRQGGGTYVQNALSKGIADPLFELLSTHPEAQYDLLE
                     FRHALEGICAYYAALRGTDADFERIRQVQSAIEEAGQQGSLVSESAAVTQFYLAVAEA
                     SHNVVLLHLLRAMGPMLEQNILRNNEILNRRPGVVAKIRRHRAHLIEAILSGAPERAR
                     AACHEHLAFIEDTLLDMQREDSRIQRSMRRIRQQEN"
     CDS             571103..573763
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPV1"
                     /locus_tag="NUITMVA1_05110"
                     /product="pyruvate dehydrogenase E1 component"
                     /protein_id="BDC80568.1"
                     /transl_table=11
                     /translation="MSDILKNDVDPIETLEWLASLESLLREEGPQRAQFILEQLAEKA
                     RASGVDVAAKANRDYINTIPSSEEPDYPGDLEMERRIRAIIRWNAMMIVLRASKKDLD
                     LGGHMSSFASSATIYEVCYNHFFRARSEKDGGDLVYFQGHISPGIYARAFAEGRLTEE
                     QLDNFRQEVDGKGIPSYPHPKLMPDFWQFPTVSMGLGPIAAIYQARFLKYLTDRGIKD
                     CSEQTVYAFLGDGEMDEPEAKGALTVAVREKLDNLVFVVNCNLQRLDGPVVGNGKVIN
                     ELEGLFSGAGWDVTKVIWGRKWDELLKKDTSGKLIQLMNETVDGDYQTMKSRDGGYVR
                     EHFFNRYPETAALVKDMTDEEIFALNRGGHDPRKLFAAFSKAAATKGKPTVILAKTIK
                     GYGMGEAAEGKNIAHQVKKMDLGSVRHLRDRFNLPVTDEQLETLPYLKIEEGTEEHKY
                     LHARRAALKGYVPTRLRESTTKLEIPALDAFGPLLGEQAREISTTMAFVRSLNVMLKD
                     KSIGKRIVPILADEARTFGMEGLFRQIGIYSPHGQQYTPQDRDIVSYYKEDKQGQVLQ
                     DGINELGAMSSWLAAATSYSTNDCPMIPFYIYYSMFGFQRIGDMAWAAGDQQARGFLL
                     GATSGRTTLNGEGLQHEDGHSHILANTIPNCVSYDPSYAYEVAVIVQDGLRRMYGEKP
                     ENVFYYITTLNENYAMPAMPEGAEEGIRKGIYKLETVAGTKAKVQLLGCGSILGHVRT
                     AAQILASEYGIGSDVFSVTSFNELARDGQDADRWNMLHPNADARVPYIAQVLGSEATI
                     AATDYMKSFADQVRAFVPTENYRVLGTDGYGRSDSRANLRRHFEVNEFYVVVAALTEL
                     AKRGEVDKQVVADAIAKYGIDADKVNPLYA"
     CDS             573877..575778
                     /codon_start=1
                     /gene="aceF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPV0"
                     /locus_tag="NUITMVA1_05120"
                     /product="acetyltransferase component of pyruvate
                     dehydrogenase complex"
                     /protein_id="BDC80569.1"
                     /transl_table=11
                     /translation="MSKQIMVPDIGADEVEVTEIMVAVGDKVELDQSIIAVEGDKASM
                     EVPAPSAGIVKEILIKVGDKVATGSQIMIFEAEGAAAPAPVQAAAPVAAAPAAAPAAA
                     ARKDVHVPDIGDDEVDVTEIMVAVGDMVEADQSIIAVEGDKASMEVPAPFAGRVVEIK
                     VAAGAKVSTGSLVMVFEVAGAAPAVAAAPAQAAAPVAAAPVAAAAKEVNVPDIGGDEV
                     EVTEIMVAVGDKVEADQSLIAVEGDKASMEVPAPFAGVVKEIKVKAGDKVSTGSLIMV
                     FEVAGAAPDAAAAPVAQAAAPVAAALVAAAPAPVAQAAAASDFVANDAYVHASPAVRR
                     LAREFGVNLAKVKASGRKGRIVKEDVQAYVKDAVKRAESAPAAGQGTGNGNGMSVLAW
                     PKVDFSKFGDVEEVDLTRIQKISGPNLHRNWVMIPHVTQFDEADTTELEVFRKEQNAM
                     LEKQKADVKITPLVFILKAAAKALEAHPRFCSSLSEDGSKLIMKKYIHIGVAVDTPNG
                     LVVPVVRDVNKKGIMELSRDLAEISKKARAGKLTAADMQGGCFTISSLGGIGGTSFTP
                     IVNAPEVAILGVSKSEMKPKWNGKEFAPRLMLPLALSYDHRVIDGADGARFITTMNGV
                     LSDIRRLVL"
     CDS             575928..577355
                     /codon_start=1
                     /gene="lpdA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPU9"
                     /locus_tag="NUITMVA1_05130"
                     /product="dihydrolipoyl dehydrogenase"
                     /protein_id="BDC80570.1"
                     /transl_table=11
                     /translation="MSKEIKTQVVVLGAGPAGYSAAFRAADLGLDTIIVERYSTLGGV
                     CLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGAPQTDIDKIRLWKEKVINQLTGGLA
                     GMAKMRKVQVVNGFGKFTGPNTLEVEGADGKTTVTFDNAIIAAGSRPVKLPFIPHDDP
                     RVWDSTDALELTTVPGKLLVIGGGIIGLEMGTVYSSLGSEIDVVEFADQLVPAADKDI
                     VKIYTKRVAKKFNIMLETKVTAVEAREDGLYVSYEGKHAPAEPVRYDNVLVAVGRVPN
                     GKMLDAEKAGVAVTERGFIEVDKQLRTNVAHIHAIGDIVGQPMLAHKGVHEGHVAAEV
                     IAGKKHYFDPKVIPSIAYTEPEMAWVGLTEKEAKQQGLNFEVATFPWAASGRAIASDC
                     SDGMTKLIFDKESGRVIGGAIVGTNGGELLGEIGLAIEMGADAEDIALTIHAHPTLHE
                     SVGLAAEVFEGSITDLPNAKAKKKK"
     CDS             complement(577430..577612)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707560.1"
                     /locus_tag="NUITMVA1_05140"
                     /product="hypothetical protein"
                     /protein_id="BDC80571.1"
                     /transl_table=11
                     /translation="MGKLVVMILLSGLLSACSSGPVRVHGADVSVDDTRIRVSDGDRG
                     GYGTFCPPGQAKKGRC"
     CDS             complement(577756..579402)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707559.1"
                     /locus_tag="NUITMVA1_05150"
                     /product="hemolysin"
                     /protein_id="BDC80572.1"
                     /transl_table=11
                     /translation="MLEGKLTLKLQLILAVTVPCLALLLVGGASLKSMGTIQQQSTEL
                     YQNTATPMRAMAEVVSRIPRMRVGIDMMLLQDTSLKDAKGVITRVKESREEDIPEMRQ
                     AMQQAVTAQTDPAAKANAQQLLSQFEGMASNELAPMLQALEQGDMEAARGIYRDRYTV
                     TYGAMRKDANALLDGLIQQAQQRHQLGEQSYASGRLQMISIITGAILISLLVSVLILM
                     NLKRRVGFLQQYIGYAAEHLALGSRAQLNGNDELAEITVSFNHFVSKIHSAIEQVARN
                     SHQLAATADEVAAKAQLTQQNCTAQRDRTVQVATAIHQMGATVTEIAGNASLAAEVAR
                     QANEQADAGAGVVAQARHGIVGLSDEIAQVAGVIESLATQTDSIGSILETIRSISEQT
                     NLLALNAAIEAARAGEQGRGFAVVADEVRNLANRSAASTAEIQGMINRLQEQSARAVS
                     AMTQGRSQSLAVVTQADEANGALGQITAHITQINDMNIQVATATEEQSSVVGELNRNV
                     EDINQLTMETADIAHQLTDASRGLQQLSGELDKLVGHFRL"
     CDS             complement(579537..581444)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707558.1"
                     /locus_tag="NUITMVA1_05160"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BDC80573.1"
                     /transl_table=11
                     /translation="MLASLTLKQKILATVTLAVVLSCLLVGYFSQRSAQQLIESRMFE
                     QELPNLTQRIGKEIEKDLTSVAGAARQLANDRFVLDWVARGMPKEQESILIDQLKDMA
                     AQYGLVTASFADRQSAAYYNQDGFLRNLTPEQDAWFYGYTKSQQDLMLSIFRESNGEV
                     KLFVNFQQLNGRGLAGLAKSLDSMVSMLANFRIGDSGFVFMTDGSGKVKLHPDASRID
                     RDSLTQLASGSGNLLNKQPFAATHAEIDGQPVVLASSYIPLLDWYLVAQVPEAEIYAE
                     LDRARLHILLVSLAIAAGMGLLGMLLAGSVSRPLNQLARLFRELGSGDGDLTQRLKVE
                     GRDELAQVATGFNNFVAKIHGSIEQVASNSRQLAATANEVAAKAQLTQHNCTAQRDRT
                     VQVATAIHEMGATVSEIAGNASLAADVAKQANEQADAGALVVAQARHGIVGLSGEIEQ
                     VAGVIESLASQTDSIGSILDTIRSISEQTNLLALNAAIEAARAGEQGRGFAVVADEVR
                     NLASRSAASTAEIQGMINRLQEQSARAVSAMAQGRNQSLEVVTQADEANGALGQITAH
                     ITQISDMNIQVATATEEQSSVVGEINRNVEDINQLTMETADIAHQLTESSRSLQHLSG
                     ELDKLVGNFRL"
     CDS             581682..583940
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707557.1"
                     /locus_tag="NUITMVA1_05170"
                     /product="serine protease"
                     /protein_id="BDC80574.1"
                     /transl_table=11
                     /translation="MRIFHRGWNPLFLILLACLPLMAAAQSERPKIALVLSGGGAKGA
                     AHIGILKVLEEKRIPVDIIVGTSMGSYVAGMYAMGLSAEEVERTTLAIDWNKGYQDKV
                     GRDELSLRKKQQSEQYQLRTDIGVNGDSVQFPDGFFQGQSMASLLRHATSNLPVQKSF
                     DDLPIPYRAMATDMETVTPFVLDHGSLAKAMQASMSIPGALKPVEWEGHILADGGTVN
                     NMPVDVAKAMGADVVIAVDISAKLRTRESLKSGLAMIDQLTTYMTQVGTEKQKALMGP
                     RDVLLTPEFGNMGIADFALMPEGIKLGEQVANRASAQLDALSLSPAAYTAYRNQKLSR
                     RAERSGQPAYYIDKVEIINKSRLSDETVRAMLKVRPDKIQTNESLEAGIRRLYALESF
                     DRITYEVEERGGENVLVVNASEKNWGPGYLNFQFGFSDDFESSSNYNVGMSYTLTNVN
                     DWGAEWLTEASLGTAKHFKTDFYTPLEPSQTFFGEASLAYDKTQRRIFIPEETRAADE
                     VSYVDAEYNFTNVDLAVGWNRQPWSRLSLGLEGKVGDIDVRNVANAKVDASSWGPYVR
                     FEHDTLDSRYFPYQGAYWDIKGGYSSVRLDDNDTINDRYEGVNYHLAMVKPWSWDRHS
                     LNLLLEGGGSTSQEELPLFVQDLGGLFRMSGFQRYQLSGRYSLFGGLRYIYRVADNDF
                     GALRAPLYLGGSLEQGGVWDKGEDISMESSFTAGSVYVGVESFLGPIFLGYGMAEGGN
                     DMFYLQLGSTFE"
     CDS             584169..586766
                     /codon_start=1
                     /gene="acnB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPU4"
                     /locus_tag="NUITMVA1_05180"
                     /product="aconitate hydratase B"
                     /protein_id="BDC80575.1"
                     /transl_table=11
                     /translation="MLETYRKHVAERAAEGVVAKPLDAEQVAALVELLKNPPAGEQDF
                     LKELLSSRIPPGVDEAAYVKAGFLTAVAKGEAHSPILSAAEAVELLGTMQGGYNIQPL
                     IDLLDHATLAPLAAKGLSHTLLMFDSFHDVEEKAKAGNAHAKQVMQSWADAEWFLSRP
                     ELAEKITVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNARPGITPDKDGVIG
                     PIKTIDALKEKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPHVPNKRAGGVCLGG
                     KIAPIFFNTMEDAGALPIEVDVSKLEMGDVIDIYPFAGKICKHGTEQVLAQFELKTDV
                     LIDEVRAGGRIPLIIGRGLTDKAREALGLPFSTVFRRPQPVADTGKGFTLAQKMVGKA
                     CGVQGIRPGTYCEPKMTTVGSQDTTGPMTRDELKDLACLGFSADLTMQSFCHTAAYPK
                     PIDVQTHHTLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISF
                     PAGSGLVAFAAATGVMPLDMPESVLVRFKGELQPGITLRDLVHAIPYAAIQKGLLTVE
                     KAGKKNIFSGRILEIEGLPTLKVEQAFELADASAERSAAGCTIKLDKEPIIEYLKSNI
                     VMLKWMLSEGYGDVRTITRRIKGMEEWLANPVLMEADKDAEYAEIIEIDLATIKEPIL
                     CAPNDPDDARLLSDVAGDKIDEVFIGSCMTNIGHFRAAGKLLEKYQGELPTRMWIAPP
                     TKMDKDQLTEEGYYGIFGRVGARIEIPGCSLCMGNQARVAEGASVVSTSTRNFPNRLG
                     KGANVYLASAELAAVAAIIGKIPTVAEYLQYAKTLDATAADTYRYLNFNEIASYTKKA
                     DAVILQQAV"
     CDS             586937..588505
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707555.1"
                     /locus_tag="NUITMVA1_05190"
                     /product="diguanylate phosphodiesterase"
                     /protein_id="BDC80576.1"
                     /transl_table=11
                     /translation="MSLPNLDFSRPWLRLGCTLLLFTLPLALGLWMLYNGHLQMLDRQ
                     SERSARQAVTLMETMLAHAESANRTLLPFVEQPCEQALFTLRQQVALVPFVRTVNLVG
                     EQGIYCNSLFGAIQWPDRAESYSDGRLRLLAGNQVRADHPLLVLRDSEGRGAAFSTID
                     GDYLRFMLVLSGRPCTLLLHVGKQWLDERGVLSEGGQPLPTLASHEVRSDRYPLSIYA
                     GHEIPSLWSSLWQARQWAIMVLFGLCFGFALLIWWLLGRPRSPVVELARALRNREFVP
                     YLQPLVAAGSERVMGAEVLMRWQHPTAGLIRPDLFIPQAEASGLIVPMTSLLMEEVAR
                     ELSMERDLVPDGFHISFNISAAHCCDMALLAECRRFLDHFAPGQVVLVLELTERELLV
                     ADPQTLALFRQLDEMGVRLAMDDFGTGHSSLHYLQQFHVDYLKIDQSFIGRIGTESLS
                     EHIVDNVIDLGTRLGLALVAEGVEMRQQADYLKSKGVDYLQGYLFGRPLPLRDFQAAL
                     GQPQAEPATSAVSA"
     CDS             complement(588510..589418)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707554.1"
                     /locus_tag="NUITMVA1_05200"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BDC80577.1"
                     /transl_table=11
                     /translation="MNGENDSQKILSLPALTALRCFEVAARTEHFSRAADELHLTHGA
                     VSRAVRLLEEDLGVMLFERRQRRVFLTEAGERLYQAVREGLGGIRQTAQALRRQGRPS
                     SLVISCEPTLLMRWLIPRWPAFQALHPELDVHLMAGGGALSFGSGIDLAIRRNDFQWP
                     AELYSQPLFEELTGPVCQPGKVTQFFETGANGPALRPAAPRLHTKTRPGAWQEWLQHA
                     GQSAGEEAPGQTFEHFYFSLQAAVAGLGVAIGPYRQVCDDIEAGLLVAPLGFCPDGTG
                     YHLLAPAPPAPGSAHARLAEWLQSLT"
     CDS             589495..590112
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707553.1"
                     /locus_tag="NUITMVA1_05210"
                     /product="lysine transporter LysE"
                     /protein_id="BDC80578.1"
                     /transl_table=11
                     /translation="MTELLAVVAITFFAVISPGPDFAMVSRNSLLLSRRSGVLTAVGI
                     GAGVCVHVTYTLLGVGLLIQQSLWLFNLIKLAGAAYLIFLGIKMLRAKPVTAEVLADQ
                     PALSSLGALRTGFLTNVLNPKTTIFIVSLFMQVVQPQTPLAVQLGYGAFIVLAHAVWF
                     SAVAIFFSTDSVRGRLLAVRHWIDRVFGGLLVGFGMLLALTQQTR"
     CDS             590236..591630
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707552.1"
                     /locus_tag="NUITMVA1_05220"
                     /product="FAD-binding protein"
                     /protein_id="BDC80579.1"
                     /transl_table=11
                     /translation="MTVRFQAFHSIKAIGQREVLFNWSRTNPLGALEQVWRPKNRDEL
                     QQLLRENPERKLRLIGSGLSFEPIHSVYAEGSQALLVDLHHLRGQLAQTADTVTYQAG
                     TPLDTVYADLIAMERMLPASPGVIGIQTLGGALSTGTHGQGLHQSALCDAVEAMTVML
                     ASGDIIRVDRTDSRFGAFVMGMGMLGILLDVTLQTVPNRIMRCTKFTTDYPFLLAHNE
                     RLNREHAFVKSWWFAWTGESHIWLVDPASEEEVARYRAGGSESLLLEGDIDARMNATI
                     DATLQKMAKDTKDEALAGEHFETVRRFKDASDLVGNVYQILCKGIPAPQINCEVAVPL
                     NRMNEALETLQAWQQANPGVLHYPFILRCTGPSKAWLSAAYDQSVCWIGFLVYLAADG
                     TFVNGSMEQMRELQQLLVPLGGIPHFGKHLAMDLYDFPALLPRWHDFLALKGELDPHG
                     RFENRWLADLFANR"
     CDS             591702..592829
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707551.1"
                     /locus_tag="NUITMVA1_05230"
                     /product="cobalamin biosynthesis protein CobW"
                     /protein_id="BDC80580.1"
                     /transl_table=11
                     /translation="MTDMQDTRIPVTLLTGFLGSGKTTLLNHWVKQPELGECAVLINE
                     FGSVGLDHHLVQQVDEQVVLLDSGCICCSVQGSLVEALQGLFMKAIQRKIKPFKRLII
                     ETTGLADPAPVLFTLREEGFIAQRYRFDGTVTVVDAGHIEQQLAAQYEAVKQVALADL
                     LVVSKGDLVDGEQLERVEAQLAALNPAAPIERVSNGVLSPAVLDKLGAYNEAAGRDVR
                     QLLAWLRTEAPKQGLASPMQPKMKPFAAKVGTAAPTHFEHGNIESFALRIGEPLKPSR
                     LLAAIDAVQAQYGDALLRLKGILQLEGESQPVVIHGVHGQLYPLQALGEWPEGKAQSR
                     LVFIVKSQDKAGIERLFLDTLKAPEPSLEEQLRAMLGQPDA"
     CDS             592891..594279
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707550.1"
                     /locus_tag="NUITMVA1_05240"
                     /product="MFS transporter"
                     /protein_id="BDC80581.1"
                     /transl_table=11
                     /translation="MPDSTHMVTPAQRKWLPPLTAVGFFMQTLDGTILNTALPSMAET
                     LGESPLQMQSVIIAYMLTVALLIPASGWLADRFGTRRIYLAAILLFTLGSLACAAANS
                     LPLLVAARVLQGIGGALLMPVGRLAVLRVYSKHELLRVMSFVTIPGLVGPLIGPALGG
                     WLVEVASWHWVFLINLPVGLLGFIASWYFMPDLRQSTAKFDWQGFVMFSAGMVLVSVG
                     LQGLGEHSISTGWALFALLFGLAAMASYWLYAANAEEPLFGLGLFKTSTFAIGIWGNL
                     FARLGSGAMPFLTPLFLQLGLGFSPSKAGMTMIPTVLGAMLTKTLVNKLIPRIGYRRI
                     LIGNTLALGAMIASFSLIDNQLPYGVLLGWLMVFGAINSLQFSAMNTLTLQDLSPEFA
                     SSGNGLLSVVMQLSMSLGVAIAASLLGLFSAGSAAADGQWLGGFHLTYLCIGLMSMLA
                     ALIFAQLAQDKR"
     CDS             complement(594289..594771)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707549.1"
                     /locus_tag="NUITMVA1_05250"
                     /product="DNA-binding protein"
                     /protein_id="BDC80582.1"
                     /transl_table=11
                     /translation="MPLDTIHDFNCRLLAGLPHQRFEHEPILDYATDEKVRARLGWQA
                     EFSKTLFLKFKDGRFALLLTHRDGRLDNKAVKAALGAKPSICTADEMQTEIGCLPGAV
                     CPFLPRADIPLLVDPVLMTHHAFTWTPGHPEQTFLLETAHLAGLLTQLPCEVSYLPAP
                     "
     CDS             complement(594893..595402)
                     /codon_start=1
                     /gene="folK-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707548.1"
                     /locus_tag="NUITMVA1_05260"
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine diphosphokinase"
                     /protein_id="BDC80583.1"
                     /transl_table=11
                     /translation="MTRIYISLGSNIERERHIRAGLDALQAEFGELQVSRVFESEAVG
                     FNGRPFYNLVVGADTELPLATLCQRLRAMEFAHGREPDAKKFAPRTLDLDLLLYGELV
                     CETPLVLPRGEILSNAFVLWPLAELAPTLRHPLDGRTLGELWERYDKASQRLCPIPFH
                     WAAGELQHH"
     CDS             complement(595402..595773)
                     /codon_start=1
                     /gene="folB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPT5"
                     /locus_tag="NUITMVA1_05270"
                     /product="7,8-dihydroneopterin aldolase"
                     /protein_id="BDC80584.1"
                     /transl_table=11
                     /translation="MDKVFIRGLEVLTTIGVYEWEKGIRQKLCFDLEMGFDNRPAAAT
                     DDIKLALDYATLSRKICDHASSKVVELVETMAEQVAMLVLADERVQWVKVTLTKPGAV
                     PNAAGVGVEILRHRTPAASAN"
     CDS             595950..596612
                     /codon_start=1
                     /gene="plsY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPT4"
                     /locus_tag="NUITMVA1_05280"
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="BDC80585.1"
                     /transl_table=11
                     /translation="MTALTILMIILAYLGGSLSSAVLVSRITGLPDPRDHGSHNPGAT
                     NVLRLGGRLAAVVVLLLDVLKGTAPVYLAWYLQIKPVYLGFIGVAACLGHMYPIFFHF
                     RGGKGVATALGTMMPIGFTMGGAVIGTWLLVLLVSGYSSLASIITVLLTPLFTYLLKP
                     EYTLPVSLLSCLILIRHHENIARLLKGEEPRVWGRQNRAEQEEVLEMDDPEQKRDERD
                     KK"
     tRNA            596660..596735
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00170"
                     /product="tRNA-Phe"
     tRNA            596788..596863
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00180"
                     /product="tRNA-Thr"
     tRNA            596867..596942
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00190"
                     /product="tRNA-Phe"
     tRNA            596988..597063
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="NUITMVA1_t00200"
                     /product="tRNA-Asn"
     CDS             597323..598666
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707545.1"
                     /locus_tag="NUITMVA1_05290"
                     /product="ion channel protein"
                     /protein_id="BDC80586.1"
                     /transl_table=11
                     /translation="MNATELWQLSPEQFNEWRRANDYPLIWDLLVASLPHFDDWMTEQ
                     KIDKQVIFQIGIARFISSRCVLSLCLYMSDDKIRLYETASSALESLRKSGLIRAETRF
                     EPYCMWLAGKHGKDEVKRVQSLLSVSENNKGEAQVLGKHRLLNIGGVELKSPIISGRL
                     LDFTCLDELSLDGAVNNSKVYLWHCSAKGVRVNGGVIGLDLFDSLLWDHRAWAKKREL
                     ALEDGVFQDFTIECEEIRFHSSRAVLKNFNVRAKNFDATMEHTNLDKVQVAYNENGRV
                     DHSEASKLYRNAKRLFSSVGDTVDAGECYYKEKLHEMKSLASPRELFKECWLRSGLLK
                     KGWLTLLCYLKCAAKFISFITWGFGERPIRSLLLSMGVILLATLTYFLAPASVTYHHL
                     GRSLYFSIVTFVTLGYGDISQTSSPLQLLSAIEAFCGMFLTGLFLAGFASKTKQY"
     CDS             complement(598694..599026)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073989.1"
                     /locus_tag="NUITMVA1_05300"
                     /product="hypothetical protein"
                     /protein_id="BDC80587.1"
                     /transl_table=11
                     /translation="MNDLVTYIRAIHRQAGPAIIVRQQSEQHSEQDESGTLTHHRQTH
                     YWFANGVVICHQLELDEDPSPQICPECWISYRVVASPIPITPARKLFHNPCQEAFWLK
                     MQEITPAG"
     CDS             599402..600574
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707543.1"
                     /locus_tag="NUITMVA1_05310"
                     /note="frameshifted, insertion at around 599232"
                     /note="possible pseudo due to internal stop codon"
                     /product="membrane protein"
                     /protein_id="BDC80588.1"
                     /transl_table=11
                     /translation="MENQAVKDSHQGAASLRRWLEPVLVLVILGSLFGYLGSQMGLSA
                     LVNTLFNTAHQLLLNTVLFIMGITVLSGALSQLLSEFGVIRLLEVLLAPLMKPVFRLP
                     GRTALAALMTFFSDNPAVISLAKDSRFRKGFTPWQLVSLTNFGTAFGMGLIVVTFMAT
                     LQLPGGESTASAALIGLLGALIGSVVSTRLMQRMIRPLVGETPISDEVASVGAKPGLS
                     QEAAPTWLRVLNALLDGGKSGVELGMAVIPGVLIISTFVMLLTFGPGEQGYSGEAFQG
                     VALLPVLAAKVGWLFELLFGFTHAELVAFPVTSLGAVGAAMSLVPPFIGKGWITGNEV
                     AVFTAMGMCWSGFLSTHTAMLDALGYRHLTSRAIVAHTIGGLCAGVAAHQLYLWLG"
     CDS             complement(600635..601648)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707542.1"
                     /locus_tag="NUITMVA1_05320"
                     /product="chemotaxis protein CheV"
                     /protein_id="BDC80589.1"
                     /transl_table=11
                     /translation="MMSKDGEERKSILTESGTNELEIIEFHLKKQLPDGREKIAYYGI
                     NVAKVREVIRVPETTDYPNAQRHMVGVFSLRERLIPLVDLAGWLGIRTNPDNSHKVVI
                     VTDFNKMANGFLIDSVSRIHRVSWEDVESPSQFLEAGENDCVVAVVRRDGNLIMILDF
                     EKIIADINPELSMEKYDVTQDRKVIIDDRMMAMRQAKTILVVDDSAFIRKMIETTLRT
                     AGYNVVTAKDGGDGLEMLMEFDRLSQEEKIPVAEFVSGIITDVEMPRMDGMHLLKRLR
                     DTPAFKTTPIVMFSSLMSDDNRHKALQLGANDTITKPELGRMVGMMDNFLLGIPIPRP
                     GNL"
     CDS             601855..602574
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707541.1"
                     /locus_tag="NUITMVA1_05330"
                     /product="short-chain dehydrogenase"
                     /protein_id="BDC80590.1"
                     /transl_table=11
                     /translation="MEESVVVIGAGGGLGSALVEHWLAAGAAPIIAVSHQPQPVGLNS
                     SKLHWLRCDYSDEQLAEVVARIGELAPRPRWLVICNGLLQQGGIRPEKRLEALNLEAM
                     TQLYQTNALLPLRWISQLLPLLGSSPCTLAVLSARVGSIGDNRAGGWYGYRAAKAALN
                     MLLKCAVIELARRAPGVKLLAFHPGTVNTALSRPFHGNLAAGSLHSPQQAAAHLVTLM
                     ARLTPDGELSYLDWRGEPIEW"
     CDS             complement(602561..604627)
                     /codon_start=1
                     /gene="tmcA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPS8"
                     /locus_tag="NUITMVA1_05340"
                     /product="tRNA(Met) cytidine acetyltransferase TmcA"
                     /protein_id="BDC80591.1"
                     /transl_table=11
                     /translation="MMPAALDELRQALTRTGERRLIWLEGDEADCIARAEALLSGVSY
                     WLGDGPSEHHPQPAAKALQRLGQECDTLVFNAFSGFHPDAFGALAGTLRAGGLLLLLT
                     PSRAQWPAWPDPDRVRLVAQPEDIVLAGHGFLARLVRLLAGDPALELTPPATATPWQP
                     VGPARPLSCDQARALPAIHKVLHGHRRRPLVLSADRGRGKSSLLGLAAAELLRQQPDL
                     QIVVTAPSQATIATLFTHAANALEDAPQLLTGLSYCSPDRLVHEPLQPDLLLVDEAAA
                     IPTPLLEAMLARHGRIVFATTEHGYEGTGRGFHLRFKRVLDRETPGWQEIHLAEPIRW
                     SSRDPLEPLVFRLLGLNAEVETPPAPTQPGWRRLEQDALAADEGLLHRVFGLLVLAHY
                     QTTPSDLRYLLESPALHIHLLEQGPHLLGVALVAREGEIADELAEAIWAGRRRPRGHL
                     LPQSLLAHAGFKTAGARSYARVMRIAIHPALHRHGLGSLLLTHLEQHYQAAGLDYLGS
                     AFSASADLLPFWRKAGLKVLRIGLQRDAASGSHAALLLKALQPSCSAELADWHQRFVR
                     QLPTLLAGELKNLESELVWQCLQDGEASSSGLDGFDQDELACFAHHHKPFELCQPSLQ
                     RWLAGNQTQLAELDPAERQLLIATIWQYADWGALAARLQLAGKPAAIKALRSLLARLL
                     PPATTR"
     CDS             complement(604624..604935)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707539.1"
                     /locus_tag="NUITMVA1_05350"
                     /product="transcriptional regulator"
                     /protein_id="BDC80592.1"
                     /transl_table=11
                     /translation="MLKKLFTALFGGQPAVVAEVTPIEYAGYLIYPEPMAEGGQYRLA
                     GRITKELDGVLQTHRFIRSDLFANPADAERFMVQKAHTFIDQMGDRMFEPRKPADSTA
                     S"
     CDS             605073..605279
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="NUITMVA1_05360"
                     /product="hypothetical protein"
                     /protein_id="BDC80593.1"
                     /transl_table=11
                     /translation="MYVCLCRGITDSQIRKAVQAGKTEFRQLKQSLEVGAQCGKCVRM
                     TMEIIAAELDKAELEQAPLYYEVA"
     CDS             605422..605901
                     /codon_start=1
                     /gene="bfr"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPS5"
                     /locus_tag="NUITMVA1_05370"
                     /product="bacterioferritin"
                     /protein_id="BDC80594.1"
                     /transl_table=11
                     /translation="MKGDPKIIAHLNKVLANELIAINQYFLHARIYDDWGLKALGHKE
                     YHESIDEMKHADELVKRVLFLEGLPNLQDLGKLRIGETVEEMLRCDLSLEMDAIPDLK
                     VAIAYAESVQDYISRDLFQEILEDEEEHVDWLETQLDLIDRIGLENYQQSQLHHGGS"
     CDS             606104..608209
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707536.1"
                     /locus_tag="NUITMVA1_05380"
                     /product="hypothetical protein"
                     /protein_id="BDC80595.1"
                     /transl_table=11
                     /translation="MHFLPNKLALACAIALSLAACNDNSSNAPADPAATKASLMQTMD
                     EALREGQALDPYGFAIDAASIAKRKALDSSLLKRLDALDSSVLSERDRLFYDMIRWDL
                     QINLAGYDLPQSQIPIHHFRNRVVDLADEVGAAPASGRAARTVEGGFDYFEQSSAERV
                     APGDAAWRRDIDRPAAAPVPASKARTATAPLAWYQEHLTWLKAYDSYLAEVKHQFELG
                     SAQGNTLPDELVDRLLAQLNSKLDGEAIAGSYLGWQQLPGEADEALRSEYKGVLDSIN
                     GRYLALRDYLDYQHGGTYAVRLGSSECDDGFCGMTNGRDWYRWLLKKHTTTDMTPEQV
                     HALGLSEVERIFGAMVKVCHTVGKCDSDDVVQSKQSGQIYAFFRYLNEPAFFYQNPLA
                     VWSAGLNPDNAAGATLSGPQQQALAEHERALQEYNAFKSKAALVLPDFFDAERTIPKL
                     DYEVVPVSYADAPYGGVAWYQDGNPQTGRKGQFFLNTYYPYGLQSWNISTLLAHEAAP
                     GHHFQITIAQELAAKDPDFPQYVANASYTAYAEGWALYTEYLADHDMGLYQGRGLYDP
                     AVGDVKVEGSSAFNNQLQYFGRLNEEMLRAMRLVVDTGIHWYGWSHDQAVNYMKENSA
                     LGAGDISSEVPRYMAYTGQATSYKAGQLALIRMRESAEQALGGGFDLKAFHHHVLEYG
                     MLPISVLEQKNKQWIEQSK"
     CDS             608298..608756
                     /codon_start=1
                     /gene="mgsA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPS3"
                     /locus_tag="NUITMVA1_05390"
                     /product="methylglyoxal synthase"
                     /protein_id="BDC80596.1"
                     /transl_table=11
                     /translation="MEQIAREMAAHKRVALVAHDNMKTPLLNWVMRRKEELKLHHLYA
                     TGTTGTMLGKQAQLPITCLFSGPMGGDQQLGALIAEGKIDVLIFFWDPLNAVPHDPDV
                     KALLRLAAVWNIPVATNEATADFIMDSPHMRQAFSVQIPDYAGYLKARTQ"
     CDS             complement(608817..609404)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010635988.1"
                     /locus_tag="NUITMVA1_05400"
                     /product="hypothetical protein"
                     /protein_id="BDC80597.1"
                     /transl_table=11
                     /translation="MKRWIQHFYQLNRLNWLMVWLLLCCSIILLFPAGLMKGAVSQWA
                     ATHAAWLGVGMLIAISYFCSQGFLIAWEWACDEWQSRRQQDQLAQMISFLDFNEKAVL
                     REFVLQRKSVINLPITEPAVKNLMDAGVLTYAYGKPVREKEDENQIRALMIALPARPL
                     LTYKVLGLSRGKMSDEQVEQIMNARPKFAQKSFQR"
     CDS             609796..610782
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707534.1"
                     /locus_tag="NUITMVA1_05410"
                     /product="membrane protein"
                     /protein_id="BDC80598.1"
                     /transl_table=11
                     /translation="MLITLLLFLLSAVTIYLACEYFVNGIEWTGHHFKFSQSATGSLL
                     AALGTALPECIVTLTALLMGNAPAQQQIGIGAALGGPLVLSTIGYAAVGVTLLLCMSR
                     EHRAINGEVQREIGRDQAWFVGIFLVAVALGMVAFTGKTWLAPLFVLVYLVYVRRELK
                     QTDSHEVELPEPLKLDPGAEIPALGKVLLQTLVALVVVALAAQLFVHQLESMGELFGL
                     SPVLAALLLSPVATEMPELMNVLIWVRQGKHRLALANISGAMMIQGTIPKAFCLLFTP
                     WLLDSTMMVSSLVTLLAVVLLWWGFSRERMTAGRLAWVGLIYLGFCGWLMAS"
     CDS             complement(610873..611931)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707533.1"
                     /locus_tag="NUITMVA1_05420"
                     /product="L-asparaginase 2"
                     /protein_id="BDC80599.1"
                     /transl_table=11
                     /translation="MTLPIRKTLLAAVLGLTLSPMAMALPNVHILATGGTIAGAGQSA
                     TQSNYEAGKVAIETLIAAVPEMKNVADVQGEQVVKIGSQDMNDEVWLKLAKRVNELLA
                     KDDVDGIVITHGTDTMEETAYFLNLTVKSDKPVVLVGAMRPSTAMSADGPMNLYNAVV
                     TASDPASKGRGVMVAMNDTVLDARDVTKTNTTGVQTFASPNFGPLGYIHNGKIDYQRS
                     PARLHTSKTPFDVSKLDKLPQVGIVYSYANATDLPAKAMVDAKFDGIVSAGVGNGNLY
                     HTLFDTLAKASKDGIRVVRSARVPTGSTTLDAEIDDAKYGFVAAETLNPQKARILLML
                     SLTQSKDPAQIQRWFQQF"
     CDS             complement(612064..612258)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707532.1"
                     /locus_tag="NUITMVA1_05430"
                     /product="mercuric reductase"
                     /protein_id="BDC80600.1"
                     /transl_table=11
                     /translation="MTIELTVSGMSCGGCAASLQKALLAQPAVSSASVDFASSKAVIE
                     SELSKAELIALIEAKGFSAS"
     CDS             complement(612326..613276)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707531.1"
                     /locus_tag="NUITMVA1_05440"
                     /product="transporter"
                     /protein_id="BDC80601.1"
                     /transl_table=11
                     /translation="MTLLASLHFSLSITGPICVVLLLGIWLKQLGLLPDSFVESASRL
                     VFQVTLPALLFLSMVRTDFSTMPSPWLILYGLLGTLTGFLVLELLAARFIPEQRQRGI
                     FVQGSFRGNMGIMGLAYVQNAYGAEGIGAAALLVGSVTVLYNVLAVITLTRSLGGSKG
                     IKPILKGIAKNPLIIAILSALPFGLLGIELPQLVITTGNYFANMTLPLALLCTGASLN
                     LKALRGGALLTGWATANRLFCIPVLLVMGAWALGFSPQALGILFLISSTPTAAASYVM
                     TRAMGGDSVLAANIIATTTLGSLVSTSLGAALMNYLGLMG"
     CDS             613487..614434
                     /codon_start=1
                     /gene="treR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707530.1"
                     /locus_tag="NUITMVA1_05450"
                     /product="trehalose operon repressor"
                     /protein_id="BDC80602.1"
                     /transl_table=11
                     /translation="MDKKLTILDIARLSGVGKSTVSRVLNQDPKVKQATRDRVEQIIA
                     EHGFVPSKSARAMRSQSQQVVGIIVSRLDSSSENQAVRGMLETLYLRGYDAVLMESKF
                     SPAKVQEHLAVLERRGVDGIILFAFNDLDYAAMAPLREKLVLVARDHPGFSSVCFDDA
                     GAVHTMLDQLAARGIRDIAYLGVDTSDLTTGQRRLDAYLGYCAEQGLAARSALGDLSL
                     QSGYRLAGELLTPTTGALVCASDTLAIGAAKYLQEQGRSEVLVTGLGNNPMLSFLFPN
                     ALSLDLGYKGAGEQAARQLLGQIEQDLPPLATIAPSHPL"
     CDS             614626..616056
                     /codon_start=1
                     /gene="treP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707529.1"
                     /locus_tag="NUITMVA1_05460"
                     /product="PTS trehalose transporter subunit IIBC"
                     /protein_id="BDC80603.1"
                     /transl_table=11
                     /translation="MSKINAQHLATLIDKIGGKENIATVSHCLTRLRFVLNDPAKADS
                     KAIETIPAVKGSFTQGGQFQVVIGNEVEQWYKALTEEIGVSGGSKEAAKQAARQNMNP
                     LERGISHLAEIFVPLLPAIITGGLILGFRNVIGDIKMFDDGTHSLTEISQFWAQVHAF
                     LWLLGEAIFHFLPVGVCWSAVKKMGGSEILGIVLGITLVSPQLMNAYGIGQQTPEVWD
                     FGLFVIQKVGYQAQVIPALLAGVFLAWVETNLKRIIPAYLYLVIVPFISLLLAVIVAH
                     AFIGPFGRWLGDGVGFAAKAAMTGSFAPIGAALFGFLYAPLVITGIHHTTNAVDLQLM
                     QSMGGTPIWPLIALSNIAQASAVVGIILISRKENEREISVPAAISAYLGVTEPAMYGI
                     NLKYKFPMLCAMVGSSLAALICGFAGVMANGIGVGGLPGILSIQPQYWAVYSLAMLVA
                     IVVPVVLTLLVYKRQQAAGKLAQASA"
     CDS             616125..617786
                     /codon_start=1
                     /gene="treC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707528.1"
                     /locus_tag="NUITMVA1_05470"
                     /product="glucohydrolase"
                     /protein_id="BDC80604.1"
                     /transl_table=11
                     /translation="MSQTPWWQSAVIYQIYPKSFQDSAARGTGDLKGIMARLDYLKTL
                     GVDALWLTPVYVSPQVDNGYDIADYLAIDPAYGIMADFEALLTAAHARDIRIVMDIVV
                     NHTSTEHAWFKSALGDKNSPYRDYYIWRDPVDGGVPNNWQSKFGGSAWELDEITGQYY
                     LHLFAREQADLNWENPEVRAEVKNIIHFWAKKGVDGFRLDVINLISKDQAFPNDEIGD
                     GRRFYTDGPRIHEFLQDVSRDVFAPVGAMTVGEMSSTSLEHCQRYGALDGSELSMVFN
                     FHHLKVDYPNGDKWTKAPFDFLELKRIFNHWQSGMHGKGWSALFWCNHDQPRIVSRFG
                     DEGEHRVVAAKMLASTLHGLQGTPYIYQGEEIGMTNPGYQRIDDYQDVESRNIFAIKQ
                     TEGMSKAEILAILGAKSRDNSRTPMQWSAAANAGFTQGTPWLKPAANYPLINAEAALA
                     DQHSVFWHYRDLIRLRKTHPIFTQGDYQELLAGHPQIWAYARRANGQTLLVVSNFYGE
                     PATFALPDELATGKGRLLLGNYPDSPARPQSCMLRPYESLIWLVE"