LOCUS       AP021847              850536 bp    DNA     circular BCT 12-OCT-2019
DEFINITION  Pseudoalteromonas sp. A25 DNA, chromosome 2, nearly complete
            genome.
ACCESSION   AP021847
VERSION     AP021847.1
DBLINK      BioProject:PRJDB8578
            Sequence Read Archive:DRR187481
            BioSample:SAMD00180048
KEYWORDS    .
SOURCE      Pseudoalteromonas sp. A25
  ORGANISM  Pseudoalteromonas sp. A25
            Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
            Pseudoalteromonadaceae; Pseudoalteromonas.
REFERENCE   1  (bases 1 to 850536)
  AUTHORS   Kitaguchi,H., Mitsutani,A. and Fujii,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2019) to the DDBJ/EMBL/GenBank databases.
            Contact:Hirotaka Kitaguchi
            Fukuyama University, Marine Bio-Science; Sanzo 985, Fukuyama,
            Hiroshima 729-0292, Japan
REFERENCE   2
  AUTHORS   Kitaguchi,H., Masu,N., Mitsutani,A. and Fujii,K.
  TITLE     Draft genome sequence of Pseudoalteromonas sp. strain A25, a
            bacterium with algicidal activity against diatoms
  JOURNAL   Unpublished (2019)
COMMENT     Annotated at DFAST https://dfast.nig.ac.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Unicycler v. 0.4.7
            Genome Coverage       :: 70x
            Sequencing Technology :: Illumina NextSeq500; Oxford Nanopore
                                     GridION
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..850536
                     /chromosome="2"
                     /collection_date="1994-07-12"
                     /country="Japan:Kyushu District, Ariake Sea"
                     /db_xref="taxon:116092"
                     /isolation_source="coastal seawater"
                     /mol_type="genomic DNA"
                     /organism="Pseudoalteromonas sp. A25"
                     /strain="A25"
     CDS             complement(502..1260)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070950.1"
                     /locus_tag="PA25_32410"
                     /product="DUF1338 domain-containing protein"
                     /protein_id="BBN83256.1"
                     /transl_table=11
                     /translation="MHNNVDQLFDELWNNYLSVTPSAVKVHELLGSTQKDDVINDHIA
                     LRTFNLEKVGLEKLAAHFKAVGYKECGEYHFEAKKLYAKHFEHSDPTKPKVFISELLV
                     EKFSPQLQAIVKDMVAQIDESAITADNFLYSGTHWQVSHEQYKQLLEESEYAAWMSAW
                     GYRANHFTVSINYLQKFNTIEAVNQALKDAGFELNSSGGEIKGSPEVLLEQSSTLADH
                     FNVKFSDGEFSIPSCFYEFALRYENQMVRSTLGL"
     CDS             complement(1327..2346)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:NP_232245.2"
                     /locus_tag="PA25_32420"
                     /product="arginine/ornithine succinyltransferase"
                     /protein_id="BBN83257.1"
                     /transl_table=11
                     /translation="MQILRPIASRDFAAFKQIAIESGHGFTSLPVDDQLLQDKITRSE
                     RSFAKSLNKPFDEGYVFVLEDSETGDIMGTTAIEAAVGMQVPLYHYHLGKTVHHSRTL
                     NVYNTVDILSMCNDYTGCSEICTLFLREPFRKGLAGRFLSRSRFVFMADHSERFSDTV
                     IAEMRGVSDSQGNSPFWKWLQEHFFSIEFPQADHLVGLGDKVFISELMPKYPIYANLL
                     SEDAQAVIGKVHEKTKPALKLLQKEGFEHRGYIDLFDAGPTIEAKLGNIRTVQRSFVA
                     VVEICAGVSGKARAISNQGLADFKATFTDKCSYDEQSKTLQIDPSVAKALALNNGDSV
                     RTFTL"
     CDS             complement(2387..3613)
                     /codon_start=1
                     /gene="argD_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KN20"
                     /locus_tag="PA25_32430"
                     /product="acetylornithine aminotransferase"
                     /protein_id="BBN83258.1"
                     /transl_table=11
                     /translation="MQTNRELFDKVMVPNYNPSEVIPVKGKGSRVWDQKGDEYIDFAG
                     GIAVNCLGHCHPALVNALTEQGQKLWHLSNVMTNEPALRLAKKITDATFADKVYFANS
                     GAEANEAALKLARRFALDNYGEDKTQIIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKP
                     ADIVHCDYNDLAAFEALISDKTCAVMMEPLQGEGGIITPTQEFVEGVRALCDKHNALL
                     IFDEVQSGVGRTGELYAYQGLGVTPDILSTAKALGGGFPIGAMITTDAIAKHLKVGTH
                     GSTYGGNPLACAVAEAAFDTVNTPEVLSQVKVKEQLFRDGLNAINEKYNVFAQVRGKG
                     LLLGAVLNDNFKDRARDFLVASTKHGLMTLVAGTNVIRFTPSLVIPDEDITAGLARFE
                     MAVADVVAAMAQAASA"
     CDS             3777..4205
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013528746.1"
                     /locus_tag="PA25_32440"
                     /product="AsnC family transcriptional regulator"
                     /protein_id="BBN83259.1"
                     /transl_table=11
                     /translation="MINSQDEKLIALLRSNARASISDLARSLDLSRSTVQSRLQKLEQ
                     SGVIRGYSVEFGQEYLSELVEAHVSIKVKQKLTTKTNIALKHMSNISALYAISGEYDM
                     IAVVEAQSLQQLSIILDEIGNLEGVERTNSSVILETKFKR"
     CDS             4470..4754
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_32450"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="BBN83260.1"
                     /transl_table=11
                     /translation="MAEIIMSKTVQQQIGNVALVVENYDDAIEFYTQKLQFTLVEDTD
                     LGGKRWVQVSPPNSNGTNLLLAQASTPEQTQAVGNQTGGRVFLFLQTNDF"
     CDS             complement(5131..6498)
                     /codon_start=1
                     /gene="nhaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92Y37"
                     /locus_tag="PA25_32460"
                     /product="Na(+)/H(+) antiporter NhaA"
                     /protein_id="BBN83261.1"
                     /transl_table=11
                     /translation="MKTMSVRSKKTNVGHATELPKEHIDWIVEPISRFFKVEVAAGVT
                     LLLSTIIALILANSPVSDAFANFWHISIGIKFDTFEYIRPIEEWVNDAAMTLFFFLIA
                     LELKRELVLGELRNPSLAMLSVSGALGGMLVPALVYLTLQFSLPGQHGWGTVMATDTA
                     FVLGCLALLGKGIPKSLRVFMLSLAVVDDLGAIIVVAIGYGGNLDWLAIGIALMGFVL
                     VKLMAFLGVRSITVFFIVGIFIWVAVDVSGIHATVTGVILGLLTPTNKWVSDDRLHAI
                     MNCVVDYPPSEHWSGDTADRKALRTAEAAAREALSPVERLEILLHPWVGFIVMPLFAL
                     ANAGIPLAEVSFTSSVTLAVFLGFVLGKPIGILLFSWAAVQIKIAKLPSDLHWGMILG
                     GGMLAGIGFTMALFIANLAYSPEQLNAAKLGILFASVFSALAGLMVLWYIAKTEQHNP
                     TELVT"
     CDS             complement(6637..7629)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:B8DYG1"
                     /locus_tag="PA25_32470"
                     /product="protein HflC"
                     /protein_id="BBN83262.1"
                     /transl_table=11
                     /translation="MKAKNISIAVALLMVVALTLNSALYTVSEVEQVIITQFGKPIGE
                     PIVDAGLHIKVPFIQQVNAIDKRVLEWNGAPSDMPTKDKLYISVNIFARWRITEPLQY
                     FLRLRDERSAQSRLDDILGSETRNSVAKHKLIEIIRTSADRKPLREGLLIELDADTKI
                     GALVPIHKGRQMVETEIFTAAADKVQVFGIELLDIRFKRINYNESVRPKIYERMVSER
                     RQIAERFLSEGNGEAARIRGDRVRELNKIQSEAYRQVEEIRGQADGKAAQIYAQAYNQ
                     SPQAVSLFEFTRTMQAYPSIMADDTTLILSTDSDLFKFLKDMEPKSDSKIKKKD"
     CDS             complement(7626..8678)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002678884.1"
                     /locus_tag="PA25_32480"
                     /product="HflK protein"
                     /protein_id="BBN83263.1"
                     /transl_table=11
                     /translation="MTDNNNTESRWGGGNKSPPDLNEILKKLFYVPTILPGGRHPSFP
                     FVFAFICVLLTIWNSAYTVPSDSVAVIQRFGKFLSLEQPGLHFKLPFGIDHASTVPVK
                     RQLKQEFGFSTVGANDPYQSPRRNEGLRETQMVTGDLNAALVEWVVQYRISDPVKFLF
                     EVREPSETLRYVSESVMREVVGDRTVDEVITIGRQEIESQALIKMQALSTKYAMGLSI
                     DQVQLKNINPPMPVQESFNEVNQAQQQKEKLINEARRDYNKVIPLALGEKDQRIREAD
                     GYRLKRVNEALGDVARFNALYAQYLKAPEVTKRRIYVETLQSVLPSVRSKVIIDDKAQ
                     HVLPFLNLNKMSGEKP"
     CDS             complement(8763..9461)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_32490"
                     /product="hypothetical protein"
                     /protein_id="BBN83264.1"
                     /transl_table=11
                     /translation="MVELGDLREGIMPDKLFDIIRQTLRLSNITLKGIGANLTCRYGV
                     APQQDNMDFLAKLAKEAETLFGIRFEIISGGNSANLLWALDLDPHVHNAVNQLRLGEA
                     IYFGVEALYKHPIAGAHTDIVTLVAEVIESNIKPSIPKGQRSINAFGEMPQVIDRGQV
                     KQGLLALGRQDVNPLGIIPPRGITIVASCSDHLVVESAGVALQVGQEIRFKLDYSGLL
                     SAMTSPYVSKYFYH"
     CDS             complement(9827..11017)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011143093.1"
                     /locus_tag="PA25_32500"
                     /product="hypothetical protein"
                     /protein_id="BBN83265.1"
                     /transl_table=11
                     /translation="MSSPNVVNLFQVVPKKVSNSKAQNDFIGSNHAHDTVATLSAVIF
                     CEGNFTKTDGKTANGLIRYSPKFRILSVIDSEKAGLDSGYALDRKNNGIPIYASLQEA
                     VHKASERPKYLIFGIAPSSGVLSTSQRLVIIEAMKLGMNIVNGLHEYLNDDPEFIAIS
                     RENGVAIFDIRKPREQRNLQIFSGLINKVDCPRIVVMGTDCAVGKRTTATILTNALKQ
                     SGLNVVSVATGQTGVMQGSAYSLVMDSIPAQFCPGELEAVICRAYETEEPDVIIIEGQ
                     GALSHTAFCTSAMIIRGSAPNAVIVQHAPHRKFRVDFAQMRMPSLASEIELIENFTHT
                     KVIGISINHEDMSNHEVDECIYHYSKEFGIPVTDALKRSSEFLLHMVFKAFPLLERKI
                     PTPL"
     CDS             11548..11901
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_32510"
                     /product="hypothetical protein"
                     /protein_id="BBN83266.1"
                     /transl_table=11
                     /translation="MNIRDILQWQWDGYNKFHKSRINLWIHILAVPVFIFGTLFFIGS
                     LISLNILSLIYSVLLMAISIAVQGFGHSKEALPAEPFSSAKNAFLRIFLEQLYTFPKF
                     VITGKWYSALRNSKP"
     CDS             11985..13202
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072930.1"
                     /locus_tag="PA25_32520"
                     /product="periplasmic siderophore cleavage esterase IroE
                     family protein"
                     /protein_id="BBN83267.1"
                     /transl_table=11
                     /translation="MAFKLKGILMFRLIATVILFLSFSVNAQDIKIGETQVLKSEVLN
                     ESREYYISFPKSYDKNNYTSYPVLYLLDGDMHSFFQVFSGMVNQMSVDASPTIPEMIV
                     VGIASQNRVRDSSPTNSLTQYGGKTNDALSVTGGADKFIQFIKEELIPTINRKYRTSD
                     YKVLVGYSFTGLPVIQSLYTTPETFNAYMAIDPSMWWDNQYMLKQLTHFYKKPALDKR
                     RLFIATTERVTEVYPKENYVAEFIKRLTNKSKDGLYFDSITFGKDENHHTMQVLSFYK
                     GLRSVFEGYMIDDHARFRSAKALETHFYNLSNKLGAKFQLREDLLNWFGYERLYNNQF
                     VDIDVNRAVEFFELNTQYYPLSSNAWDSLGEGYMIQGNDSAALISYEKSLQLNPNNKN
                     AQEKIAQLKSKLN"
     CDS             13326..13745
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011030981.1"
                     /locus_tag="PA25_32530"
                     /product="transcriptional regulator"
                     /protein_id="BBN83268.1"
                     /transl_table=11
                     /translation="MTSNNKLKRLNTSRDFIADNYHVPLSLSDIAKCSYMSPYHFLRV
                     FKDTYGETPTEFLIRLRVEQAKNMLITENFTVSEVCEKVGYTSLGSFSSLFLKQVGMA
                     PTLYRRKLWALSSEAFRFPAQAIPACYAYHFLRNLTK"
     CDS             13816..14244
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003863690.1"
                     /locus_tag="PA25_32540"
                     /product="hypothetical protein"
                     /protein_id="BBN83269.1"
                     /transl_table=11
                     /translation="MITSIAHTTIYVLNQDNALDFYKNKLGFEVGDDMKVEGDFRWLT
                     VHPKSTPQLQLVLAEPKEGPMFSKESAEKIRSLIEEGAFGAGVFETDDCQKTYQELEA
                     KGVEFIQPPTEQLYGIEAMALDNSGNWFSLVERVNKLNKS"
     CDS             14728..15006
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013087264.1"
                     /locus_tag="PA25_32550"
                     /product="transposase"
                     /protein_id="BBN83270.1"
                     /transl_table=11
                     /translation="MSKGKRYTQEFKIEAVKQITERGYSVTEVSERLGICTKTLYHWR
                     SQLSDKPKSVKSSDEQLRIAKLEAELKRVTEERDILKKAARYFASNPE"
     CDS             15054..15350
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_32560"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="BBN83271.1"
                     /transl_table=11
                     /translation="MCRLFKLHRSGFYAWLKKPVSDRALEDSRLLKLIKEFYIASGGT
                     YGSPWIHADLREAGEQCSVNRVAKIMRQHNLKAQIGYKRRHIKSGKTSRIADNL"
     CDS             15447..15875
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_32570"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="BBN83272.1"
                     /transl_table=11
                     /translation="MDLFSRRIVGWSMDKNMDKHLVINALLMAVYQRQPKTEILVHSD
                     QGSQYGSADYLAFMKEHNLVPSMSRAGNCHDNAVAESFFATIKKRIIRRKIYSTREDA
                     KAEIFNFIEMFYNPKKRHSHTGGVSPAKFEEAYYSELKTV"
     CDS             16029..16295
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_32580"
                     /product="hypothetical protein"
                     /protein_id="BBN83273.1"
                     /transl_table=11
                     /translation="MYQKAKTYLDLGESNYKSALSSAKECFSLAKSDEKALTRISIYH
                     DLLSGCYMKLDDSENAKIELQKAIENCSNEKYKVDLQNRLNKLY"
     CDS             complement(16346..17170)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_32590"
                     /product="hypothetical protein"
                     /protein_id="BBN83274.1"
                     /transl_table=11
                     /translation="MSEMKFDSETLDRCLFIGVVYDLYQPLCFRDFEFGTAPSDVNYV
                     LQVHHRANALNDTFKSLETIYQLLSLTNLPVETPLGNISRYNWVRSILDVMLGRVTSI
                     RDCVFLLIESVYEVGLPPRQVSRKALIKSETILANSRLIKLIDAVAETGKNLREERDR
                     LFHRGERRILGSLPEFYYAASAMEAFGSSGKHTGPNGEELDLEAEHKNVIAEIEGDFN
                     QVVTLLSITLTEIFSNLYPMFKETFIGKMKAGDGISEVALGLIERAEHYNSKLSKK"
     CDS             complement(17172..18398)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_32600"
                     /product="hypothetical protein"
                     /protein_id="BBN83275.1"
                     /transl_table=11
                     /translation="MNKLARNNNQIALADVLREFEENGTIFTAEMVAQRTTYSKNSIN
                     KYINEKLLDKYIFHAGSRAKYRIEGISVLSNDEFLAVMSQSAKAKQKKPEEQFHDKLV
                     SRSLDAFTLALEVYNRPSMKNRVEAFAIMMVNAWELLLKAEILKAEGYEKIFYDGDKS
                     ISISDAVKRRLQEKDPVRINLETIIDLRDHAIHLLIPELQPQLSRLFQATVLNYQTRY
                     RNEMGNAPLAGQSVGMLSLVVDGPAPEVALIQKLYGKHAAQSVSKFIQRFDETSKKVD
                     STEFSIPVDYRLALVKREDESDLSLSVGDAGEGAIIITKTKDPDATHPYHTKEALYEI
                     NKRQATISIKSGAFQAVLNKHKINNQTKSDMRWVIDGRPRYSEKFIRWFVDNLKQPKW
                     LESAKEFRRSQLRNKR"
     CDS             complement(18805..19236)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_32610"
                     /product="hypothetical protein"
                     /protein_id="BBN83276.1"
                     /transl_table=11
                     /translation="MNTELPDSFLALTFRFKSLVLKAIRAQGVEVVPMEIQSLHLINR
                     TEHCTAAFMSEHMDRDKGQLARLIKDMIKKGLIEKAKNPNDTRSHLLSLTNNGKAVLE
                     QVLSIEAKIIQNMRVGLTPEQIDVFNEVAVIMTANLKDSDC"
     CDS             19330..19773
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_32620"
                     /product="hypothetical protein"
                     /protein_id="BBN83277.1"
                     /transl_table=11
                     /translation="MRLFKKILVMVPVVFTLVGILTFVMTYQNIGFSNSFVEQWLTST
                     IWAATTMAPIGFVMVAIISKVVNALLPKTRDVIKNAVIGISMAIVMEGFMAAVTTINN
                     VRYVSLEAFVDYWWQAFIIALPVGLLISVFMTLTVKPRLERFMAN"
     CDS             20663..20965
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005477072.1"
                     /locus_tag="PA25_32630"
                     /product="1,4-alpha-glucan-branching protein"
                     /protein_id="BBN83278.1"
                     /transl_table=11
                     /translation="MLTKRFFKTKDEAEVTFEFSHPQAKKVELVGEFTDWKPLAMKFV
                     KKDKAFKLKQRLPVDKQYHFKYLIDGKQWDNDTQADAYVPNSFGTDNSIVNTQRLV"
     CDS             20974..22959
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_32640"
                     /product="hypothetical protein"
                     /protein_id="BBN83279.1"
                     /transl_table=11
                     /translation="MQGLSQLFYLHGIGYDYTKYTGEHVVFEHQTRAQALRCCGIDTD
                     NISHIDKLNFDLDIAPWLNVVGDVCMVEQHDSLLKLRLPDSQLNGIANLCIEALNYEH
                     QFALTSGAVIGEYLFEGVRYVEVAYQITALPIGYFDANICLPSGTYQTQIWSIPSECY
                     KQPEHPSCGISVQLYTLASDRNLGIGDFADLHELVKHSASHGCDYILLNPLHMLFKEQ
                     QHRVSPYSPNHRGLLNPLYIAIDWCDDFEQSTQIQHELALSLAALKSHKKEPFVDYNL
                     VSEQKYRLLEMLYHHFKQHKTSKSVDAFACFKREFAKPLEVLNNDECQIYWQFLARQQ
                     LNRCQRFSIESGMAVGLINDLAVGCAQDSLEFNANKTLYAGNAHVGAPPDPWAEAGQD
                     WGLPALNPIKLRTNKFEFFKQLLRSNMKSVGGLRIDHVMAIRRLWWCFSVQGSQQGCY
                     VYYPFEHLIALLKIESQLQQTMIIGEDLGVVPPEVRSVMLDANMLGNVLFYFEKDQNG
                     EFVQPEHIRSHVLLMVANHDVPPFNAWWQGKDLIVKSQYDLLDEQALSNEQSKRDNEK
                     DRLLRWFEKAGVSHFNKQSNANLVYESLITQLSKSSASMLCIQLDDLDEQDLPVNIPG
                     TYLEYPNWRRRLKNNISDIFTNKSDFINSITQSRKGL"
     CDS             22956..25181
                     /codon_start=1
                     /gene="glgB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q2RR72"
                     /locus_tag="PA25_32650"
                     /product="1,4-alpha-glucan branching enzyme GlgB"
                     /protein_id="BBN83280.1"
                     /transl_table=11
                     /translation="MNSVVSTSKPVQDYSQQLNALQSGCFADPFSFLGLHSVSATEYE
                     LRVYLPGADSVSIEQGKTATKLKRYLSSDLFLLSLSRPLTHENKLVVQYDKHKQVKHD
                     VYRFGCHLDEQALYLFNEGTLEHAYQHLGAHFITHEGVEGVRFSVWAPNAKSVSVIGD
                     FNCWNRCEHFMRFHPASGVWELFIPALKPNQCYKYAIVDNYGNVQDKADPFAFKMQQA
                     PGTASVLQPLKQHKALTQSQLSARAKRNHVSAPVSIYEVHLGSWKRRVDEDNRYLTYR
                     ELADDLIPYVKDMGFTHLQLMPISEYPFDGSWGYQPVGLFSPSSRFGSFEDFIYFTER
                     CHDEDIGLLIDWVPGHFPSDPHGLHKFDGTHLYEHADSRQGFHPDWNTYIYNYDRPEV
                     KSFLLANAMYWLEEFKIDGLRVDAVASMLYLDYSRKDGEWIANKYGGRENLGAIDCLQ
                     QVNTRCYGADSSIMMIAEESTAWPGVTNTVDNNGLGFGFKWNMGWMNDSLSYMSRDPL
                     YRQHHHHEMTFSMAYAYSENYILPLSHDEVVHGKGSLLSKMPGDDWQQFANLRAYFAF
                     MFAHPGKKLLFMGSELASRHEWDHNQGLDWQLLEHESHNGIQKVIKKLNTLYTATPAL
                     HECDHTPAGFQWIDCNNAAHSLFSFARFGKERNDLTVVISHLAPLVHHQYRVGVPRAG
                     VYEVALNTDDKDLFGSGVKVVGSKQQLIQTEPTPSHGFEHSIVISIPPLATLYLNWIT
                     G"
     CDS             25185..27230
                     /codon_start=1
                     /gene="glgX"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EGU6"
                     /locus_tag="PA25_32660"
                     /product="glycogen operon protein GlgX homolog"
                     /protein_id="BBN83281.1"
                     /transl_table=11
                     /translation="MLNSRRGSCRPLGSTVIDDGVNFAVYAPEATSLSLCLFDSSGHS
                     ETARIAMFLHEGGIWSVHVSPLNVGALYGYRAEGEYNPQKGKLFNANKLLLDPYAKDL
                     HGEFTWSERHFCHMPVGKLSLSDNAIDMPKSKVVAIDKYDSPKPQVPWSRTVIYECHV
                     KGATARHREIPPALRGTFAALCEPAFISHLKFLGVTTLELLPVQTFVSEQFLTTKGLT
                     NYWGYNTLNFFIPHKAYLCNGDVREFQSMVRTLHQAGIEVILDVVYNHTAEAGVDGPT
                     LSLKGLNNQGYYRSVLGQPDVYINDTGCGNTVNIDDPYALGLVLDSLRYWVEVMGVDG
                     FRFDLATILARNADGFNRYHAFLQAVIQDPILQQVKLIAEPWDIGPGGYQLGAFPAPW
                     REWNDKYRDTVRRFWRGDINVLPELAKRIHGSHDLFEHNLRGPLSSINFITSHDGFTL
                     ADWVSYEHKHNEANGEQNLDGHGANHSMNCGKEGFSTDPKITSLRLKMQKNALVTLFL
                     SKGVPMIASGSEFGHSQGGNNNAYCQDNRSNWLAWKSSQFNHSLTVFIKELVALRKQF
                     DAFSHPFYIHTDDSRFSVHWLNEHGEPMLPQQWHEANRQWLVYMLVDKQKQNALMIMF
                     NAAKDPLDMTFPAAPYSEQWQLALTSCKSVDVIEQSISISPQSSWVFTSVNEGITHG"
     CDS             27223..29706
                     /codon_start=1
                     /gene="glgP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EGU5"
                     /locus_tag="PA25_32670"
                     /product="alpha-1,4 glucan phosphorylase"
                     /protein_id="BBN83282.1"
                     /transl_table=11
                     /translation="MAKKSAQVCVVKHWQEAPKLDESTFSDDLMRHFYYTLGRDKVGE
                     SQLYLYHALAMTIRDRLVSRCRATNQFLKQQKTRKAAYLSLEFLMGRALGNAVLNLDL
                     QKGVQSALKQYCADLESVGEAEHDAGLGNGGLGRLAACFLDSCASLALPVIGYGIRYE
                     YGMFNQTIEQGNQVEHPDNWLREGHPWELAAPEQSQRVKFFGHVETFRDRSGREHRQW
                     VDTQDVLAVPYDVPIPGYKNGVVNTLRLWKSEATDEFDLTEFNAGSYSEAVAKKNLAE
                     QITMVLYPNDSSENGKELRLRQQYFLSSASLQDILLQWVEQYGANFSDFADYHVFQLN
                     DTHPSIAVAELMRLFVDVYELSWDEAWQITTQTMAYTNHTLLPEALEKWSVPLFAKLL
                     PRLLEIIYEINARFLKLVSLHWPGDVNKQRELSLIEEGDVPQVRMAYLAIVGSYSVNG
                     VAALHTELLKSGLFKTFYELWPEKFNNKTNGVTPRRWLAHCNPSLSKLISDKIGSGWI
                     ADYSEISQLRRYYDDEKFHKQWQKVKTANKQRLCDLVKQRCGVEFDVNMMFDVQVKRI
                     HEYKRQLLNILHVIHLYDRILKGDVQSLAPRCVLIGGKAAPGYYMAKKIIKLINNVAE
                     VINSDEKAKPYLRVAFFPNYNVTAMEAICPATDLSEQISTAGKEASGTGNMKFMMNGA
                     ITIGTLDGANIEIRDNVGADNFFLFGAHAEQTDEIRARYNPQKIISQDPNLNAVMRLL
                     ESGHFNLLEPSVFDDLINAIKSPQDPWLTAYDFASYIDAQQKASDTYLDQPTWTRISI
                     LNTAASGSFSSDRTISQYCDEIWRLAPMQ"
     CDS             29737..31035
                     /codon_start=1
                     /gene="glgC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EGU3"
                     /locus_tag="PA25_32680"
                     /product="glucose-1-phosphate adenylyltransferase"
                     /protein_id="BBN83283.1"
                     /transl_table=11
                     /translation="MPSYANRYISSLTRETYALILAGGRGSRLHELTNWRAKPAVYFG
                     GKHRIIDFPLSNCINSGIRRVGIATQYKSHSLIRHVNRAWGHFKKELGESVEILPASQ
                     RYGDEWYCGTADAVFQNMDIIRHELPKYVMILSGDHVYRMDYGALLAKHVETGADMTV
                     CCIEVPCEEAANTFGVMTVDGDKRVRRFDEKPEHPTSIPGKDGVCLASMGNYVFNTEF
                     LFEQLKQDAEREGSGRDFGHDIIPAIIEEHNVFAFPFRDPSHEGQPYWRDVGTLDSFW
                     EANMELVSPEPQLDLYDPSWPIWTYQEQLPPAKFIFDDDDRRGMAVDSTVSGGCIISG
                     SKVKKSLLFSNVHVHSYCDIEGSVVLPGAVIERNCKVRNAIIDRGCHLPEGLEIGFDP
                     NLDKDNGFRVTNKGIVLVTREMLLAYNQKQLAKKDKLQTA"
     CDS             31048..32586
                     /codon_start=1
                     /gene="glgA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071682.1"
                     /locus_tag="PA25_32690"
                     /product="glycogen synthase"
                     /protein_id="BBN83284.1"
                     /transl_table=11
                     /translation="MRVLMVAAENDRLPNCKVGGVADVIRDIPYALSAQGISVKVVVP
                     DYGQSKLNRSFIGDIAVPFRQHLETATLWQVEQSEGVTQYVISHSLFSEHQGSIYCND
                     DHNRPFATDATKFAFFNAAVCEAIEHKMFDELDVLHLHDWHAACVSVLQHFSPRFVYL
                     KQLKTVYTVHNLALQGIRPFGHDESSLEAWFPTLSYNGQQLCDHHHPHCFNPMRSAIT
                     LADKVHVVSPTYSDEVLHSSEPDRGFFGGEGLEHDMHIAKRQGKLVGILNGCHYNQQN
                     ASSQISLADYYNLVNDELIRWMSKQPALLSCHYIAHQRLKAWQNKAANGPLITSVGRL
                     TDQKALLLRQNTEQGIVLDKLAQLALEVDARIIILGSGDPHLENLFTQVMARHENVLY
                     LNGYGQKIGDYLYHLGDLFLMPSSFEPCGISQMLAMRAGQPCLVHQVGGLADTVQHLQ
                     NGFTFSGEDLEQQCDQLIATFNFALTTYQSAPEQYTQLSKNAAQARFTWQSSAKDYIL
                     QLYE"
     CDS             32820..34037
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:NP_229795.2"
                     /locus_tag="PA25_32700"
                     /product="hypothetical protein"
                     /protein_id="BBN83285.1"
                     /transl_table=11
                     /translation="MKVFVARQAIFNRRKQVVAYELLFRDGTRNSFPDIADDVATAKL
                     IMDNQLNLGTRYLTSGKKALINIGPDSLKQELAHFLPARDVILELLESIDPTSENYEK
                     VRELFHQDYRLALDDFEYTRKWEPFLKLIRLVKFDIQQNSLDSIKELVDEFKKRKNMK
                     LLAEKVETEEEFEQARAMGFHFFQGYFFAKPRVIQQNDIETNHAIVMLIYSEVLRKNM
                     NIDKIARLFAQDTALAYKLLRLINSGVFPLKNRIESLKQALVYLGDERIKKFVGLIMT
                     AHVAEGKPTELTRLSIVRSRFCELIAKSVNPNIKNMSFLTGLFSLLDAILDRPMEQVV
                     SRLPFPEELHDALMGKHNLLYYILNVVKAYESGSWWQLQEACSLLNIDDGRLPDFHVE
                     AIRWADMYNETLF"
     CDS             34058..35161
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071602.1"
                     /locus_tag="PA25_32710"
                     /product="DUF418 domain-containing protein"
                     /protein_id="BBN83286.1"
                     /transl_table=11
                     /translation="MNRISQLDSLRGIAVLGLLLLNSYYFALFETGYVRPQVPVLSDQ
                     IIQYLNLLLLDSRFRTLFCMLFGAALVIQFSKRNNIESLKPRLIAIGIIGILHSIFVW
                     PGDILLSYGIAGFLALSYLNANNQRVLHHGIALFFLSCTLLLLLSFTSTDEMISRQSA
                     QFELLVTSAPSDLPSLLIHNVAMTAIMLLMLPILTLWNALGLMLIGMYCFKKQIFTLG
                     LNKAHLTLTISAIFILSATSIALETIDGQKYAGINEALVWVNALFGALLVTHLNAKIS
                     FGRVLLMPVQAVGKVALTCYLMQSFIMICYFVWLNPQARASYNRIDYVELAFVGIALQ
                     LLLAPLYTRYFTHGPFEYVLKHLSLKIAQRHKD"
     CDS             35253..36134
                     /codon_start=1
                     /gene="rluF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E4I3"
                     /locus_tag="PA25_32720"
                     /product="pseudouridine synthase"
                     /protein_id="BBN83287.1"
                     /transl_table=11
                     /translation="MAQLTRLNKYISETGFCSRREADKLIETGRVKVNGNLPEMGLKV
                     SDDDQVLIDNKPLKAKPKRVYIAYNKPVGVTCTTEKKIRSNIVSAIDYPERIFPIGRL
                     DRPSEGLIFLTNEGDIVNKILRAGNNHEKEYVVTVDRPINKRFVERMAGGLPILDTVT
                     KKCFVKQNSEHTFTIVLTQGLNRQIRRMCEYLGYEVTKLKRVRIMNVNLNGLRPGQWR
                     HLTDAEMKVINDSISDSAKTEEGSIDPNKKELKASIRKPNTTKNQSNDPHQKSAQKPK
                     HTRVPKRKPGTLSLKKQ"
     CDS             36478..36951
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011074234.1"
                     /locus_tag="PA25_32730"
                     /product="peroxiredoxin"
                     /protein_id="BBN83288.1"
                     /transl_table=11
                     /translation="MIEQGQSLPQATLSELTADGMVNHQVSELFANKKVVLFAVPGAF
                     TPTCSESHLPGFITLADKIKAKGVDIIACVSVNDAFVMKAWGESQNASELKMLADGDA
                     SFTRALGLDMDTQAFGGVRSQRYAMIIENGVVTTLNVEAPKQFELSKAETILALL"
     CDS             37008..38009
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014208462.1"
                     /locus_tag="PA25_32740"
                     /product="fatty acid desaturase"
                     /protein_id="BBN83289.1"
                     /transl_table=11
                     /translation="MTNTNTRKNIQHIVTQIKQQERALRQRYPILKYQNQISLLILLL
                     SLVGMVSIGVLYIQGTVSALTCIVISAFFASISHELEHDLIHRQYFKSNELAHNTMLL
                     IVWLMRPNTINPWYRRHIHLHHHKTSGSTQDIEERLVGNGIKNPLIRAIVIVDGLLGL
                     LLMQKRYTKEIKGFNFFSLFNSGFPITTCYFAILYSALLFHGVNMLSRGTLTYPIWLI
                     DAMYWVDILMVVLILPNMLRSICLNFVTSSMHYYGGVTNLLEQTHVLNHWVMLPFQLF
                     CFNFGATHTIHHFVPNQPFYIRQLIAANVLPIMKRYGVNFNDFKSLRNANLYTNRGK"
     CDS             complement(38078..41134)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001881459.1"
                     /locus_tag="PA25_32750"
                     /product="multidrug transporter AcrB"
                     /protein_id="BBN83290.1"
                     /transl_table=11
                     /translation="MNLAKWSIENKVISWMFALLLLVAGAVSYLGLGQLEDPEFTLKK
                     AMVVTLYPGASPQQVEEEVTFVIENAIQQLPYVDYVTSISSAGKSQITVEMKSIYRKQ
                     DLKQIWDELRRKINDLKPNLPPGVYAPKVIDDFADVYGVMYAVTGEGYSYDELKDYVD
                     YLKRELVLVDGVSKVTVAGEQQAQVVVEVATQKLSQLGISPSYIFGLLQSQNSVSNAG
                     KIRVADESIRLHPTGEFQDVKELEHLLISKPGAKELIYLGDVAKVSREYAEVPNHITR
                     YNQQRALLVGVSFSSGVNVVDIGKAINKHLIDLEYQRPHGMEINTVYHQPNEVEKSVD
                     GFIVSLLEAVAIVIVVLLLFMGVKSGLLIGAVLLLTVTGTFIFMKIFAIDLQRISLGA
                     LIIALGMLVDNAIVVTEGILINLKRGQTKLQAAVNIVGQTKWPLLGATVIGITAFAPI
                     GLSSDASGEFAGSLFWVLLISLLLSWVTAITLTPFFADLLFKAPKHTGSEQDSDPYKG
                     IIFNIYKALLSFSLKHRALTVGLMLVLLATSIVGFKSVKQSFFPASNTPMFYVDYWHY
                     QGADIRSTADNLAVIESFLQAQPLVEEVTTTIGQGAPRFMLTYAPEKQYAAYGQLIVR
                     VSDREAVKTMISKLRAFEQNNFLAGELKIKRMEIGPSTDAKIEARFSGPDPVILRQLA
                     AKAKQILAKDDGAFNIKDNWRQRTKVLRPAFNEQKARRLGISKSDVDQLLLTTVSGNK
                     VGLYRDGTQLLPIVARSPEEERKNVENLNDLQIFSPVLGVYVPITQVVDDFKVMWEDP
                     LIMRRDRKRTITVMADHDVIGDETPAKLFARVRGEIEAIDLPHGYEMEWGGEFESSSE
                     AQKAIFGSLPIGYLAMFMITVLLFNSLRQPLVIWSTVPLAIIGVTAGLVALNAPFSFM
                     ALLGLLSLSGMLIKNGIVLIDQINHELAQGKAPYQAVFDSGVSRVRPVSMAAITTILG
                     MIPLLFDVFFKSMAVTIMFGLGFATILTLIVVPVMYCVVFGIKQPT"
     CDS             complement(41137..42216)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261803.1"
                     /locus_tag="PA25_32760"
                     /product="acriflavin resistance protein"
                     /protein_id="BBN83291.1"
                     /transl_table=11
                     /translation="MYKTAAILMLLALLLGCQDKESSQVELEPLRPVKLVTVANSDAS
                     DIRSFPAEVVANQGSYLAFRVNGELMEFPVLAGQEVSKGQLLAKLDPEDFQLQLEQRQ
                     AQFELASSQLARLESLYKKSIASKSEYDQALANKQVAESALKIAKTNLQNSELRAPFS
                     GTIAKVFVKNYENVVAKQNILRLETRDMMDVVIQVPEKLVARVDKEFDYHPSVVFDGF
                     PDKSYELTIKEWDTQADPATLSYKVVFTLPIPKDFNLLAGMTGHVYIDRNKVTHGAKK
                     KLYVPISAVFSERTETIADNAYVWVYDESTQLLHKRAVLIGKMHHQDIEVTSGLNGGE
                     IIVGAGVHHLKEGLKVRPWTKERGL"
     CDS             42323..43219
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_32770"
                     /product="hypothetical protein"
                     /protein_id="BBN83292.1"
                     /transl_table=11
                     /translation="MKISDIEILQAIASANSMSEAAQQLYKTQPALTQAIKRLEEQLG
                     FPLINRNNYRVTLTEKGRRFCDESAKLLVLRDDLQTLAKEFSLGNEARFNICYEPLCY
                     QTQYNQVISDVFKQFPHTEMAITSGKRFVALEQVNNAQANLGIGPWFDLFHATGDLES
                     IAIGEIRLGLVAKKGLLPTSVNYEQLQSFPCLAMFESGFNFDSERLAYARGAGMMKLD
                     DIASIKSFLLSGTGFAMISLSHCQAEIDAGLLEQINVIDRQSTFTAKIHAFRKQARHH
                     GPVARVIWDKFKHIGASYAEQK"
     CDS             43203..43538
                     /codon_start=1
                     /gene="adaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072490.1"
                     /locus_tag="PA25_32780"
                     /product="methylated-DNA--protein-cysteine
                     methyltransferase"
                     /protein_id="BBN83293.1"
                     /transl_table=11
                     /translation="MPNKSKGLDAEFKARVYTLIGAIPQGKVAAYGQLAKLAGAENQS
                     RAVGRLLKCLPPESSLPWHRVVNSQGKISFDENSEKYQQQRKLLEAEGIQFKNNKVNL
                     KTYQWLVSY"
     CDS             43597..44172
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072077.1"
                     /locus_tag="PA25_32790"
                     /product="peptidase S16"
                     /protein_id="BBN83294.1"
                     /transl_table=11
                     /translation="MIRALFPLPVFLLPGGYTKLRIFEPRYLTMVGNALKRDEGFVLC
                     PHVENAYLNVPSEGMYVRIVDFSQDKGGQLLIDVAAQHRVTIADPFQDEQNLRHATIS
                     IIEQPVWCDVEPSQSDFAGEMADMLSDVFVQNPEIDALYREKHFDDPVWVASRWLELL
                     PMKDAEKHKLKSSVNFEQVVNFLHTILYKSQ"
     CDS             44232..44855
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707772.1"
                     /locus_tag="PA25_32800"
                     /product="RNA polymerase sigma factor"
                     /protein_id="BBN83295.1"
                     /transl_table=11
                     /translation="MVDQVSTCDSPNVARNSKNMEQAPSQALSDALCKVANLRDKRAF
                     ATLFEYFAPKIKRFGIKQFGNEALAMELVQDTLTSVWRKAHLYHPDKGAATTWVYTVM
                     RNASFDALRKMKSNKEEHLSEEIWPLLQDEHVIEDGFGDHLQDRKIKEHISKLPPAQQ
                     DVVKGVYFQQMSQEQLAEQLDIPVGTVKSRLRLALQKLRAEMGDSND"
     CDS             44848..45498
                     /codon_start=1
                     /gene="chrR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011263592.1"
                     /locus_tag="PA25_32810"
                     /product="zinc-binding anti-sigmaE4 factor ChrR"
                     /protein_id="BBN83296.1"
                     /transl_table=11
                     /translation="MIKHHPSEQLLSQYSIGELPATLSIAVSAHLEFCSCCQAKVEAL
                     EAANATQEFEDVDSPFDNDDFEDIFSLITNNDDVDTIKAYEPQFVSYQSKQATLPRAI
                     AATDRSNFIQLGKLSRSRLQLDDGELRASLLQIEAGGEIPHHTHTGFELTLLLDGEFS
                     DEEGSYVPGDFIWLDARHHHQPATTRGCLCFTVVNSALHFNKGLSKLLNPIGNLIY"
     CDS             45511..46467
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011705026.1"
                     /locus_tag="PA25_32820"
                     /product="hypothetical protein"
                     /protein_id="BBN83297.1"
                     /transl_table=11
                     /translation="MEKSSSIRIGISACLAGDKVRFDTGHKRSNFCMDELAKHVEYVK
                     FCPEVAVGLPIPRPTIRQVRVGDTIKVCRPDGSGDVGPKLTEYGKKVATEQAASLSGF
                     VFCAKSPSCGMERVKIYNEAGTGNTSEGIGFFAQQIMKHNPLLPCEENGRLNDPHLRE
                     NFVMRVYVYKSWQNLNHEDVGMHELTQFHAKHKYLVMAHNYESYRELGRYLAQASDEP
                     LDEVKQNYIAGLMKALSSPASRKNQTNTLAHLQGYFKNDLSKIEKQELCTAIDEYRQG
                     LVPLYVPLTLLKHHLTVHPNDYLAQQVYFAPYPNELKLRFGI"
     CDS             46467..47849
                     /codon_start=1
                     /gene="phrB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011705028.1"
                     /locus_tag="PA25_32830"
                     /product="deoxyribodipyrimidine photo-lyase"
                     /protein_id="BBN83298.1"
                     /transl_table=11
                     /translation="MAPIFWFRRDLRYFANDALIEAVENGAKEALFFVCEKQWSMHNS
                     APVQIDLIKRRVAWLGEALSAYGINLSVLEVDDFADIPKSLKQFCDERNTHRVYANAE
                     YEINEQQRDAKCIAAGIELVLFDGDLVAPPKSVVTKSGDMFKVFTPFKKAWLKHYEQV
                     HFYIPSWPLDAVKNADGWSTPKCLESDGSSQKWPVDDDAIKVIANNFIENKCADYQSV
                     RDIPSIKGTSGLSPYLALGVISVKQLLAQLQLFYPDILHTTNKPEFCWVNELIWREFY
                     RHLIVSFPKLCKHKNFNDKYDSVCWRNDPSQFKAWCDGQTGYPIVDAAMRQLNQTGWM
                     HNRLRMIVASFLTKHLLIDWRWGEKYFMQRLIDGDFASNNGGWQWAASTGCDAQPYFR
                     IFNPITQSEKFDRQGDFIRRYVPELEDVPTKYIHFPHDYLVTKQSAQYVPPLVEHKAA
                     RVRALDAFKV"
     CDS             47853..48278
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073250.1"
                     /locus_tag="PA25_32840"
                     /product="transcriptional regulator"
                     /protein_id="BBN83299.1"
                     /transl_table=11
                     /translation="MHSVISRFIDMYDVLSADNLSVLEQVYHQDVQFVDPLHQVNGLT
                     HLTMYFANMYANVRAIKFDIKDAFDIEENGFVYWQMRFKHKRINGGKEVIVNGHSHLR
                     FKDDKIIFHQDYFDAAAMLYRNIPLLKQLIGFIDKRAVK"
     CDS             48278..48988
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011263590.1"
                     /locus_tag="PA25_32850"
                     /product="short-chain dehydrogenase"
                     /protein_id="BBN83300.1"
                     /transl_table=11
                     /translation="MKHVLITGATSGIGRGLAEHYAHDSIVYACGRNEQALNELESIK
                     NVRALKMDVTQLDEIKAQSSDIDKLDILILNAGNCEYVDDVKQFDSALFQRVIEVNLL
                     SLGYCLDVLLKKIRSGGQLVIVSSSASFLALPRAQAYGASKAAATYLGQSLAVDLDDI
                     DVSIVHPGFVKTPLTDKNDFPMPMAVTVEHATRSIAKGIAKRQKEIHFPKRFTFILKA
                     LRLLPFSIWLYLSKGIRR"
     CDS             48985..50238
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001889265.1"
                     /locus_tag="PA25_32860"
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="BBN83301.1"
                     /transl_table=11
                     /translation="MNKIAIIGSGISGMTAAYLLSNKFHVKVFEKNDYIGGHTATVDV
                     EMNGENYAVDTGFIVFNDRTYPKFEKLLAQLGIDRQPTQMSFSVKNSQTGFEYNGHTF
                     STLFAQRRNLFRLKFWRLLYDIVRFNKICKSMYAQQDYTQCKTLGELLELHSFNDFFK
                     LHYILPMGAAIWSTSIKEMAAFEVEFFIKFFYNHGLLDITNRPQWYVIPGGSREYIAP
                     LIKKFKDNIVLSANIRKVTRNSTGVELVMEDGSSELFDKVVFACHSDQALALLDQPSE
                     DELSVLGAIPYTANSVILHTDDSILPKRKAAWASWNYLLDQQTDSAAVVTYQMNILQG
                     LDSPNPFCVTLNHESGIEQSKILRRFTYHHPVFNQTSIAAQKQKPLIDGKNNSYFCGA
                     YWYNGFHEDGVRSAVNVAKQLGVEF"
     CDS             50235..50969
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073247.1"
                     /locus_tag="PA25_32870"
                     /product="DUF1365 domain-containing protein"
                     /protein_id="BBN83302.1"
                     /transl_table=11
                     /translation="MNVSLNSALFIGDVKHKRYSPKEHQFHYPLYMMWLDLDELENLN
                     SIHPLLGTKGLKILKFNDKDYLVNYHGDLRERAVSVSQELGAKTEIGKIFLLCQLRCF
                     GVYFSPVNFFFFADSNGQFQHMVAEVSNTPWNERHCYLVKLNEKVNFKKTFHVSPFMN
                     LDMHYHWQVRVSDSRVFIHIANKRQSTLLFDASLRLKRQELLRANVSSLLMQFPAMTL
                     SIFKGIYWQALKLFLKRVPFLGHTGR"
     CDS             50971..52233
                     /codon_start=1
                     /gene="cfaS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073246.1"
                     /locus_tag="PA25_32880"
                     /product="cyclopropane-fatty-acyl-phospholipid synthase"
                     /protein_id="BBN83303.1"
                     /transl_table=11
                     /translation="MENTSSIENQLRLSWSEKLYSKVVFSAFDSIETGHIKVLVGNQR
                     YEFGQRDSKLTCTVTVVDSAMFKLFALGGSVGAGEAYIQGYWRCSDLTALIEIFAQNQ
                     AQLDAFERKFSFITGFVNKLKHIQNKNSKTGAKKNISAHYDLGNDLYSAFLSKEMLYS
                     SAIYPSQDSTLEQAQEHKLHTICKSLDLKANDNVIEIGTGWGAFAIYAAQNYGCHVTT
                     TTISEEQYDYVKQKVAVLGLENNITLLKKDYRDLEGHFDKLVSIEMIEAVGHSYLPSF
                     FKKCDALLKEDGVMLIQAITIACQRYEHYLKQSDFIQQYIFPGGCLPSVTELSKQICT
                     NTSMVVHDISDIGLHYARTLRDWYVRFKQAWPTLDHTKFDQRFYRLWEFYLCYCEGAF
                     KQRSTSTIHLVARKPRYVSTHCADTLNY"
     CDS             52916..53191
                     /codon_start=1
                     /gene="hupB_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P0A1R9"
                     /locus_tag="PA25_32890"
                     /product="DNA-binding protein HU-beta"
                     /protein_id="BBN83304.1"
                     /transl_table=11
                     /translation="MNKAQLVEKMAADAEISKAAAARALEAFTGAVTKSLKEGDSVAL
                     VGFGTFSVKERAARTGRNPQTGAEIQIAAANIPSFKAGKGLKDQVNL"
     CDS             complement(53255..53752)
                     /codon_start=1
                     /gene="ilvH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011262676.1"
                     /locus_tag="PA25_32900"
                     /product="acetolactate synthase small subunit"
                     /protein_id="BBN83305.1"
                     /transl_table=11
                     /translation="MRRILSILLENEPGSLSRIVGLFSQRAYNIDSLTVGTTADQTLS
                     RITITTHGDDRVVEQITKQVNKLVDVLKIIDLTEVPHIERELLLVKVFAKDEATRAAV
                     TRIADVFQGSIIDMGKQSYTLQLLSNAERLESFLDMLRHESDIIELVRSGAVGIGRGD
                     KALKG"
     CDS             complement(53752..55476)
                     /codon_start=1
                     /gene="ilvB-1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KGN4"
                     /locus_tag="PA25_32910"
                     /product="acetolactate synthase"
                     /protein_id="BBN83306.1"
                     /transl_table=11
                     /translation="MKTQQYNGSELVVKALGALDVEYIFGYPGGSVLDLYDALFQQTE
                     IEHILVRHEQAATHMADGYARATGNVGVVLATSGPGATNCVTGIATAYMDSIPMVVLS
                     GQVPSNLIGDDAFQETDIVGCSRPIVKHSFNCRDAQEIPTILAKAFYLASTGRPGPVV
                     VELPKDILNPQLKFNYVMPERIDMRTYNPSVKGHPKQIKKAVEAILGAKRLVIYSGGG
                     IVLSNTSVQLTELVETLNAPITNTLMGLGGISGTHPNFIGMLGMHGNLEANKAMANAD
                     VILALGARFDDRVTNNVKKFCPEATIVHVDVDPTSISKTIKAHIPVVGCLATVLEQLQ
                     AAIDKSSSRIDRSAQEDWWQQITQWRSQQCLSYELGKEVIKPQTVVEKVYEVTNGDAY
                     VCSDVGQHQMFAAQYYPFKNPRQWINSGGLGTMGFGLPAAMGVKLAFPNEHVVCVTGD
                     GSIQMNIQELSTCLQYGLAVKIVSLNNRSLGMVRQWQDMMYGGRHSSSYMESLPDFVA
                     LAQSYGHIGIRVDHPSELDAALEKAFAITDRLVFLDIRVDEKEHVYPMQIKLGAVDDM
                     WLKKGVKA"
     CDS             complement(55865..56872)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071715.1"
                     /locus_tag="PA25_32920"
                     /product="isocitrate dehydrogenase"
                     /protein_id="BBN83307.1"
                     /transl_table=11
                     /translation="MAKQTITVIKGDGIGPSIIDSAIEILNAAGCDFDYEFVDAGLAA
                     LEKTGELLPKETLEVIEKNKITLKGPLTTPVGEGFTSINVTLRKQFGLYANVRPVKSF
                     AGTKARYEDIDIITVRENTQGMYSGLGQVVSDDGNEAEAMSKITREGAEKIVTFAYEL
                     ARREGRKKVTAVHKANILKSTSGLFLKVAREVGERYPDIESAEMIVDATCMKLVMTPE
                     EFDVIVTTNLFGDILSDLCAGLVGGLGMAPGANIGENAAIFEAVHGSAPDIAGKNLAN
                     PTSVILASIQMLEYLEMGETAERIRSAVADVIKSGDRTTRDLGGNHGTTDFTQAVIDR
                     L"
     CDS             complement(57126..58817)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_32930"
                     /product="hypothetical protein"
                     /protein_id="BBN83308.1"
                     /transl_table=11
                     /translation="MSEFTPSPVHLKRLFEHTHQALRLYYKKQKWPAIYPTLTQLAER
                     FVQCYYAQPNAMHAHLQFYASDYGYTTNLTVNQCILVCAFCCANGYKESFTEELVIAA
                     LSDYLCCSNETNKLARSATLSKQESKLVKLRHQFAVTMLNSANVPNGQLQRILSRLDK
                     YSNAITGNKAIPLYDNTSILVTLAKRIAKAITPRPNVKTFTIVQAIKSLYLGTHNEFA
                     QLSLMALSKQIIHYPGGSLVNYKGQGALVLSVINNGYLLALLDNNKAVGMIKTTKQFS
                     PVYQPIVTSDNTLLYTIWFNEQMPVAHCGHVEHTDIWQAITNLGKQQFLEFKAIEKTI
                     KPFSQITQALQLAARQYNRQGQKATTLRHCLTMVGLDTAGLLCQRVLLETLISQLHHP
                     FANDVWQKYIHINKLIITLFSHAQGEQFEQLLSPFTAAIYFILNNHNTNIMRLVIPCT
                     EDIEDKGVSIAHLFGFNRLDESKFEAFVESYFKHSTSHQAFLKSEVEQKQTLDELGQQ
                     IIAIKLLAIYTLGGSQALSAWQTQLLDNVLSDLQWPSLASFCDAFIAQSPSCNVD"
     CDS             complement(58820..59203)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_32940"
                     /product="hypothetical protein"
                     /protein_id="BBN83309.1"
                     /transl_table=11
                     /translation="MIKKVLQYIVLGLAVYATIVMLVINYYKDDPQAMIWQDREAFNK
                     RFISKLKPDQNIELDEVLETLGSPDLTYVKKHQDKTLQIVYYRTQLVKPDGITTQDEC
                     TGLLFDNGQLILWGPAASVAYEKAK"
     CDS             complement(59270..60058)
                     /codon_start=1
                     /gene="xni"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KHE3"
                     /locus_tag="PA25_32950"
                     /product="Flap endonuclease Xni"
                     /protein_id="BBN83310.1"
                     /transl_table=11
                     /translation="MKRKLVLIDALNLIRRIYAVDEQQAHRSEQQTIVSCKSRVSHAT
                     KKLLAITEATHAIAVFDGQKSWRYHFYPNYKHSRKPMPELLCANLESVARGFVEHGVT
                     AYMPQQDEADDIIATLASKASKANVESTIISTDKGFYPLLSEHISIYDYFKRHWLTNN
                     CILERFGVTKDKLADFWALAGDKTNDVPGVAGIGKKTAAQLVANYNELADAIEDSDCK
                     PSTKEKLVTGMDDYIISKQLVTLRTDIHLGFNLKQLRLCANGVV"
     CDS             complement(60055..61398)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011705076.1"
                     /locus_tag="PA25_32960"
                     /product="LOG family protein"
                     /protein_id="BBN83311.1"
                     /transl_table=11
                     /translation="MQVQLNPTGVLNLLSQLEVDLLQQSSNSERYRLFRNCALAVLNV
                     GSHTDSSSEIYNKYQDFDIKLIARERGIKIELSNPPETAFVDDEIILGIHEHIFSVIR
                     DILFICQRHEAQINTPREITHMVFDMLRNADALEVNSDPNIITCWGGHSINETEYRYT
                     KEVGYQLGLRGLNICTGCGPGAMKGPMKGATIGHAKQRISSNRYLGLTEPSIIAAEPP
                     NPIVNELVILPDIEKRLEAFVRTAHGIIIFPGGAGTAEELLYLLGILLHPENEKQCLP
                     VILTGPKESAQYFEEICMFVKSTLGDEALKKFEVIIDDPALVAKKLKLGMKEVREYRK
                     AHGDAYYFNWTLKIDNEFQMPFAPTHENMAALDLHLSQPTQQLAANLRRAFSGIVAGN
                     VKDEGIKAIAQHGPYTLSGDTSLMKDMDKLLRAFVEQGRMKLPGSKYIPCYQIKA"
     CDS             complement(61413..62963)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071723.1"
                     /locus_tag="PA25_32970"
                     /product="diguanylate cyclase"
                     /protein_id="BBN83312.1"
                     /transl_table=11
                     /translation="MVTKNSALLEKKLEQTIKARKALETARKHQVDVLSNFAAKLSLS
                     CKGQDVALDNQLAKFRSALQKGMDFEELEPLIDGMNDILKHQEATISTNNRSLQQSIM
                     QAGKQLQKIRGLPEDGRRKLRHLLDHELSNINTTSDYIPVLEKLSSIYQQALQLKLSQ
                     ADIVNDAEQLQQSPEIANELLNLANELTFDEDVSQEVKAIKNAITLNDSIDSLLNSAL
                     NIIKVIVKSISRERQSAQGFLVSLNQTLEELNSSIVATTKHSQSVNKQISSLNKQIES
                     KIERLNSHTQKATTISELKSLVDGELKLLSQDLIERERIESEDKKALYESFEKINDRI
                     SVLETKVNTYKKRLSEQRFKSLLDGLTKLPNRAAFDDRFNQEFHLFGINKSDVTLVVI
                     DVDHFKSINDKYGHSAGDKTLQVIARALKKAIRKTDFIARYGGEEFVVLMPGMHLQHA
                     KPPLEKLRNVIKSIPFKFKETQVQITISLGATQFKDGDTPLSAFDRADSALYEAKNSG
                     RDRLCLRE"
     CDS             63143..64930
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011057589.1"
                     /locus_tag="PA25_32980"
                     /product="peptidase M61"
                     /protein_id="BBN83313.1"
                     /transl_table=11
                     /translation="MQYKHFLIPLTLITFNSFAQVEYKLTIDQGEHHLGNVTVEFPKS
                     AQAHLDIKLPDWRTGRYEVLDLANGIRYFNATDQKGDTLNWRKIDKSTWRVHLDSPTQ
                     VKVSYQVYANELGKRARHIDDTHAFVDASGFFMFSESFRQEPVLVDLDVPKPWRSVSG
                     MEYAHDKHSFTAANYDVLVDSPIETGVNELHKFTVDGRNYELVIWGQGNYNVEQMLVD
                     LKKLVNTGSLIWQDYPYDRYVFMVHATSGARGATEHLNSTIIQRHRDSFAKRKDYVGF
                     ISTAAHEFIHTWNVKAYRPAGLVPYDYINPNYSDLLWLSEGSTSYLEDYLLLSAGITT
                     APEFFNNLTETLNAHFATPGREVQPAAQASFDKWINQGGDHGKNYSTSIYREGALISL
                     ALDIDLLSKSEGKVSYRDVHKHLYKQFKLPKSFTSADVKYILRQISGRDYSTWWDKHI
                     NSPLDIDIQNLLDKVGLVYDYPAEAIPTANLQIDVKHTGQLLTIKHVARNSSAWQAGL
                     TAGDKIVAFNNQHVRDTLPDSLSYFKGGDRVKVDFIRRDELMSTQVILEKGFNLPKRI
                     SAIEHPDDAQKKLFKAWTGIDHPSVEQSN"
     CDS             65104..65487
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073477.1"
                     /locus_tag="PA25_32990"
                     /product="STAS/SEC14 domain-containing protein"
                     /protein_id="BBN83314.1"
                     /transl_table=11
                     /translation="MSQHHGFSIGIERLNDQFIVHMKAFGTLTHEDYKTITPMLEGAF
                     QQVAHPHIKVLADMTHLEGWELQAAWDDLKLGLKYGSSFDKVALIGSHPWQDTLAKIA
                     GWFIGAQVEKFTDQAQAQAWLLKKE"
     CDS             complement(65587..65916)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33000"
                     /product="hypothetical protein"
                     /protein_id="BBN83315.1"
                     /transl_table=11
                     /translation="MRKLIVALSMVSAFCANAASVDRGKITEIYTDNVGHVGLKIDTG
                     YVDAQRNGECHSNNGWAGLYDPHPNLLSTIYHAHQTGADVTVVTEGCEGATWIRLKSL
                     YLKTTSN"
     CDS             66313..67260
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33010"
                     /product="hypothetical protein"
                     /protein_id="BBN83316.1"
                     /transl_table=11
                     /translation="MSNSGQVEQRISQRTLQSTKSEEPELGPLSQLPGIWQNTGQFKG
                     HGWNMIALPFPSGNHDYRLLNNQYNETLTFQLVDKNVPNRGMNGDQEVFTIDYVQAIE
                     QIAAADFPDSGLAGGAGLAIHHEPGLWLHMKDHTTGDINIARLSSIPHGDAVMALGKS
                     QTNTTGFDIPNLNGLPIGVNQDLSNPYLKPYAHFNDQPFKGIFNPTKPNDLLRSAITP
                     FFSANEIASVTQLKVDTAMGSGGVNNIPFVTRQANAAEVSSIFWIYELKEKHSNGEPR
                     MLLQYTQTVLLEFFDSPNGPGLIKWPHVSINTLEKQPSN"
     CDS             67786..67941
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33020"
                     /product="hypothetical protein"
                     /protein_id="BBN83317.1"
                     /transl_table=11
                     /translation="MKIKLNKKSVKNLNNSKNIPVEQTPNIAGGYTAAWMCQHSYPVC
                     YTEQVCP"
     CDS             complement(68079..68384)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33030"
                     /product="hypothetical protein"
                     /protein_id="BBN83318.1"
                     /transl_table=11
                     /translation="MQYIITAHDYKDDEAINRRLAVRDAHFVGIKTLIEKGHFLSGGA
                     MLDETGKMIGSSVHVEFSTRQELDNWLSDDPYVVNKVWESIDIKEARLVPVEQYKTF"
     CDS             complement(68605..70407)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011970775.1"
                     /locus_tag="PA25_33040"
                     /product="pyruvate decarboxylase"
                     /protein_id="BBN83319.1"
                     /transl_table=11
                     /translation="MNNVIDKYCVADYLKQRLEEIGVEQMFGVAGNYTAALLDVILSD
                     DNSPIKISGNANEICAGFAADAYARLKGVSALYVTYSVGAFSLLNTIAGSFVEQVPVI
                     LINGAPTNKEDQISKQAGLLYSHTTGYDFVDIHMFKPITVAAERITNAQQAPYQIDSA
                     ITAMLTQKRPIYFEVAEDVWRTPCQKPQGKLASGVNATITISEAHKAAQATVELMLSK
                     PNSIFWAGIELQRYGLQDKFLSLLDLLNQSHTLPNKHIHFVTTALSKSVIEETHPWFE
                     GCVTLKNEEIDKLVGDDGALIGIGAWTTGKDTGNQDIRSSKTVLAAHDGVFVGANFYP
                     SVQLEQYLDALIAKFTTLALADSEKFSGLRLNHSLIKQAQTCPNSDSTLGYDNFFHAM
                     SQWISEDDVMIVDAGFPLIGAQGVKIPSRNGFIAQAAWLSIGYSVPAGTGVKCAMPDK
                     RAVVVVGDGAFHETCQAVADQHAYSQNTVVFVIANGIYGIEQYLVNPNPFRQPPVDYK
                     DELLDNVYAYNELPSWKIAKLTDAFGGVGRTVSKMDELMAVMEEIRCNPDINFLVEVC
                     IPKENVPLSIAQEASSAVGEDEIDNPNWPPAGKF"
     CDS             complement(70464..72431)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33050"
                     /product="hypothetical protein"
                     /protein_id="BBN83320.1"
                     /transl_table=11
                     /translation="MTHCKLGSEIKYKSIPGSVEVAIVGAGMSGLYSAWRLQNESDVC
                     DYAILERSDRTGGRLDSDLIKFKNQKKGPGEPDTITVKEEQGGMRFLFDGMDDLMALF
                     LKLDLQDDIVPFPMNSGGNNRLYFRGKSFSVNQAKEDNFAIWSELYNLDQPEQGMNPT
                     EIVNVVFNRILQANPQFNERPKVKGPQFWQDFRLECKWKDKGLNEWSLWDLFSDMGYS
                     QECITMLYRALGFNGTFLSKMNAGVAYQLLEDFPADANFRTFKDGFSTLPNALVEQIG
                     EQRIHLKTEIEAIDYDKNCEEYILRYTREQEDGCLVNGELRAKKVILGLPRLALERLF
                     VGSNAFNDLPKEESKKIWNTLQTSTNQPLLKINLYYDTPWWATGITGRPSVEFGPNFA
                     DLPTGSVYPFYAVNEPLVASLMYQERKTTTDKATQAKLDEIDAKKYDRPAALTIYCDY
                     LNINFWSTLQNKGELYHNPNQDQYVRSVPSDIYPASVAVVEQATAFFKDIFDTRYVPQ
                     PVLTSARIWEGSVDFDLPMSQQFGYGVHQWAVGADDKQVMADLTEPLPNLFTCGEAFS
                     DYQGWVEGALRSTDLVLEKGFGLQPLNKLYTEQTGVTPSAAIKAAYEENASRLIHEYI
                     DPKLALCDAPIDETVDRSSILGVSLTYFDKV"
     CDS             72519..72710
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33060"
                     /product="hypothetical protein"
                     /protein_id="BBN83321.1"
                     /transl_table=11
                     /translation="MDEFKSEIVMSLMFGKYRKLTSLSMHAVSPFRVDINKCSSYVNK
                     CMLQHITNALTTQEKHITH"
     CDS             73063..74979
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33070"
                     /product="hypothetical protein"
                     /protein_id="BBN83322.1"
                     /transl_table=11
                     /translation="MFKINKLVTGAVIAVLVSYSTKGLAGEWIPIYSPEPNLDKGESK
                     YGYSSEGRDVFTIQNKDGSVLNVVDIGGYGYVGDMILGDTATLKQNGFQLNTSATPHI
                     HNDNSQFNSIQGAIRHTSSSYIWPNGVIPYVIDRSLGDQARRDFQYAVEHWHANTNIR
                     LVPRTNQRDYVVVQNGGGCSSWIGRSGGAQTLTLANNCGRGAAVHEIGHAVGLFHEQT
                     RPDRDNYIRLIWRNISSNMAYNFQRIGNHQGKSHGEYDYQSIMHYRINAFGIGGRRTI
                     EILDRNVNEYNVGNGQRLSQGDIAAVAHLYGPQEPVKQCEVVAIEHNQSVSLAGTQGQ
                     SQCFKLSLTDSVKSYRVFTEGNNGDADLFIHKGQIATQSNYDCKSDGENSNESCSSQA
                     TAGDYYITVFAYSDFNNLTLNTVVELKDDDDPIDDSCQAHALTPNTMVTLKNIAAQTS
                     MCFKVNADDNHQLVEFNLADGQGNADLYVKKDTQASLQNYDCMSASATNDEYCSLTAH
                     SSTYFIRIFANTTVTNTKLNVTLKGKNDDSETYMGEISTKDEVDIQPNGQWFEYQGGS
                     LTGLLHGDNQADLELSLEVWNESRQQWQLVKSSTEPQSVEKIEYQAPYGYYRFKIYSW
                     DSQSTGQYQFTLKK"
     CDS             75376..76359
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33080"
                     /product="hypothetical protein"
                     /protein_id="BBN83323.1"
                     /transl_table=11
                     /translation="MLTSAFGSASLTTDSEYELSRAQYFMRSNPAKSLAILNKIPHVE
                     SLPDDQQVTFYALKLRTSLTLNHLDDIDPILETLFKLDDKPAFANKIVSVLSGTGIWL
                     RKTNYFDAAQHVFSCALKHADTSSQQISILISSAIVARYKKDYTLAKSIYEEATPIAQ
                     RLNDQRAIATIDNNLGTIAMDQGNIKQAEMRFRDALSAFQLANNYSGHLNSGINLLFT
                     FVLQNKSIDFQRLYPHISQLSNEYSDESKKAYLFWVNSAFQYTQGVKPNDMQRQELLS
                     TFDKLAGPQLKTLIKNHLASLMGVNVPRVEHASAKKFENKSWYNKVLSCNW"
     CDS             complement(76374..76898)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_007245794.1"
                     /locus_tag="PA25_33090"
                     /product="23S rRNA methyltransferase"
                     /protein_id="BBN83324.1"
                     /transl_table=11
                     /translation="MFDSGFACIGLTNPKSPSNVGAVMRAAGCYGVNSVFYTGKRFEN
                     ARKFTTDTKKVYQNIPLIGTQSLGDVLPLGATPVAIELIEGAKPLTEYVHPKSAFYLF
                     GPEDGSLDKETLKLCQDVIYVPTQGCMNLAATVNVVLYDRLLKSGVTFNHDEIIRSSR
                     DNNNNIVLTDLLAK"
     CDS             77023..77529
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33100"
                     /product="hypothetical protein"
                     /protein_id="BBN83325.1"
                     /transl_table=11
                     /translation="MNIDTFWQIISSVQNEDDVNLALRTALSTLEKDEIAQFDELYTQ
                     QLRMLWHWDNWAFAYVLCGCNTEYDFLDFCNWLILQGKDNITQILSSPDYLAGYEHIP
                     MVNELPAPYCDELDLVAGLLYEDITGEELPYHNVVNFQPQGKRFRNKPKLLKEQFPRL
                     FDKYWNKN"
     CDS             complement(77564..78673)
                     /codon_start=1
                     /gene="asd"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P30903"
                     /locus_tag="PA25_33110"
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="BBN83326.1"
                     /transl_table=11
                     /translation="MNKVGLVGWRGMVGSVLMHRMMEENDFAQIDAHFFTTSQTGQLG
                     PDFAGTPKPLQDANDVTALAQMDVIISCQGGDYTKSVYPALRESGWDGYWIDAASALR
                     MSSDSIIVLDPVNNDVITQGLEQGVKTFVGGNCTVSLMLLALGGLFEKDLVEWVSPMT
                     YQAASGAGARNMRELITQMGDIHASVADLLDDPGSAILEIDKLVAEKIKSEDLPKDQF
                     GVPLAGSLIPWIDVPMESGQSKEEWKAQVEANKILGSSKSPIPIDGLCVRIGAMRCHS
                     QAMTIKLKEDIPVDEIERILASHNDWVKVIPNDRDTTARELTPVNVTGTLDIPIGRIR
                     KLSMGPKYISAFTVGDQLLWGAAEPLRRMLRIILG"
     CDS             complement(79350..82034)
                     /codon_start=1
                     /gene="fecA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011038525.1"
                     /locus_tag="PA25_33120"
                     /product="TonB-dependent receptor"
                     /protein_id="BBN83327.1"
                     /transl_table=11
                     /translation="MNTQMKLKKIALAVSSAMVVGVSMPSIAAEEQAIEEVVAVGTRL
                     QGSAAAVIEERKNQAFVADIMGAEQLSRTGDSDAASALRRVTGLTLVDGKFVYVRGLG
                     ERYSSARLNGASVPSPDLTRNVVPLDIFPSSIIESLAVQKAYSPSMPAAFGGGNIDIR
                     TKSVPTEFTAGIEVGVGMNSNSDEGYIYSRPSNGQPAALHSAVLRYKGDFSLSAIVDR
                     DFIQNTETQTRAEQAAAINKALVLSLPRDIKVKKESLDPNFDIKANIGNSFDEDYFGG
                     TIGVMLAGAYDSDWSYSERKTGVTDDAPSDDCSTSLATEADSKNSCYVTFKDSKVTTE
                     NERISGVFNLGYKLDQQSVHYSKIYLQDNEDEVNLSVLQSPNGSTVRTIAGTGQAQRS
                     HRFNYEERTLDVDQFIGQHTFLDYWGIGADWQYTESKAETRIPTNIEYKFIDQFKNGT
                     YDTSIVTGDDNRANFAFTDMVDNVKSYSGNVTLPLTFENLEVTLKAGYDFLDRARVYN
                     TSNFAINNDTGIPVPVNSDVENINNLTTYLSDEFVNSNDFFIAFNEPTAPSADDYTAA
                     QKIDAGYLEFDVFFDNAWRVSGGLRYEDFKQVTIGTSSLIFDKITQGIYYSEERIKEG
                     TVNQDDVFSSLALTYLAENNYQVRFSYGETTVRPDLRELVAVAYFDPLTDIKTFGTPG
                     LKSSELKNYDARFEYYMDNGDNFSVGAFYKDIANPIETVLRVGDEDYSASFVNGIDGE
                     VYGVEAEWLHDLSYAASGLFTSGNITLSDSEVSIDPAFAGNLTNPTKRMTGHSKYVVN
                     LQMGFDSADGQHSGSIVYNVFGERILASGIGGRQDAFEQPFHSLDLVYTWYPDFNSKV
                     KFKVKNLLGEDQEVTQSDLIVRQKEAGTTVSVNYSYEF"
     CDS             complement(82116..83798)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33130"
                     /product="hypothetical protein"
                     /protein_id="BBN83328.1"
                     /transl_table=11
                     /translation="MKISGLFKVSLVASALVLAGCGGDIKVTPTVNDTSVTNSNNTTT
                     NNTGGATGGDTGGDTGGDKVENPCTARTVAGNEVQGAFEAPHCVYSTSFAGKTLEIEE
                     DITFKALANGGAHIFDGAILMGKNCNTTLGCTVEENGPTLNIEAGTTLAFRSGEAIIR
                     IGRGAKINAIGTADAPITFTSANIYPEFDIAETGPQFADWGGIIINGFGLTNQCTNAE
                     RAANTCNAESEGITSHFGGNNNADSSGNIKFANIWYAGSGPREGGDGDDLNSLTLNAV
                     GSGSTFDYLHIHQGFDDGIEFFGGAANIKHIVVTDTQDDAIDIDAGWKGNAQFIFVKH
                     GTVTTKKDVSFYDDGELKTIAAGTPGFMGNNGFETDGEKNKGADYSEVPASNPTIANV
                     TVVTTDGKSIRDNSSSQAAKFDDAIRGMYYNALFVKADGANGTDCLEFKDSDAAANAE
                     ADVLNFNNSVLACVNNFKNDGETLPGGEVKEEWFRNGGSSLVLNTGEGVLAANGFATN
                     TGAEAITIEANNLSGLDAGFFESVDYIGAVSDKDTSSDWYKWVQKSLAAIAN"
     CDS             complement(83966..85270)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000829069.1"
                     /locus_tag="PA25_33140"
                     /product="hypothetical protein"
                     /protein_id="BBN83329.1"
                     /transl_table=11
                     /translation="MKNIKQLAIYSALFIAGSAAPSLVSIVPSIDINSAFAETKTKRV
                     PALREKVYSQLARAQKLADDGDVKAGLEALDSIKDRASSMNSYEIAMMHNFYGFIYYN
                     ENQLDKAISSFEKVVAEEGIPESLRLSTTFSLAQLAMANSQYNKVIAYLDSWESINAG
                     VIPDNYYVLRAQANYQLKDYEEAIKYINTAVELSESKGNVPNENWLVLQRALYYSLNQ
                     PIKVTEVLEKMVNLYNKPNYWIQLAGMYGEIGNEKKQLAIFEAADQQGFVKSRSEIRQ
                     LAQVYTYNGLAFKAAKVMERGLQQGALENNAKNQAFIAESLVQAKEDSKAIPYFAKAS
                     ELVDHGNYDQRLAEIYINMEMFDEAADAARSALDKGQLTFESNAYVALGMAQYNLQNF
                     DASILAFEQAEKHKKSANLAKQWIKYVKKEKLHNETLKQALL"
     CDS             complement(85292..85897)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KRU0"
                     /locus_tag="PA25_33150"
                     /product="protein TonB"
                     /protein_id="BBN83330.1"
                     /transl_table=11
                     /translation="MRYLIALIIAGVVTFFLFLGMQALIKGGEGAMTEPVKGNVLDFV
                     RLKKEETVQKKERKPQKPPTPKEPPPPMDAPQMQSNDLDAAGADFDFSANVEADVDLA
                     GGLALESSDGEYLPIVKVAPVYPRRALSRGIEGYVIVEFVVTKQGTVRDPKVISAQPE
                     SIFDRAALDAALKFKYKPRVVNGEAVEVAGVQNKISFQING"
     CDS             complement(85908..86318)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010633018.1"
                     /locus_tag="PA25_33160"
                     /product="biopolymer transporter ExbD"
                     /protein_id="BBN83331.1"
                     /transl_table=11
                     /translation="MRAPLAKVFQEEEAEEINMTPMLDVVFIMLIFFIVTASFVKEAG
                     IDVNRPEAATAVKKQRANILVAISDKGEIWINKRQVDIRAVQANIERLKAENPQGSVV
                     IQADKKATTDMLIKVMDASRAAGAFDVSIAAQES"
     CDS             complement(86344..86871)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707201.1"
                     /locus_tag="PA25_33170"
                     /product="biopolymer transporter ExbB"
                     /protein_id="BBN83332.1"
                     /transl_table=11
                     /translation="MVLLVEAINALREFLDTGGQVLLVIGLIIFAMWLLILERFMFVF
                     GRYKTYKNELLTAWKSRSERNSWNAEQIRQAQISRAGIELNANLPYINVMVALCPLLG
                     LLGTVTGMIEVFDVMAITGTGSARSMASGVSKATIPTMAGMVGALSGVFASTYLQRKA
                     KREVELLEDKMLLDH"
     CDS             complement(86874..88241)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005459000.1"
                     /locus_tag="PA25_33180"
                     /product="biopolymer transporter ExbB"
                     /protein_id="BBN83333.1"
                     /transl_table=11
                     /translation="MKFIKQFSKHAVLAATIALSTSAVAEEALNLDSLLKTLEQGQVA
                     QSKQNQAREAEFKAKQDQQVAMLNQLTQERNAALTRSERLETQFEENEIKLQNLTDTL
                     AKRMGSLKELFGVLQQVAGDSSNKFQTSVVSSQIPGRSEFMDEMAKKMGSTSRLASIE
                     DIEKVWFELQREMTEQGKITRFNSEVIVAGGSKASKEVMRVGAFNLIADGKYLSYNPV
                     TNTISELTRQPVARFTETAADLQAAQSGVVEFALDPTGGSILGLLVQAPNTQEQVHQG
                     GAVGYVILGVGVLALLIALERFISLMLMGAKINRQLKDSTARDDNPLGRVMKVKDQYP
                     NVAYDTLELKLSEAILREMPKITRNLTLIKIISVVAPLLGLLGTVTGMINTFQAITLF
                     GTGDPKLMAGGISQALVTTVLGLVVAIPTVFLYTLLNTRSRNLLLILQEQSAGIIAER
                     SEKGA"
     CDS             complement(88252..89004)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707199.1"
                     /locus_tag="PA25_33190"
                     /product="DUF3450 domain-containing protein"
                     /protein_id="BBN83334.1"
                     /transl_table=11
                     /translation="MKCVNPLLLAGLLATASSVQANDLNQVVEKSSAINESAQKTQTK
                     IDSIADSMQSRLQKFKTLNKEIDGLTVYNAQLDKQIKNQLDEMSAINASMDQVSVIER
                     QITPLMLRMITGLEQFVQLDVPFLPKERAERLAKLRAMMDRADVTSSEKFRRVLEAYQ
                     VEVDYGRTIEAYTALLTVDGQEREVDFLRIGRMELLYVTKDGALAGSWNQSAKKFVEL
                     EDTSISQIKKGIRIARKQLAPDMLSLPVHASE"
     CDS             complement(89232..91121)
                     /codon_start=1
                     /gene="pctA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:G3XD24"
                     /locus_tag="PA25_33200"
                     /product="methyl-accepting chemotaxis protein PctA"
                     /protein_id="BBN83335.1"
                     /transl_table=11
                     /translation="MFKSFKFTTKVTIAASLVLVMVLGLFTINNFIVMRSQTQQQLTL
                     VLQEISQSVSQNIANWLNGRLEIVSSVALGHRASDSRDQILRRLATADAAGDFKNVYI
                     GMREGDFILDDPSIVLPADYDATTRPWYQLAKEKNGTAFTNPYIDVTTNELTISAVVP
                     VTSGSEFLGVAGGDIDMATITDIINEIDFLGFGYGFLLDSDGRILSHPNTQLNDKPMA
                     ELFGKHLPLQSEFIEEEIDGSERLISFVKMEGIKNVDWYLGVVINKEIAYSSVSSFRN
                     MAAIYMLLGVIVIVLMLKLLLKYLMKPVAQLNDAIKDIAQGEGDLTRRLHVESEDEFG
                     ELSNYFNLFIEKIHNSIAQVRDTTITLEHSVESLISQTQSTLSMYSDQTKRTDNVATA
                     INELSSSAVEISNNASHASELATEANKLSVDSQTALNANISEIASLSDKMAQAQSTVD
                     SLDKHSASIGQVLEVIKGVSEQTNLLALNAAIEAARAGEAGRGFAVVADEVRQLAQRT
                     QESTQEIEATIIELQQGSASAVAVMKSSLEDSAKSASQATQAGEKMHEVSNAIDSIDG
                     VNHAVASATQEQNTVIQSLDSDIHHISDLSVQGSENLNATLGECRQLQAQFDELEKMV
                     MKFKV"
     CDS             complement(91556..92824)
                     /codon_start=1
                     /gene="fucP_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011036694.1"
                     /locus_tag="PA25_33210"
                     /product="MFS transporter"
                     /protein_id="BBN83336.1"
                     /transl_table=11
                     /translation="MSDINTNQSYVAQGNGENKNYLLPLSAMTTLFFLWGFITVLNDV
                     LIPRLKGVFDLNYTEAMMIQFCFFSAYFIVSLPAGALVKKLGYKNGVLTGLVVASIGC
                     LLFYPAVIVHEYWLFLGALFVLASGITVLQVSANPYVAALGPVKTASSRLNLAQALNS
                     LGTTVGPYVGGLLFFGTAGATAAEAGAESVKVPYLMLAGALLSIAIVFAFLKLPTIES
                     HTEEKDCKAKEHSLIDAPHLVMGVGAIFCYVGAEVAIGSFLVNYFAQPNIAGLAEHDA
                     AKLISYYWGGAMIGRFIGSVVLQKVAPSKALTFNALCIVALLALTMSTNGSLAMWAVL
                     AVGLFNSIMFPTIFSVAIEGLGSLTSKGSGWLCLAIVGGAIVPLIQGLFADSLNIQIS
                     FIVPLVCYLYIALYGLKVVNWTQIWQEKVN"
     CDS             complement(92938..93834)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011266560.1"
                     /locus_tag="PA25_33220"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBN83337.1"
                     /transl_table=11
                     /translation="MQVQDVDLRLLRIFVAIVECGGLSAAESRLNIGRSTISSHLSDL
                     EVRLGLKLCKRGRSGFELTEPGRITYQASLELMQQCEAFATTVASSKNELSGRATISV
                     IDTMVSDPRCGVAHAIATLKRKSNSIQFDINVCEAREVETSVVNGRSIVGLGVSRHHL
                     RGLDYVPLYNENNYLYCGVGHPLFDCDTSQVDALLQQAEVVTSNYMRDRETRNDGLNY
                     QNSAAAYHDEGIAHLILSGQFIGYLPDHYASYWVDKGMFKAILPEQYSYQIPVVLITA
                     KNITPSPLASALIEQVKLCHQK"
     CDS             93986..95479
                     /codon_start=1
                     /gene="hutH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q2S4M1"
                     /locus_tag="PA25_33230"
                     /product="histidine ammonia-lyase"
                     /protein_id="BBN83338.1"
                     /transl_table=11
                     /translation="MTFRYGVDRLNLDVVNGIANGSIKAELCQEALDKINKSRSNVEK
                     MAASDKAVYGINTGFGPLCDTQISPEETHLLQKNLLITHAVGVGEAIAKPISKLMLIT
                     KVHALSQGFSGIRLEVVERMLKFIELDLIPVVPEQGSVGASGDLAPLSHLFLPLLGEG
                     EFWHGEQTIPAATALQEHGLEPLELQAKEGLALINGTQFILSHAITALTKMRYLLDLA
                     DLAGAMSIEGMQGSQSPFREELHQIRAFAGNIEVAARMRRFFKDSQNMADHEECDRVQ
                     DPYSLRCIPQVHGASRNAYNHLKELAEIEMNSVTDNPIVISSEEAISGGSFHGQPLAM
                     VLDYASIAAAELGNISDRRCYLLLEGLHGLPRLLTTSGGLNSGMMIPQYTTAALVTEN
                     KSLCFPPSADSVPTSMGQEDHVSMGSISGRKLNQILGNLEKIFAIELMYAAQAIEFRR
                     PNTCSSLIEENFKVIRNKVAKLEEDRLLKPDIDAMIALVKSQAFTVN"
     CDS             95492..97492
                     /codon_start=1
                     /gene="hutU"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6H0Z9"
                     /locus_tag="PA25_33240"
                     /product="urocanate hydratase"
                     /protein_id="BBN83339.1"
                     /transl_table=11
                     /translation="MNFKEQIKQGIPSVLPAPKPYPADANRAPKRKDILSADEKQLAI
                     RNALRYFPKEWHHELAVEFAQELKDFGRIYMYRFKPNYELKARSISDYPAKCEQAAAI
                     MLMIDNNLDPAVAQHPEELITYGGNGAVFQNWAQYLLAMKYLSEMEEDQTLHMYSGHP
                     MGLFPSSKDAPRVVVTNGMMIPNYSKPDDWERFNALGVTQYGQMTAGSFMYIGPQGIV
                     HGTTITVMNAFRKVLNKDESPKGKIFLTAGLGGMSGAQPKAGNIANCITVCAEVNPKA
                     ATKRHQQGWVDELIDNMDALLTRVKQAQANEEVVSIAYIGNVVDVWEAFYEHDIFVHL
                     GSDQTSLHNPWSGGYYPVDISYEESNRLIREEPELFKEKVQATLKRHADTVNKHTAKG
                     TYFFDYGNAFLLEASRAGGDVMAENGIDFKYPSYVQDILGPMCFDYGFGPFRWVCTSG
                     KPEDLDKTDAIAAEVLNKIMAESPEEIQQQMQDNITWIKDAKQNKLVVGSQARILYAD
                     AQGRAEIAKAFNDAIARGEIGPVVLGRDHHDVSGTDSPFRETSNIYDGSRFTADMAIH
                     NVIGDSFRGATWVSIHNGGGVGWGEVINGGFGMLLDGSPEAEGRLKSMLLFDVNNGIA
                     RRSWARNEEANFAIKREMARTPKLKVTLSNNVDDEVLNNLSF"
     CDS             complement(97569..98075)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92R94"
                     /locus_tag="PA25_33250"
                     /product="UPF0260 protein R01011"
                     /protein_id="BBN83340.1"
                     /transl_table=11
                     /translation="MNDTPFWQTKSLEEMDQQQWEAICDGCGKCCLHSFIDSDHEDDD
                     DFASTDFLREGETLIHTSLVCQYIDENTCGCTRYNERQQLVPSCVKLTKENLKDIFFM
                     PQSCSYRRLYEGRGLASWHPLLNNGQKEQMHAAGISIQGRVTKDNTVDLENDFEEYVA
                     QWPTFDCD"
     CDS             complement(98144..100027)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011268975.1"
                     /locus_tag="PA25_33260"
                     /product="sensor histidine kinase"
                     /protein_id="BBN83341.1"
                     /transl_table=11
                     /translation="MSPHGGVYNVKEFGQYFHDYDRQISTLEQLQTLSHVLAAYQPQK
                     PHVKPYWKWATVELVNNTEQSNWYVSFGFARIPILEMYWLNANGVNTERIVNLNEQSN
                     YYERPIHHPQMYVPITLLPNERKTLVIKYQTFANAPAKIQIHSSNHFNKAAQFSIFNN
                     AVIAGLVLTILFVVIVNLYFNPNLTNVFYAIWTALFFLIVADMAGFTYQYLWPQHGQF
                     ANNFSIVLMVTVPIFHLLFVRRFLELSRHHNKLDRLYVGCICIYVLLVPLALYLQSVF
                     YNLFTSSLIILLFLYTCYWCWRQRAPSIKIFAISLLNHILFVNVLTILGASFGNMLPN
                     FDIATYIKIGYSIEVCLFTIAMAVQNKSVQDQLVHHLQNQVNALNQSVLQQQRFSKQQ
                     CEQVKKHEQRLFTDLSHELRTPLTVMKIQVESLQHNIVENVHESYRKLHDKIDELNEF
                     INTLMLVSNSKDLHYSLDIRPTEIGSFINEVHHLCLQKLNLKKQQLSLNCQTDDIDTI
                     QIDKKAITQVIEEIVINAVKFGGDNVNMILSFVACSQYLTVRVEDSGNPLTYEAHKLL
                     FEPLFRQEPSRNNLLGGKGMGLAVCKKLIEAHHGVISSHNSLLGGLCVEFSLPKEPLT
                     VIA"
     CDS             100541..101677
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011706804.1"
                     /locus_tag="PA25_33270"
                     /product="sodium:phosphate symporter"
                     /protein_id="BBN83342.1"
                     /transl_table=11
                     /translation="MRESANSGLYKFLNWAAIALLVYLVLVAVGTVSGGFKLASGGSE
                     GAKEIFAFATNPFVALLLGALATALVQSSSTVTSVIVGLVAGGLPIHIAIPMVMGANI
                     GTTITNTLVSIGHIRSKEEFQRAFAASTVHDFFNLIAVAIFLPLEIMFGILQKLAGYL
                     SHLFVGDADLSLKSYNFIKPLVKPTVGLIKDALSFLDGKAVGVAMVVAGIGLILFAVT
                     ALGKLLKKALVGKAKDILHSAIGRGPIAGIGSGAAVTIMVQSSSTTTSLMIPLAGSGV
                     FNTRQIYPFTLGANIGTTITALLAATSITGPAAEVALTIALVHVMFNVFAVAFIYGIP
                     VLRELPITLAEKLAHIGANNKPAALGYVLGSFFILPGIIMMAVR"
     CDS             101906..103222
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010971367.1"
                     /locus_tag="PA25_33280"
                     /product="diguanylate cyclase response regulator"
                     /protein_id="BBN83343.1"
                     /transl_table=11
                     /translation="MGLANSIVRHRHTLTKDPKINGGHTVLIIEDQEAASAALKQLLV
                     ERLNVNVDIAHSFQEAKAKLKQHRHEYLVAVCDLHLPDAPNGEILGLVNKAKVRAIAL
                     TGIVRECMHKCLKKALLIDYVEKDAPNSVLYVVGLVERLCKNQKVRALIVDDSPTALL
                     LLERIMLLLNFNVLKASNGRDALDILNESSDIRLLITDHEMPDMSGFELVIKARALYD
                     KDHLAIIGLSAHSQIELGASFIKYGANDFLSKPIEFQNLLCRVNMNMEVLEHLDYIHE
                     LADKDSLTKLHNRRFFFEHGKPAIENAHKTKANLVVAILDIDFFKKINDEYGHDCGDQ
                     ALRHFAILLAQTMKDHLVARFGGEEFVVLFQDIEPNAAQSKLNEFCKLIKDTPFKWLN
                     CDISFTVSTGAVVAKTSVLDEALKLADDNLYKAKQNGRDQVVMTHS"
     CDS             103569..104177
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011389979.1"
                     /locus_tag="PA25_33290"
                     /product="threonine transporter RhtB"
                     /protein_id="BBN83344.1"
                     /transl_table=11
                     /translation="MSFEGFLGLFIAMVVVAVIPGPAVLTITTASVTGGFKRGLYMTI
                     GLVLADYIFIILAILGLSHISELMGEAFIYVKYVCAAYLIWLGIGMWRAKPAAVGTSK
                     RINSHNDVLAGLLLTLSNPKAILFYVALFPAFVTLHSVRFFDMLAILACATLAFGSVN
                     LAYSYLASHLSKSLNANKQFPILQKVAGTIMASAGISVAIQE"
     CDS             104397..104942
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003815169.1"
                     /locus_tag="PA25_33300"
                     /product="transcriptional regulator"
                     /protein_id="BBN83345.1"
                     /transl_table=11
                     /translation="MNLSPKIENFVLHCGEMGSRWGFNRTIGQMVALLVIHEKPLTAN
                     EIAESLKISRGNVSMGIKELQSWQLVKVTHIPGDRKEYYAPNGSIWDLANRVFEERRK
                     REIDPTLSLLRDQLLEGSETPEEEYAQEQIQTIHDLLETITKWSAELQRLSPEQLQTL
                     MKLGSSVSKVIDLKDKLLNKS"
     CDS             104958..106301
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000887578.1"
                     /locus_tag="PA25_33310"
                     /product="cytochrome ubiquinol oxidase subunit I"
                     /protein_id="BBN83346.1"
                     /transl_table=11
                     /translation="MLDTLLLSRIQFAANISFHILFPTITIALAWFLVFFKIKYDKTQ
                     HPVWLRAYRFWVKIFALTFALGVVSGITMSFQFGTNWPGFMEKVGNIAGPLLGYEVLT
                     AFFMEATFLGVMLFGMKRVSPRVHTLSTIIVAIGTSLSAFWILSLNSWMQTPTGFEVR
                     DGVVFPTDWFAVIFNPSFPYRLAHMILASGLTAAFLIAGVSSYRLLKGDDKKAPQLTL
                     KVSLTVAALLAPLQMFVGDLHGLNTFEHQPQKVAAMEGVWETQRGAPLLLFAIPNEQT
                     RSNDFEIAIPNLASIILTHEKNGEIKGLNEFPNATPPVKPVFFGFRVMVGMGLLMIVV
                     ALYFRFTLWRNNTLAPWQLKTLVAMSFSGWIATLAGWYVTEIGRQPFLVTGVLRVEEA
                     VTHVASNNVLMSLIAYLSIYVLLLIAYIRTLFYTADKSVEVEEFQRPSIEENAYV"
     CDS             106294..107292
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000984106.1"
                     /locus_tag="PA25_33320"
                     /product="cytochrome bd ubiquinol oxidase subunit II"
                     /protein_id="BBN83347.1"
                     /transl_table=11
                     /translation="MFEAHTLSFIYASLMALAILLYAILDGYDLGVGILLPTNNEPHA
                     DTMIASIGPFWDANETWLVLAVGLALIAFPLAHSMILQALYIPVTVMLIGLIIRGVAF
                     DFRAKAKIKRKSMWNKLFKIGSIISAFMQGYMLGLYVMSFESSALAVTFAILSGVGVV
                     AAYALIGAAWLILKTQGQLQLDAISWCHMSTRMAFLGVVAVSAVNPVINHSVYERWFT
                     SDIFLLILPIPIICLALFILLDRILVQLKSQPDLGAWLPFLISCVIFILCFFGILYSF
                     YPYVVPGKLTIFEALAAPESLNFLLYGVIVVVPTILAYTAFSYRVFWGKVQPLSYY"
     CDS             107759..108553
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_007336892.1"
                     /locus_tag="PA25_33330"
                     /product="biofilm PGA synthesis protein PgaB"
                     /protein_id="BBN83348.1"
                     /transl_table=11
                     /translation="MNPITVAIFDVNEKAILAGPQNKSARVLYAIFKAQPDIKTLIVT
                     SKIIRQNKLEGVDVFVVPGGGNVLVQQWMLGIRGRKIIRDFVRKGGGYFGICSGAFLA
                     TNARFGWLALVDVKLHDMKHQNRGGGLINVKLNPDTANAILSPKWINNPLRPMLYWQG
                     PLMRLSTASELTQAKRKQGFGIINEIASFGCVIEPEDAKDEKIRFPEYFSDEHMTGYT
                     ACISTTFGKGRVFISSPHLEHPEDNQNMIPEIIHWTAQKGTSLECS"
     CDS             complement(108893..109909)
                     /codon_start=1
                     /gene="mltB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011262256.1"
                     /locus_tag="PA25_33340"
                     /product="murein transglycosylase"
                     /protein_id="BBN83349.1"
                     /transl_table=11
                     /translation="MIKKLTLLVSALCFSTSIWANTQEKFDKYVADLKVEAQAKGYDQ
                     ALIEKAFSTTKFKKKVITNDKNQPEVVETLETYLPKRVPQWKINQARKLYKEHKTILE
                     KIAEEYGVQARFIVALWGLESNFGRIQGGYPVISALVTLAFDGRREAMYKRQLWAALD
                     ILKDGHISLEDFKGSWAGAMGQTQFMPTSFNSYAVDYDKDGRKDIWTTQVDAFASIAN
                     YLKQAGWDDNLTWGRQVKLPDGFDHKYVLKRGTKTRKQWLEYWKDSERSLDAWQALGL
                     RRADGSDLPRVNITAALVMPDDINGRMYLAYDNYKALMHWNRSYYFATSVGYLSDRIG
                     YPKI"
     CDS             complement(109902..110183)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KK58"
                     /locus_tag="PA25_33350"
                     /product="YcgL domain-containing protein"
                     /protein_id="BBN83350.1"
                     /transl_table=11
                     /translation="MLTAVYKSLKKADTYLYIEKRDDFSKIPEPLMAMFGRPQYVMMF
                     DLSKRKRLGTADIAQVKEKLSSDGFYLQLPPPEENLLDQFKKQNGVSSD"
     CDS             110386..111096
                     /codon_start=1
                     /gene="minC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EE14"
                     /locus_tag="PA25_33360"
                     /product="putative septum site-determining protein MinC"
                     /protein_id="BBN83351.1"
                     /transl_table=11
                     /translation="MSEQTFELKGNLFTLSVLHLFSVDINQLRKELDEKISQAPKFFI
                     GAPIVINLAKLQDTEVDFANLKQTLLDLQLNPVGICNGSELQNEAAKAVKLSVLNYSK
                     DTTKPVQPKKNDAEVVEVEKEVYLPPQIVQGTVRSGQQIYAKNRDLVVLGAVSHGAEV
                     IADGNVHIYGTLRGRAIAGAQGYEDAAIYCQRLEAELVSVNGSYWISDSLQGELWGKA
                     AQVKQKNDSLEITALVKG"
     CDS             111102..111911
                     /codon_start=1
                     /gene="minD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KK56"
                     /locus_tag="PA25_33370"
                     /product="site-determining protein"
                     /protein_id="BBN83352.1"
                     /transl_table=11
                     /translation="MAKIIVVTSGKGGVGKTTSSAAIGTGLALKGYKTAIIDFDIGLR
                     NLDLIMGCERRVVYDFVNVINGEANLNQALIKDKRVDKLFILPASQTRDKDALTREGV
                     ERVLNEMRDSFDFIICDSPAGIEAGAMMALYFADEAIVTTNPEVSSVRDSDRILGILQ
                     SKSQRAEKGLEPVKEHLLLTRYNPSRVEAGEMLSVEDVQDILAIDLLGVIPESTAVLN
                     ASNSGQPVVLDSESDAGQAYNDAINRLLGEVVDFRFLNVEKKGILKRIFGG"
     CDS             111913..112182
                     /codon_start=1
                     /gene="minE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KK55"
                     /locus_tag="PA25_33380"
                     /product="cell division topological specificity factor"
                     /protein_id="BBN83353.1"
                     /transl_table=11
                     /translation="MSLLDYFRSEKKSSASLAKERLQIIVAHERSKRGTPDYLPQLKQ
                     DILDVIRKYVKVDSDAVNVQFEQNEDDLAVLELNVTLPDDDKESK"
     CDS             complement(112288..113418)
                     /codon_start=1
                     /gene="rnd"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87RC6"
                     /locus_tag="PA25_33390"
                     /product="ribonuclease D"
                     /protein_id="BBN83354.1"
                     /transl_table=11
                     /translation="MQYQVIQSQKELNEFVVKISDVQVVALDTEFMRRRTLYPEVALI
                     QVFAAEQLALIDPLLELDFEPLWDVFKNPQILKVLHSPSEDIEVFQKFAGFVPSPMFD
                     TQFALQVLGEGNCVGFANMVKTILGVEIDKSESRTNWLQRPLTQSQLDYAASDVFYLM
                     PCFEHIFKLINERELVDIVISESELIASKRAFIVPDEQVYLDVKNAWQLKPRDLAVLK
                     ELAAWRRAKAHRKNLALSFILKEHNMVEVAKRRPTSLNGLRNVPGIEAMEVNRSGKEI
                     LACIEKGKAIVEGQCPKKLLRLIDYPDYKKAAKQLTLQIKQIAQDNDIPADVLASKKQ
                     INQLISWSWKKTADERASLLKPDLLQPWRYELVKEVLAEWDV"
     CDS             complement(113474..115126)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011706061.1"
                     /locus_tag="PA25_33400"
                     /product="long-chain-fatty-acid--CoA ligase"
                     /protein_id="BBN83355.1"
                     /transl_table=11
                     /translation="MEKIWLKRYPEGMPETIDPEHYNSLLELFDKSFTEYASLPAYTN
                     MGKTLTYKQVDEKTKAIASYLQNTLKLGKGDKVAVMMPNLLQTPLAILGVLRAGCTVV
                     NVNPLYTVRELEHQLNDSETKAIFILANFAQTLQKALPKTQVKHIVLTELGDMMGGVK
                     KHLVNFVVKHIKKMVPSFSLPNPISFKEVVGANPNGYKVPDINLSDLAFLQYTGGTTG
                     VSKGAMLTHGNMVGNLEQVSGCLDKVLDSGKEVVVTALPLYHIFALTANCLTFMKYGG
                     QNILITNPRDMPAFVKELAKYPFTAITGVNTLFNGLLNTPGFDELDFSNLKMSLGGGM
                     AVQRPVAERWQKVTKSKLMEGYGLTECAPLVTICPYDLDGYNGSIGLPAPSTELKIIL
                     ENGEEAGKGEAGELCVKGPQVMAGYYNRPDATAECLKDGWFATGDIATYDDEGFFYIV
                     DRKKDMIIVSGFNVFPNEVEEVVAMHEGVLEVAAVGVPHDVSGEQVKVFVVKKDPSLT
                     EKDIIKHCRDNLTNYKVPKLVEFKDELPKTNVGKILRRALKE"
     CDS             complement(115247..116107)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010946217.1"
                     /locus_tag="PA25_33410"
                     /product="lipase"
                     /protein_id="BBN83356.1"
                     /transl_table=11
                     /translation="MTRVKNAIDRLKQLGIAAQIFGEGPEVVICVHGWLDNSNSFQPM
                     LCKIDAKYTYIAIDLKGHGQSQWRSSDAHYYFVDYVYDLLKVIDVLQVTQCHLIGHSL
                     GAMVCGLFSALYPERIKSLVMIEGIGLVCTEPDGIKQQMLDSFEQRNVTGKFKKRLYS
                     SFDALITARSLAGDITKKDAALLMSRNTQKVEGGYYLTTDPRLKTQSGFRFAKAQALA
                     ALKDITVPSLLIIGDAGYDFVKQNCSIFKSNFNVLEVKEIPGGHHCHMDSPQQCIMLV
                     EQHMNRNTLT"
     CDS             116314..117651
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005463736.1"
                     /locus_tag="PA25_33420"
                     /product="alkaline phosphatase"
                     /protein_id="BBN83357.1"
                     /transl_table=11
                     /translation="MKKPRSLFSNKHTCFSKALMASTFALGLTSSYALAQSSPKNVIY
                     MIGDGMGPAYTTAYRYYTDNKDTKVVEPTVFDSILVGMAHTYPDDDTVVTDSAAGATA
                     LSTGSKSYNGAIAVDTHKKSLTTMLEIAKLKGMTTALVATSQINHATPASFAAHNESR
                     RNYDEIADDYIDNKIAGKLPVDLLLGGGTKYFSREYRNLVEEFKAMGYRYSDSLNTID
                     SLTSLPALGLFAPVGLAFAIDENPDRLEKMTKKALSLLEKKNEKGFFVMIEGSQIDWC
                     GHANDIACAMAEMHDFANSIKAAKQYVDNNPDTLLVVTADHSTGGLTLGANGQYRWES
                     SIIKGIKSSVQVMTKKMLESDNLKEIWTTSTALPFDKPTKLLLEQAKGQGDKALAQAI
                     TKIISDASFTGWTTGGHTAIDVQVFAHGKGAEQFIGSQDNTAIADKLISFIQN"
     CDS             complement(117679..119319)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33430"
                     /product="hypothetical protein"
                     /protein_id="BBN83358.1"
                     /transl_table=11
                     /translation="MPIFCCYLLHQLSKLDFLKIVNVSSISLFLRKHINLIFPYLVVT
                     SVTLFVFPYINHVGIWLYDNLLHVHFELTGLGKLYFQLISTHLLWFFGVHGDNTFHIL
                     APLELSHYVLEPDIVIYQFFTSFVLLGGTGCVWGIIIASFFIKEAHHEQHIAKLSLPL
                     AVFNISEVMIYALPIVFNPFILIPFLLAPALNAIVSYLCIYFDVFSMSNEVNVPWFTP
                     IFINAWMLTESYIAVLIQGILVLLNAAIYYPFLKACQKNSMPGKALEMLVKRYSAGRE
                     IESKAESIFAVHHGEFQLEHDCLKQVTDALNRGALVLHYQPKINLQSGEIDGFEALIR
                     LRLPNGHVEGPWFLNTLARHNLLEVIDNFVIDQLEVDLESFKKAGAVPKISFNMSPDN
                     LLNGGYKRVIKAFSKYQNQVEVELLESVYIEDFKSTIGIVELLKSNHINCAMDDFGTG
                     YSCLSVLSKLNIDTIKLDRSLLPDPSNTKSKTLYLHLAQLCKQLGFKTVAEGVETTEQ
                     ELIVKQANIDLVQGFLYYQAMPVEEAIKLLGNTQKVVV"
     CDS             complement(119798..120100)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33440"
                     /product="hypothetical protein"
                     /protein_id="BBN83359.1"
                     /transl_table=11
                     /translation="MQTMKTQLIVQSQHTYQLKPAIKKLDAEQQSAPKPTEQTSFVKS
                     SDKGIELAKKLQSEFKSTIYDQPSFNNSKAISSYMAINNQQRRDEVQSLIGVNVFA"
     CDS             complement(120131..120817)
                     /codon_start=1
                     /gene="yeaZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011262263.1"
                     /locus_tag="PA25_33450"
                     /product="tRNA (adenosine(37)-N6)-
                     threonylcarbamoyltransferase complex dimerization subunit
                     type 1 TsaB"
                     /protein_id="BBN83360.1"
                     /transl_table=11
                     /translation="MKHNLLAIDASTEALSLALHYNDQTYRHFEVCPQQHSQKILPEI
                     ERLLSKANCQLSDLDGIVFGRGPGSFTGVRISVAIAQGLAFSSNLKLVGVSTLEAMAL
                     QAVRQCNVSQVLSGIDARMGEIYLAHYQVSSDGTVAVVEDEIVCAPEDVKCFEPQIAA
                     VGSAWQAYPELVKSNNLDVQEAITLPDAFYMLELGDLAFSKGLSVDAASAQPHYVRDT
                     VTWKKLPGRE"
     CDS             complement(120819..122729)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001881716.1"
                     /locus_tag="PA25_33460"
                     /product="ATP-dependent helicase"
                     /protein_id="BBN83361.1"
                     /transl_table=11
                     /translation="MSIQHVFSQQGPLAQHFNGYTPRQPQIEMALAIEKTIADNGQCV
                     VEAGTGTGKTFAYLAPLLLSKQKSIISTGSKALQEQLYHRDLPTLQKALKVGKTTALL
                     KGRANYLCTYRLSQHVAHVPSDDPDIMHQLAMVAKFATETDSGDLADCIGIEEDAKVL
                     PYVNSTADNCLGKDCPDFQSCYIRKARLKAMEADLVVINHHLFFADMAVKDSGFAELM
                     PTADNYVFDEAHQLPQIASDYFGESFSTKQLGDLINDIRLIYRSDIPDMLQLGKTLNK
                     LETSVADLRISFGVEGGRGDWRAALASKQVCDALHRVISDLDFLYQVLKTCLDRSDKI
                     EHPFERVLKFKGQLERAFDVSQTGFSYWFETTRRYISIHITPLDVSGKFQEIVEKTKS
                     SFVFTSATLSVDDSLAHFNASLGLTPSHQSIVVSPFDYQQQALLCLPRYLPESRDDLM
                     PHTLVKIAKQLISAAKGRTFLLFTSYRVMHLVFEGLSTALEYPVFMQGQSSKRIILEQ
                     FVRHGNAVLLGTASFWEGVDVRGDTLSCVMIDKLPFTSPDDPLLQARMNDAEMQGKEP
                     FSTIQLPQAVISLKQGVGRLIRDNSDKGVLVICDNRLVTRKYGQTFLKSLPAMKRTRC
                     LETATKFLENIK"
     CDS             complement(122812..123201)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33470"
                     /product="hypothetical protein"
                     /protein_id="BBN83362.1"
                     /transl_table=11
                     /translation="MVNSLNIRYAVFVYLEKHRKVKVCKHFFVISKEYLITADNIGRF
                     YKARALIMDALKPFLTNIVRLEVEHKPMFYIAGVKDGLVSKVKLRREVLEQQRKKLKE
                     QEMAEQQKNAKSKDQEEDDETHLDTWA"
     CDS             123381..124277
                     /codon_start=1
                     /gene="hisG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KKB9"
                     /locus_tag="PA25_33480"
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="BBN83363.1"
                     /transl_table=11
                     /translation="MNSNRLRIAIQKSGRLSKDCQNLLKQLGVKLNLREQRLIAHSTN
                     MPIDVLRVRDDDIPGLVMDGVCDLGIVGENVLVEAQAERAGGTQNAEVIKLSKLDFGY
                     CRLALAWPQELGPQDKSWFEGKRIATTYPEILKQYLQRENINASAVMLTGSVEVAPRA
                     GLADAICDLVSTGATLEANGLMQGDTILESNACLIQNPNLADSDKLALINKLMPRLKG
                     VRQAKESKYIMLHAPKDKLDEICELLPGTGQPTLLALAGSDEYVALHMVSTETLFWET
                     MEELKALGANSILVMPIEKMME"
     CDS             124283..125581
                     /codon_start=1
                     /gene="hisD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87QL1"
                     /locus_tag="PA25_33490"
                     /product="histidinol dehydrogenase"
                     /protein_id="BBN83364.1"
                     /transl_table=11
                     /translation="MIRWNEETPQTQQALLTRPAVMASKTVENSVLKIIEEVASEGDA
                     ALLKYAELFDKRVNPRLVVPQDEIDNSAAQLSTELKKAIEQAYANVKAFHQAQQPKDI
                     KLTTSPGVECELKYQAIDAIGLYVPGGSAPLPSSVLMQGVCAQLSGAKTVVLCTPVNG
                     ESRISPAILYAAKLCGITTVIESGGAGAIAAMALGTQSVPKVNKVFGPGNSYVTMAKQ
                     LLSQSQTGFAIDMPAGPSEVLIIADERANPEFIAADLLSQAEHGSDSQVILLCNSEAI
                     IEQTQRALDAQLQALTRRDIAQAAMNNSALILVNSLEQAFDISAQYGPEHLILQLADA
                     TPYLPLVKNAGSVFVGDYTPESAGDYASGTNHVLPTYGYSKVYSSLNLLDFYRTYTVQ
                     SITAQGLKNLSSAIVPLADAEGLDAHANAVKIRLEAMNND"
     CDS             125574..126647
                     /codon_start=1
                     /gene="hisC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KKB7"
                     /locus_tag="PA25_33500"
                     /product="histidinol-phosphate aminotransferase"
                     /protein_id="BBN83365.1"
                     /transl_table=11
                     /translation="MTKQVFPNNILPDNINALAAYSSAKSQKLTGSTWLNANESPYTK
                     TFELSLSDLNRYPDPQPENVINAYAQYAGLGAEQVLMTRGADEGIELLVRTYCASGKD
                     SIALFMPTYGMYKVTADSHNVAINALTQELLLEGSVEQIITAVGNSKLVFICNPNNPT
                     GSLTPLNKISAIANALENKAIVVVDEAYIEFCPQQTATTLLQEFANIVVLRTLSKAFA
                     LAGLRTGFMLANTALLAPVRKVIAPYPVSRVVATIAEQALQSDAITQMRRQVTILNRA
                     KVILMQWLESSPAVSKVLNGQGNFVTAQLKNKADIDKAMKGGLIMRPFTLCEQDNWLR
                     ISIGNEQELEQVKLWLETLGSKL"
     CDS             126658..127719
                     /codon_start=1
                     /gene="hisB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E636"
                     /locus_tag="PA25_33510"
                     /product="histidine biosynthesis bifunctional protein
                     HisB"
                     /protein_id="BBN83366.1"
                     /transl_table=11
                     /translation="MSNPYLFIDRDGTLIDEPITDKQVDSLEKLVLLPNVIPALLQLQ
                     AAGYKLVMVSNQDGLGTNSFPIADFDIAQNKMMEIFTSQGIKFDEVLICPHFNEDNCQ
                     CRKPKTGLLTELMRSGKVDLERSYVIGDRQTDIGLAENLCIQGILYDGDWPAIVTQLT
                     TQNRTACVTRNTKETQICVSANLDQNANGEINTGLGFFDHMLDQIRTHANIGLNIKAS
                     GDLHIDEHHLVEDVGIALGQVLKRALGTKSQIARYGFALPMDECKAECQLDLSGRASF
                     VLNANFSREKVGDLDVQMVEHFFKSLADNAQVSLILSVTDGNCHHQVEGLFKAFARAL
                     RMAIAQDLQQQTASSKGCL"
     CDS             127716..128309
                     /codon_start=1
                     /gene="hisH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KKB5"
                     /locus_tag="PA25_33520"
                     /product="imidazole glycerol phosphate synthase subunit
                     HisH"
                     /protein_id="BBN83367.1"
                     /transl_table=11
                     /translation="MIAIINTGCANINSVRFAFERLGVTPEVITDPAQLAHFDRAILP
                     GVGHAKVAMERLKQGGWQQAIAEYDKPLMGICLGMQLLCEHTDEGDVSCLGMIPGNVG
                     LLEVGELTSPHMGWNNLCEVKPHPLTKGLSAQQQVYFVHSFAHTPNEATLAQGEYGSA
                     FSAIVAKDNYAGMQFHPERSAKVGAQLLQNFIDWQLP"
     CDS             128318..129052
                     /codon_start=1
                     /gene="hisA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P10371"
                     /locus_tag="PA25_33530"
                     /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)
                     me thylideneamino] imidazole-4-carboxamide isomerase"
                     /protein_id="BBN83368.1"
                     /transl_table=11
                     /translation="MIIPALDVLQNQIVRLYQGKYDTAQFYPYELGQRLQKYQNSGAQ
                     KLHLVDLEGARDPQKKQWLQIQAATKALNVPYQVGGGIRSFDDVKQWLEAGANQVVIG
                     SMAVDKQQEVAMWIQEFGAERFVIALDVNQTETGWATATHGWLAGGQDNLFELVDFYY
                     ALGVVDFLCTDISKDGTMTGPSFKLYEQLVAHNTQIKVQASGGVSSLEDIEKLSRIGV
                     GGVILGKSLLDGVFTVEEALACYQNA"
     CDS             129034..129813
                     /codon_start=1
                     /gene="hisF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E633"
                     /locus_tag="PA25_33540"
                     /product="imidazole glycerol phosphate synthase subunit
                     HisF"
                     /protein_id="BBN83369.1"
                     /transl_table=11
                     /translation="MLSKRIIPCLDVKNGQVVKGVKFKGHEVVGDILELAQLYSQAGA
                     DELVFYEISASVEKRLLDVDWVSNIAKHIDIPFCVAGGIKSVADAAKVLEQGADKISI
                     NSPAIARPQLIKELHDEFGKQCVVVGIDSFYDENTGDYLVYQLTGDPNASSRTRYKTQ
                     QWVEMVQELGAGEIVLNCMNQDGVRKGYDNAQLSLIRRMCDIPLIASGGAGNMQDFAD
                     VFKQSQVDGALAASVFHKNIIDIGELKTYLNEQQVAVRLCN"
     CDS             129804..130421
                     /codon_start=1
                     /gene="hisI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KKA9"
                     /locus_tag="PA25_33550"
                     /product="histidine biosynthesis bifunctional protein
                     HisIE"
                     /protein_id="BBN83370.1"
                     /transl_table=11
                     /translation="MQLTPDNLSQLDFEKSPMMPAIVQDAATGQILMQGFMNEEAIAA
                     TFEKQLVTFYSRSKERLWTKGEASNNVLKLISAHTDCDQDSILILALPEGPTCHLGTQ
                     SCFADAKPATSFLAQLEQVIIARKNDDPNSSYTASLFAKDISRSCQKVGEEGVEVALA
                     AMKQDKEELINESADLLYHLLVLLQRSDSSLKEVVDCLESRHKPS"
     CDS             130489..130668
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33560"
                     /product="hypothetical protein"
                     /protein_id="BBN83371.1"
                     /transl_table=11
                     /translation="MFIYIQGFMLAFIATRLVRLSVLSKGTFSEANGAPLNYLGLLRI
                     ATIHADNCHIKSDES"
     CDS             130665..131435
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33570"
                     /product="hypothetical protein"
                     /protein_id="BBN83372.1"
                     /transl_table=11
                     /translation="MNTQPPIYLINLDQSTDRLDKSSARLKEQGLTFERISGVYGKTL
                     SDIDLIKNYQPMLNKQLFYRPLSKGEIGCYMSHRKAWQAIVDNKHPYAIVMEDDFRLV
                     GDLSDVFATIECLPVDWQLLKLAAYENRTRPIAFSHSVNEKFELVVHKKAMTGCCAQA
                     ISYEGAKTLLAATEQFARPVDTDLQHVWETKVAVYSLMPYYIEQDLGFDSDISAASGT
                     KKVKKRFWKRKWLQLKEKITNKNATTQIIDTLKKQLNK"
     CDS             131551..132051
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33580"
                     /product="hypothetical protein"
                     /protein_id="BBN83373.1"
                     /transl_table=11
                     /translation="MTRKAQLKEFLQSISFRELTLTIDLLVSVYISYIYIISLINATA
                     EQLASVSWLSGLLLEVLTYSVILMVSSYLLLAFISDDELKQPLDVREKQINLVGYKSK
                     AHILQAGICVAIFQYQAEANGWGPAIEYNIPYLPMHVMVGAFLLAEIANYAAQLYKGR
                     TGQIYE"
     CDS             132044..132277
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013223905.1"
                     /locus_tag="PA25_33590"
                     /product="transcriptional regulator"
                     /protein_id="BBN83374.1"
                     /transl_table=11
                     /translation="MSNAKDTFEITNSIRTLRFLNNEMTQKQLADIIGVTRQTVMAIE
                     ANKYSPSLEVAFKIAAVFNLPLEEVFQYRAKQT"
     CDS             132365..132985
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33600"
                     /product="hypothetical protein"
                     /protein_id="BBN83375.1"
                     /transl_table=11
                     /translation="MKYQLLKLALIITALPAACSKPPVDCSAYSNQQNSLYILPYQPG
                     ESYKVEVSTGHYRKSNKGVGLYAIDFNMPIGTKVVASRSGEVVAVQESFEDYNGEDLK
                     ENYIFIRHNDGTIARYFHLTHQGALVSEGDTIEAGQVIGLSGNTGQSGGPHLHFDVQQ
                     CGPNLPPNYNKLPCGQTIPITFNNTIAHECGVEKGKHYRAAEPSHS"
     CDS             complement(132991..133539)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005173810.1"
                     /locus_tag="PA25_33610"
                     /product="cytochrome b561"
                     /protein_id="BBN83376.1"
                     /transl_table=11
                     /translation="MTMEDKTVKFDSTARTLHWISAVVIVWAMLSGLYVSLLSALHLD
                     QAHSMQVIKRFITDFNVSLTALYIPLFVMRVLHVLRTKKPHYGDMLSPAQIKMANAAH
                     ICMYILIATLLCSGMLMMNRPFGIFGLFTMMPIITDPQWLNVYSDIHQYSSYVLLVFI
                     ILHLGALLKHQRSGNRILQRML"
     CDS             complement(133961..134860)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33620"
                     /product="hypothetical protein"
                     /protein_id="BBN83377.1"
                     /transl_table=11
                     /translation="MSKWSLTIAISMITALSLAALLGGVLSTAEEEVTQHVEPMLSDA
                     SPDEANNQAPLFFETSKSSQQGCQSITAKDRHKIDDWLLALQKEELQTQWQHHIDKLD
                     VCLQAHATAYLNYKSALAEVDENLNIFERHELLMALQRQYFSVQLIERWFADENRWNE
                     HALERWQILADKRSSSEQKERLIAQHISQLSDTERQLIHSSTQITTLSKNLPDKTPNE
                     LIAQYGEAAAQRLVELNAKQTQWREKLLKFEQQRLEIMASDNTQSEQLQQIERLKQTM
                     FNSAEQKRLPHAFALIQSKHERN"
     CDS             complement(134857..135774)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704485.1"
                     /locus_tag="PA25_33630"
                     /product="lactonizing lipase"
                     /protein_id="BBN83378.1"
                     /transl_table=11
                     /translation="MKRYIFSLIIGISSLCCTAAQSSEELKYPVVLVHGLFGFDNLLG
                     VDYFYRVPSVIQQEGGDVYVAEVSSAHNSELRGEQLLEQVALVRAITGKAKVNLIGHS
                     QGAQTIRYVASVKPQWVASVTSIGGVNWGSRFADVVRGSVDTGSFSEQFLASLANGLA
                     GLIDLLSGKPSAPKDALEALSALTTEGSVAFNQSFPEGIPSTYCGHSAALADNGVYYF
                     SWSGSKAWTNVFDPADNALALFSQVFTEPNDGLVSACSSHLGQVIGTNFKMNHLDQVN
                     QTIGIHHLFETDPLTLYRQHIRRLKGLNL"
     CDS             136358..138007
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33640"
                     /product="hypothetical protein"
                     /protein_id="BBN83379.1"
                     /transl_table=11
                     /translation="MYKNKMTTITLAVLSTLASPLLMAQPATQPDVDINIVGGVVTDE
                     YSRPYQVALLMNGQQGCGGTLISQDWVLTAAHCVDNASTSSLTVRVGAHSISRNDGQT
                     LRVSQIINHEQWRGAQSIRSGYDIAVLRLASPASSQYTPAKLPTAAIEQQYASVGDYV
                     TVSGWGRTSNGGRGSDVLREVDLPVISNSSCSSQLNYNIPSSVICGGGQGGRSACNGD
                     SGGPYAVRVGNEFYSIGTVSWGIGCRGASAFTRTTSYLDWIKAKTGIGNTVPDDSAPV
                     ADFDVTVNQLSVTFTDRSRDDKGVVSHSWNFGDRQGGTSSQASPTYQFSEAGTYNVQL
                     TVTDTKGQTGTTSKQVKVSTGDDNGSCSGVESWSASKSYALNDKVSFNGYEYTAIWWS
                     QGAQPDLYPSVWQKGNKCGDTTVPVADFSATANGLSVSFDNSSAGNISSVLWNFGDGN
                     RSNAFSPNHTYAQAGSYQVTLSITDNNNQTATVTKSVTVSGGDTGNCNGVDGWSASKV
                     YQQGELAHVEGIVYRANWWVQGENPQSSGPWGPWTRVGTCQ"
     CDS             138094..139299
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33650"
                     /product="hypothetical protein"
                     /protein_id="BBN83380.1"
                     /transl_table=11
                     /translation="MGLNQQSASELTRLGERLKKNLNAIFAELPVTASTINGLTNYLD
                     YHRSNSQRIFNAKKAATGEQVLLQLPGIKALEEFICKLQPHISESNHQQLSQACHLFG
                     ESIKTYASSHADLKRQLKQIHEPNTDELPHQQDKRAQLFYAAKSLLGFSIEHIFSTYV
                     LTLQSQDSDFLQEIAMISKKGIKRQRGAPPFVQFYTHPHPSDFKKPKLLSSSSKINAD
                     EFTIGIAGEFSTDGLERAYSSYSPSNSGIVFDDLANTPTFDATFIFNNPDELVNPLTH
                     QNQCSSTSISIKNPAKRLTLLVLVDKAIDRSSNVNVGCYHGNQKVEEGKLNVSDMWTE
                     RLPDFPELSIISLQNPHNLLNKDQQMQAKLKYLLNYANLDEERFVCYLMDVEYPIWSA
                     TYRIYFEHR"
     CDS             139456..140256
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33660"
                     /product="hypothetical protein"
                     /protein_id="BBN83381.1"
                     /transl_table=11
                     /translation="MRYLLPIMTLVLPLSAFANTTTEKQWFNSAQYANEQRDNALSGY
                     KSFNQMNFASTYYFAPQQSTGVWDDYGYLDTDSKVSVNYTDSDRDNFFGVSGEAFFNN
                     WFVNAEVNDLSDEDSHSIGFGYLYNDNLKVSVKNVRNEGRSDDVWVEAAYNHQINESD
                     YLGFTARVQDSPDDWSISGRYFKKLDAGQYFTIDASHDDYAHSRGSVTRIMANYYMTE
                     NWAFGIGANDSNLELGATFFLSDTYYYKASFINADNGDVASISFHANL"
     CDS             140638..143238
                     /codon_start=1
                     /gene="eddB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003114304.1"
                     /locus_tag="PA25_33670"
                     /product="extracelullar DNA degradation protein EddB"
                     /protein_id="BBN83382.1"
                     /transl_table=11
                     /translation="MLKKTILATLISAACIPAHAELIISEYVEGSSYNKAVELYNTSG
                     QTLNLADYAVNFYFNGNTDAGRTFTLEGNLEPKATFVIAHSSANETLTAKAQLLSGGS
                     WFNGDDAVALLKTGTIIDSLGQIGVDPGYSWADDEANTKDKSLVRKGQFVVGDTNASD
                     EFLPSAQWIANAKDDFSNIGKHSDELPPEPAELVCDTNNVLISEVQGSGSASPLAGQT
                     VEIQGVVTSALQGDEQLKGFFLQEELADQDSDPNTSEGIFVYFKNTQVSNGDRVKVAG
                     KVEEKYGQTQISAVSAVKVCGTSASVSATTISLPLEAGLESVEGMLVEISNDLVVNDT
                     YGLKRYGEVRLATERLYQSTQIALPGDAANAVEAQNKQKEILLDDGSSAQNPDVIPYP
                     SPELDAYNTLRLGDTVTGVKGVLGYGYGQYRVHPTAQPNFIATNPRTEAPEVTERGDL
                     RIVSFNVLNYFNGDGQGGGYPTPRGADKSEEFERQKAKTVAAMLKLDADLFGILEMEN
                     DGFDELSALADLTAALNAQDAQNTYAFVNLGTEKVGGDAIMSAIIYRSNKVKEVGTAA
                     FTETVPFDYGNRPPVMQAFTDLQSDETFNLVVAHLRSKGSCSKAEGLDQDQNDGQGCW
                     NQTRVNAVKALTNWLATSPTGQDDPDTIILGDMNAYSQEDPIRTYVEEGYQDIKKQLH
                     QTTTDYSYVYQGRIGSLDHAFASSSMMEKVVDITDWHINADEPVALDYNMEYKSDKHL
                     TSLYADNAYRASDHDPIVIELKTKAKQEVIEGEFTNLAGWFWWQRFSIELPAGYKNLE
                     VSISGEGEADLYVRHNKKTHFFKYDCRPYLWGSEESCSIEDPQAGTWHFGVRGMFPYA
                     NVTLKYKATK"
     CDS             complement(143436..144230)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010946941.1"
                     /locus_tag="PA25_33680"
                     /product="hypothetical protein"
                     /protein_id="BBN83383.1"
                     /transl_table=11
                     /translation="MKLRIYQVDAFANDLFTGNPAAVVPLDAWLDDALLQNIAQENNL
                     SETAFFVKAEIGFELRWFTPKDEVDLCGHATLATAHVLYEHLGYEDESISFQTRSGTL
                     EVTKTAQGYSMDFPASILEEIPASLALLGGLKQLEPVQVLAAFDYVIVLQNEQQVRAL
                     KPDLDTWRKLDRRGVVVTAQGDNVDFVSRCFFPKLNVDEDPVTGSAHCELAPYWAKKL
                     GKTQLCATQISQRSGTLLCEVKNERVILIGSAVDYMQGEISYKIDS"
     CDS             complement(144720..146018)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261772.1"
                     /locus_tag="PA25_33690"
                     /product="RNA helicase"
                     /protein_id="BBN83384.1"
                     /transl_table=11
                     /translation="MNFKSFSFSPLLLQALDELNFHTLTPIQQAAIPVVRKGHDVLAT
                     AQTGTGKTGAFALPIIQKLLDDNACEQPRALIVAPTRELAEQIASNCASFCKYTDLKT
                     VALFGGVSPEGQAQLLAKGADIVVATPGRLLDQIRLGNLSLAKVTHLVLDEADRMLDM
                     GFITDMQQVISLVDENRQLLLFSATFPSAMKQFASQVLRHPKYVQVTPENTTAETVRH
                     VVYPVEQSRKTELLSELIGKKNWQQVLVFVNMKDVADELVEELNLDGIAAIVCHGDKK
                     QGARRRALREFKEGKYRVLVATEVAARGIDIEGLPRVVNFDLPYLAEDYVHRIGRTGR
                     AGNQGQAISFVSREEEQVLVHIEQLIEQQIKRYYLPGYEVSNRESLIKKLTKKPAHQR
                     RQPRSNRPSNQASGEARAKNRARIANVRKQTKGKKLGLDK"
     CDS             complement(146077..146991)
                     /codon_start=1
                     /gene="dapA_3"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:B5YKK4"
                     /locus_tag="PA25_33700"
                     /product="4-hydroxy-tetrahydrodipicolinate synthase"
                     /protein_id="BBN83385.1"
                     /transl_table=11
                     /translation="MRTIQTIKQASLITAIKTPYTMNGEIDLSMYDKLVDAQIAGGVD
                     GIIVGGTTGEGQLMNWEEHLMLIAHSVNKFSDRLIIVGNTGSNNTREAIKATEYGFAS
                     GMDAALQINPYYGRTSIEGVKTHFERVLDIGPAFIYNVPGRTGQDLTPDIIEPLAKHA
                     NFIGVKECGGNERIAHYESQGIACWSGNDDEAHDSRHRFQSHGVISVASNLIPGLFRQ
                     LMDKENVELNQKLTPLMQWLFCEPNPIAINTALIMTGAVKPVFRLPYVPLDKTQQQQG
                     IALINQLNEVDVVGGKAKPIDETLLKLC"
     CDS             147221..147874
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33710"
                     /product="hypothetical protein"
                     /protein_id="BBN83386.1"
                     /transl_table=11
                     /translation="MSLLNHLNTHFYHTEELCQALKIDTEQLFEWQQQGLFPKPSYSI
                     QNQIKCSSFLGLYECEEFTDYYPRGCAQWGLDLIKHKASSSSHAYELFYQQYIYSLSK
                     CQQQGFICQSERFSDDLSEQIQNAWQQFLCSKYGAISQNGLIEELVQIELGRAIVDEI
                     TEERTASSISPALRPQLLQAIKLLNRAFSHPAKHERNLSLRERYIDELILKYDLSIK"
     CDS             complement(147928..148716)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33720"
                     /product="hypothetical protein"
                     /protein_id="BBN83387.1"
                     /transl_table=11
                     /translation="MKLCYSILLVVLANVHTVYATQSIKTQHLTQHVTLLKSSDNSTN
                     IGMISTSQGLVLIDPMPGHKQLHGLLNTIESLNDDSGSVRHVFNTHMHLDHTGGNRFF
                     AGYGAELNKEVADIRVYRVHSHSSDDFVYFIPQSNVVFVGDVLDMSWHPTFYVGGVKG
                     FNAAIETILNIGNEQTVIVPGHGKVASKQQVKAFRQHTLDWISRVNTLYDAGTSVASI
                     SQDPQIVMLIDKFNHDKQDPFLTEKALRRFIKRTISVIKNDKKH"
     CDS             complement(148838..149101)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33730"
                     /product="hypothetical protein"
                     /protein_id="BBN83388.1"
                     /transl_table=11
                     /translation="MTEQNQQLDNSVIATLKNKDHSSLNEKLDGLACTHSDIIELLAQ
                     YQALSEQDDDEKFDNWYDELCQSQLDVLKAFEVMRAHFEQECQ"
     CDS             complement(149268..149660)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33740"
                     /product="hypothetical protein"
                     /protein_id="BBN83389.1"
                     /transl_table=11
                     /translation="MYQYLYVALLCLSSFAFSKQSSDLEVTMKNMGHAYKQAMQSESQ
                     QELLAAIDSFREHLHVSKQHQFSPELHDESQKGLSKVSSVLDESIMLVNQGHLVAAKT
                     KLKEIDELRKHYHQLHEPPSIWDLLFGN"
     CDS             149804..150862
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33750"
                     /product="hypothetical protein"
                     /protein_id="BBN83390.1"
                     /transl_table=11
                     /translation="MLQKIVTLICFLLLTLPCYAQQIKVTFVNPGFSQDNPTGNFWLN
                     VSEFMQAAADDLNVELSILYADRNHIDMKRLINKALTRKDNYIVLVDEKSAATQALLT
                     STELHDKVIFLLNKPTKQEVMRLNARGFGILGSIIPDNYQAGRLLIQELEKHVTKSKK
                     NPTINTLALLGESATDAAKLREQGLLSYSNRSYYLKLLERVSANWSEQEAYTVAKGLL
                     RRFDDTKVIWAANDAMATGAARAAQELNMRQHVIIGGINWDKDQHKKLNVSVGGHVSL
                     GALAIIKIADFDADNKNYIGDLKLPIFKSYAPKYESLYQAIHNKELDKIDFRYFSYSH
                     TTPAPKPYTLDNMTALVK"
     CDS             151062..152678
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33760"
                     /product="hypothetical protein"
                     /protein_id="BBN83391.1"
                     /transl_table=11
                     /translation="MKKSVSNSVKLSILSACVGAALSAGTAYADEGQRVIVTLKDSAI
                     NTLPLSVSKSDAANYKQQALASFAHQLNLQPMTALPSVNAVVMEVTPEKLEELKANPQ
                     VANVEADPKRFLMAESTPYGINMVQANQLADTMSGNRKVCIMDTGYTLNHPDLPSTGI
                     TGDDGYGSNDTGNWYNDGNGHGTHVAGTIAAIGGNGQGVVGVNPSGQLGLHIVKVFND
                     QGRWAYGSDLIKAIEQCESAGANVTSMSLGGSGSSTAERSAFQNSYNRGVLHIAAAGN
                     SGNSSLSYPASYDAVVSVAAVDSSENKASFSQYNSQVEIAAPGVGVNSTWNDNGYKSI
                     SGTSMATPHVSGVAALVWSHFPNCTNDEIRKVLNNTAKDKGTAGRDTSYGYGIVQAKA
                     AYDYIAQNGCGDPVGGPVASFSFSVNGTTVKFTNSSTDARSYSWQFGDGASSAEVSPS
                     HTYAAAGTYQVTLTATDGAKTNSVTKSVQIGDVTPPGCDGLAAWSASKMYKIGNEVSY
                     KNYKYEAIWWSRAAQPDVFSNVWKRVGSCN"
     CDS             complement(152714..153445)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33770"
                     /product="hypothetical protein"
                     /protein_id="BBN83392.1"
                     /transl_table=11
                     /translation="MSIMFSFLVLPIFVTFWLFSGAQLPTENYYTSATISGLIAALGS
                     VSFIRALAIGKMAIILPMLSFTPVWSAMLAWLWLNEPLSTSQALAILTITLGSFWVLG
                     GKLKATEKGVGHALLAALCWGSCIVLDKYALQYATKEFHATYITLIVFFATSLLLKII
                     VKPQVVKMRVKWWLFATVCFSGAVIFQFIAIEQLQPGLVEGLKRGVGILSALFIGFLL
                     YKETLSAKQLMAIGLIIVSTLVLVY"
     CDS             complement(153535..154479)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011106521.1"
                     /locus_tag="PA25_33780"
                     /product="phosphotransferase"
                     /protein_id="BBN83393.1"
                     /transl_table=11
                     /translation="MLYQFLSDRFSEIIDKDKHSVLWSGCGEVRKMRLDGQHAVVKYS
                     QVPKQLAHRHIEQSDFALSRKLNSYAIELKFYQDHSKCFIERCRVPKLLFATEQNKST
                     CLVLEDFTAYGYASPSDVSQKVHYAVLGWLARFHSFTLNNSGIGWHQGGYWHLATRPD
                     EWQRMQHHALKTHAQDINDLIEQCPYRCVIHGDAKLANFALNSEFDVIGYDFQYVGAG
                     VGVQDVMLYLTSVCDSSSLHESGEHLLAYYFLQLSQELRKTLSEEQTLDVVNYWQALW
                     PVVWADFHRFLTGWKPDHFKINQYMLAQTSLTLSQVRQ"
     CDS             complement(154614..156863)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005462399.1"
                     /locus_tag="PA25_33790"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BBN83394.1"
                     /transl_table=11
                     /translation="MSLRTQLKKVLPSISVTEQEALDAGDVWLEGSIYRGKPDFDALR
                     AVPEAKLTAEEQAFLDGPVKELMAMIDDSVIQNSKHLPDHILEFLKTERFFSLIIPKS
                     FGGLEFSPYANSTIVGTIATKSSAVAVTVMVPNSLGPGELLLHYGTQEQQAHYLPRLA
                     NGREIPCFALTSPEAGSDAGGIPDIGIVKKGQYNGEEVLGLEVTWDKRYITLAPIATV
                     LGLAFKVEDPDGLLGGKEHLGITCALIPKSHPGVELGNRHDPMGIRFYNGTTRGEKVF
                     IPMDFIIGGQKNIGRGWQMLVSCLGAGRGISLPALGVSTSQVALKSASEYAAVREQFG
                     LSIGQFEGIQEKLADIAGKTYLQEAMRVLTTEGLGMGLKPSVVTAIAKYHMTEIGRDV
                     LDSAMDIQAGKAIQNGPQNTLASGYVAQPIAITVEGANILTRNLMIFGQGVMRCHPYL
                     QSMVESIHSEDKGADKTFNKILRKTVGYSVANSLRAFRLGVLPFTAGSKSSLPEVQAY
                     EKAAHQLSAKLAVYADFSLLVLGGKLKQAEMLSARLGDVMSYLYAAMASIKYYEQKVA
                     VADRQAAAPYFHYATRWALQNAENALHKFLDNFPASGTRKFMRVITMHYTYRMPAIGD
                     DLVRELAKAAQMDTAFKAQLTHLIKPTAGDGHDINEQAYKAKMACLDLLAKVKKALRK
                     KEIKAGVRFAQTLDNALAANLISSQEYAQLIDYNKKREKAIRVDEFDFDLNLLDDNAQ
                     PIEKVKQAS"
     CDS             complement(157323..158159)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33800"
                     /product="hypothetical protein"
                     /protein_id="BBN83395.1"
                     /transl_table=11
                     /translation="MYENIKSKLNTLKNNKAFELSVVAVIIISALEIGAKTFPLSSGA
                     ISVTHVLDVFITLFFLFEISVRFIADEDKKRFFKKGWNIFDTLVVVISLIPVNDSEMA
                     LLARLVRVFRVLRMVSVVPELRVLINSLIKAMPQLGYVILLMFIIFYIYAAIGSFVFK
                     DINPKLWGDIAISMLTLFRIMTFEDWTDIQYETMEVYPMSWVFYLTFIFFTAFAFLNM
                     VIGIVVNVMEDERSKMKKAKEDAKNVPTIEDLHSEIQQLKALIVQQQQSIKQTADKES
                     TN"
     CDS             158578..159426
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011106282.1"
                     /locus_tag="PA25_33810"
                     /product="AraC family transcriptional regulator"
                     /protein_id="BBN83396.1"
                     /transl_table=11
                     /translation="MQALINSINSITSKDVDLPFSVYCAFHEQRLLDVPITKPTLIIV
                     MNGSKLLGKQGNIRCNAGEFVFLSDSPKLDMRNIPNDDIYQALLIEFDANDFSIFERL
                     QIETEQQNIIPKHYSASVSEELLACITQFVDSVPWANGDIIKHRKQEILLLLHALGFE
                     HIPLMAHNVSLSNQIFGMLKNNDFQALRLDQLCGLLAISESTLRRKLQAEDMTLQQIK
                     DKARLGHGLHLLQTTSKPIGDVASLSGYTSQSRFTQKFKNHFGMTPSELRSTKLKDMG
                     ENLTAF"
     CDS             159488..160039
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000647512.1"
                     /locus_tag="PA25_33820"
                     /product="kinase inhibitor"
                     /protein_id="BBN83397.1"
                     /transl_table=11
                     /translation="MKIIANHLLAISMIAPFTSLALTLTSQDIAPGEFMSKKHEFKGF
                     GCNGDNLSPHLAWQDVPKGTKSFAITAYDPDAPTGSGWWHWQVVDIPVSINELKTGLG
                     INAQSKLPDGAKQISNDYGVESFGGACPPKGHGVHRYQFTIHALSVEKLSLPKSPSSA
                     LVGYMINANSLRSATVEALYQRD"
     CDS             complement(160486..161460)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071997.1"
                     /locus_tag="PA25_33830"
                     /product="transposase"
                     /protein_id="BBN83398.1"
                     /transl_table=11
                     /translation="MATARKRQVSLVDTKYYHCISRCVRRAFLCGDDTITGKSYEHRR
                     QWVEDKLLALAKVFCIDVCAYAVMSNHTHIVLYVDDKKAKRLSDKAILIRWHKLFKGT
                     LLTQKYLQGDKLDKAQQFFLNRTIADYRERLADISWFMRVLNEDIARKANKEDNCTGR
                     FWEGRFKSQALLDEAAVAACMAYVDLNPIRAKMAKTPEESEHTSVHKRIKAAKDAKQP
                     KQLARFAGSPRKHMPKGLPFELKSYLELVELTGRCMREDKRGYIEQRTLPILERLNIA
                     PENWLKLTTQFTKVFKGAVGRPNKLDGYYTHLEIKRRTGISHCEQLFG"
     CDS             complement(161477..161737)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33840"
                     /product="hypothetical protein"
                     /protein_id="BBN83399.1"
                     /transl_table=11
                     /translation="MATARKRQVSLVDTKYYHCISRCVRRAFLCGDDTITGKSYEHRR
                     QWVEDKLLALAKVFCIDVCRTKQDTYFYLFVFHSSPIFYLSD"
     CDS             complement(162425..162955)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33850"
                     /product="hypothetical protein"
                     /protein_id="BBN83400.1"
                     /transl_table=11
                     /translation="MHKAIFIFIFISTSTVAKQEIKEVTLLTKLECKQGKVFATIINK
                     SQKKVDIPYGLLGVKNSFGWGSIQVFEKSKFDELMEKPSPLKMKEISLSPIKGGDESK
                     EITLGAFEKLSYPLNLKSGFRVDGSEKYIAVLIIVLGEVVLDDSIKGYITSVSNPVTF
                     SLAGMCEEMPRIKDDR"
     CDS             complement(162959..163936)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33860"
                     /product="hypothetical protein"
                     /protein_id="BBN83401.1"
                     /transl_table=11
                     /translation="MNGRVYDYNLGRFMSVDPVIQSPGNSQSINPYSYIMNNPLAGVD
                     PSGYEAEKKETVEVAADAEVQQDTDGNYYVSAGDGSGELIQIDSVKGTTSNGSSRTVN
                     LGAGGKVESVEIVDIGSQGLITQVNNSYKSGVGGVSDPKVRENLTDEQWMKTKREIEN
                     NKWMILGVIAALSDPSSEEYKGIASDYGYHVGIDDFSEAAEYLLQNYRQALSILEKLE
                     RKDFYYYPASGNYGEYTQRIGLSRMFYKISQHKYVSSTITHEISHGIGFKHEKGKNTT
                     FGREKGDLIHLALIGRTAASALARLDARKQLLTNAFQFERTALKFDHRK"
     CDS             complement(163955..164413)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3CI26"
                     /locus_tag="PA25_33870"
                     /product="Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase"
                     /protein_id="BBN83402.1"
                     /transl_table=11
                     /translation="MTPAIKLLEKNKIIFEILKFEHDANSPSFAAEAAEKLNLNAAQV
                     FKTLLVDVDGELNVAILPATRQVDLKAFAKVCKGKKAILADAKKAQNTTGYLIGGISP
                     FAQKKRLNTLLHSDAQQFERIYVSAGKRGLEVAVAPSDCISLCNAAFAHF"
     CDS             complement(164799..165932)
                     /codon_start=1
                     /gene="dnaJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3FRG5"
                     /locus_tag="PA25_33880"
                     /product="chaperone protein DnaJ"
                     /protein_id="BBN83403.1"
                     /transl_table=11
                     /translation="MSKRDYYEVLGVSKDASERDIKKAYKRLAMKYHPDRTAGNPELE
                     TKFKEVKEAYEVLTDSQKRQMYDQYGHAAFDQNGGGHGGFGGGQGDFGDIFGDVFGDI
                     FGGGGRRQSRQQRGADLRYNMDLTLEEAVRGKDVEIKVPTWVSCSPCDGSGAKAGSKP
                     KTCTTCHGAGQVQMRQGFFAVQQTCPTCQGTGSIISDPCNKCHGQGRVEKTKTLSVKI
                     PAGVDTGDRIRLSGEGEAGMHGAPAGDLYVQVAVREHPIFTRDGNNLYCEVPISFSTA
                     ALGGEIEVPTLDGRANLKIPAESQTGKMFRMRGKGVKSVRSGAVGDLICKVVLETPVN
                     LNERQKELLKEFEESMGGDNSKNRPKAQGFFDGVKKFFDDLTK"
     CDS             complement(166062..167987)
                     /codon_start=1
                     /gene="dnaK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3FQT1"
                     /locus_tag="PA25_33890"
                     /product="chaperone protein DnaK"
                     /protein_id="BBN83404.1"
                     /transl_table=11
                     /translation="MGKIIGIDLGTTNSCVAVLDGDKARVIENAEGDRTTPSIIAYTA
                     EGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFEDEEVQRDIGIMPFQIVKADNGDAW
                     VEVRGEKRAAPQISAEVLKKMKKTAEDFLGEEVTEAVITVPAYFNDSQRQATKDAGRI
                     AGLEVKRIINEPTAAALAYGMDKKQGDNVVAVYDLGGGTFDISIIEIDEVDGEHTFEV
                     LATNGDTHLGGEDFDNRVINYLVAEFKKDQGIDLKTDPLAMQRVKEAAEKAKIELSSA
                     QQTEVNLPYVTADATGPKHMNVKLTRAKLESLVEDLVTKSIEPLKQALADADLSVGDV
                     NDIILVGGQTRMPLVQKTVAEFFGKEPRKDVNPDEAVAVGAAVQGGVLAGDVKDVLLL
                     DVCPLSLGIETMGQVMTALIEKNTTIPTKKSQTFSTAEDNQSAVTIHVLQGERKRSSD
                     NKSLGQFNLEGIRPAQRGVPQIEVTFDVDADGILHVSAKDKDTGKEQKITIQASSGLS
                     DDEVEKMVRDAEANAEEDKKFEELVSSRNQADAMVHGTRKQVEEAGDALPAEDKEAIE
                     AALTELETAIKGDNKEEIDAKVQALAEKSQKLMEIAQAKAQAGQAGPDAGAQQSSAKQ
                     DDDVVDAEFEEVKDDNK"
     CDS             168206..169006
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003090970.1"
                     /locus_tag="PA25_33900"
                     /product="hypothetical protein"
                     /protein_id="BBN83405.1"
                     /transl_table=11
                     /translation="MTFDQLINNPALANNDSMFSFPENWCQGRTAFGGLSAAFMLKSM
                     FYRLTDDRRLLSLSTNFVGPLLADEPFQISTQVLRSGKNATQMLSTLTQADKVCLIAQ
                     GCFAKDRNSSITVPSADKCTLEPVQPKHVLPYQEGLMPAFFQHVALNAQQGALPFSNA
                     KSSNLGGWMKFKAEPEHQLNALHLLALADAWPPTLLQMCSAPSPASSMSWYIEFLSDI
                     KLPKDAWLGFEALTHHSAKGYGVEDANIYGPDRQLLALSRQTVAVFDS"
     CDS             169087..170295
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001890363.1"
                     /locus_tag="PA25_33910"
                     /product="paraquat-inducible protein A"
                     /protein_id="BBN83406.1"
                     /transl_table=11
                     /translation="MILACKHCDRLINVGHIGQQQRARCPVCHSHLLSCKNNQQQWLS
                     AFSIASLLFLFSSLYSPFISFAQKGLSQQITLWDAALLLSEKYSTALAVVFVFTILVM
                     PLFMCFLVLLTNSPLWSKLNPHNARWIAKTLSYIMPLNLADIFLVAVLVSTFKLMSYA
                     ELSLGYGFWAYVLFVFCFIELLTLIDANELWQRQQKQFEPKPLLCGQSALSQSLKQCN
                     VCGQLTAHEHCPRCYAKTHFRKPQASARAFAWMLTSLVLMVPANLLPIMNTINLGQDT
                     FATVFSGIVIMWQSGSYPIAAIIFVASICIPLFKALALFYLLYEAKMCNNPKRASQLY
                     RWLEWMGKWSMIDVFVVIVLVSLVQLGSVLTVEPQIGIVFFAVMVLCQMMAVHSFDPR
                     ILWDKLKANE"
     CDS             170288..171943
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005457973.1"
                     /locus_tag="PA25_33920"
                     /product="paraquat-inducible protein B"
                     /protein_id="BBN83407.1"
                     /transl_table=11
                     /translation="MNEHAYIESKPKFSVIWFIPIIALFVTAWMLYQHQLNQGQTIFV
                     KMTTADGIVAGKTEVRVRSVKVGVVQSLRLQLDQNAVIAKVQIDNMYTSLLSADAKIW
                     VVKPRIDESGISGMNTLLSGVYLELEPGSSNVKSSLFTLQDEPALIASDIKGKRYRLK
                     SRHAEVLDVGTSIYFRNFKIGQIESTNFNTDNLAMEYGVFVFSPYDKLITDNVIFWVS
                     SGVSVNLSTEGIQVSTGSLSKLIKGGISVDYPPNQEPSAEATQNSQFTLHENFSVALE
                     QRFDDYDFYLIEFEQSIRGLSPGAPVEYRGMRIGTVEQAPAQLQRDGQPLYFQQGSTS
                     LPVLIRIEYGRLFEKSQLAREYWQKNIEQWIRNGLRASLKSGNMLTGAVYIELDFYPE
                     SPQASVTTASLYPTLPSVSSGFTALSEQVTKLLNKLNDLPLNNTLTQLDGTLQQYRQM
                     AMEMNQLVSTFNQNGTANKVNDNLDNISTTLTQLTSSLKQFEKTLTHYQQDSTMVEQL
                     TDTLEELESLSNTLKPFAKSLNEQPNMLIFNKNNVEDPEPRKK"
     CDS             171944..172540
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33930"
                     /product="hypothetical protein"
                     /protein_id="BBN83408.1"
                     /transl_table=11
                     /translation="MRVILASLVLAFATGCSHSVTNPNAYFSFAAATGVNSDTDVAAQ
                     KRTLKIHSIKLSGIADQQAIVQIQPDNQVSVAQHHFWAEHPNDMLSKKLHNLLSNKLD
                     LWQVVSANVPTSGYNTIYLMVEVTEFAGHYEAGTLLSGSWYLYEKNNTSDQLLAYQNF
                     TLSEPLTKDGFPALVRALETSWMQVAKQIAKQLHALEN"
     CDS             complement(172548..173051)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072653.1"
                     /locus_tag="PA25_33940"
                     /product="N-acetyltransferase GCN5"
                     /protein_id="BBN83409.1"
                     /transl_table=11
                     /translation="MIIINTERLVIRKATLSDDAFILKLLNQKSFIDNIADKKVYTLA
                     DAQNYIQGAFLDPYMQGLKAPFIVTLQDGTAIGVAGFYQRPVFKEPDLGYAFLDEFTG
                     KGYASEAANALLKFAKDNLQLDTVLAITSLTNEASIKLLRFCGFDFKQTIELEPAVVS
                     NLYEIHF"
     CDS             complement(173109..175952)
                     /codon_start=1
                     /gene="ptr"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011816978.1"
                     /locus_tag="PA25_33950"
                     /product="protease III"
                     /protein_id="BBN83410.1"
                     /transl_table=11
                     /translation="MITGCSTHSLGTVNSQSPSLLSEQLVVSPNDTRQYQTLTLENGI
                     DVILVSDPSVEKSAAALSVGVGLLHDPMTQQGMAHYLEHMLFLGTERFPDTNGYSDFM
                     TQNGGAHNAYTWLDITNYMFKVNSNAYDEALDRFSDFFKAPKLYPEYTEKEKNAVNAE
                     WSMRRELDFFGQFKLARNLMGEHPANRFLPGNLETLGDKEGSKLHSETVDFYNRYYSA
                     NIMKVVMLANEPLPEMAKKAKKHFSTIKNKQIEKPKVSAKLDFSQIGRKRVHYVPNED
                     VKQLKLDFTIENNRDQFAVKPNYFVTYLLSNEMAGSPAQVLKQEGLISELTASADAGI
                     YGNYGALSVDINLTDKGMENRELVVATIMQYIDLIKRKGIDSKYFDEIRTSLNNQFQF
                     LEKSDEFGYVSNLADSMQKYPINHAINAGFHYAKFDPKEVSSVLEQLDAEHLRVWYIS
                     KEEPFEKQLHFYDGKYKVADISQDEIDSWKAPSKLALQLPSVNRLLPEQFAIKTTPEQ
                     GQIGVQKVFEEQGITVWHTPSALFAHQPKGSLNIYINSPEPMSNIKADVALAIWTDLY
                     AMAQSKLATEAAVAGMSMSLSPSNGLVMNISGFTDKQSRLLSQAMDELKVEVSQEEFA
                     QAIDRYRRELQNEGKQFPINQVFGQYHRLIRAGSFDTQALLDAANNLTLEQFDKIQTQ
                     LLKNNQVRIFGYGNYDKASLVDVANVVKKALPKSQQITDYVKTPYWQPKKGETLVWQQ
                     DIDVADVGLIDMVVHPEAGFKQKAAARVLVSHLRTHIFDTLRTEEQLGYAVGATAQSI
                     DDYSALGFYIQTPVKDVASMQARFDQYKTQYAKALEDLDHNTFMQLKNAQLVSLKEAP
                     KNLGEELSPLLSDWYRENYQYDSKEKLIKAVEQVTLADVKSYYKQTMLNPEAPRLNIQ
                     LRGKKFQQKPFAQLPKQTKLASIEDLYKRISLQ"
     CDS             176109..176534
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532284.1"
                     /locus_tag="PA25_33960"
                     /product="membrane protein"
                     /protein_id="BBN83411.1"
                     /transl_table=11
                     /translation="MFSSPDKIVIISMLLQVFLTFSVMIVMGRRRFAAAREGSLQIHD
                     FKTMQLNHAPEQVLLASRNFENQFEIPVLFYVVCLLAMHLNTTSWFFAICALLFVLSR
                     VAHSVVHLTYNKVRARFRLFLLGCTFIVIQWLALAVTLI"
     CDS             176635..176820
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33970"
                     /product="hypothetical protein"
                     /protein_id="BBN83412.1"
                     /transl_table=11
                     /translation="MNNEMPICDFGLHAGEPYTKLPASFLNWMVEINHDKSSLAKQEL
                     SRREDAVMAACSGTKNS"
     CDS             176893..178473
                     /codon_start=1
                     /gene="ushA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261476.1"
                     /locus_tag="PA25_33980"
                     /product="bifunctional metallophosphatase/5'-nucleotidase"
                     /protein_id="BBN83413.1"
                     /transl_table=11
                     /translation="MRIIFTVLLCTFLSSCQLTSSEPTQYLTVLHTNDNHGRFWHNED
                     GEYGMAARKTLIDKLRSQAQQQGHAVLLLSGGDINTGIPESDLQFAEPDFKGMSLLGY
                     DAMAIGNHEFDNPLDVLDKQQNWSNFPLLSANILHAKDNSHAYQPYTIINKQGLSIAV
                     VGLTTTDTAKIANPEYLGDLIFVEPSKILTSVVKSIRANHAVDAVIAVTHMGHFHNAE
                     HGINAPGDVTLARNLAPNTIDMIIGGHSQEPVCVTERGQADKDFAPGKSCIPDQQNGI
                     WIMQAHEWGKYVGKAEFKIKDGKKSLISYELIPVNLKDDKGQYINGYIEPDQKLEAFL
                     QPYQTFGEQKLKGSVGYVDNYLDGKRSTVRFTQSKLAALIIKAQMAAVNADFGLISGG
                     GIRHSIKAGDVSYKDILKVHPFKNRITVMQWKGNELLDYLNTVTRFPPDSGAYMQYYG
                     LSFDLVNGQLTNVMINGEALDINAQYRMSINSYNAAGGDGYPNITQLAGFKSTSITDA
                     QVLKDYLEKHSPINVGLL"
     CDS             complement(178542..179474)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_33990"
                     /product="hypothetical protein"
                     /protein_id="BBN83414.1"
                     /transl_table=11
                     /translation="MIMKVKHHKVTSFVLLVVTFTLLFSFSQSYVIERDAKSDLSKLA
                     TRIALDLEMLPIAEPLFNYSGDQQKVSLYIQEINRVLSAHNSRIVLDDIRSVEPSPKP
                     DHNHVYILESAHKKVVIKYLVNKQHLWISYIAPLIFAYLVWLLYLRSHLKARQNLVKS
                     VTNIESERAKLVLDLNTKCIYLSSDPQQHVQLANKPLCFYIALVEFCDSNADTILNPN
                     KDVPEALVSIANRYFERLTVLGHTVRKKPNFSNSLEKTLSEIRAALDDVFNEHPELKS
                     KYYPPKAYGEGSRSKLHSYGLSNISFSDVDVKGK"
     CDS             complement(179458..180357)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34000"
                     /product="hypothetical protein"
                     /protein_id="BBN83415.1"
                     /transl_table=11
                     /translation="MNKTSILNNKCTFFVVLLLLLLANWFVPYLLVNSELNKLSPVSS
                     YSYTCKIASSSSLAVFRVHVPVQSLAEKVHHSLCQDSVLAKQYGSVETYWGGSLAEQI
                     EFLAKGIADIILSKDNVMEAMMAESTQNYMPLIGYPSYTAFFISAREKPRLEKAYFLD
                     KTIGLVDYPTSRSAHILPKQVFKQLDIDLSALNIVYAGSHSALRELLSKGEVDIIASY
                     WQEQDQQKFSENYITPIADNVSGSKWYIKMADENTDLACALQSSISAVVNNVQSSYFD
                     KLQHYWQCNIAPYGFVEGYDNEG"
     CDS             180578..181438
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011038304.1"
                     /locus_tag="PA25_34010"
                     /product="endonuclease"
                     /protein_id="BBN83416.1"
                     /transl_table=11
                     /translation="MLTTKISSLALAAALLTSSQALAWGQNGHRIVGELASLHLTPTT
                     QNALLPLLEGDSLAEVSTWADEMRSDNSTFWRKKSSKWHYINVTDAENMHKHVHHDVS
                     SKEQVKNVLDGMYYGINVLKSDKSSLNEKRFALRFLVHLVGDSHQPFHAGRADDHGGN
                     KISVTFFGDKTNLHSTWDTRLIENERLSYTEFTNFIKTSNSAIIEDYLNSEPADWLLE
                     SHHIAENIYNLNETDISYGYIYKYMPTVKTRLQQGGIRLAGLLNQIFDKNAQPLKEAL
                     KTSNTATLNN"
     CDS             181467..184565
                     /codon_start=1
                     /gene="oar_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011037631.1"
                     /locus_tag="PA25_34020"
                     /product="Oar protein"
                     /protein_id="BBN83417.1"
                     /transl_table=11
                     /translation="MKTLLRKTSLSLAIAASLAASGAAFANDTASSLKGQVVGPMGNP
                     AAGTKVTIIHTPSGSVKTAVVNESGVFSAKGLRVGGPYQIIVDSDKFEDTMLEDIYLS
                     LGKTFPVSVQLKSQQTMEQIVVTGRPVTAQTGGTGPATHFSLADLQSKPAINRDIKDI
                     VRTDPRIYVDESNSGAIQCAGGNPRFNSLTVDGMRMNDNFGLNSNGYPTERMPFSFDS
                     IAQVAVELAPFDVQYGGFTSCNINAVTKSGTNELTGGVFFDYTNDSLSGDEIDGQKQN
                     IGNYTEKRYGFNFGMPLVEDTLFLFTSYEKLEGSEIFEYTPFANGKISQAQINEIITI
                     TKDVYGYDAGSMIPSMPVEDEKLLVKLDWNINNDHRASFVYNYNDGFSLSQSDSGSDR
                     LSLSNHFYERGAEFTSFVTSIYSDWSDVFTTEVRVGYSELDNRQISLDRASGFGEFQV
                     RVNDVNVYLGPDDSRQANKLKYDNLSLKFAGTYYLDDHELYFGYEREELDVFNMFVQH
                     NEGEHRFGSIEDYRNGVARVYYGNASSHNPQDAAGEFKYALNTLYFQDKFDLIDYDIT
                     VTAGLRYDWYTSDDVPAFNPNFKERFGFSNQQNLDGVDLLQPRLGINWVLNDQLELRG
                     GIGLYSGGNPNVWISNSYSNDGVRNIQDSERNVQLLGPDAVAFVDGGKPGYAIPQSLY
                     DSISTGSVDDSTNVTDPNFEIPSEWKFSLGATYVTESDYVFTADYLYTDKQDSAVIRN
                     LALQTNETAPDRRPIYNDSIHSRESDLMLTNVQGDDGYSHVLSFGMNKSFDNGVDLAL
                     SYAYSVTKDVHPMDSSVAFSNFHRIATYDPQNPGRSRSDYEVPHRVTMNLSYNTELFD
                     GLDTKFSLFGQASVTNPYSYTFEGQRSSMFGYADDNRDLLYVPDVDAANVVYGDDFDK
                     TAFDAWVEREGLKRGHIQGRNSQDGEWWVTFDLKVEQEFGGFAEGHKGSAFFVIKNVG
                     NLLNDDWGTLNKGNSMQNAVTASINDNGQYVFEKFNNPSGTDFEIKPSLYEIRFGVKY
                     NF"
     CDS             184766..187972
                     /codon_start=1
                     /gene="oar_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011037631.1"
                     /locus_tag="PA25_34030"
                     /product="Oar protein"
                     /protein_id="BBN83418.1"
                     /transl_table=11
                     /translation="MRNVRLTKVAGALALALGVSASAFAADTSSAMRGKITTPTGDAA
                     ANVKVTVIHEPTGTISTFMTNESGAFIAKGLRVGGPYRVVLDSDKYSDAQLNDIFLEL
                     GDTHRIVNQLEPLQQVEKIEVTGYKIVQQAGGSNSVFGAETIENAPSFNNDIKDVARI
                     NPLASINGDGELTIAGNNPRSNSLTVDGIGQNDDFGLSKQGYPTLQPPVALDAIEQIS
                     VDASPFSAKKGNFGGGTINAVTKSGSNEYTFTGFYEHSSPSLGGKIDDITQNFDGRDA
                     VLDSDGHRTFSTKSVETEVTEKRLGFSTGGAIIKDELFYFVNYNAWEKEKELGYGFAG
                     SGAEKEFVASQADYNTFINTLNNVYGLQDSLSGDPEDKSDSILVKLSWNINDAHRADF
                     TYQWQNEEETRDYQDEVATVQMNSSLFTLTTKFNNFATKIYSDWSDDFTTEFGLAYKD
                     VSNSSVTNSDLGSIEVHLKDGRGPGFQFGATEFRHNNVGETETLELTFDATYLLGDHE
                     IGFGVQYKDLRLYNLFAENSRGSWTFASLEDFANKKLHINRDNYQFTYGNAYTSNAND
                     MAYDSTRNQFALYVEDKFYPTDDLEVTAGLRYERLSSSDEAKLNQNFLNAYGYSNQEN
                     LDGLDIILPRVGFKYYATESLTINGGIGRFQGGIPNVWYNAPFQNDGITYVTASQNAI
                     NDYFAGVEEVDITRVPDEIKQSLVQGAGSTNYTDPNFELPSSVRAQVGFEYEFDSALL
                     GDGFKWTAELAYHKKENEAVWRNTAMRPVGTSATGRTIYESIYEGDLKDNFDIMMTNS
                     KEDGRSVIFSTSLAKEFDNGLYVSASYTHQDVEDVNPGSSSRAQSNYQYATVHSRNVD
                     LVGRGHYEVEHNFKVSMSYKTEFFDGYATKFNVFFERRSGRPFSYTMGLFNDGDLGDT
                     RDFNRGSAYLAYIPTGADDVNVDWAKSKLSWAELETLLNRAGISERGQLLGRNTGTQP
                     WVTTMDVSFKQELPGFSEGHKGEFYVMVENFANLLNSDWGIEKKLRFSDQAIYDFGGL
                     ENGKLVIDPRYNGADVRNYTEITEASAWRAKIGIRYTF"
     CDS             complement(188027..188470)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532319.1"
                     /locus_tag="PA25_34040"
                     /product="MarR family transcriptional regulator"
                     /protein_id="BBN83419.1"
                     /transl_table=11
                     /translation="MNKVSLKIEEFLPYRLVKLANKVSTAFSSVYFEEAELTVPQWRA
                     IAHLAQQETCSAKRLCDLAQIDKSTMSRAVKQLTDKQLIELCADPNDKRAKLLSLTKD
                     GEALYAQLSPKALKWEQELLVELSNEERVLLKSVMDKIELQVDKL"
     CDS             188589..189884
                     /codon_start=1
                     /gene="hmgA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8PDA2"
                     /locus_tag="PA25_34050"
                     /product="homogentisate 1,2-dioxygenase"
                     /protein_id="BBN83420.1"
                     /transl_table=11
                     /translation="MSNDFQYLTGFGNEFETEALPGALPIGQFSPQKVKYDLYAEQYN
                     TTAFTAPRADNRRNWFYRIRPSVVQGDYQAMDNGLLRTAPITEVPTPPTMLRWNPIEV
                     PAEKTDFIDGLVTMAANGSANGQAGIGIHVYVANASMEGRYFYNADGEFLFVPQQGEL
                     VLHTECGKLALRPGEIAVIPRGIKFSVELLSEQVRGYICENYGHPLILPERGPVGANG
                     YTNERDFQYPVAAFEDKEGDFELVAKFNGNLFRCDIGHSPLDVVAWTGNSAPYKYDLA
                     RFNVMNTVSFDHPDPSIFTVLTSPSGTAGVANVDFVIFPPRWMVAEDTFRPPYYHRNI
                     MSEFMGLIEGVYDAKEHGFVPGGMSLHNCMSPHGPEADVFEKASNAELEPQRYENTLA
                     FMFESRYVISPTKYALEGKERQQNYLDCWKGIKKYYKGA"
     CDS             189951..190577
                     /codon_start=1
                     /gene="hmgA_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014207986.1"
                     /locus_tag="PA25_34060"
                     /product="maleylacetoacetate isomerase"
                     /protein_id="BBN83421.1"
                     /transl_table=11
                     /translation="MKLYTYFRSSAAYRVRIALNLKNIDHELVAVNLLKSEQQSEAYT
                     SKNPQGLLPALETEQGVLAQSLAILEWLEETHTDTPLLPNDPWQKAQVRNFCYAIACD
                     IHPIDNLRVLKYLSQELNVDDEQKSTWYRHWVIEGFKKLEPMLGDSKFCFGDTPTLAD
                     VCLVPQVFNALRFKVDMAPFPKIAAIYERCNQLSAFSDAAPENQPDAQ"
     CDS             complement(190580..190810)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005462432.1"
                     /locus_tag="PA25_34070"
                     /product="DNA-binding protein"
                     /protein_id="BBN83422.1"
                     /transl_table=11
                     /translation="MAFDQNMMAELTLLAKFPRTSMHQGIKIHSDAEQSLIDAAQRLY
                     DKGIIDSPDGGYLTDLGLDLISHLDQVHCALQ"
     CDS             190907..191197
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34080"
                     /product="hypothetical protein"
                     /protein_id="BBN83423.1"
                     /transl_table=11
                     /translation="MKSPVYITLSVLLITATYSFAVDSNHEKVTLLETPQRVCWYQGE
                     QYSEGALIKQFDLLFICSHKYSNQPQSQLVWLKANKEGQPIRLDPTKTIRVN"
     CDS             191223..191468
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005396617.1"
                     /locus_tag="PA25_34090"
                     /product="hypothetical protein"
                     /protein_id="BBN83424.1"
                     /transl_table=11
                     /translation="MTQQQPNNPLHGVKLEDIIIKLEQELGWQAMGEAINIRCFTHDP
                     SVKSSLKFLRKTPWAREKVEQLYLDTFHGFVWPSIKK"
     CDS             complement(191485..192183)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34100"
                     /product="hypothetical protein"
                     /protein_id="BBN83425.1"
                     /transl_table=11
                     /translation="MRLWLLVLSFVCFASNANTLNVMTEDFPDFQYTNHEGVLVGSAA
                     EKIKAVLNKAEVDYTFSVNQWSVSYNAAQRNPNSCIFSIARSDSREKLFDWLFPISGF
                     TTSFYGLRSKKYNIEKLDDALQYKTAVIRQNFSHLYLKERGFEEDRHLIMISSFDNVF
                     ELLATRKGFVDLVILSDVQFEHKRTTERKTSLLEKKYTLKNFGAQLYFACNKALAPRT
                     KEKIVEAYKALYQK"
     CDS             complement(192317..193429)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34110"
                     /product="hypothetical protein"
                     /protein_id="BBN83426.1"
                     /transl_table=11
                     /translation="MASTKQQFIQKLEHCLCPPGDGVFTVNTAKERKDALRTKLYGQT
                     EGVDALWKASLENLEQSEYKAAILGISSDCGGGILRGANWGPLFLRSTLIEQQPQVSA
                     FDLGDVRVIPHLLHDKYLNEATISNCQKALYHNENSEYYVSPLSITEDVCDGFYQQHP
                     DKGIFGIGGDHSISYPLTKSYLKAKRDSGKRTAIIHFDAHTDLLVERLGIDLCFGSWC
                     THILEFLPAPHHLIQFGIRSSGKDKAHWESTFGVKQHWAHEIREQGAQTIAQQVIAQL
                     KSDNVDELYVSFDIDALDEEFASATGTPEGNGMTPDEALTILNALRAEFPITGADMME
                     IAPFTDSSLVGQTSSETTLREGAKISAFLIDAINNS"
     CDS             complement(193740..194519)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005461722.1"
                     /locus_tag="PA25_34120"
                     /product="cytochrome b6"
                     /protein_id="BBN83427.1"
                     /transl_table=11
                     /translation="MPASPPIDKNTEFARCFESNKIGTFAAFHWLALAFKDMTRAPIL
                     SLVYGLVFTIIPATIMWLVYQSGTHLVILPAAVAFALIGPAFAAGLYDVAWELEKGHT
                     PTFRHSLKSMFRNPAGEWGFAILLMVIMIIWMRLAALIHALYPNVTDPTFEQLSAFLT
                     LGTLVGGVLMAAVFAISAFTPQIMMERRVDIMTAVISSMHAVKTNVSAMVVWCALIVL
                     LVLLGFLTGTAGFIIIMPLLSYASWHGYIAIIKTKKPRGYE"
     CDS             194673..195428
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3ENJ9"
                     /locus_tag="PA25_34130"
                     /product="uridine phosphorylase"
                     /protein_id="BBN83428.1"
                     /transl_table=11
                     /translation="MDKVFHLGLDKQALNGATLAIVPGDPERAKRIAHKLNDPICLAQ
                     TREFHVYRATLNNHSVVICSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINE
                     GDVLVSTASVRLDGASQHFAPLSYPAVSDFHCTQAMVNACEQLDIPHHIGITASSDTF
                     YPGQERYDTYSGYVNKAFQGSCEEWQKLNVMNYEMESATLFTMCAALGLKAACVAGVL
                     VNRTRQEIPTVDHAKVEHDSVAVVIKAAELLLK"
     CDS             complement(195484..196362)
                     /codon_start=1
                     /gene="cdd"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87Q52"
                     /locus_tag="PA25_34140"
                     /product="cytidine deaminase"
                     /protein_id="BBN83429.1"
                     /transl_table=11
                     /translation="MFPIMAVFNPQQLKQLQRQAKHTRGYFSKEQLSDLQQQLDCDMD
                     ALLKALLPVAATFSVAPISHFNVGAVAYDKISGNAYLGANLEFSHQALCLVVHAEQSA
                     INNAWLNGAKEVSAMAITDAPCGHCRQFMNELSTAKQLKIMLPSLNTHLHELLPSAFG
                     PQELGNSARLLDSSALAITDLSSEISEQLKSHLQRAYAPYSKNLSAVEICTASHGNFY
                     GRYAENAAYNPSLSPMQSALSQLALAGLTVEQAGICEVTLVQSDGLENQTAVAEAVLA
                     SYNADIKPNYITAKLN"
     CDS             complement(196396..196764)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34150"
                     /product="hypothetical protein"
                     /protein_id="BBN83430.1"
                     /transl_table=11
                     /translation="MSTLSTSITYDDTTSLILMTLRGCVSADDVVSVYRIANDYAKAH
                     NSSKILIDLSEVEHRFAAIDIVDFMPKVAHYLRDFTVARVVGFEGYMHDLILQKAKRY
                     NVNAENFECFKSAKQWLCNL"
     CDS             complement(196990..199623)
                     /codon_start=1
                     /gene="ppc"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KFU8"
                     /locus_tag="PA25_34160"
                     /product="phosphoenolpyruvate carboxylase"
                     /protein_id="BBN83431.1"
                     /transl_table=11
                     /translation="MTEQYQTLRTNVSMLGELLGKTIKQAQGQKVLDKVEQIRKLSKS
                     SRNGNEQDRALLIDTLHGLTDEELLPVARAFNHFLNLANVAEQFHTISKQGAPDGMLS
                     TLKSTLTQLKANVDDGSLNLNQVAQVIANLKMDLVLTAHPTEVTRRTIISKHVELSEC
                     LEALELHVLDDHHQAYLLDRIEQLICQAWHTNDIRGKRPTPLDEAKWGFAVIENSLWH
                     AVPEFIRQFHSYSEEILALKLPEDFSPVAFTSWMGGDRDGNPFVTAQITQTVLDHGRW
                     MALDLYYRDLDKLGAELSMHCASDELKEYVSEQSEPYRYLLKLLKAQVSETIFALEHK
                     IKNEPTKKQDKITQVSQLKAPLELIYRSLCNVNMHVIANGLLLDVIRRLNCFGINLCK
                     LDIRQDSARHTEVFSELTGYLGLGKYADWSEQDKQAFLLAELNSRRPLIPKHWQPSSN
                     VQEVLDTFAVIANQDEHALGIYIISMAQNASDVLAVELLLQESGCKFKLPVAPLFETL
                     DDLNRSAQVMTELFAQSWYRQHINRKQFVMIGYSDSAKDAGMMAAGWAQYSAMEKLVD
                     ICEQQDIELILFHGRGGTIGRGGAPAAQALRSQPPGSLKNGLRVTEQGEMIRFKFGLP
                     KVAIQSLAIYSGAIIESNLLPPPQPEASWQEVMELISSASCEHYRSIVRENPQFVPYF
                     RMATPEVELAKLPLGSRPAKRNPNGGVESLRAIPWIFAWSQNRLMLPAWLGALQGLSA
                     AVETYSEQTLKEMSERWPFFRTRLEMLEMVFCKADSWLSEHYEKGLVDDDYKPLGKKL
                     RDELSQARDLVQRLAPDSTLLSAQPWIKESIALRNPYTDPLNVLQVELLNRARSGHSD
                     DIDNALMITMTGIAAGMRNTG"
     CDS             199789..200127
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071074.1"
                     /locus_tag="PA25_34170"
                     /product="thiol-disulfide oxidoreductase"
                     /protein_id="BBN83432.1"
                     /transl_table=11
                     /translation="MKSLQSYDQQGCITLVDLHDERFPEQYPDIDRNQALKVLHLQDC
                     EGTVWFGLDATYQAWKAVGKHRWLKVLRIVPIRWAADWCYLFFAKHRIAISKVLMPNQ
                     CARSGCNINE"
     CDS             200120..200842
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707541.1"
                     /locus_tag="PA25_34180"
                     /product="short-chain dehydrogenase"
                     /protein_id="BBN83433.1"
                     /transl_table=11
                     /translation="MSNTTIIIIGANGEIAKAFMHEQRIKYPHHTLITISRGPFEQLD
                     AHHEHFLCDNSEQSINNLAPQIESHIANAQSVTIFNGQLHNDKFVPEKRLEDMSEQYL
                     IWLFKTNTITPMLWLKAIGQRLTNQSRCVITVLSARVASIDDNQLGGWYSYRASKTAL
                     NMAVKTVSIELARRAKHCKCVLFHPGTTDSSLSKPFQKNVPEGKLFTPQFVAQQLSHL
                     ITTRVVDGQVDYIDWQGKTINW"
     CDS             200868..201530
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011964140.1"
                     /locus_tag="PA25_34190"
                     /product="flavin oxidoreductase"
                     /protein_id="BBN83434.1"
                     /transl_table=11
                     /translation="MHFSKQHIDALDKQTRVHLINSLSGFKSANLIGTADKQGKENLA
                     IVSSVFHLGANPPLIGMIMRPHSVPRHTLENILETGHYTINHIHTEIVEKAHQTSARY
                     DKAISEFSAVGLTPQYHEPCMAPFVKESKLKIAVTLKSTQTIELNQTELVIGEITDIY
                     LEDDAAYCHDGFLDLEQLQTVAISGLDRYHTTSGLTRLSYAKVDNPLQTLPIKAHKKY
                     NS"
     CDS             201672..202409
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34200"
                     /product="hypothetical protein"
                     /protein_id="BBN83435.1"
                     /transl_table=11
                     /translation="MWHKKLKVALCVGMLAWALPSNAGLEEGIEAANKGDFEVALKEF
                     RYLADMGYGPGIYELAKMYEGGYGVPKDLRKAAQLFQDAVNTGVADAMFSLAVMYEQG
                     NGVKQDKQRAVELYTRAAKKNLAAAQFNLGVMYTNGDGVIKDYHTAMDWYEKAAASNY
                     TLAQFNLALMYYQGLGVSKNIEKSFIWNTIAEYNGSQQAAESRQLDEKQLSPSQIERA
                     TEKATEIYYKIQARKYIPEVRPRKAAY"
     CDS             complement(202501..202848)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34210"
                     /product="hypothetical protein"
                     /protein_id="BBN83436.1"
                     /transl_table=11
                     /translation="MKKALLSVSMLFLSGTAVADECGYWETYYVKNCSVEQSYPVTVC
                     HYYTDYPNQGAPNSVSNTLDGHVSCPSTYLWWDLDRTEHTTRTRTVQDPNRCVWEARR
                     RWVWNENPPSYCR"
     CDS             complement(203076..204479)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87I45"
                     /locus_tag="PA25_34220"
                     /product="aldehyde dehydrogenase"
                     /protein_id="BBN83437.1"
                     /transl_table=11
                     /translation="MQVEQLSELNKQLMALQVAFSQQPYQDTQTRVKLLKTLQQALVA
                     HQDELVAAARSDFNGRTEFDSVFGDIIPTVNALKYMCGHLKGWMKPQKRSAGMMLWPS
                     KASVHYVPKGVVGVISPWNYPIQLALLPVATALAAGNRVMLKLSEFTPQVNQVIKKMF
                     VGLCEHCVIVEGDHHVANAFSQLKFDHLFFTGATEIGKKVMASAAQNLVPVTLELGGK
                     SPVIIADDADLKHAAKAILFGKLLNCGQICVAPDYVVVTKPQFEGLIKELKAQYTLNY
                     PNKEHDEKISSIINSRQFARLNELLVDAKSKGATIWPSLPSQDAPQRMGLHLVINPSS
                     SMQVMQSEIFGPILPIMVVDNVDEAIQYVELHERPLATYLFSDDTSLINKVSKTLRTG
                     TLAINETVLQVTAEDIPFGGVGHSGMGQYHAKEGFIQLSHAKSILHSNKKTRLRTHLM
                     LKQSKVLTYLVKKLMLK"
     CDS             complement(204570..206012)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:NP_599478.1"
                     /locus_tag="PA25_34230"
                     /product="di- and tricarboxylate transporter"
                     /protein_id="BBN83438.1"
                     /transl_table=11
                     /translation="MNKTINNNSNTLLLLLAPSLFLITCLTEAPAGLPPEAWRTAGLA
                     IWLAIWWVSEVVPIPVTSLVPIIAVPLAGINDIKSATSLYAHPLIFLFLGGFLISIAM
                     EKWQLHRRIALHTMLRCGNNAKVQILAMMLVSGFLSMWINNTATTLMMLPIALSVIHV
                     LRDNGGNCENYGKALLLAIAYSASIGGVGTIIGTAPNALMAAFLWESYQIKIGFAQWM
                     VLAVPFCVLMIVLCWIWLVRFAFKVKATSSEADLECLFKGQLSALGNMSIAEKNVFGV
                     FVFAALSWILRPYLAMWTGLNITDTGIAVAAALLLFVLPSGQPQQRIMDWESANKLPW
                     GILLLFGGGLTLAAQIKGSGLADYVANSLAGASLVPIIVGVLLVSALICFLTELTSNT
                     ATAAGFLPLLGPIAEQVAGTPLIWVIPAAMAASCAFMMPVATPPNAIVFGSGELKISD
                     MVKAGFAMNIIAIVLITILTMTVGAWLFGY"
     CDS             complement(206173..208032)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001037204.1"
                     /locus_tag="PA25_34240"
                     /product="aminopeptidase"
                     /protein_id="BBN83439.1"
                     /transl_table=11
                     /translation="MYKAITLPLVGASLIAGFVAKADMQSDEKIWVTIDPHAAKHYQL
                     KSMMSGLSVNTQASGQLNADLMHINQGMVGELSAFMHDNYHRCGGFVAHSSYQEAQQY
                     LAQLAEVDKGAITPLLVDYTIDNPERVNSLLGYVFASNLTNTVNTLTGFHNRYYTQQT
                     GVDAAQWIKGHWEQLSASRSDITVEYYNHSWSQSSVIVTIPGAEKPDEIVVIGGHLDS
                     INSSSPSSGRAPGADDNASGIAVLSEALRAIVASDFKPKRTIQIMGYAAEEVGLRGSK
                     AIAQAYKSQNKNVVGMVQFDMSGRNGSTQDIVMMTDYTNGAQNQFLGQLIDTYLPTIS
                     YGFDQCGYGCSDHASWYQQGYAASMPFESSMSDINRKIHTVNDTEFDAEHSVKFAKLA
                     VTYLAELAKDAGSVDPEPNNKLKNGVAKTGISGAAKQQLFFTLDVPANSTGLKFVTSG
                     GTGDADLYVKFDSKPTLQSYDCKSTTSSSNESCIISNAQTGTYHVMVEAWNQISGVSL
                     TGSYQAIGDGPTPINRKETNLSVNRGAWLNFEQVLEAGHSNFTVSTSGGTGDIDLYVK
                     HATAVSDNVYDCRPFKNGNSESCSFDAPASGTWYIGLKGYNASSGVTLTINAQ"
     CDS             complement(208097..210289)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704796.1"
                     /locus_tag="PA25_34250"
                     /product="hemagglutinin"
                     /protein_id="BBN83440.1"
                     /transl_table=11
                     /translation="MKLSNITLATLSALALAHMSSAVAANKQFLNQNPTINTAVNSQA
                     VSVLSDKPRDIIGLSADNELILLKEFKQPNGDVTRRYQQMYKGVPVVGDTVILSFDKN
                     EQLKFVHGAAVFDIADDLYSVTPTLNKDMAIARAEQAHGMKALSAKGDKLKKHNETSK
                     LVVWVNKKNKKAYLAYEVQYVVYGDNPSRPYQIIDAHTGELLFSYENLQHADGTGPGG
                     NQKTGRYVYGTDYGYLNVSQSGNTCTMNNANVKTINLNHGSSGTSAHSFTCPENTIKE
                     INGAYSPLNDAHYFGNVVFDMYNEWLGTAPLSFQLKMRVHYSSNYENAFWDGSAMTFG
                     DGKDRFYPLVSLDVSAHEVSHGFTEQNSGLVYSGKSGGLNEAFSDMSGEAAEFYMKGT
                     NDWLVGQEIFKAEGALRYMNNPTQDGRSIDHQSDYTSGMDVHHSSGVFNKAFYNLATT
                     TGWDTKKAFLVMAKANQEFWTANTNWDLAGNGAIDAACALGFDTDDVKAALAAVGVNS
                     TASPGGNCGGPITDEEIFNGVPRTGISGASKAQQFFVLNVPAGATNLNFATAGGTGDA
                     DLYVKFGARPSLDTFDCKSTSSTSTESCAINNVQAGTYFVMVEAWNQISGVTLTGSFS
                     TDTGGPTPIDRTESNVSVARSDWARFTQDLSAGYSSLDVTISGGTGDADLYVNFGAAS
                     TTTTYQCRPYKNGNNETCTIANPQAGTWHIDLRGYNTASGVTLSIKAN"
     CDS             complement(210814..211914)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34260"
                     /product="hypothetical protein"
                     /protein_id="BBN83441.1"
                     /transl_table=11
                     /translation="MLSNVNAMSRREFCKRVLAMSASICVMQALSGCTVNVLPRFASA
                     YTDNHGDHYVGWFNGQGEILGKVAIDSRAHDLCYVPDNDSLLVFSRRPGRVMYVIDVN
                     ENKIRHRIDSAENQHFFGHGTLSLDGRFLYTTENKFDPSYHAYEGLIVVRNTHNYKVE
                     AQFNSGGIGPHQLAMLRQQNTLVVANGGIHTHPARPRTKLNIDSMKPNLSYIDISSGK
                     VVETVLPPDNQLSTRHLCLAKNDTVYVGCQYQGPAHYVKPLVFSHSRGEQLHALPASD
                     EQWRSFKQYIASLAVSHDDHKLAVTSPRGGVVGVWDRHLQNLPVIENKIDCAGIAPYQ
                     DEFIASTGSGILSSYKHQVKHELHWDNHMIYM"
     CDS             complement(211917..213107)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003102644.1"
                     /locus_tag="PA25_34270"
                     /product="hypothetical protein"
                     /protein_id="BBN83442.1"
                     /transl_table=11
                     /translation="MLNTDSKAMSWAFIAMLSAVSLGGCGSGGSDSKQLDSNQQNNSN
                     VDSNSGGTPNTQEKLTAEQGYEKLTSNLVDNVIIPTYQQVREQNLKLKMHTTQFCNNE
                     QRDQNSLSQLQQAWQQTHLAWQQARTIKLGPIAETFHYSRIQFWPISANKLANDVESL
                     MAEQVDLSGGVSAMKHQVQGLPAYEYIIYNSDVPLLEAVDFTRRCAYLGAITENIDTM
                     IVNSIEAWEGDYGNNFKHGLGVFSSKKQALEKLLTIWFEYLEIIRDNKINGPLALEAP
                     GKLELIESVLSQTSITNIKANVTALEKLYLGEQGFGFDDYLQQVNQREDTVTEIGLHF
                     QAVYDGVDATQYKPMQTLITTSEGRAQLAMLATSIANLRSIMSSDFVQITGLAPGFNT
                     NDGD"
     CDS             complement(213125..214570)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011105988.1"
                     /locus_tag="PA25_34280"
                     /product="thiol oxidoreductase"
                     /protein_id="BBN83443.1"
                     /transl_table=11
                     /translation="MYVLRILAVAVLSSTAVVQSVLAQVSALTSFEKQAVPSFSEREQ
                     LPGGKATAKRVATRTFIHPAGNIPTIEQLDFWDGFSFFRDPWVASPAITSDRDGLGPL
                     FNARSCKACHHDGGRGRLNNSGEFASPALLFRLLKRDGNGVDKHYGGQLQPNAVRLSH
                     HKLPRPVKGEGRVRVNYQNISGRYPDGSEYRLRKPIYHLDKLEYGELEKNTVLSARYA
                     PAIYGMGLLDAISEQDLLAQQDVDDIDGDGIRTQYNRVKNVQTGQIQIGRFGFKGLHP
                     TLEQQVAGAFVNDMGITNAIFADEVCTDVQKMCAKAASVDPYGTLDIPKKLHDLTVYM
                     NQTLGVPKARDLTSERAQQGRTIFFQLRCNSCHTPKYITRADYPIKALQSVHIYPYSD
                     LALHDMGEQLADQGSENLAKGSQWRTPPLWGIGLQKRVQGFEAYLHDGRARTVEEAIL
                     WHGGEAQVIKQNFMQLSAKQRNALIYFLKQI"
     CDS             complement(214570..216255)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010895673.1"
                     /locus_tag="PA25_34290"
                     /product="hypothetical protein"
                     /protein_id="BBN83444.1"
                     /transl_table=11
                     /translation="MTHYLNKLLTYISILTLSACGGGSTNNTNTEKQNTSNDTVDHVA
                     TDKPAFSISVTDGLPPLLTNKPDDAEHLSAGLATTHILDQNAYSKAIPAIVDSPQLDA
                     VFKAGDHTFRSNHDGQGPLFNNTSCQGCHIKDGRGQVPANANEPMTSMFLRVGDSSGN
                     VEPTYGDQLQVFGTITGQTTTLAKYRGALDDGLAYGEAYTWVEYETVIGSFADGESYE
                     LRKPVYKIKDLAYGDFIDDVQFSARVTPHVYGSGLLESIPEQSLLAYEDPNDSNNDGI
                     SGRAAFTNHPLTGESQIARFGQKAVTGSVLQQISGAYRGDMGITNTVNPGEPCTQAQD
                     ACSAQAQLENNKHHNGVDLNNVDLAQVEFYNRTLAVPKRRGFDESTQTWQADVLAGRE
                     QFYAANCHSCHVPRHKTGAALGSVLGDVDLVTLSETRTNITALEHQVIYPYTDLLLHD
                     MGGSCRVSRELADGQTCSQGKECIYVQRCEGLADGRPEGDATGTEWKTPALWGIGLVQ
                     TVNPKATFLHDGRARTIQEAILWHDGEAKASQQAFVNMDKAQRVALLAFLRSL"
     CDS             complement(216344..217786)
                     /codon_start=1
                     /gene="icmP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003112765.1"
                     /locus_tag="PA25_34300"
                     /product="insulin-cleaving metalloproteinase outer
                     membrane protein"
                     /protein_id="BBN83445.1"
                     /transl_table=11
                     /translation="MKNIKNIALSLVCVGVLAACGGSDKKVAAPVDNSQGNGQTTGQQ
                     TEVVHPTATFESVVSANANYAFAVYSDALSSAKSLQEAINTFVATPSEANFMLAKQAW
                     LNSREPYGQSEVFRFREGPIDALTKDEQGNWTLQDGQGPEGAINAWPLAEALIDYTQD
                     MDGNEARGNAAVYQSGGNIIQDSFTFAQITADLIREKFELDGEEANVTSGYHAIEFLL
                     WGQDLNADLTYTAQRDYTAGHRPVTDYYTSSNLPSSEANGRTCTSGEQGAQDEICQRR
                     GDYLKAAAALLVQDLQAVVDAWHPETGFHYQEYTKADNAAANLGAMLESMGRLSFGEL
                     AGERMSIAVRTDSQEDEHSCFSDNTHRDIFLNAKGIRNTYLGLYTDINGLEQSGPSIH
                     NLLVTKGHEALALKLKTALDNTMAKVLIIDQTAKAGMSFDVQIQKAENQAHIYAAITA
                     LAEQTDLIQEAIDALGVSAEDLKQDTEENI"
     CDS             complement(218225..220000)
                     /codon_start=1
                     /gene="btuB_5"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3EPM0"
                     /locus_tag="PA25_34310"
                     /product="vitamin B12 transporter BtuB"
                     /protein_id="BBN83446.1"
                     /transl_table=11
                     /translation="MNYVPGFQSTRGDWVGAVPKEHTRGIFLDSGNVLVMLNGHRLNE
                     SSFGKASVYMPHISVDIIEKVEFIRGPGSALYGSNAFLGVMNIVTSKDHNHMSLGIGE
                     HGFTQAAVGFNKVLFGDLNIYGNASWQGQQGERYVEGVRDPLASYFIELGGQWRDLKL
                     SMWHNQTQLNGFVNLAGWSDENKHKSQNLAVLIGYDWLRSAQWDVSSTVKYIEHDIYS
                     AGLIASAQDLSLQNDFFVGPSWQSKDLTLNLDGAFRVNNSLALNFGVEYSEEEQSEAG
                     INTSYYDFARGDVFLGEEFYQNGIITVNPHQPFNTLLQSFDSTAVYGQLKYTMSEKAT
                     LFVGARYDDVKDIDSKFSPRVAAIYSLSEQNTIKLQYGESFRTPVSNELNSNDDVTVG
                     NPNLTSEYVKTTELVWHSKYHSWELDLVLFDNQLKDFINLVPINTRQLPVEQRRFTFL
                     NTFNTDMQGYEVSGKFNITPSTWLEMGYTHLLDEPFNPSYKRFASLAVTHNMDPLQIS
                     FNALWRDSVFVKTPEPGVLDNYDQPAYSLLGASLSWRLGNSQSIVMKVKNLFDKQYVI
                     FEPRMSDGRIPGTGRAIHVQYVQKF"
     CDS             complement(220368..220643)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34320"
                     /product="hypothetical protein"
                     /protein_id="BBN83447.1"
                     /transl_table=11
                     /translation="MDKNMIDILFDVIGMSGTALVVGAFFMLQLGKASPESLTYNLMN
                     LSGAILLLISLCYNFNLASFVIELFWIAASIIGLVKYLKAKQSSVAT"
     CDS             complement(220786..221037)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011263413.1"
                     /locus_tag="PA25_34330"
                     /product="hypothetical protein"
                     /protein_id="BBN83448.1"
                     /transl_table=11
                     /translation="MAKPNKKGPVRTVDIYCSSCAATLFKYRKGGKGALVKCFLERIV
                     KNHTQNNSHCPKCEQEFARSTLIRGTPAIKFIGGKVRFK"
     CDS             complement(221044..221448)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34340"
                     /product="hypothetical protein"
                     /protein_id="BBN83449.1"
                     /transl_table=11
                     /translation="MLIFDLNYWAVLLAALSSFMLGGAWYSPWLFGKKWMECCGLTDV
                     DLQQSDPKLIYGGAFVLALIAAFFMAVLLGKDPLLIDAIILGGSIGAGLVSTTLGISY
                     IFEQRPLTLFFINGGYHTCQFVLMASVLSITG"
     CDS             complement(221765..222166)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010957955.1"
                     /locus_tag="PA25_34350"
                     /product="hypothetical protein"
                     /protein_id="BBN83450.1"
                     /transl_table=11
                     /translation="MTNKINAELLELLIDQERQLLEPGVRQSCDMLERLLSDDFYEIS
                     ANGLMFDKKHVISRLPNEKVPQFYNQTFKGRMLGPHLVQLTYQAAYRRSVKCQLNYSV
                     RMSLWRLEHDLWRLVFHQGTPCAEFKLRLDD"
     CDS             222310..223374
                     /codon_start=1
                     /gene="fabH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KH32"
                     /locus_tag="PA25_34360"
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase 3"
                     /protein_id="BBN83451.1"
                     /transl_table=11
                     /translation="MIYAKITGWGKCIPPAKISNEELSQIVDTNDEWISTRTGIKERR
                     VSHATTAELATVASQHALACAGLTGKDIDLVLLATCTPSTMVANTASLVQKNIGATGA
                     AACDTNAACSGFLYALQNATAQIQAGMIKRAVVVAAERMTWYVNWAKRDSAVLFGDGA
                     GAVVLEASEEPCGLLGTKTGCDSTDRDILHIANYGTDMDKYQPTGPSDLLFEGREIFK
                     RAVKGMSEACDEVLDKANLKLSEIDVLVPHQANLRIIQAIQQRLDIQDDKVMVNIDKY
                     GNTSAATIAIALCEAVENGLIKPHSNIMSAAFGAGLTWAASYIKWGDRVTPIAQSDAT
                     LAPCTQSGVELITPAVKACQ"
     CDS             223441..224907
                     /codon_start=1
                     /gene="pepD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261447.1"
                     /locus_tag="PA25_34370"
                     /product="aminoacyl-histidine dipeptidase"
                     /protein_id="BBN83452.1"
                     /transl_table=11
                     /translation="MFKPHTEISQLEPTAIWQFFDQICAIAHPSKHEEALAKFIVEWA
                     TNKGLDVRRDPTGNVFIKKSATSGMEDRRTVVLQAHIDMVPQKNDDTDHDFTCDPIKP
                     YVDGEWVTATGTTLGADNGIGMASCLAVLAADDIPHGPLEVLLTVDEEAGMTGAFGLK
                     KGWLDADILLNTDSEQEGEIYMGCAGGVDASLKLAVERQPCADMRVFEISLKGLKGGH
                     SGVDIHTGRANANKLLARFLQHHVTDVNWHLIDIKGGSLRNAIPREAYAKIALSASEL
                     TAFESQLNNFEALLKTELASIETNICLNIKEDCSQLAPMSEASQSQLLALLNACPNGV
                     IRMSDDIEGVVETSLNVGVIKTSDEHVEILCLVRSLIDSGREDVTGSLRSLASLAGAN
                     IELSGAYPGWKPDPDSQILHIFRDVYEGIYGKKPDIMVIHAGLECGLFKEPYPNMDMI
                     SFGPTIKFPHSPDEKVNIASVGLYWQQMKAILANIPHK"
     CDS             complement(224956..226323)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010957670.1"
                     /locus_tag="PA25_34380"
                     /product="cytosol aminopeptidase"
                     /protein_id="BBN83453.1"
                     /transl_table=11
                     /translation="MRGLLVQASTGTPIHFILKPQLDNWLKSQPALTQTLVRATKTAN
                     TKYFLVPQENSEELAAVICLVDSLDSMWLAGELAKQLPKGVYQLQGSDEFVEQQALSF
                     VLGAYQFSAYKSMAKVESQLAVADSAMLERVTRCAEAIYLVRDLVNTPAADMMPQHLA
                     ETMDELAQRFDGQFTQFIGDELLEQNYPTIHMVGRASDNKPRLLDLTWGDEKHPKLTL
                     VGKGVCFDSGGLDLKPASGMRNMKKDMGGAAHVIGLAHMVMAANLPVRLRVLVPAVEN
                     AVSKNAFRPGDVIKTRKGITVEIDNTDAEGRLVLCDALAEAQSQSPDLLVDFATLTGA
                     CRVALGTELPGFFSTDPHVAAGLIEQGANTQDPVWQLPLFDQYKELFKSDVADIANCG
                     STPFGGAITAALYLKEFVEPQQTPWVHFDVMAWNVRSLPGRPAGGEGLGLRATFSYLA
                     NRYAG"
     CDS             complement(226388..226666)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34390"
                     /product="hypothetical protein"
                     /protein_id="BBN83454.1"
                     /transl_table=11
                     /translation="MIELKLALSQEKQETKEMLDIYKRYSSGKAHKAELKVANKQFVD
                     LLKGLGLGVFALLPFAPITIPLIVKLGQWVGVDVLPSSFSPGNKAARK"
     CDS             227264..229906
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34400"
                     /product="hypothetical protein"
                     /protein_id="BBN83455.1"
                     /transl_table=11
                     /translation="MKLQLNAISRAITYAIASTASVGLFSTTAMAEENSAKKEKIEKI
                     AVVGSRAAPRSVGDSPVPVDIIGGDELSKAGGDDMLELLKGSVPSLNVHQNPISDAAS
                     LVRPANLRGLPADSTLILLNGKRRHRSSVIAFLGGGINDGAQGPDISVIPSIALKQVE
                     VLRDGAAAQYGSDAIAGVINFVLKDASEGGSFSVKQGQYFEGDGDTTTFEGNVGLPFS
                     DDGFANLSFQYKNADPTSRSVQRPDAAAFTAAGLEGVRNPAQVWGAPEIKDDISLFGN
                     VGLDLSNDSQFYMFGNYSERDVKGGFYYRNPTTRPGVYGGNIRLVDGVPTRRHPTDEA
                     LQAAWDAATPTVLVGSNDGYDAQLNCPVVEIQSNGLPDPDALNSLSASNCFAFNEMLP
                     AGFTPFFGGNITDTSLTIGTKGEITEGFMKGALYDLSGSVGRNESRYFITNTVNASLG
                     AETPMEFSPGKYIQLEKNFNADISKGYDFDLAYDVNVAAGLEWHEETFEVIAGDEASF
                     IAGPLTEQGFGIGSNGFPGFKPSAAGEYSRRNYAAYVDVETPFTEEFLMGWALRFEDY
                     DSFGSTTNYKVTAQFQATDDLSFRGSISTGFRAPTVGQANVSNVQTNLSSGVLVDSAL
                     LPPTNPVSKILGGTELQPEESDSYTFGAVYQSGDLFMTIDYYNIQVEDRISQSNKIDL
                     TLAQKAALKADGVPNVDSLAQVSFFTNDFDTTTQGVDVVANYSMDMLGGYSTFAFAYN
                     WNETEVDRFSAITGDFKVKRLEKDLPNHRATFTWTQQWEDFTGFVRYNYFGEYQGVHV
                     DYDATAIMADPSVTFDAELTYFATENISLTVGANNIFDQEAEKLDFQKATGIPNNNWG
                     GKYYETSPYGINGGFYYVKATYTF"
     CDS             230035..231483
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530022.1"
                     /locus_tag="PA25_34410"
                     /product="sulfotransferase"
                     /protein_id="BBN83456.1"
                     /transl_table=11
                     /translation="MDENKLREAEFMFKAVLKENNHNGSALFGLGRICVQLEDYDSAI
                     YYLRRACEHLPKQLEPLFTLAFCFIQVGSPVDAKTVLEYTLSVAKHSARAHYELGQFY
                     LDYGFVKQARTTFSQGIHCAHQEVTPYIFRELVQLAPSQDLPDYLEPLEKLLEEYDDK
                     RMNIVNYYSLGTCHHRLGNHEQAFEYFKLANDLQLQFCDFRTHHMLPFFAQIKQHFNA
                     EFFQKPTDRVKTTFTPTFIIGLPRTGSTLLEQMLVQHSCIGSLGESTVLSDKIVPFLV
                     KRSELPFPFCFGNLSTSASDYCRNLYVDEIKKQRVPDEVVINKLPANFQNIGMIYRLF
                     PNARFIHLTRDFGATAWSVFSNHFNADEPYFCSLSEFKLYAEAEDELMAHFKQQIPDS
                     ILTLSYESLVAQPEKVISRTLKFLGQKYEPECMKYYEDHRPVSTLSKAQVRKPISKAP
                     LTNWQNYQEKMIELFNSGEQIDHIEQTNPISL"
     CDS             complement(231428..232243)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707407.1"
                     /locus_tag="PA25_34420"
                     /product="alpha/beta hydrolase"
                     /protein_id="BBN83457.1"
                     /transl_table=11
                     /translation="MHGAVENGKIFYTKSNKGLAPFLASQGYRCYVGDLRGRGDSVPL
                     ISAQSSYGQTEAIVEDIPAMLEFIYQHGGSFPRYWVAHSWGGVLMNSYFARFPDDVSK
                     VDACAYFGSKRSLHNHHYSKYLQANLIWYGLAPLYTKKYGFLPAKKLRWGSDNETKKS
                     HEQGMEWAKRKPWMDSDDGFDYAKTLKNMKLPPTLHIAGVKDKALAQPIDIKKFIQES
                     GVGVQELKEYGRKHGHQHNYGHIDMLTHKAAHHDQFKDLLDWFARYDRFAHHC"
     CDS             232448..233329
                     /codon_start=1
                     /gene="rlmF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3CKP5"
                     /locus_tag="PA25_34430"
                     /product="ribosomal RNA large subunit methyltransferase F"
                     /protein_id="BBN83458.1"
                     /transl_table=11
                     /translation="MPTLIERLSMHNRNKHRHGYDFKALCKTLPQLSEHLITTPKGTQ
                     SIDFAKPSAVVCLNQALLMHYYNVQFWSIPDGFLCPPIPGRADYIHALADLLNQQQPN
                     PQIRVLDIGTGANLVYPLLGNAEYQWQFTGSDVNPNAIKCAKAIIDANKLNIALVQQN
                     NPSTIFEGVIQQKHFFDVTMCNPPFHSSKEQAQKGTRRKWQNLKQQENNKLNFGGQSQ
                     ELWCDGGERKFIKTMIRESKNYAQQVGWFTCLVSNKDNLSPLKLYLKKQQPAEIKVIK
                     MAQGQKISRFIAWRYCD"
     CDS             complement(233406..234002)
                     /codon_start=1
                     /gene="tdk"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KST9"
                     /locus_tag="PA25_34440"
                     /product="thymidine kinase"
                     /protein_id="BBN83459.1"
                     /transl_table=11
                     /translation="MAQLYFYYSAMNAGKSTTLLQSAFNYRERGMTPFILTAAIDNRA
                     GVGKVASRIGLEADAHVYDVQSDIMQIIRDEHREQKIDCILVDECQFLSKSQVNALTD
                     VVDELKIPVLCYGLRTDFRGELFEGSQYLLAWADKLIELKTVCHCGRKANRVLRTDEN
                     GVAIADGAQVEIGGNDRYVSMCRAHYKAQLKQAIKAAE"
     CDS             complement(234063..234746)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34450"
                     /product="hypothetical protein"
                     /protein_id="BBN83460.1"
                     /transl_table=11
                     /translation="MPSVRPGVSIEVLQMMERQIEGLNIQFVREPWQRCLHDMKRNKV
                     DAVIASYRPERSQYMVFPTTESGELNTSLALNQFGRCLVGDKVFIDELKTTKDSFSLA
                     IPRGYSSANSLSDTRFVKVDTLSQLDAFDLVNKRVVDATIGLCMINGKAVKAFPYAKK
                     LHAFYPPFDTSFGFLTYSKLFFENNEGLAKQLWQQLAQFPFADVYMEYLAAEHQQINS
                     HVSDMPSSK"
     CDS             complement(234918..235382)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5FMC6"
                     /locus_tag="PA25_34460"
                     /product="methylated-DNA--protein-cysteine
                     methyltransferase"
                     /protein_id="BBN83461.1"
                     /transl_table=11
                     /translation="MIYQHTMNTPIGVLTIQSSSYGLTYVGFNPKNEYEEVCNEHTRQ
                     AKQQLKEYFLGTRRDFDIALDINGSVFQKSVWQLLKQVGYGQTNTYGWMANFLGKPKA
                     VRAVGGANGKNPISIIIPCHRIIGANGTLTGYAGGVEKKAWLLKHEQQNKLN"
     CDS             complement(235379..236743)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005482874.1"
                     /locus_tag="PA25_34470"
                     /product="3-methyladenine DNA glycosylase"
                     /protein_id="BBN83462.1"
                     /transl_table=11
                     /translation="MLSAAICQKARESRDHRFDGLFYVAVKTTGIYCRPICPAPAAKE
                     GNVEYFQYAHNAADAGFRPCIRCRPDAAPGSYAWLGIQTTAVRAKKMIDEGELSTHTT
                     AQLAERLGITQRYLNKLFKQFYGTSPKQYALYRQCDFAKQLLQQTTMSIADIAFASGF
                     NSLRRFNDAFVRLYQLSPSQLRHKKAQSQSHITLFLPFRPPYNWHALHEFLSKRLIEP
                     VEWLTANSYGRTYCLGDYDGSFEVEFEPSNHRFRVKISINDVAGLHLIVGNIKRVLDL
                     DSDPTFIEAHLKRVLPETFKLTEGLRLPGLWCEFEAGVRAILGQQVSVSAARNLLKTL
                     VSELGEGNHLGQRLFPKPAAMKDNGFSFFKMPARRKEALASFATYYSKKSDSLDLDKW
                     LCIKGVGPWTVDYAKMRGQSNPDIYLAGDLGIKKAFAQHGELEVQACAPFRSYLTFQL
                     WQQL"
     CDS             236966..237265
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34480"
                     /product="hypothetical protein"
                     /protein_id="BBN83463.1"
                     /transl_table=11
                     /translation="MQSVGASAASTQVHQIDIEHLQSEHVHSSKLSSLNDQYDQDGHN
                     IKDCHHCGHCSGSHLSWFVSKSTTALYVKQPRDDIDHERSQAQYRHEPQFKPPRA"
     CDS             237398..238549
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34490"
                     /product="hypothetical protein"
                     /protein_id="BBN83464.1"
                     /transl_table=11
                     /translation="MFKFNTMAVRTIAVALLFTPYTIATAGENHDHHNEQPQITDSDN
                     HAQNTLVSLTQRQIKTANIQVSELQPRFLMQHHYAPGVLKENGYTSYIVSPRTDSVIM
                     TRHVALGQKVNQGDKLITLYSESMADAQADYMVSQSEWLRIQNMQKQTLSESERVVAK
                     TRYLASVGRLNALGLSHEAISALTTQSDIKLGQYTLYAQVSGVVLQDDFTQGQRVNTG
                     QTLLRLADEQNLWVEARLSANDNESIDIKSTAKVQFKEDTYHAKVIQESHTIDPITRT
                     RTVRLVVNNADDRLHAGMFVNVYFNLPSKQPLLAVPETALMQNADEEWQVFVLNDHNQ
                     FLPQRVTRGRPFGDLVEISGLPAGTQVVTQGAFFISSEFAKSNFDIHNH"
     CDS             238564..241695
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070862.1"
                     /locus_tag="PA25_34500"
                     /product="cytochrome-c peroxidase"
                     /protein_id="BBN83465.1"
                     /transl_table=11
                     /translation="MINRLIDWAITNRLLVVLLLIAMISVASVLIPKLNLDAFPDVTN
                     VQVTINTQAPGLAAEEIEKLITYPIEAVMYALPNVEQVRSVSKTGLSGITVVFKEGTD
                     IYFARQLVFERLQAAKALIPDGLGTPEMGPNTSGLGQIYQYLLISDPDSNIDTMQLRS
                     INDWVVKLLLMPIDGVTDVLSFGGEVKQYQVNIDPTQLIAYGLSQHDVIAALKQNNEN
                     AGGWYMQRGQEQLVVRGMGWFNSGAQGIAELKQAPVKTIDGTVITIAQVANVELGSEI
                     RQGAVTMTRKDEYGKIQHMGEVVTGIVLKRMNANTNNTIEGIKQRLKLIESTLPKGVR
                     FEPFYDQANLIKQAVSTVVQALSIAFILIIVILALFLMSLRATFLVLISIPISIAIAL
                     MLMSWLEISANLMSLGGIAIAIGMLVDGSVVMVENIFKHVSQNNQSNPEIIAQASKEV
                     ARPVIFAAVIILIVFAPLFSFEGVEAKLFQPMALSIMLALVSAIFVAVIIVPALASYL
                     FKYKLSTRTSIFFTPIEHCYGKLLSKALAKPTFILLTVLSLLIATVTITPKIGTEFVP
                     ELEEGTINLRVTLAPSASLDTALSVAPKLEEKLLTFPEVTYALSRIGRAEIGGDPEPV
                     NNIEIYIGLKPIQQWQSAKTRHQLQNLMLDKLAAHPGLLFNFSQPIATRVDELLSGVK
                     AQLAIKLFGPNLEVLTEKGKQIEALIKKINGTTDVALEQIAGEAQLIITPNRQQLSRY
                     GLSVADIMSLVRNGIGGTSAGQIINGNERYDIYVRFAEQFRANAQVINDLRLRTTDGA
                     WVKLRDIAEVELKSGPPQIRREDVQRTVVIQANIQGTDMGSAVSQIRSEIDTKIKLPA
                     GYSVVIGGQFESQQRAQKRLSLVIPLSLILIALLLYIAFSSVAQAMLILINVPLAVIG
                     GVFALYISGQYLSVPSSVGFITLFGVAVLNGVVLVESINQRIKTGEDSNSAIYHGALS
                     RLRPIIMTALTSALGLVPMILSSGVGAEIQRPLATVVVGGLVSSTLLTLFVLPILFNR
                     FSAYKITEMQRGQ"
     CDS             241911..242378
                     /codon_start=1
                     /gene="brf1_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EHV0"
                     /locus_tag="PA25_34510"
                     /product="bacterioferritin"
                     /protein_id="BBN83466.1"
                     /transl_table=11
                     /translation="MKGKQRVIDAFNALLANELAAIDQYFIHSRMYDDWGLNKLYERL
                     NHEMEEETTHADWLIKRILFLEGTPNMTKRRDLLIGSDVRSMMQNDLTLELEVVESVK
                     EAIAICEEEQDYQSRETLEKLLFDTEEDHVYWLEQQLGLMDKIGTQNYIQSQL"
     CDS             242388..242852
                     /codon_start=1
                     /gene="bfr"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPS5"
                     /locus_tag="PA25_34520"
                     /product="bacterioferritin"
                     /protein_id="BBN83467.1"
                     /transl_table=11
                     /translation="MKGDKDVIASLNAVLANELVGINQYFLHARMFKDFGFSVLDKAD
                     YKTSIQKMKNADRLIERILFLEGLPNLQSLGRLRIGENSEEMIAANMAFEQQALIDLK
                     AAIKLAEEKRDYISREALDNILNEQEEQIDWLETQQSLVKTMGIENYLQSQI"
     CDS             complement(242907..243101)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003092075.1"
                     /locus_tag="PA25_34530"
                     /product="hypothetical protein"
                     /protein_id="BBN83468.1"
                     /transl_table=11
                     /translation="MYICICHGVTDKKIAQTIDEGATSMRELSKELGVGTQCGKCTNC
                     TKKILNEKLIEIVDVTDQVA"
     CDS             243500..248002
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070706.1"
                     /locus_tag="PA25_34540"
                     /product="diguanylate cyclase"
                     /protein_id="BBN83469.1"
                     /transl_table=11
                     /translation="MYQRCMLILFVCIIFVLHNNAIAVNSDTINRLSTAEGLSQASVS
                     NIVQDKHGYVWIGTHLGLNRYDGDSINVINKPVNLSTKHISLLKLLDQDTLFVSTAFS
                     GAYLINIDTLNIEQVYSGKLSANSNTFSEITAAIKVGHFLYAGIDNNLYRIDLTSKRS
                     TFVTSLDKHNYVRALLKFDKQILIGTNHGLFNLNPESGQLERLEFLDEPFRTSLNSNI
                     KLLKVDPAIGLLVGTVQGLYAIPINNKSLQLHAAYTLVPHYNIWAHEITPHGELIATE
                     LGLFKINRSTKSAEQLLSLQQSKYELPQTSITDLMYDKQGNIWMATLNQGAYFWPMPS
                     LRFKTLGANNPNLNKNIWSIYQDESGEIWLGTDNGILRYHSLADTSPQRYYENNDIKA
                     AYASNAVYQVFGSSTNKSDELFLETLTGLKLLSKTTGHIRLPPLASQLPNNPFETLNW
                     GARLLHGEQIAFISKQGFFIYDIKSQTVHPLSQLTQQVDIGTAYKFLPPLPSRPNELL
                     LSTEQQLISYNQETGTVTKIYEFTKTDSERFSVIDSWVATPNGTIWLASSIEGLVALN
                     EHDFSVKFKVNTASGDGSQTLYQMQPDNFGNLWVSSQSGLIRYNIETGQIKKFNTNNG
                     LPNSEFNANASSTIKNAKLAFGTISGMVWFSPEDFIDTSNSESSLSITDINLMTRSLN
                     YFPSFLSTQSLVLNHDDLGLSIKFSNFDFAQQQVYNYRAKLDGPTSIEFDSLKANHLF
                     FNQLKPGKYTLAIEQQMLGSDKVVDTITLPFKVKHSTFGSPFAWGVYIAFAMCALVII
                     IWQSRQKRREIESALQEVTVSKQQTEMALNTTRSGVWQVDLSSKMITQSRNIDCSLSK
                     SKDEKIPLRNYFDLIHPDDRHQVSVIWEQILQSATNQQFSLTYRVKSGDEPWRWYHDI
                     GQVLNFDEQGNPEQVTGIYTNITEQKAIDLRASILGEAFSKVSDWILILDAELNPLSV
                     NTSFCKAFELDEETAIEELSFRKLAQVVGLNRLNSLLKRIHELGPNQHIRQELTVKTS
                     HQVAHPIHLSINAISKNEELIEHYVIVISDLTDQKQAESELRYLANFDTLTKLPNRTL
                     MLQHIEFALHNAELSGKYCALLFIDLDKFKPINDAYGHHTGDQLLIKITERISSKLTS
                     NCILGRQSGDEFLVLVKNVHSPHKLSELATLLLECLPNKIEIGGISMSISASIGVAMY
                     PFDADSPEMLIRNADIAMIHAKQSGRNGFKFFTSQMNTQFSRKLTLENALKTAYREGK
                     IYNNYQPIVNIISGRVVGVELLMRWTHEGEAISPMDFIPIAEEVGLIELMTEQALKRA
                     LYELNQFIVNGRDFYLSLNLSAVHILKTDIAQNLLNILRAFNLSPSVLRLEITESSLM
                     EDTDSAKRSLDALKRAGFVLLLDDFGTGYSSLTYLNQFPIDIIKIDQGFVRKMNVLSS
                     NKSIIKTIYLLAQSLNMSCIAEGVETSEQLAFLKDLGCHLMQGYYFSPPVNAEKLEGV
                     IAMSTH"
     CDS             complement(248075..250837)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34550"
                     /product="hypothetical protein"
                     /protein_id="BBN83470.1"
                     /transl_table=11
                     /translation="MPNYLHKYTPLLVTLLLGTLGGGANLLPFFFLDASEFLFGQLFV
                     LLCLVLFGWKYACLAVALGGCFIFYRWGHSWPSVVYLLEIVWLQVFCVSRGKPFFARG
                     LGFWLAVGLPILLLFGYYLLELPNLVIATALAKYFINAALYLAITDLLSFFFIRHLWR
                     AHPLSSILNYTVSLLIVLVVLITSIVLTNNSYRRIEFEVQEQLHTSANNISEQLDDYL
                     QSYRRAVVGAAKSVELGLDEDAVIKSLVDLQPDLKTAIFADQNGRVSAFYPSVFNSNA
                     VSEVVSVIDRDYFVQAPYYPDGYISSIFKGRSFGSDLIIAISAPIFDAEQFKGIVEGS
                     LLFGSFSRFQPNILAHKGDIVLLDNDNKVVFSSLGESFNTLDVVDSEVLASWLDNQLV
                     SYTTSSGDVYYRHAVKVEGLNWTVVTLLEGHIIRLAAASAWLKSLLLALVIIVLSSFF
                     VSQLSRFLVKPIKALSEDINRFEPSTMLKNSAGEEVSCLEVITLQQHFNQLAFKLTMS
                     FSKLQLANNENEELNKKLTNFNRELEQQVNEKTEELLEAVASANNANKAKSRFLANMS
                     HEIRTPMNGIIGLTGILIEQKKGDEETLKQLDIVHTSAKSLLLILNDILDYSKIEAGA
                     LTLDLHPTDILKMFDTLASFFKQAGLKDNVEFEYQLSAQLPPCLLVDSLRVTQIVNNL
                     LNNAGKFTEQGKITLKVEYDNGTLMVSVQDTGIGITQKQQQQLFKEFTQLDVSTTRRY
                     GGTGLGLTISKCLASLMDGDLVVQSQEGEGSCFTLTIPASIAELPIEIEQKGTQLNLS
                     GVSVLLVEDNMVNQIVVSKALQSTQCNLNKAMDGVEALAFLQEHHVDIVLMDCQMPNM
                     DGYECTEHIRKQPDVYGKPYIIAITANAYNEDRLKCLQVGMDSFVAKPIDKELLFRAM
                     QQYKVY"
     CDS             complement(250978..251796)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011014254.1"
                     /locus_tag="PA25_34560"
                     /product="cobalt transporter"
                     /protein_id="BBN83471.1"
                     /transl_table=11
                     /translation="MVIQLVGAYYANSLAVLADAGHLFVHNSSLFIAVIASSIAVYLA
                     KTFNDGYKKAEYVGGLINGILYLAISILIIVEGAQRFMHHSDGHQLEVNSYLMSVIAG
                     IGFLFHGLSTWVLYKGRKDSINVYAVFLHSFFDLLSTVSTFFAGVMIYVTGWEIIDVV
                     SSLLISLFVMFTGVKVVRSCINGLFFSQIALPKATHVEKVILATEHVESVHNITVSEV
                     EGMLAIGAHIVLKHHCTIELHDASCRVQVEQALQRRFDAHQCVLQIESHQCPAH"
     CDS             complement(252000..252479)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34570"
                     /product="hypothetical protein"
                     /protein_id="BBN83472.1"
                     /transl_table=11
                     /translation="MKTPEKPENEPLRIQTLNQLGLLDTEPDPKLDRLTEFVAHVFCV
                     PVALISLVDSDRQWFKSKVGLDACETSRDISFCGHAILGNDVFVVPNALKDVRFSDNP
                     LVTGPPYIRFYAGAPLIHENGTALGTLCLIDIEPRTFDEDDIKVLREVANKVVNEFY"
     CDS             252659..257359
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34580"
                     /product="hypothetical protein"
                     /protein_id="BBN83473.1"
                     /transl_table=11
                     /translation="MHQQVLLNSERFLLLGEIIFSLQKERGFTSVFSHFGGSSSRQHL
                     STYQNDTQLQFNELIHTLNEANNGTNGTNGNTVDILNGLLQRVLTIRSQIKSKEITTE
                     QSFTQYTQVIDSLLNMLLAFKHKTFVGVNTSKTTYPDLSAYVNLIEAIEYAGKLRAKT
                     GKLLNFSNTKGAQLTPTIFYLNANLNSSLSDIHASKKVNDALVAIENSQERLQLNTLI
                     NALRANNQANMSAATWWEVSTRYIDMLTLVSKTIVADGQSFAQEYVRTTNIKSQLMIA
                     TFVAVACVSCFLFYAIWQLAKPKGVNKHAAVSYWQLSLVLFSILLVMLLAHKVSQREL
                     EGQLKLQLTSELKNNAVHTLKSAEAIWYEPAKSELMAIQKALFPLTQIQIEAQPILSK
                     YISNANVAIYDIQNKAWLINENNQLKTALEQIKGQYKAVEQGKILLTTVYRNNKLSAH
                     FVTQLVSQQGVLPYQIWYSLTDLSPLISILKSPFLESDSNIIYFDNRNIVTNKGIYKN
                     LKKAASKSHSNTIEPLLSPQTPRQYKNYLDKEVIGVLVWNNELHIGVGAEHELASVDA
                     IVQNVQQEFSIQLFILLSLGGAILLFTYKIQNSAFSQLKHSEQQLEKDKIQLNNAQKI
                     ANMGSWEWSLGQLHIHISKELSNMLNLPREASQYSARSILRFIEPESRHQLIKAIKGY
                     KILKSITLQLTTQNLPNITHVDLVANWQASEHDEHGPLEKTLVGIVKNVTLLVMEQNR
                     QQRQQAALRAAREAALAKMEEADQQRHALEVALKENKETERLLQQTLDSIPAFILLLD
                     SQARVTLVNQYWFKTQHADQFSGGLFLNTFFNVGDDCIDAINTLPLTKNKPLINALRE
                     AKFQDSYLAELECEYVITDGPIWFEVIITTLETHNGKSILMYQHDITQRKQDAMQLEE
                     AKAKAELANDAKSRFLATMSHEIRTPMNGVVGMLDLLNQSNLSAEQSHLTSVAKNSSL
                     MLLGIINDILDFSKIEAGKMVIDKVPFNWHNVIKEIAELLAHQVKEKHLQMYFLFDPE
                     LGYWQIGDPIRIRQILLNLIGNAIKFTKTSSSKIGLIEVSISSAKHDQHQLEISVSDN
                     GKGITEKQQTLLFKPFTQADDSIQREYGGTGLGLSITQKLVTMMQGSIDCRSTENIGS
                     TFKITLPCAKTTHKQAEIEIIFKDVSVCILGDEDIFESDLEANLTAHGAKCSIINWVN
                     VSDNNIHALNVNYVIVTLERYQQIITANYQFQLDNKKTSYIILVNNNFTIPLPKESCC
                     EAIYFNPYYSFKIIEHIAIREGIISPEILPTQLISNDHPLPTIEQAQQQNQLILVVED
                     NTYNQEVFKRQLSILGYQCMIAEHGEMALDFLASHSFALVITDCHMPIMDGYTFTKKY
                     REREHLSSAQKELPIIAATANALSGERNKCIACGMNDYISKPIELNNLKNLLQKWMPS
                     AISSNNTAKPENKTNQDNKNVLDLSQLATYVGDDTKIQHLFLKNFIADSTPLMSALQK
                     RAKDFELVKSSAHQLKSSAKAIGANELANLYLEIEQAAKAQHSDKILDMLPSCVSIFN
                     EVCSEITSILDLNE"
     CDS             257405..258628
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704849.1"
                     /locus_tag="PA25_34590"
                     /product="transcriptional regulator"
                     /protein_id="BBN83474.1"
                     /transl_table=11
                     /translation="MDDKDLLNIIAIDDNGLILTQLKLLLSQSYHVNFSGFTNGPDAL
                     SFLKQHPTDLIFLDLNMPGMDGIEVLRHLSDINISASIVLLSGEDNNIIKMAKNLAQM
                     RNLNVIIGIDKPITAGQIKQLIESLFKLPHHKSSHLTQRAFNLEELKTAIEAEQMCLY
                     LQPKVTLSNEEVIGAEFLVRWNHPEFGVLSPFYFIDLIEHSDLVHDFSILVVKEAFEF
                     IEQHFELLKSLTFNINLSVKNLEDLKLPERLAELASTYNVPTDMIVFEVTESLLIENL
                     TQSLDVLLRLRLKGFSLSIDDFGTGYSSIKQLSQIPFCELKLDRCFIHDCAIDTDKQA
                     IIEATAALAQNLNLKVVAEGIEQQQDLVFLGKYNIDYGQGYLFALPLEKLNFLKSIES
                     QTNYNTQSRQALLRG"
     CDS             258821..259696
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003816010.1"
                     /locus_tag="PA25_34600"
                     /product="AraC family transcriptional regulator"
                     /protein_id="BBN83475.1"
                     /transl_table=11
                     /translation="MTLKNTTKHSYRQRLLKVIDYLYQHTDMDLDVNSLAELANMSAY
                     HFHRIYREFTGETINSTVRRMRLFKAATLLLHSRLSQADIAKQVKYASVEAFNRAFTK
                     HYGETPNQYRLNRSAQQLEQSVFYPTRPKEYNQMYNVERIQNDKLTLIGLPHQGDYMQ
                     IGQAFEKLGMLAGSAGLLNEHSRSFGIYYDDPKTVDTDNLRSMACISIDNPNVELPDE
                     QLQIIELPAGTALSVLFQGDYTELDKPYDWLFGQWIPENQIELADFPPFEEYLNDVKQ
                     TPPSELLTRIHCLVK"
     CDS             complement(260054..261457)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_009889640.1"
                     /locus_tag="PA25_34610"
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="BBN83476.1"
                     /transl_table=11
                     /translation="MGQMIKVPHTLILLLGMMVIALVATWVIPQGFFDTATTESGRQM
                     VLAGTYHLAENTKLLTPWDLLKAIPRAFAAAQDVIFFVLIVGGVLSIARATGTVDALI
                     GRLLEKHGDKPQKLIFMVVFCFALASSTIGTAGEYIPFVLILVALCKAMKLDAMTAVG
                     MIIAGYGIGYGVSAFNPFTVIIAQQIADIPVYSGIWLRLAIFLPFVLIGFHHVWSYTK
                     RVQANPELSMMKGVECPLAGQAQQNYPLLNKRHQLVLLSFIATLVVAVWGIATLHWYL
                     YELGGLFIAWGVLISVIGKLSADEAAHKFIEGVSDLVTTAILIGVARGIALILEDGQI
                     LHTIVNGLSTPLSYVAAEVSAVGMLFIQTLLNLFIPSGSGQAYVTMPLMVPVGDLVGV
                     PRQVAVLAYQFGDGLSNMIVPTNAVLMGIIGMAGVPYTHWFRFCLPLLAKLMLAASTV
                     LVLAVVFGYGLDVQPQL"
     CDS             complement(261722..262951)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34620"
                     /product="hypothetical protein"
                     /protein_id="BBN83477.1"
                     /transl_table=11
                     /translation="MTCTLNVQAQATLAPDVCRGFVSEAEQLVRSGANQKGDPSYNRL
                     QRLEERLRQFCPNSDFLKEPQKKPTASVKNDNKPVLQVATTRLKQIVEPYQNADKHSA
                     WLQFYQASERCAKTQKTTQEHVYCSEEIAQQKRLFELQWQQPSPGAELTSNEKVADSE
                     QTEPTKQLKVSPNANKPSNQTTPLANPQMQGYTPTQQQTSPWLYVGRYVWLILLIASI
                     LVVAVTVWPYTRRVLYHQASRLLLSYVLAKALPKSAYTLTGKVYFFADGKMHQIDELV
                     VSKFGIFVVQYQRQAGAIWEDAHSDLWTQSIDDERYYFDNPMTELSQKIKWVKGLLDV
                     EHHVDGCVVFPNDVHFRTEMPEQVCLYKGAPNYIKQFNTEQFTSLQLDMFKEQIKLHR
                     KDMSLAQRIGQLVTQGP"
     CDS             complement(263067..264050)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34630"
                     /product="hypothetical protein"
                     /protein_id="BBN83478.1"
                     /transl_table=11
                     /translation="MHRTVLVGLLITFLMSCSEPILLEPTNQYQFSDVLVLDGQLSGD
                     AEQVMLLLEGPNLAIWRVFDKQTVMSINETQLPSNVRTIHLNDLAKLVLVAGDNIVQF
                     WHSLSGELIGTLNVAGVDELARVCALTTSDDGDEVAIGFTDGSVSLVKRKSKEMKQFM
                     PHSSNIIAIHFVKNNRMITGAHDGVVKAWDRETGDNYYQRKFDSRLSSLALSEDHQQL
                     FVADALKTQEVLSVNDGSTLSKLHYITRFKWFRQALFMPNSRYLVTSSPKAELTVWDV
                     LSGQERMSWQIDTHSMGTTLLDMVVINDQFVTLSSEGVIETWPLISTLTDL"
     CDS             complement(264066..265070)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34640"
                     /product="hypothetical protein"
                     /protein_id="BBN83479.1"
                     /transl_table=11
                     /translation="MLRYKMRKHVVFTFLFLLLLSGCSKDVAISEGVVHQFEIEPLLM
                     GQISDDGRLLLTVNTSEQVKVWRTASKQVEYQVPEKELLKPVRHALLSRDNTLLLMAN
                     YDTLGVWSVAGKAFIHKVQFSGVDPMAVISHIALSPNNGRVLVAMTDGSLNMADMNTR
                     LNNRFKPHERPIDFLSFGNQGELFLTGAQDGKVALWQFGSPKAMFEKEFAHRVTSLSV
                     NKDFSRFFVSDGLNAQHIKTLTQGEEVAKLNYSARFKVFRKSLFISNADLLATSSSKS
                     HLTLWHTNTGDELGTWTIQTQREGATILSMHATQTGTLYTLNSDAILESWDLSALRQL
                     "
     CDS             265295..265774
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34650"
                     /product="hypothetical protein"
                     /protein_id="BBN83480.1"
                     /transl_table=11
                     /translation="MNTLTNEPIELLPVTYLLKPNKPNQLGDLSVTLQLLINPIANHL
                     NGVSQVYSSTSTSVQSSVFGDWQYIPSVNKPSILIVLSGACLSKVLFDGEAKEYENLK
                     VRLLLNEDWQFGYGMFEYKKEGAWHKIATAVAQLDTRTGNEKLDKLYTLTQSTKAGL"
     CDS             complement(265817..266665)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005456619.1"
                     /locus_tag="PA25_34660"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBN83481.1"
                     /transl_table=11
                     /translation="MYFKHAAQLGSFKLAAQELFVTQAAISQQIRMLEAHLGCMLFVR
                     ETRKVKLTRQGEQLLPHVLGAFSQFEAGIKALKHDPSPHTLNLSVLPSFAACWLLPKI
                     ADFQNKHSDIKLRIDPSDRLVNFEQGEADLGIRFGEGNYRDLHSECLGDDHMLLVYKK
                     GMLDDSVSLKAQLLKHQLIMDVCPDAQRAWQLMLGNLGVLKKQQPSFLEIDNAALVVQ
                     AVLSGQGVGMLRRRLIEPVLENQQLEVWPNFELLCDYKYYLVGPENHFSWPKVGAFKS
                     WLQTHF"
     CDS             266809..267114
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34670"
                     /product="hypothetical protein"
                     /protein_id="BBN83482.1"
                     /transl_table=11
                     /translation="MKSLATLLLVLFTTASYANTQATEQINTTEGYPYKNVIHKAQRV
                     ELHYSELDNGIECHVNVISDTLKHSSAPQKVSHKKFKHSPMAACLTRATAKQILAKL"
     CDS             complement(267235..268329)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34680"
                     /product="hypothetical protein"
                     /protein_id="BBN83483.1"
                     /transl_table=11
                     /translation="MCRFGDKFVVSLSFRFVPLAKKRPHWLVYCAVVSIALLSIFISN
                     GEFVSVYLTPAESSKQTIELHRNVVVKPELTQATALNKHPVSHGADHYCNMDGFIKKQ
                     QQRAKHLQSMLSAEFKQTQHVFSVNSGPTVILSVYYTQLSELALDMIIERLSMVHDMY
                     SQLLPNSQGKTVTLNLIVLSDRTQYEDYTSRYGFDPRTSQGVFFHGSNSAFVEFKNDK
                     QVIKTAIHEAIHAMNLRLIGLTPRWLNEGMAQLFSSIEMQNGELVFAVEKKALSLESH
                     DIYSLLASESQWESIDTNKLYYSGWSWLRFMMGDEQGAKTMAHLLRLESSNPCNVLSA
                     DETYQLLQGAFPTFEQAFYDWQQRLDRSAQ"
     CDS             complement(268366..269736)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013224881.1"
                     /locus_tag="PA25_34690"
                     /product="aspartate aminotransferase family protein"
                     /protein_id="BBN83484.1"
                     /transl_table=11
                     /translation="MQFNDENRQQIFASLQYFFEKFHQQLDTSAVASKQTQLPDMPLS
                     AHPRTLSALNKIIEEQLSEHVSGSNGPRYWGFVTGGANPIATYADWLVTTYNQNLSKG
                     GDSIASSFERQAINWLLELFSLPAQFSGLFTTGATSANLLGALVARQFAGSQQGIDIA
                     KQGMFALDVQVFSACPHASMIKSLGLAGFGQNTWQPVACLADSEAMDVEALREALLNS
                     NAKSKIVLASAATVTGTDYDDLMRISELCKTHNAWLHVDAAFGVFERLVSGPNGKTKG
                     LERADSITLDCHKWLNVPYDCGVFLTRHHALLKQTCHVGAPYLVQGEEFDDYMSLGIE
                     NSRRFRAFPAWCTLFAYGKSGIREAIESNIAQAKALAKWLDSSPYYTLLKPCELNVVV
                     FAPSVKHPLSSSSECLRAINNSGEVFVTPGLWQGQATMRAAFSNWTTQMKDVERSVTV
                     LEDICK"
     CDS             269830..271218
                     /codon_start=1
                     /gene="ydcR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014208000.1"
                     /locus_tag="PA25_34700"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BBN83485.1"
                     /transl_table=11
                     /translation="MNKTPTYQRLANHIIDDILADKYTCGDALPSLRIFAQLQQISMT
                     TALNCYRYIEQQGYAVAKPKQGYFVTQPYRANSGYQFPSFIATTTQLDKRHSEYFIAE
                     HSFATAQLDEALVDKTGFQKCWQHIGKDPSLTLGYADIRGEEKLRKALSEHFLKQGFT
                     THYEQLVITNGCLDAVLLALEVVSNKGDTILVSSPCYSGLLDILKLLERKVLEVPSTI
                     DGLDIEQVEQAMQRQQISACLISANHQNPTGHSLSTEQKQKLASLAEQYRTPIIEDDV
                     FRELSHSPVIPLPIKHFDKSGWVLWCSSVSKTLAAGLRVGWCSPGHYYEKYIEQRKVR
                     TLGVNQPIQLALARYIQQGYYQQHISSVNRHLVEHLKTYSQVLTDSLPNTCQAYSPTG
                     GLVIWLSLGKLNAFKLSRLLWQQQVFVRPGTDFTTTNEYQNCIRINFGLRPSNETLTK
                     LNMLVDVIKAQS"
     CDS             271280..272668
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011089359.1"
                     /locus_tag="PA25_34710"
                     /product="MATE family efflux transporter"
                     /protein_id="BBN83486.1"
                     /transl_table=11
                     /translation="MQDLTKGPIAKHIVTMALPIAIGMLIQTLYFIIDLYFVGHIGGA
                     ALAGVSTAGNLFFFVMALTQVFNVGCATLVAHAIGRKDKPLANKIYSHALFYALLMTL
                     LSVVLGYGFSDNYFAATAADQATFQACIDYFYWFLPALALQFVLTVIAASMRGAGLVK
                     PFMAIQMFALVINALLSPVLITGVGLFTAMGVSGAGLASSISAFIALLLTIKYLRSNT
                     QTLQLDLRAISHHGPTLTQLLKVGIPAGSEFMLTFFYMAVIYWALADFGAAEQAGFGL
                     GSRIMQSLFLPVMAIAFAAPAIAGQNYAAGKPKRVYVTYKVSTLCTVSLMAIISIPCI
                     LMPQIFFSPFTDDAEVIRAATTFLSFIGLNFVPAGLVFSASAMFQAFGNTWPSLLGTT
                     VRVGSFCLLLAYYLSQQALSITTIWTISVVTVCIQAVLVFAMLQLTLKGRIFSKALKH
                     KPTEDAAPQAAI"
     CDS             complement(272722..273702)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010966221.1"
                     /locus_tag="PA25_34720"
                     /product="hypothetical protein"
                     /protein_id="BBN83487.1"
                     /transl_table=11
                     /translation="MKTSCFKKSLAVLAIIASCNASALPRCADATWMEIDYAKPQLPD
                     TGYRNGLNRFITWLPSFHMIHDVVVAKGNTATLSAKFDYGAVAHKDLEYETVRFYIRG
                     EQDSQWQFLSEQVTNSDGKAFVTIPALPAGQYRIYAGVPADGSGTEGFVTVVDPNTPA
                     VLFDIDGTLTLSDEEAIGDYTGIDRADAREGAYSLVRRYMDLGYQPVYLTARVYWYAK
                     GTRSWLDWLGLPEGILRTTMSNETSLYRTAEYKIEQINRFKAQGLNIVRAYGNAKTDA
                     EAFIKAGLGSQNSFTIGEDAGHYGTTAILNDGYSEHISQHVDNFTQAQCE"
     CDS             complement(274415..275812)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34730"
                     /product="hypothetical protein"
                     /protein_id="BBN83488.1"
                     /transl_table=11
                     /translation="MLPSNIKRHAVSLVVASTALVVFAPAAHAYSKEACNLEPSWFAN
                     PVPNPNEGPNSPFAFKDGKDNSSNCDFHQWSWNKFLYLTQSAKASGGLFMFGNGFWQV
                     DNALKPYFEPWNDLLNPTGLMPTKHLILEDFNQAGRGDPIIYSKYGGKSVYFSIHVND
                     TFMKSAMEHPTADPNAEFAVGSVEMKVAWIDVKDLQQVYKGVDLSKQFYIRKAVYKTD
                     NKYSDPTDVAMIGMHVVGVVEDHPEFIWATFEHKLTAPDYYKSGMEFQKSEEYLQQDK
                     VVSTSDNYLLYKGGTEVQNAHLSYPATEKHTNSFRLYQYGVPNGYPYTNSSNSSLGAP
                     QSQQERDVENYKNIARLNSEVTAKLAQSNPVWSNYFYAGSVWLSTLGYNFDNGISGDI
                     VGKDRNDKLRGSLAVANMTMETYTQTFSTTTGANPQIKPENCFACHGISKGQSTMQVS
                     HIYNNYLKWIKTAQQ"
     CDS             275997..277475
                     /codon_start=1
                     /gene="dgt"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9I4L1"
                     /locus_tag="PA25_34740"
                     /product="putative deoxyguanosinetriphosphate
                     triphosphohydrolase"
                     /protein_id="BBN83489.1"
                     /transl_table=11
                     /translation="MNFNTKINLLRPHNPMKTLQGSLESDRGRIINNAALRRLQQKTQ
                     VFPLERNAAVRSRLTHSLEVQQNGRFIAQSITKELQRRQLAPELHSELGAALETLVEM
                     ACLMHDIGNPAFGHFGEAAINDWFKRYLAQHKTYADNIAQLNQSEQPNLCSLENKLLF
                     DVCHFEGNAQAIRIVHTLCGLNLTYCQTASILKYTRCGTDPKPNKTEPLSYLQKKVGY
                     YFSEQTFVHTLCDKLQITPGHRHPVSYIMEAADDISYCLADIEDAVEKGLISVEKLMV
                     VLNQEYQSQLKALPECQQPYADFIAQKCQYAFDKASANSANFNNEFFIWLRVSLTHPL
                     VKHATQRFVDNLEAVYHGSFNQALLEDDSYQFAITQALKNVAFKHVFNHKEVEQLELQ
                     GYKITSGILSEYQRLLDLNAEQFATVINKSKDYPVEVRLLNRISGKFVAVYQQTVEAL
                     SEDQQQNPIFEFYYRCRLLQDFISGMTDQFAYDTYRALMVAD"
     CDS             complement(277643..280066)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34750"
                     /product="hypothetical protein"
                     /protein_id="BBN83490.1"
                     /transl_table=11
                     /translation="MFKQYLSSTLFESCIKKITLNKSLSSNEAEYLYSVAIVFLNVYE
                     KDKRKRTYFDFSYYIILLVSISIKDYRALHHFSLSFGLYPISSHIKRFKLIDDDSLEE
                     VLIGEQIECYKSDGIVDTHEQNTARDLILEKQAADLAFIAPTSFGKSSTIVSLIKKNN
                     KKRFAVIVPTKSLLAQTFRKLNAELPDRNLYFHDEMFVNCNDFVAVLTQERALRALKK
                     QGVSFDFLIVDEAHKIFDFNSRSILLSRLIKRNKRLNPSSNTIYLSPLISDPNNLAID
                     IGQRFEEARIEKNVKEVRAKLHDEDHKNYVFNRYVQKFFYESDSIDYMSYILENKKEK
                     NFVFLRTPRKIESFAKEIAANLPDKNNAYLNEIAEIVSRYIHEEHFSVEYIKKGLVYI
                     HGQMPDILKEYLEYKFGVEARVSFLIANSVVLEGVNLPIDNLYMLDLRGVNDSDLINL
                     VGRVNRLNEVFSEKDKNLDKLVAEAHFVHAGNYTTCSMKNKVEQLKSRLKKDEVKNPL
                     LLNHDMKKIESLAEKSNEEGENAKLKLVRLNQVLENENYLDLNYLDDSDIAVHLIENG
                     VSSHYSNQGSVLDILRSRALEFRGTESWHNLDVLDKVYHFFIKGLDAYLTKWFVRLSH
                     FRFENTREYYRAFIRNLHQLTLKEHLQKQIRYQYQIKSTEKGRLFFIGESFGEISKDE
                     GNKLYVDLTDKSRKEMVNLALIKIKLEGDLVAYKINILVEVLYRSKLLTDSEYNLFIY
                     GTNNVVLNSFSKLGISSRLLRKLEADGQFRNIKIDNNGHIDINDEFRDYLLKQDDFAK
                     FEMLKYLNV"
     CDS             complement(280068..280838)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34760"
                     /product="hypothetical protein"
                     /protein_id="BBN83491.1"
                     /transl_table=11
                     /translation="MREDMKNNVKKVKIDSSSELHLIDFSAYSEDFIKDFESHLSSIC
                     VGKLGKKLSLIKLRLREFLYSKDDNTRSGAIAELFIAYYLKNAGYKQEYLFFNLEEGS
                     IKKGFDGVFSMKKKSYLMESKSTLPSTKNKSHRSKINEAYTDLKNYVEGRSKKGKNNP
                     WRNAYNHASHCDVKTSQSIKKKLDKLADKFDERKYIKVRLVNIIPCSTIFGLTKDACP
                     NQVAEDDYDYIKNLEANSKVILCIKSRNINDFISYLEN"
     CDS             complement(281024..281242)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34770"
                     /product="hypothetical protein"
                     /protein_id="BBN83492.1"
                     /transl_table=11
                     /translation="MRLKEALSVLSNPSSDMNKFILLPCVNEQDVFRVVKRSRPFTNR
                     TIRLNIQRIFKYLMPNITLKKKKNLQVR"
     CDS             282045..282476
                     /codon_start=1
                     /gene="ntpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002240378.1"
                     /locus_tag="PA25_34780"
                     /product="NUDIX pyrophosphatase"
                     /protein_id="BBN83493.1"
                     /transl_table=11
                     /translation="MQLRKPISVLVVIYNKAKEFLLIRRADDSTFWQSVTGGVEPNES
                     LLDTAYRELKEETGIDARALGIEIKDHHSTNQYEIRPCWRHRYVEGAKINTEHVFSIC
                     VPNNIQITLDPNEHTDYQWLPQSIAAKKAWSASNQKEILNI"
     CDS             complement(282580..284649)
                     /codon_start=1
                     /gene="pepO_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070787.1"
                     /locus_tag="PA25_34790"
                     /product="peptidase M13"
                     /protein_id="BBN83494.1"
                     /transl_table=11
                     /translation="MKKTTLALAIGVGIAMLSGCSQQLNSSNTTQSAQSLAVANTVQS
                     GIDTENFDQSVRAQDDFFRHVNGKWLNSTDIPSDKSAWGSFYKLADDSDKAVNALIQE
                     AKDSAAQPGSSAQKIGDFYASFMAEQQLNELGYEPIKPLLEKIANVKNYQQLSALMGE
                     LSRYNIQVPVGLAVIPDGKDATTNALYMWQSGIGMPDRDYYLKEDEKSAELRAAYLAM
                     VTEKLQLIGEPQAKKKAQTILELETKIAKIMWDRTKTREISLIYNPQTPQQWDKTLGQ
                     LDWPKFAQALALPQMDKVIVSQPSFFAELGTLFSQVSVSDWQDYLKYQTVNEFSNLLS
                     EPFAKSHFEFYSKTLRGVTEQQARWQRGVRLTSGTLGEEVGKLYVEKHFSPAAKDRME
                     ELVKNLIEAYRISINDLDWMSDETKQAAQEKLSKFRYKIGYPNKWREYNFEIKADDLV
                     GNVMRAAEFESTRQISMIGKPVDKEQWEMTPQTVNAYYHPLKNEIVFPAAILQPPFFN
                     MEADDAVNYGGIGAVIGHELGHGFDDQGAQFDGDGNIRNWWHEADLAKFKTRGDALVE
                     QYGNYKPFDDAHVNGRLTLGENIGDLGGLTVAYKAYQLSLKDKPRQVLDGYTPEQRFF
                     IGFAQVWRAKVREAALRERLVTDNHSPAEYRANGSLTNFTPFYEAFALKEGDKLYKPE
                     NERVKIW"
     CDS             285009..285962
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003811759.1"
                     /locus_tag="PA25_34800"
                     /product="paraslipin"
                     /protein_id="BBN83495.1"
                     /transl_table=11
                     /translation="MDPVTQLFETLYNIEVLLLVFVLVVLKSSIKFVPQNRAWLIERF
                     GKYQSTKEAGLNFIVPFIDKVAADRSLKEQAVDVPSQSAITKDNISLIVDGVLYFRVL
                     DPYKATYGVDDYVFAVTQLAQTTMRSELGKMELDKTFEERDLLNTNIVAAINSASEPW
                     GIQVLRYEIKDIVPPNSVMEAMEAQMKAERVKRAQILESEGDRQAAINVAEGKKQAQV
                     LAAEGEKAEQILRAEGEAQAIIAVADAQAEALRKVGEAANTEQGQKAIQLDLATKAIA
                     AKEAIAKESSVVLLPDAGTDASSLVAQGMSIISSINKQQKG"
     CDS             285967..286419
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34810"
                     /product="hypothetical protein"
                     /protein_id="BBN83496.1"
                     /transl_table=11
                     /translation="MELVLNNLPQSLIIIGILALIIEVAVLGFATFVLLFLGLSLIFS
                     GTMMYAGLIANDWMTALWVNAVFTFALALILWKPLKRLQQPSNDEQLNNDFADIDFIL
                     EDDLHDNSQVFHSYSGIQWQLKSKQPLSKGTHVKVVKKTVGVMWVKAL"
     CDS             287061..287219
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34820"
                     /product="hypothetical protein"
                     /protein_id="BBN83497.1"
                     /transl_table=11
                     /translation="MKTSIKLNIKAKKLKELSKDKAKLVGGGALTTKEPQQQGSHYWS
                     TYVTCINC"
     CDS             288152..289798
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261722.1"
                     /locus_tag="PA25_34830"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BBN83498.1"
                     /transl_table=11
                     /translation="MMDFLTKMTVKSRLMTGFGFILALLILLTVQGIQKVNFINSTLS
                     EITDINSVKQRYAINYRGSVHDRAIAIRDIAIADNNAQINQFVQEIKELEKFYRDSES
                     KMNNMLRNNSSQFASQERNILSRIDDIQDQTLPLVNDIIAAKKAGQDVLKQVLNEARP
                     AFIDWLNTINEFIDYQENQNQQATPEARAVAGGFQNLMLILCAIAIAVSIFVGLLIER
                     SLRATLGGEPFEAQKAINVTAGGDLTQTINSRYPNSIIGSIADMNKKIISIVSNIIDA
                     SNSVATQVEHVSQGSKDVLNAAKNQAKLTSQTAAKLSEMRESIDQVSQIAHHTEENSE
                     LTAKYAEQGREIVDATATEMEKISQTVNTTVEQISKLEENTKQIGGIINVISGISEQT
                     NLLALNAAIEAARAGESGRGFAVVADEVRQLAQRTGEATSQIESMINDVQAQTVASVS
                     AMETVRPQVESGKEKTMKATELLLNIEQQASDSLKRVREVAQASSDQVAVISDINSTM
                     EKIAAMSEDFIDSMQQNDASTNTLAKLSTKLKKDISFFKI"
     CDS             complement(289861..290931)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010920312.1"
                     /locus_tag="PA25_34840"
                     /product="lipase"
                     /protein_id="BBN83499.1"
                     /transl_table=11
                     /translation="MYKAIILLSVLFSTPLFAESLRATHHSVVYEGRVVKQYDQGHVS
                     INWPGSNFKTKLTGQSLHVTMVGLGNQFDVLVNGQPHKKIVTDYSGQPQKFELYRSDT
                     PKTVEIEVVKRSEDTNNFSEIIGFDVEGNLEGIWQQQKHILFIGDSISAGFGSESNKR
                     ECTWQEVQQTSNARLAFPYVSSQMLNATLTQVSMSGLGLIRNWSGNQAHHTITHYLDK
                     AGALFEDSREFEDRFPNLIVIEVGTNDFSTDPQPHEPWQTIEEVKQAWIKRMVEFVTT
                     IRGRYPKQPIVFMPRPAYPYNFIIPATEEAISLLKAQGQSDLYSHTFYSQLSGCVWHP
                     TEQEHKAIAQQLVDFINTNKVL"
     CDS             complement(291116..292576)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012640003.1"
                     /locus_tag="PA25_34850"
                     /product="alpha/beta hydrolase"
                     /protein_id="BBN83500.1"
                     /transl_table=11
                     /translation="MKFKAAVLTACVGLTGLNQLAWANTNPYKNEKEIEFVANSGEKT
                     QAFEGFYMVRENRDDPHSRMIRVNYVRFAATGKRKGAPIVYLAGGPGGSGIATAKWRR
                     FPLFMGLREYGDVIALDQRGTGASEQPEVCTSDIKIALDKKASAVTIASKYHQAANQC
                     LANWKSQGIDVKAYNSVQNAYDIDSLREHLQADKVTLWGISYGSHLALTAIKLFPERL
                     DKVIIASAEGLNQTVKLPAMTDKYFAQIQTVIDQQPLKKLVPNLPALMQRVHGKLDSA
                     PITLQIPNKDGSERAILFQTHHMRMLASMMIADPNHYLAMLIHIYLGLDGGNTDLLVN
                     VLQRGIFKDEAISFRLMPLVMDVASGITEARLNIVKQQAKTSLLADKLNFPMPMLNRF
                     EATLDLGDRFRKAPQSDVATLLFTGSLDGRTYPKEQQAAVAGLSNLTHIMVNNAGHNL
                     FTSSADVLDIMKLFLAGEKVQQTQIDLPLPDLSLKK"
     CDS             292722..294284
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010918439.1"
                     /locus_tag="PA25_34860"
                     /product="hypothetical protein"
                     /protein_id="BBN83501.1"
                     /transl_table=11
                     /translation="MTKITSVNVILVAMLYVFSFMVYAQDKLLFLPYNHAATICPVEQ
                     TTRLLEPAAPSFTDADCKLLTVKDINPQANNIWVKINFDVPKKWQQVKPPLGFYISGK
                     AASRVYLNSQLLGTNGQPETTLASAHTDEVAGKMDSVFYVPNKLIKLKNNELIMHLSG
                     RNSIIELDSPMHLLTLGPFGSPKRFIQNYSEVGLILVGAFAVGTLYFLVLSFGNRDAG
                     TYRIFTALCLIAACQLTAEISRKLFDYSYQWHDIRLVVITALSFIFGTLVLLYSARKL
                     AGKHAVHWVYIGVLLSAITLIFAPGFDTKTTAGIFIPLLVSLVLLLYYWINTKNTQTL
                     RWLLFQFAVVVTIVISAASFHEIVHFVIIGLLLSYLFVQQASDVRQQQKMLHQEQTRL
                     AKLEYKLAQNTQLNAPTKLEISVAGKTEYLNATDIAYCKAAGDYVELYLNDQSEKLFS
                     GSLKHLESLLPETFLRVHRSYLVNLAEVVSLTSNLNQEGNMSELTLSSNQTVPVSRRL
                     LPTVKDTLKQQI"
     CDS             complement(294715..296289)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011705620.1"
                     /locus_tag="PA25_34870"
                     /product="alkyl hydroperoxide reductase subunit F"
                     /protein_id="BBN83502.1"
                     /transl_table=11
                     /translation="MLDQNLKNQLKSHFSALKDPVELVIALDDSNKSKELETLANDFA
                     SLSDQISVTNNTDISVRKPSMTVHSPVRDTDIQFAGVPMGHEFTSLVLAVLQTGGHPA
                     KASNDEIEQIQALDTQLNFEIYISLSCQTCPQVVQALNLMAAQNPLIKTTMIDGALFQ
                     DEVNERNVLAVPAVYLNGQLFSQGAVTLTDILTKVDGNGAAKQAQKLNDKDVFDVLVV
                     GGGPAGASAAVYAARKGLNTGVVGERFGGQVADTMSIENFISVKATEGPKLVAQLEEH
                     VKQYDVDIMAGQRAAKLSTDTLINIELESGATLKAKSVILATGARWRNMNVPGEAEYK
                     GRGVAYCPHCDGPLFKGKPVAVIGGGNSGIEAAIDLANIVEHVTVLEFADTLRADDVL
                     VKKAQSLSNITIIKNAQTTEVLGDEKRVTGLRYTDRVTQQQHELTLAGIFVQIGLVPN
                     TEFLQDSPIALTKFGEIEIDNKGATSVPGVYAAGDATTEPFKQIIIAMGSGATASLGA
                     FDYLIRHSEEKATRAA"
     CDS             complement(296359..296928)
                     /codon_start=1
                     /gene="ahpC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071237.1"
                     /locus_tag="PA25_34880"
                     /product="peroxiredoxin"
                     /protein_id="BBN83503.1"
                     /transl_table=11
                     /translation="MTTSLINTKIQPFNATAYHNGDFVQVSEKDLLGKWSIVFFYPAD
                     FTFVCPTELGDLADHYAQLQDMGVEVYSVSTDTHFTHKAWHDASETIKKIQFPMIGDP
                     TGRITRNFGVMIEEDGLALRGTFVINPEGEIKVVETHDLGIGRSAKELLRKVQAAQYI
                     ASHDGEVCPASWQPGEETLAPSLDLVGKI"
     CDS             297190..297615
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34890"
                     /product="hypothetical protein"
                     /protein_id="BBN83504.1"
                     /transl_table=11
                     /translation="MHPYTNHIQLGYYGVLPFLACVFWPLLLGSSAQAVEAFSFYSMG
                     ILAFMAGTLWRSGEQSYTHAVMAVLVVIPFPLLAVASATTTLIYLAICYPIVLLFERG
                     MPAWQSHHKDYHKMRFILTSVVFVCHLFMIAQSIELTRG"
     CDS             297682..298494
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34900"
                     /product="hypothetical protein"
                     /protein_id="BBN83505.1"
                     /transl_table=11
                     /translation="MIQKFLIAFVWSLGALFLFWTITHGDIGLDTIEEVLWFCLSITV
                     VVVAAPQLNSKPLIYGWSCYCLGLLLDVFDGYLDFTVPFLLLDTSLKSIGFILVCYGM
                     LLLLASKKATIAKLNLEIAAKQQLEEKLRYEAHHDPLTKLGNRKACFDKFDELSGQYK
                     WLYYFDLDNFKQANDEYGHHIGDKVLELFGKALTSQFTHEAVFRLGGDEFVAFSNYAP
                     DKLENLRDNLTDPMKQYQVSTSIGSTKTDPKLGPDKILRQADAKMYRDKSRD"
     CDS             298572..299372
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34910"
                     /product="hypothetical protein"
                     /protein_id="BBN83506.1"
                     /transl_table=11
                     /translation="MILDKHWRVLTVGDGDLSFSHALHLLMSNGHVTASTYDSEQTIR
                     DKYKYHALELLAKENVPYFAEFDVKNPQAWQRLAPKKYDLAIFQFPLIPAFSSHKAFA
                     ESELTVNTLNRALLRQFLDNAYRFALDPNGPMLCYITSKDVKPYCEWDLEGTLTKHAQ
                     MQYLGQLPFNIDQFPGYKIRNVDRDKHVKDTSGITYVFSAKSNPKISAQLTTPEYLGD
                     NHCSICRAGPFHSEADKLAHQNAKKHKTMQKHQQAWLDYLHGYKNSHL"
     CDS             299573..300427
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001142129.1"
                     /locus_tag="PA25_34920"
                     /product="threonine transporter RhtB"
                     /protein_id="BBN83507.1"
                     /transl_table=11
                     /translation="MKLTNRDFLFAVLCLLIAMVTIQSGASIAKQLFPLVGPEGTTAY
                     RLGFSALILCLVFRPWRHIPANKQSILVYGLCLGGMNITFYYAIERIPLGIGVALEFT
                     GPLAVALFASKRKRDYIWVLFALLGIVLLLPDMSAADGLDPIGVLLALIAGACWAGYI
                     LFGKKTGNQGSGGTTVALGMSVAAIAVVPIGVASQGSALLNWELIPLGIMIGILSSAL
                     PYSLEMVALRNMPAQGFSIMMSLEPAIAALAGFIILGELLSLWQWLAIFMVIIASVGS
                     SLATSKAH"
     CDS             complement(300424..301086)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34930"
                     /product="hypothetical protein"
                     /protein_id="BBN83508.1"
                     /transl_table=11
                     /translation="MMEQILSDTYTFTLSNEVLRVFDNAKAMLFPAIRLDKPPWCVQA
                     HPIEQKLLTLCYGGAGIDVWDLHSASLLFSVNTREAPNEFIMSNSGRYVVIRACWDAI
                     SSSGTCLYLVDLQRKKSDIAPYTIVAIPFEYPYEFDPKIYFSDDEQFLYLIWDDEFEQ
                     QSDVVNVCYHLPNEELDSLGEQKVSHERLPTKPYHPNYYPQDLVSNLSELAILKNGQY
                     FY"
     CDS             complement(301183..302142)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013222113.1"
                     /locus_tag="PA25_34940"
                     /product="interphotoreceptor retinoid-binding protein"
                     /protein_id="BBN83509.1"
                     /transl_table=11
                     /translation="MKTIRLFLSTVLCVWCLFFSSINEANVSVHSDKLLASERLAAIN
                     QIAQYIDSSYVLPDVGTDVVAALKSAQNIGRFCHINSKKQFIEEIGQFLREQSKDGHL
                     GLTFMRSDKKVTHVLQEHDEKRINNFALEQAKVLPGNIGYFKLNKFHPNEQAKQIASF
                     GLNFLSNTSHLIIDLRQSTGGSMELVTYLVSHFIQKDIHLWDIYERDELAYRVHSHAV
                     DREPQLLSIPLTILTAKTSISAAEFFAYTLQHLGRARIVGEQTEGLAHATGARKVNDW
                     LVLRLPLMRPVNPITNTNWEQVGVKADKEIAKELALDWVLNTL"
     CDS             complement(302303..302713)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_34950"
                     /product="hypothetical protein"
                     /protein_id="BBN83510.1"
                     /transl_table=11
                     /translation="MPYKRLLAKFMIVLGVATALLLYGLLLSSVAPSGSSDITQAKTA
                     APYIYKSDLKSLVQITQLSKAQQFLHELQSSPTVVLLFLFAFLSVRLLPYKALLFLHL
                     QPWYWHCHPPNKLRVSLWRDSNILIRQTRHSLDL"
     CDS             complement(302717..305233)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011035989.1"
                     /locus_tag="PA25_34960"
                     /product="hypothetical protein"
                     /protein_id="BBN83511.1"
                     /transl_table=11
                     /translation="MKQIWLLGLIIVTLVPAFGKAEQPAGYQAPSPAIAKLVDAKLIP
                     SSFLSADGRWLALLERQRVVSLSDLNRPEKALAGIKFNPQTFMRKSRHTYVSLEFKHV
                     DTGSVLRPSGLPANGVIRFPKWSSDSRYLAFVVEQQSDATLWVYDVKERESTQLTQST
                     LNGVITKIPYEWLPDSKAIVVNFAVNHGQPALQPTAQKVVPIIQQSRGEKAPVRTYQN
                     LLRSPFDEAQFKFYAQGQLAKISLNAKARAIGKPTLVKSFSVSPDSTSLIVGMIAEPF
                     SYQVPYERFASVWQIWGMTGFPLYELAKQPLAENIPQGFDSVRSGPRAFQWRADEGAT
                     VVWAHAQDEGNMKNDVEHHDYLYSISAPFKREPELFAKVEHRFSSILWADDEVALLTE
                     WRFSDRTVRTSVITPRAADLNRVVFSERSYNDAYKNPGNFITTRSDLGSEVLKLVGGR
                     YLFLHGKGASKEGSRPFLDRYDIKTNSSTRIWQSQAPYYERIKGLLDDEGMRFVTIRE
                     SKTEQPNFFIRDLNFNTLTQLTRFSHPYPEFNGVKKEQLKYTRNDGVELTGNLYLPAN
                     YDVTQGPIPVLMWAYPLEYKDKKVASQVRESPYEFPYFGYWGPMPYLANGIAVFDDPK
                     MPIVGEGSALPNDSFRTQLVASAQAAVNVLVDKGVADKNKIAIAGHSYGAFMVANLLA
                     HSDLFVAGIARSGAYNRTLTPFGFQGEERDFWQAQDVYANMSPFFHADKINEPMLMIH
                     GQEDPNSGTFPMQSERMFAALKGLGKEARLVMLPSEGHGYKARESILHVLWEQEQWLK
                     QYLFPETLVEPNEAVQQDIQNLDEENNERQLDIEVQSGTH"
     CDS             305607..306770
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011267685.1"
                     /locus_tag="PA25_34970"
                     /product="glycosyl transferase"
                     /protein_id="BBN83512.1"
                     /transl_table=11
                     /translation="MSLLKFFKSQQWHVEFASPAQPTDHMTDLSQYDITTQSIQLNCA
                     SFDEYVQKLQPDIVMFDRFMMEEQFGWRVDQFAPNALKILDTEDLQCLRNARHDAHKA
                     KRPLVQSDLHSDLAKREIAAILRCDLSLIISSYEMALLTDTYKVDPALLHHLPFMVDL
                     TDLPSSLPARNERQHFMTIGNFRHAPNWDAVLYLQEIWPLIRKQLPKAELHIYGSYPP
                     PKATALNNPKTGFLIKGWADDALEVMKNSRVCLAPLRFGAGIKGKLLEAMITQTPSVT
                     TPIGAEGMHLDLPWPGSIATSAQDFADKAVALYNDELAYTQAQIAASNVLNHLYDKTQ
                     LQQQLFEKISLIIKDIELHRQHNFVGQMLKHHTMRSTQYMAQWIEAKNVNKNR"
     CDS             306857..308119
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070677.1"
                     /locus_tag="PA25_34980"
                     /product="hypothetical protein"
                     /protein_id="BBN83513.1"
                     /transl_table=11
                     /translation="MVGHSFTLGFTQLNTATFTQKRKFIVKLGKMLHKYGTPAYRLEA
                     HLMEVATHLGLKSSFVMSPTSVTFVIWTEGHEEEYTHVARVDPGDHDLGSLADTDDVV
                     NKMLSGQLTVEQADAELEAISKQKAPYSKLMTGFAFSVSGAAFAMLMGTSWNDVLWSG
                     LLSIVVFLFVLWSARSKRVTHMLEPLVAIVAAIGACAISSYIDPSVNIRLVVLSAIIV
                     FIPGLALALAFAELSSRHLVSGTARVMDSLMLLFKLYFGAFLGISIGFSMFGITDFVQ
                     PTPLPKWTAWLAILLLCLSLIVIFRTKLKHASWSIASGFIAYAASISAAVYFDYSIGA
                     FVGAFAVGVFSNLFNRIVNAPASIVAMQGLIVLVPGSKTYIGLNSLIEGQSFVHADHI
                     GQQTFLIFMSLLAGLIFANVALPPKKAL"
     CDS             complement(308179..308805)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011036328.1"
                     /locus_tag="PA25_34990"
                     /product="DNA-binding response regulator"
                     /protein_id="BBN83514.1"
                     /transl_table=11
                     /translation="MSNEIINCLLVEDQTLVRMGLKSLLELDEAIHVKDCAENGEVCL
                     TLLAEKQYDLVLLDMRMPEKTGLEVLQTMKSQNNNTKVLIITTFEDCDVLVKAIHLGA
                     RGYILKNAELESLIRAIKAVYGGELVLQETITRYMLKQTAAKTESLTKKEHEVLKCMS
                     LGLSNKAIAEQLNNSEGTIRNHVSTVLAKLNVKDRTQAVVKAINECLI"
     CDS             complement(308798..309940)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35000"
                     /product="hypothetical protein"
                     /protein_id="BBN83515.1"
                     /transl_table=11
                     /translation="MEQTIRHTTDWSYSTIASWLGVTIACFYYADSQLSIFMQTPIHL
                     ALLCLLWFIIKRPNDYVNHAASVYFMLLVWLMQLTTTSLVFIHLVMFTAIFSAHFSAF
                     KMLLCVIAILSAYCITHWQRWEGSIPWATLLVWFFFSLMNWFVSRRIVESLNIHYQSK
                     QNYKELKATQSLVAAMGAEQERLSLSRELHDTLGHKLTALSINLDLAKRQASSETLDA
                     ISLCHRLSQDVLDEVREIVSKQRQKHAVLEDSLEQVFAATPQLNCKLSISDELVTLTQ
                     QQSICVVRFCQEMISNTLKHTKATEIEFTVQIVQFTESNSNAPWLRVSALHNQKEVKQ
                     PKPGNGLKGLGERLEQLSGTFKQSILKDRLISEISFPLTFQEADYE"
     CDS             complement(311310..311768)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35010"
                     /product="hypothetical protein"
                     /protein_id="BBN83516.1"
                     /transl_table=11
                     /translation="MILKQLRLSKHLTQEQLANMAGLNVRTIQRIENGQNASIESLKC
                     LASALDVDIKQLQQEQFMIDKNEDNWQTLPLFLKIWFVFNFLQARPTRRSATRVQFLA
                     HISGFVFCCLGFVSEAALAGGLIMLASGYLFNFLIYQGDKYGIWYDIHTD"
     CDS             complement(312039..312428)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35020"
                     /product="hypothetical protein"
                     /protein_id="BBN83517.1"
                     /transl_table=11
                     /translation="MLKFSIGLLALCLLSGCEMVAKDQPSPLPTALVNEQRALEWFVD
                     NPVEQVIKAHEAEQVFGLIALNRRGYFYPKVGMARGPLSLREGCQTWLIAASDDVLKS
                     DSEREKAAALQAFAAKFNMHMESKCLP"
     CDS             complement(312421..315261)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35030"
                     /product="hypothetical protein"
                     /protein_id="BBN83518.1"
                     /transl_table=11
                     /translation="MNRFLLFLSLLILPFTLHANNVKSWQWQEMSVKSDDLSQVDYLS
                     LYRLDFNRVKSDLLSLANDKTALNVSLPNGQGGFVDYVLWHDSIMAPELQNKYPMIRS
                     FAGHQVGATHNTGRFDVGPNGFFAFYHIDGEALYIDPTNTLYKVYKKTRHNSAWEDEV
                     VTLSQSNMPLGDDHKRGPLISNGGKVEMVTYRLAVTTSDEYTTFHGGKTEALNGVVTT
                     INRVNQIYQTDLSVKFELVANNDTLIFTENDPYDNGNLNDTLSVVQTQIDTLIGAANY
                     DVGHLMATSGAGLAALGVVCADGAKAQGMTGIANPKGDAFDVDYVAHELGHQFGANHT
                     YNGSDGSCTTRVSDSAYEPGSGITIMAYAGICASENLASNSIAMFHSKSIEQMHNHLT
                     QESGATCGTLTDSGNNAPVADAKDNHTIPVNTPFMLTGSATDANSGDTLSYAWEQLDL
                     GAQTSNSTDLKDNGEGPMFRPYLPSASATRYFPLLADVISGQVTKGDGYPTTNRTMTF
                     RFIVRDGKGGVSFDTATVTTVAAAGPFAITAPDENTKAGSNNMVTVSWDVANTDQAPV
                     SCANVNIMQTNSDATETQIIVANTPNDGQQEVTLVGSENNKARVMVQCASSVFYALSK
                     EFELATTLAVTSQQSLSVAEDTSITLEASQFSVVNQQVGSALSLTVLSGSNYTFAGNV
                     VTPASNYNGDLTVNVTLTDGTTSTSYAAKVVVTAVNDAPQVVSQQALSVKEDETITLG
                     VALFEVQDVDSSNFTLAIEAGENYTLEANVVRPTANFNGLLQVPIKVSDQDGASANFT
                     TQITVEPVNDAPVATNDTGEATSGTATTFDVLTNDTDIDGDDLTLSDLIYEGTGTAAI
                     SGNVISYQSADGFSGQEQIVYTITDAGGEMAQAMLTIDVSAPPVVVTPPPANNLDETP
                     DSGSSGGSFGYWLPLLLIGVVSRRNSKRNEYA"
     CDS             complement(315418..316923)
                     /codon_start=1
                     /gene="treA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3CHG0"
                     /locus_tag="PA25_35040"
                     /product="periplasmic trehalase"
                     /protein_id="BBN83519.1"
                     /transl_table=11
                     /translation="MKFEYCTLFKDVQLSGIFSDSKTFADAIPKQSWQTAQQAYEQLD
                     LPLSYCELKGFVEQHFSFALQPELQALSDVSCVKDYIETLWPKLQRHGFSQSNNSLLA
                     LEHDYVVPGGRFNEIYYWDSYFTALGLEDCGSIALIEAMVNNFVNLIERFGCVPNGNR
                     VYYTSRSQPPVLALMVQLLMPYKKSDIEWVKRVVNAMLKEHAFWHQGEQQLADSSGEY
                     KRLVKFANGAMLNRYWDDKAEPRPESYAEDVTDAQQLPVQQREAFFRNIRAACESGWD
                     FSARWLDNPASLLSINTTKRVPVDLNALLYQLEITLSECLLLLEQASHSEEHAKRAGR
                     RKSAILQLLWSNEHGWFCDFDLAKNSISNVLSLAGSVPLFCAIASKQQADIIAKKLES
                     NFLRPGGLVSCLSQTSQQWDSPNGWAPLQWFAISGLRDYGHHKLAENIAQRWLKMLEQ
                     DFAKRGCLLEKYNVCEPNETAGGGEYQVQQGFGWTNGVTSRLYSLYCAMLS"
     CDS             complement(316933..318195)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010958165.1"
                     /locus_tag="PA25_35050"
                     /product="MFS transporter"
                     /protein_id="BBN83520.1"
                     /transl_table=11
                     /translation="MTGAPTTLTNASRARIIFAMMACYFLFAVLLNSVGTVILQSINT
                     FSISKTQAASLEGFKDLSIALMSFLVASMIPRFGYKLALLGALAAVMLACIMTPQLGQ
                     FYAFKLLFAVVGCAFAVVKISVYALVGQLTDSPSSHSALLNTIEGMFMVGVLSGYWIF
                     SFFITDDPQSLSWLTVYYILALLSLVCLLCIAVAPIKKQALPPDSSIVGEFTAMLKLS
                     YQPLVLVFIISAFLYVLIEQGVGTWLPTFNNQILHLPVDVSVQLTSIFAASLAAGRLL
                     AGQILKFCHWYLLLNICLLAMGGLIVLTLPLTQGVSAQDVTSVFNAPLAAYFMPMIGL
                     FMAPIYPVLNSVILSSLAKHQQASMTGMIVIFSALGGTTGSILTGYIFEHFSGQHAFY
                     CALVPLSLLIVFVYLFKQRSTPAQAVAA"
     CDS             complement(318303..319310)
                     /codon_start=1
                     /gene="cebR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011038454.1"
                     /locus_tag="PA25_35060"
                     /product="LacI family transcriptional regulator"
                     /protein_id="BBN83521.1"
                     /transl_table=11
                     /translation="MAQKKLKLADLAKLAGVSTSTASRALNDNPVIKQATREHVQQLA
                     KQHNFSLNTAASRLRLQKTKVIAVVINLDANTEQSIDDPFLLKVVSDINQAVNRQGYE
                     LLLSNSYMAGDDWHGYFIDGRRADGLIVVGQGKHQGRIELAAKLGAPLVVWGDPKTPS
                     DYPIVGSDNYLGGLQATEHLIAKGASKLLFLGDPGHAEISERYRGFNAAIAQSEHVTS
                     PQTIKIDITSHAAYDAINQQLREQGLNFDGIFACSDMVALGALKALKERYVSVPNDVR
                     LVGFDNIAMADVSHPSLTTIKQNTQLAAKILVDKLLAQLNNEVVDSQEIAIELCCRQS
                     S"
     CDS             319613..321862
                     /codon_start=1
                     /gene="fhuA_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011037795.1"
                     /locus_tag="PA25_35070"
                     /product="TonB-dependent receptor"
                     /protein_id="BBN83522.1"
                     /transl_table=11
                     /translation="MRKLKQYSLLASAIAAVLSNQSIAQDSQSKEQKVETIVVSGTAG
                     GRGIRKIDAGFAVTNIDAVKIDKLAPKSTADLLKAVPGIWVESSGGESGANVFVRGFP
                     GGGDAPFLTVSLQGSPVYPAPTLSFLENSSIFRLDETISMMEALRGGPNPVVSNGQPG
                     LTTNFQLKRGHEDTEGTFKYTTSDYGLQRLDAVVSGELSDDLYYMVGGYIKRSSGIRD
                     AGFTSERGQQFTINITKELDNGEINLYTRQTDDTGAWYLPTPLNVEGVDAEYTQLGTL
                     NRQATIYAGTNAQAMEIDLGEGRGWKGHVSGGSIKLELKNGWHFIDRFSLTQGDANTY
                     GLVPAGTATTLSEVADNDVDATGYVTGKTYSADTAVQSMGRWVVLKDIESFTNDLAFS
                     KTFGKLDSAFGIYSASTSAKDWWSLGNAAYYVLAPGGEMLDGIECNSSVEGCAWNYDI
                     NSTGDAKTLAFYTTQSYKATDSLTLDLGLRSERHQVDYSVDENLDSSIDKVVDYSERK
                     TSWTIGADYKLADDMGVFARLNKGYKMPYFDDFRDNYGTYQAGDPLLKEVTQAELGYK
                     FMGDNTDFFATVFKNEVKGDTFVRRPGAPAEVLTNEALGLELDYNYNHESGLSVNLNA
                     TIQDAEITDSPDNQGNDSQRQPNWQLRITPSYDFELAGMFATVYGTFSAVDDRFGNNE
                     NTVVLEGYEKLDLGLIVEPAEGVKLQLAADNLTDEQGITEGDPRNVNSPNGRYIMPRS
                     IKFSVSYSF"
     CDS             321985..322482
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704469.1"
                     /locus_tag="PA25_35080"
                     /product="membrane protein"
                     /protein_id="BBN83523.1"
                     /transl_table=11
                     /translation="MDLATLFSIAPLRWPDIGAAIIAGSIVGLERQLRGKPVGIRTSS
                     LIVLGTYAFIMLSIQVNNEVADPSRIIGQVVTGIGFLGAGVMLSKEGVVVGVTSAATI
                     WMLAAIGVSIAVAGPLVAIKLSVIVVGILYGVDILESSFTNLTRGVHGKYTGWKTRVK
                     KDANK"
     CDS             322469..322936
                     /codon_start=1
                     /gene="soxR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012708212.1"
                     /locus_tag="PA25_35090"
                     /product="redox-sensitive transcriptional activator SoxR"
                     /protein_id="BBN83524.1"
                     /transl_table=11
                     /translation="MPTNNTKRLQDANLTPGYVAKRSDVRVSALHFYEQKGLIRSWRN
                     SGNQRRYKPDVLRRIAVIKAAQKMGVTLEEIKQTLSTLPDSRTPTKEDWAKLSKAWQQ
                     QLDEKIAYMQKVRNQVEGCIGCGCLSMKNCPIYNPDDVLGENGSGALLLGKDW"
     CDS             complement(323434..323904)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35100"
                     /product="hypothetical protein"
                     /protein_id="BBN83525.1"
                     /transl_table=11
                     /translation="MTQKVIIREASEHDHAFIFSLSSYLAEVAQLGWHSDDAVQKMQD
                     EYISQMLAHTSTANKTLIAEVADQPMGFVHVRKHQDGITGESCGTVPLLAVLPEAQGL
                     GVGKMLMAAAQQWAKDRGYRLLHLEVFANNAKANSFYQNLGFKPEMLHMIKVLD"
     CDS             complement(324056..324220)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35110"
                     /product="hypothetical protein"
                     /protein_id="BBN83526.1"
                     /transl_table=11
                     /translation="MKRAGILLEETDQKVNHTNFMQLVSKKTTLMQYWEEESTIYKTK
                     EHVLVIGAVV"
     CDS             324266..326431
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011020540.1"
                     /locus_tag="PA25_35120"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BBN83527.1"
                     /transl_table=11
                     /translation="MKALLEFIKNRNWMLWSLILGIATGVIFGERVAFLQPIGAGFVK
                     LMQITIFPYIVVSLIVGLGKFNPEQVRSILLKAATVMMCLWGVGLFAIWCFTFTLPHH
                     DAGTFFSPTLVTSNNEIDFTKQYIPANPFASLAEGNVPAIVIFCIALGMALIANKRKN
                     AVLEFLDVIGQGLTVISKKIISIFPIGIFAMTASTAGTLSVEELNNLQVYWVLVLCLG
                     LYLMLVLLPMLVAALTPIKYRALIMVMRNAWITAFSTGNVFIVLPVITEGIKDHLRHI
                     KRADEQADHIAEVLVPIAYTFPSLGKLTTLIFVMFAGWLTGNPVGLVDIPNVTLSAML
                     SYFANVHLAIPFMLDSLKIPADSYQLYLSMSVLTAKVVSPTTVVYIFAFVILSIFYCR
                     KQLHLKRLRSVYYLTLLSALLPAFMLASYTFNSHLAKNTQAADEVIANMVVADKVPSH
                     VLSYVPKAYQSGELSLTNIDVIKKRNLLRIGYLTDNVPFSYFNQKNELVGFDISLAHR
                     LASDLDVKVEFIPFKKQQLSEYLNKGYFDIAMSGLEINVADLTKVRFSDQVLQLQLAL
                     LAKDHQLDKFTTLSQIEKQNLTFAHVEYGPLLAKVSKDRPNIRFKQLANLKAYFSQPD
                     KYDALVISAEAGFAWSMFYPEFGVVVPQDGVSKYPTGFAVAKRNYDLLNYLNAWLDIQ
                     QASGQVKANYQYWILGQGSQKTTKRWSLIDEYAPQLLKE"
     CDS             complement(326883..327890)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35130"
                     /product="hypothetical protein"
                     /protein_id="BBN83528.1"
                     /transl_table=11
                     /translation="MRLLLLIVAALVSCSLAARSVNPVGIMNEAEDYLTVNPAHSIVL
                     LEQIEAPIELPDNLFLRWHLLMMRASVPTNQMPRLMDSLEKVFTKADIPYFKSNITSI
                     TSALGIWLRREGYYQDAQISLDCSYKYAQNDRQRLTITNSMALVAREQGNYKKARNLY
                     SRSRLLAQQMQLTPVLAMIENNLGSVALDQGNIDEAEQLFRKALSDYQEVDKLSGKIS
                     AGINLLFIFLIKEQVVNYQRLVEPTSKLTEIFPNQSKQALLLWLDARYKQLQGNDPDE
                     KRALALKAAYEELQSNKVKAQVHKYLASKLNVDVSKPLLPAKQSFEASWFSAVEACNW
                     D"
     CDS             complement(327974..329575)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35140"
                     /product="hypothetical protein"
                     /protein_id="BBN83529.1"
                     /transl_table=11
                     /translation="MKTHETVSGASYFDSLEHALCAYHYAKQAQRLKDINTSQGIQMA
                     KTLLQEETANGLGYQAQLRKEKVHFKLACLLEKSHPELAIQLLEPCESAKSQEKRIRL
                     LYSQGESEYCKQLLYAVLKTPNDEHLLLFAKDFLLRKYGQKRTSILTDLLNENEQLIA
                     IDEAYKGNTEKGVIDHYFNRGIKAWHTENRLWLALFSLVFWQELYDEKQSMPANEFER
                     YPQLLKLNRFYDVLGDKVELKLEFVSQLADISKWLLRQASLSFGKPNPLFQWSDALLN
                     QLFILVKYSSITAIVSLLRAMSKDFQNLKDGYPDLMVLERENLRFEEVKAPGDALRRN
                     QLVSINRLSECGFAVTVQRTSWQFDPNQTYVVVDLETTGGKKETDRITEVGLVKVKQG
                     KIVSKWQSLVNPQRHIPKYITQLTGIDNEMVATAPSFGEIAETVREFCENAIFVAHNV
                     NFDMGFLKYEFQRLNIVFSKPKLCTVQLARKYLPGYPSYSLGSLCSSLEIDLHQHHRA
                     LDDAMAAAKILLLINNLRGTEQVVA"
     CDS             complement(330187..333504)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35150"
                     /product="hypothetical protein"
                     /protein_id="BBN83530.1"
                     /transl_table=11
                     /translation="MTSHLLGKWLRLRSNKLFYAFLIMSLLLSVLISIFLVGQQASRS
                     VTDLQISSSQIEAQLTKNYLLQFIEVREQLLRDLANQPTVIQGVMGSDTSRASLSDFL
                     DGQTLLGRKEPVRVVNILGETVYTSSFGGNFEDNQAPWLQKILIAERRNAIVLIDNGD
                     SQLFKIAVPIRYNGFTEGAIIAGFAINLSDVLLATKEDYSSAMSLKGDWVEYSNLDPK
                     SSYISIGKEEIGSTAIAYEYFVKTSWLEREVTMFKQSIGWAITLSLSLSFGLLLLFGR
                     HLLLNPFRSLEKSEHQAKANETRYKLAVKGSHDGLWDWDLEKQEVYFAPRFRELLGFN
                     SEDLDSFPNTLSALEERVHNQDRPRLREELINHFKYSKPLNIELRIKSLSREYRFYRV
                     KGVALKDTTGRATRMAGSLTDITDQRLYQEALQEAKEHNDMLAEAIESCTAGISIADA
                     TKPGFPLVFVNRAFCDMTGYDKRVLGTNCRFLQGDETDADAITQMRNAIKSHQKLSIK
                     LLNYKKNGDKFWNSLQLSPVFDVSGKLKAYVGIQQDITDRVEFERALEEAKIAAEQAS
                     QAKSEFLASMSHEIRTPMNGVLGMLNLLLNGELEKEQQHRARVALNSATSLLSLINDI
                     LDFSKVDAGKLELEELEFDLRGMLDDFAQAAAMQAQHKELELILDMTGVDESVVRGDP
                     GRLRQILTNLVGNAIKFTEQGEVLVTASLHKVDDEHLRLECAVKDTGIGISQEQQKKL
                     FKSFSQVDASTTRKYGGTGLGLAIVKKLCELMGGRVWVTSGEGQGSCFCFDVIVKVSA
                     VSEHVIPNVNMSKLHILVVDDNDTNREVLTTQLQHWGANTYEADSGKLALETCDTFLK
                     QTGRCFDIAFLDMQMPQMNGAQLGEKLKNSAKFERMKLVMMTSMGGRGDESYFAKLGF
                     SAYFRKPATTSDLFAALSIVADSEQVLSHNRPLVTSGYIKALKDKAVIEPEQILWDDS
                     IRILLAEDNQVNQIVATSMLQKLGLKVIDVAADGCEVLELLKQRREDDRYTLLIMDCQ
                     MPELDGYQATQAIRRGDAGQRYANVNIVAMTANAMVGDKNKCLEAGMDDYISKPISQE
                     ILLEKLMQWLPYTLKSD"
     CDS             complement(333501..334589)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35160"
                     /product="hypothetical protein"
                     /protein_id="BBN83531.1"
                     /transl_table=11
                     /translation="MAALSEVNNQIQGYKLVVVEKDHRGNSNRSFLNMRQFLKDPDAI
                     AILGGLHSPPYIKYRNFINENGILLLVPWAAGGPITRYPSADNWVFRLSIDDTKAGYK
                     LVAHAKQTLKCKSMHALLENTPWGKSNHKTILSAAGKEDALKVTWFNWNTQFNSARII
                     VRDIVNSDADCILFVGNAIEGSHFVNAMASIAEPSRLPIVSHWGITGGNFLSSTKEAL
                     QQGVVLHFIQSCFSLRHYQQQPQARKAVASARAIFPKLTKHIEILPAPTGFVHSYDLG
                     KLLLAAMSNITLSGDIKQMRLTLRNALENIAMPVSGLIKTYQAPFSMWTEETPDAHEA
                     LGLEDFCLAQYANDGGVTLLSEPKQEAP"
     CDS             complement(334889..335731)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005468574.1"
                     /locus_tag="PA25_35170"
                     /product="esterase"
                     /protein_id="BBN83532.1"
                     /transl_table=11
                     /translation="MSSKIYFSKKSGRKPISFYVIKALTGSMARLAPSLGQRCVQKLL
                     LTPVRHQSKALKPAAMREHRLNTLGAPLHIYELGEGPVVLFTHGWSGSASQFYPLMEK
                     VASLGYRAVAFDHFAHGKSAGKIANLPLFVKGVDAVQGFIGEPISAAISHSMGCIAAL
                     NRVNAQSHILIAPPFDFYTGFEERILATGISKNLFEGIIRSVEREHNMPFQSLLPEQH
                     LTKHENVFIVHDLEDKFAFHHLSENVANKHPHLKLLTTQGLGHSRVINDDLTWQSIKT
                     QLTG"
     CDS             complement(335724..336320)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010974549.1"
                     /locus_tag="PA25_35180"
                     /product="TetR family transcriptional regulator"
                     /protein_id="BBN83533.1"
                     /transl_table=11
                     /translation="MRKGKHTKQQVLAIALQIATNKSFNELTIGGLANATGMSKSGLF
                     AHFNSKENLQLAVLDYAKDVFVETVITPAQEASTPLGKLMKMCELWQGWYREQAYSCV
                     FISAAVEFDDQPGAVRDRVKSQLSDLLHYLNGLVQAAIAAQELNTSTNAKQFTYELYS
                     LYLGSQHMTWVGFEDGAHSRFNMALQQLVERHKGENHE"
     CDS             336825..337538
                     /codon_start=1
                     /gene="bla"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q6HFY5"
                     /locus_tag="PA25_35190"
                     /product="beta-lactamase"
                     /protein_id="BBN83534.1"
                     /transl_table=11
                     /translation="MHTRVLLALLIAILGSTHSKAAKIDIQIINDQVYQHTSYQEIKP
                     WGMVATNGLVMIDKNEAYIIDTPWTEEGTEQLVKWLRAKNLTPKAAIISHYHQDASNG
                     IAYLTRNGIPTYANQLTNQLLSKHKRMQSSHSITEPHYSLANQQIEVFYPGAGHTTDN
                     IVVWLPNQKLLFGGCFVKSLDSKNLGNLADANVKQWPESITHLLTKYPNIKQVVPGHG
                     KLGGIELLKHTAQLATNTH"
     CDS             complement(337650..338135)
                     /codon_start=1
                     /gene="brf1_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EHV0"
                     /locus_tag="PA25_35200"
                     /product="bacterioferritin"
                     /protein_id="BBN83535.1"
                     /transl_table=11
                     /translation="MQGNQKIIDLLNQQLTLELTSMDQYLAHSKMYEDWGIGKLGHKL
                     AHEYDEELDHAKNIIERILFLEGKPDTASRAPINVGDNVQQMLENDLAAEMTVAASLK
                     NIIAECEKAQDYVTREMLEKLLDDTEMDHIYWLEQHLGLIKLIGLPNYIQSQMGDGSP
                     Q"
     CDS             complement(338139..338609)
                     /codon_start=1
                     /gene="brf2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EHV1"
                     /locus_tag="PA25_35210"
                     /product="bacterioferritin"
                     /protein_id="BBN83536.1"
                     /transl_table=11
                     /translation="MQGNKQVLNVLNRILTLELTSINQYFLHARMYKNWGLEELNEKA
                     YKKSIKDMKQADDLIERILFLEGLPNLQHLEKLRIGEQTEEMLSCDLAFEMEQIPELK
                     SAIALCEQEQDFISRELLEGILEYEEEYVDWIEAQQFLINHTGIENYLQSQIEG"
     CDS             complement(338854..340431)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001155015.1"
                     /locus_tag="PA25_35220"
                     /product="regulatory protein LuxO"
                     /protein_id="BBN83537.1"
                     /transl_table=11
                     /translation="MCHLDLKPQTLSQLLTLSVTLTRAQPSDLSHTVNGFYSTVIQAI
                     KACINADAVALLLNQTGTLVPVAIEGLTKDTLGRRFELSAHPRLAAICGSAGSMRFDE
                     YCDLPDPYDGLLLANDGDLHVHSCMGLALFNEQALMAVITLDSLTPGSFAKYSESFLQ
                     HVNDIVTEQLKCVLYNEQLLRKAQHGYALVSELSQATHDMVGQSAPMQSLNNDIHLVA
                     SSDFSVLIQGETGTGKELVARNIHKHSRRADQAFVQVNCASLAESLAESEFFGHRKGA
                     FTGADKNREGKFMLADGGTIFLDEVGELPLSIQSKLLRVLQNGEIQPVGADQTELVNV
                     RVIAATNRDLEHEIVQGRFRADLYHRLSVYPIFVPPLNARRDDILLLAGFFVEKVRKK
                     LALKQLTLSNKLEQVLLEYDWPGNIRELEHVISRSALRAKQAQWPADIITIEPEYCEL
                     QSTTLSTITSKPDDKTLFEEKPLKQAVDDFQRVRIIAALEKNNLNWSAAARQLQLDRA
                     NLVRLAKRLNIQVKKYV"
     CDS             340801..342018
                     /codon_start=1
                     /gene="nnrS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072738.1"
                     /locus_tag="PA25_35230"
                     /product="short-chain dehydrogenase"
                     /protein_id="BBN83538.1"
                     /transl_table=11
                     /translation="MRPIDLVEPISKQSLWYHVKQWPIFMLAFRPMFIAAAIWAVISI
                     ALWVGILTGKLGWNSSIPATLWHAHEMIFGFAGAVAVGFLLTAAQNWTNVQSVSGYKL
                     ALLSCIWITTRYVFFAYPGKLALVLSGQTVFWLIAIIYLSSMLLRAKSKSNYIFIAIL
                     CALCTFNLLFFVTLVKTDFELARSFTHVAVLLFMLLIGIVGGRVIPFFTTRGLGLVGQ
                     VRTPNLDRLLLCTSILGTSGFVLSQVFKLPLNPGYLLALAAFIHLTRSIFWFQLRIFS
                     VPLLWSLHLGYALSALGLALLASSFFTARIYFNDALHLITLGGIGLTIMAMMARVSLG
                     HTGRPLSVPITINIAFIAVTLAALCRAFLPGFISPHLAWLYSAAFWCVGFSLFIYHYF
                     TVLTQKRVDGRRG"
     CDS             342038..343201
                     /codon_start=1
                     /gene="hmp"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KMY3"
                     /locus_tag="PA25_35240"
                     /product="flavohemoprotein"
                     /protein_id="BBN83539.1"
                     /transl_table=11
                     /translation="MLSERTISLVKSTIPLLSGAGTAVTEHFYARLFSHNPELKHIFN
                     MTNQQTGKQHFALFNAIAAYATHIDNPSVLQDAISRINHKHMSLNIQAQHYDIVGHHL
                     IETLKELAPQEFTPDIEQAWREAYALLADMFITQEEGLYVHAQQQVGGWRGKRAFKIT
                     DIVQESANVKSFYLTPCDGNAIASYQAGQFIALSIKPTHCDYMQIRQYSLSQSPKAGH
                     YRISVKKQGLVSEHLHQLHIGDLVELYPPAGDFVLRDNPKDKVFISAGVGITPMMAML
                     ERALICQNSRKLLFIHACINKNEHSFKDAIDIKCKQHLNLSQEVWYEQENTTNKQGRI
                     QLDQSDLLLPLEQGEFYLCGPTPFMANIKQQLINLGVAPTQIIYEVFGPHETL"
     CDS             complement(343339..344520)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001077104.1"
                     /locus_tag="PA25_35250"
                     /product="signal transduction protein"
                     /protein_id="BBN83540.1"
                     /transl_table=11
                     /translation="MMLKRIIVIDDEPHYRELIKEFSSLISVECMSFAQWSDEIIEYA
                     DKNTLLFLDIHMPNQDGIDTLMELNRLRIEAGVVILSGAEEGVVASVMKLGEVMHLTM
                     LGQLNKPFSIQRFKEKVAAFQADKRKYADTQLKLGALEITEQELTEFFEKGWFYPVYQ
                     PQIAPKTQTIFGVECLARLDHPDLGPISPLSFIDDLIRLELIDQFTLLLIEKALTELG
                     PYLKKNRHVAISFNVSAMSLNRTFTSNTINLCQELGVSSGQITIEITETKAITLSEEA
                     LYSVSKLRAAKFNLSVDDFGTGHSTMMQLHELPFNELKIDRSFISKITLSSAALKIVE
                     ATIKMAQSLSFNVVVEGIETQTQLDLVSALGNCYVQGYIYSKPIPAQEFVEFSNALQG
                     L"
     CDS             complement(344636..344965)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35260"
                     /product="hypothetical protein"
                     /protein_id="BBN83541.1"
                     /transl_table=11
                     /translation="MIIYYLDDEVALCELFDEFMSGEGVNVSTFNDAQSLIIACQNTQ
                     PDLVVLDYRLTETTGDKVAAKLDSEICKVLVTGELDLPRCDLFTQIITKPYKLSDLKG
                     KLMQMME"
     CDS             complement(344975..346783)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35270"
                     /product="hypothetical protein"
                     /protein_id="BBN83542.1"
                     /transl_table=11
                     /translation="MQSFDYQRFFEISLDMLCIASTDGYFLKVNASFCEALGYLNEEL
                     IGHRVFEFIHADDIEKTQNELTNLACGTKVLNFENRYKHKSGHYLTLVWRAQLDTNSN
                     AILASAQNITEELILNNRLSQIEKALNHSTIMAETDCKGRIINVNDKFCKISGYTKEE
                     LLGKTHAIVNSGHHDRAFFTQMWKTIKSNKVWSGLIKNKKKSGEYYFVQTIITPITDH
                     QGCIKSYLAIRQDITQSIEFESEISRILKILNATSSIAKIGGWELDVRTGELTWTDET
                     FKILEFSKKAGQKPILPEGLELFTSEYKPVIERAVARAIEFGEPYDLEVKALTAKGNE
                     RWVHTTGHANVHEGKVVSLSGTIQDIDEKKKIEYKYKLEKQNSIQQSKLASLGELAAS
                     MAHEINNPLGIISGNTELLLLTEELSQKGRNKLDVIFESCERITHMVKNLKRFSRKEN
                     DTTKKHCDLAQIINNSVAMAMPRLKREQVVLRFYKLEECIIECLEFEIEQVFLNLINN
                     AIDAISRLEQRFIEISMYVQDEFILCRVLDAGCGINKSERDKIFEPFYTSKPVDVGTG
                     LGLSIVKNILSEHNAKIEYDASCTNTCFVLKFPKCP"
     CDS             complement(347080..347994)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35280"
                     /product="hypothetical protein"
                     /protein_id="BBN83543.1"
                     /transl_table=11
                     /translation="MQIFYSTILFFMLLVGLTSCGGDNFPQQPDPDFKPKNTFMRFEK
                     QQAPVVLVDEAHHNFHTIDTRYKAFAQVLKSDGYQVKPNKQRFSQKSLAKGEILVIAN
                     ALHESNSRNWDGPFLSAFTAEEVDAVSTWVNQGGALLLIADHIPFPKAVDELAKAFGF
                     EFANGHVQQMTFSKSNNMLNYHPLLDSTARTGRVTQVKSLGGDAFKVPKAAVNLMQVP
                     AGIMAVLPDRPFAVNDETPRLPIEGWSQGAVLNVGNGRVAVFAEASMFTSQVYMPTGK
                     KTGLVSPGAEQNERFLLNVMHWLANKGS"
     CDS             complement(348040..348744)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35290"
                     /product="hypothetical protein"
                     /protein_id="BBN83544.1"
                     /transl_table=11
                     /translation="MRLSTLDLSQTKQWLSDAQRCEISHIIQSSFAKVAPQEYLAKYF
                     DNAGPYQRKLRLYYHQEKLVGYCLITFSDENNITVIRASAAFLAQYRQGGNTFVFSLI
                     QSVKAWLKRPWRKHYYADTMLSPAMYRAIAKKTAIIWPHYDNPAPKGLFERFNFAGKV
                     SSANALRCLIGVSRTTNYSEQDLVLLKASKKQEIQYYCRVNPDFDKGTALFVIIPISF
                     VQVAKTLIKTLRVGVR"
     CDS             complement(348825..352712)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35300"
                     /product="hypothetical protein"
                     /protein_id="BBN83545.1"
                     /transl_table=11
                     /translation="MTLMSYFFNSNHPRVCRFIKWIALVLFAGIGLTSAHAVYAAANT
                     KPHESTNLYELAELIFQTVGDDNAIPKGAVTSLVQGSKGFIWIGTQFGLIRYDGYRFE
                     RYEYDADRKDSISGNFIGALWAADDGKIWVGTYADGVSVFDPSTNTFSHFKHNASDIQ
                     SLSNNTVRALTGDNLGNIFVATDQGLNHINAKTKVVTRLIQVAGCEVPFKSLRLRSVL
                     LSATKSLWVGGKTGLCRITLPQMLEFEAGTLNGEAVEELNNQNAYRLFMAKNGDVWVG
                     TTDHGVAVIKANTKKVKRINHIPGDRNTLSHHWVNSIAQVNEHEMWLGTPGAGVTVVS
                     ANSGRVIRHINHDPLLETSINLDATSAILVDRSGLVWLGTWGAGLNRYNPHNSALRLF
                     TKSINKANTLSHEDVRCFLELENGHIWVGNSQTGIDIIDPQFGVIGGLRPKPNDPKGL
                     GDGFVRTMEEDRNGNIWVGTANKGLYRYSLADQRFYHYSKEDGLPSVAVVFLLETPEQ
                     LLWIGTSDGVALLDLRTNTLRSLNHITGYQLLNGKSVMSMAYMPDGNVWVGTRNGLFV
                     ISQQNQVVLEVSKIAGTTSSLSGNYVSNLLVDSQKRLLVATSQGLDRLITFDGNTAEF
                     ESIDKLASRPPRAGGVLLEDERGRLWNGYGWVSPKDKSWHDMTTGDDWRVGTIWTGSY
                     AKLRDGTLLFGGTKGIAVVRPSLWQEWEYAPPIVISELEVNNQLIPTPDELTLFANTK
                     SFSFEFAALDYTYPQNNEYKYMLEGFDEHWILADSSRRRITYTRLDAGDYRLKIQGTN
                     RDGIWSNNEESLLVVQLPAWYETQWFKLIIVIFSATLLYTIYLWRVRGLQAQKVALDN
                     LVQSRTANISMLSTIGREITSTLQLESVLERVYKHVNELMNAQVFVVGILDQKRQVIA
                     CKLAIESGQRLPAFEYELYDEGRPAVWCVKNNKALIVNCFEELKSYVGQVNPPISGAN
                     TESIIYLPLVINNAVIGCVTVQSFDKNAFSDNDVQMLRTIANYTAIALANADSVEKLA
                     STYQELKEAHEHLQKTQQQLIEQEKMAGLGRLVSGVAHEINTPLGISITASSHAARQV
                     EECEQLLAAAKLTKPQLTSFISTLKESLQLQESSLERAAQLVKNFKQVAVDQSVEELG
                     SVNLSEYLTDVLMSLQPKWKNTKVDVYTDFPEEVRLTTYAGALAQILTNLIDNALRHG
                     FDEGRLEGKINISLALCSGWVKWTFSDSGKGMDSETLSKVFEPFFTTHRGAGTGLGMH
                     IVYNIVTQKLKGKIECASEPGKGCVFTIMLPES"
     CDS             353109..353603
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005462468.1"
                     /locus_tag="PA25_35310"
                     /product="protein-tyrosine-phosphatase"
                     /protein_id="BBN83546.1"
                     /transl_table=11
                     /translation="MSNTPVLEQIQNILVVCMGNICRSPTGEAVLKHKLTKAGLKHIE
                     VDSAGTIAYHQGNAPDRRSAAAGKKRGYCFDGMQARQVKPQDFEHFDLILAADKANFA
                     DLVALCPEQYQHKIKLFLEFGSSNYREIPDPYYGEGDGFELVLDLIEEASNGLIKQLQ
                     KDNK"
     CDS             353673..354311
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35320"
                     /product="hypothetical protein"
                     /protein_id="BBN83547.1"
                     /transl_table=11
                     /translation="MATSTNLFEQIALDLQVHGVSIQSLDLNEPALLTLTERLAHLSQ
                     QDFYKAGIGRQEEHMKNSQIRRDKIHWLDTNNAQEALFLSYMQDLKIYLNRRLFLGLF
                     SYECHFAHYEPGAFYKKHLDAFKGETNRILSTVLYLNPDWQSSDGGELALYDPNDHSK
                     VLQIVTPNFGTLVTFLSDEFPHEVLPAKKARYSIAGWFRVNTSVGGHIDPPQ"
     CDS             354404..354778
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35330"
                     /product="hypothetical protein"
                     /protein_id="BBN83548.1"
                     /transl_table=11
                     /translation="MTRVLLASSLLTLVSGCIFVPKEITYFNEQCQTFNKKSVLDTKT
                     AVRLQDCHDHTCSVMLASAGLVSAASLVVSGSIVVVKNIVHWKENRSDCKEQEQITRD
                     KQPKTRHQQQANPTETSDIERG"
     CDS             354872..355267
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35340"
                     /product="hypothetical protein"
                     /protein_id="BBN83549.1"
                     /transl_table=11
                     /translation="MKNIYLCCSIPLFINGCMFVAKDIRYFDEECQIYAIKTVLDVEM
                     LKAENNQRRSCTDTCPVLTDNNMYVGAASLLVATAAAASKNTEHWQQRIHDCQLQKRK
                     NQQTIMQNTAKSDLSEIERQYCSNNSCIN"
     CDS             355392..355625
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35350"
                     /product="hypothetical protein"
                     /protein_id="BBN83550.1"
                     /transl_table=11
                     /translation="MAAATLSSTGADPSATVKKFNGTARSDDIPFAHFAQGKVGQFVE
                     CQGARLNVGWRCAYHNLQTPNAKKPDSFESGFL"
     CDS             359102..359293
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35360"
                     /product="hypothetical protein"
                     /protein_id="BBN83551.1"
                     /transl_table=11
                     /translation="MIQPQVPLGLPCYDFTPVMNHSVVNVLPKVRLSTSGATHSHGVT
                     GGVYKARERIHRGILIRDY"
     CDS             361317..364007
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35370"
                     /product="hypothetical protein"
                     /protein_id="BBN83552.1"
                     /transl_table=11
                     /translation="MELNSIHSFFHQAYMPHGHCYLWQPHLLWTNVISDLLIATAYFS
                     IPIAIIIFYKKRPEIGKHWLFILFASFITLCGVTHLIGIYTVWHGAYGLHGVSKALTA
                     TVSIITAIYLFRLIPNAVAIPTPTQFFGVKEKLSKLTSEQQQLKSLLAEHKTTEFMLN
                     SLPVCTLLIDNSSNIVKCNPQLLKELGYNSHKALIDTKLSEHVQLDDPFEDLSIILSE
                     CKKNHSKVVELLCQIISKNGVAIPMEMKLVHASFESQEFTIVIFNNLSSYKRLKQQLD
                     ASHQRIERAISATEDGVWEWDIQNDNVIYSPTLMKMIGKEHLKNPSYLDWYEHIHPDY
                     RAKVEDAIKTHFETKTRLQVEYLGRNHEDKYAWFLAVGNSQFDEHGNACVMSGALRYI
                     QENKQLESQVAEKTNILNCLFDGANQAIWLLKVEQYQDFKFLQSNHAACESMGVSPQD
                     IMNKRLSEIGSSVLSNDVINRIRNNYLLCCERKLPLEYIETLPSKNEEKWYQTTLYPI
                     LDPKNNVVKIVGTAIDITARKLAEQELEHNRTFLEQIINSAVCGLYLYDIKERRNIQI
                     NQRYTDLLGYTIGDLKNITLNELVHPEDEQQLIVHFDEVLISKEQQLIPIKYRLKHKN
                     GHWISCSAVHTIITRSKNGTPTVLLGTFVDITEQDQLLQKLKSSNENLEHFAFLASHD
                     LQEPLRKIIAFTDSLSVRLKNYIGNDENAQFEMSRLIEASDKMRVMIQALLKLSRLQS
                     QKLIPIETTLGNLIDDTCEQISCAIEETKAQITVDTPDQLLEVDNSLFVQVFQNLIAN
                     SLKFIESDITPRIKVFSELRDNQIIIYYQDNGIGIQEPYWQSIFEPFKRLDNGVTYSG
                     SGIGLAMCKEIIKLHNGSIACRSHKSNGTTFIINLPSTRG"
     CDS             364010..364426
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010889309.1"
                     /locus_tag="PA25_35380"
                     /product="response regulator"
                     /protein_id="BBN83553.1"
                     /transl_table=11
                     /translation="MDIVLVDDDTDDVYLFTTACEYITPKPNLIVLQNGEQLLEYIDT
                     HGLKGDKLYLVDLNMPKMGGLEALKHIKQRGLVNKLCIISYTTSSQPSDIEHAFSLGA
                     KSYITKPSKVVDLIELLEVLTKYWFTYNHFARSNNE"
     CDS             364419..365339
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35390"
                     /product="hypothetical protein"
                     /protein_id="BBN83554.1"
                     /transl_table=11
                     /translation="MNKWLIYLLEDNEDDIYLIQQFLVNHNGRHQFKLKSLKNLATLK
                     LATRQCSPDILLIDLNLPDSSGLNTLITVKHFVPNIPIVVLTGDSNERIGEQTIQLGA
                     QDYIPKHELTSSLLARTIIFSKERFELQRNLENMVVMDKLTMLNNRGSFDNELHKYVQ
                     DAIRYDTSFGLLFIDLDNFKAVNDELGHQAGDQLLRGIAAKLKMFRRTSDFVARYGGD
                     EFVIIAPHIADKNQLMKLAQHKYSLLADNYCIEGSNNQIHEIHLEVSIGAVLFPDDGE
                     TESKLIQNADASMYEAKEAGKPFRICKDKD"
     CDS             complement(365497..366114)
                     /codon_start=1
                     /gene="lexA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KVP9"
                     /locus_tag="PA25_35400"
                     /product="LexA repressor"
                     /protein_id="BBN83555.1"
                     /transl_table=11
                     /translation="MRPLTKRQEQVFELIKVFIKDTGMPPTRAEIAEALGFKSANAAE
                     EHLKALAKKGVIEMVPGASRGIRLVEEIEKEDPGLPLIGRVAAGEPILAQQHVETHCQ
                     IDAHLFKPAADYLLRVNGMSMKDIGILDGDLLAVHSTKVAENGQVVVARVEDEVTVKR
                     LEKAGKKVLLHAENEEFSPITVDLEYQSFEIEGLAVGIIRNNSWV"
     CDS             366440..367111
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010968036.1"
                     /locus_tag="PA25_35410"
                     /product="dihydroxyacetone kinase"
                     /protein_id="BBN83556.1"
                     /transl_table=11
                     /translation="MKKVLIPVTNHATLGTTEQANGTYAPELTHVVHVLNSNSIAFDI
                     ASIQGGKAPLYGTDIEGDDVNSQVLSDSSFKAQIDNTLVASQVNIEDYDAIFYPGGFG
                     LLSDLAINKDIGGMAAKHYEAGGIIAAVCHGPAALLPITLSNGEPLLANKHVTAFTRE
                     EEIDFGTINDIPFLLEESLTRNAAKYSKVQPWGEFVIEDDRVITGQNPTSAHAVGEAL
                     VKLLS"
     CDS             367121..367729
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010920924.1"
                     /locus_tag="PA25_35420"
                     /product="glutathione S-transferase"
                     /protein_id="BBN83557.1"
                     /transl_table=11
                     /translation="MIKVHHLNQSRSTRILWLLEELGLPYEVERHERDSATRLAPASL
                     AKVHPLSKAPIIEHNGLVLCESGAIIEYILDQAPSEYLRPEKGSKAYFQYLEWLHFAE
                     GSLGLPIIARLLMNMEQRDGTKPMDGYISKELNLDFSYIDNVLAKQNYFAGEQFSAAD
                     IMMTISLEIADSLNLLEGHDNITRYLGDMQSREAYKKARAFG"
     CDS             368117..368599
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011267607.1"
                     /locus_tag="PA25_35430"
                     /product="N-acetyltransferase"
                     /protein_id="BBN83558.1"
                     /transl_table=11
                     /translation="MITAITQKDFRNFWPTFKNIIQAQQTYAFDSNMSFEEAYQLWCQ
                     SPLKAFAYKVDGVVLGTYYLKANAMGPSSHICNCGYMVSEAARGQGIAQKLCEHSQRI
                     AKEMGFEAMQFNSVVSTNEGAIRLWQRLGYSIIGTIPKAYKHPQLGYVDSHIMHKFLV
                     "
     CDS             368906..369052
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35440"
                     /product="hypothetical protein"
                     /protein_id="BBN83559.1"
                     /transl_table=11
                     /translation="MSPLKILIDKHIGADSLSEIQHSLNELNIGLEIKERSRKGSYLS
                     LDWV"
     CDS             complement(369382..370971)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35450"
                     /product="hypothetical protein"
                     /protein_id="BBN83560.1"
                     /transl_table=11
                     /translation="MNKSYLLLIASVLLAACGGGSESNGPSDGGVETTPPITKDTSAP
                     TITAPSDLVVDADTQSGMTASSQQIVDFINSVTATDNSGTVTISHNIPQVIPFGTFEA
                     VFTAADPSGNKATASVEIFVDEFPGTFLEPGSNWVAVCGLEGEVNNTDYGCELKKFSN
                     YGYGRLTDYTVVNSAVLHVDERARQLELSSATEQQMFELCPVDLFPIGRLVSSSDVSQ
                     NNTEVFSNGLSELSNSMTFERVNAVYRAEQSSFDTMLSNFSVWANYAPMSDIDAVDGV
                     ERVNLRYALPSTVIAWHSLKSHRDIELPQLEAIQNFFEQWAQKIYVSQAHAIGSDMPT
                     LLEQGNIGWLGDLGLMMLGVTENNDDYFRRGIARYFMILDKQVRADGSIVFESQRGDS
                     ALGYSTSALASVIMMAEVAAMQGYDLYSVEIDGKSIETMIDFNLRAYSDNELYHQYTQ
                     YQNPFFASPEQLKNWNNQTYENFDLETNQFLLSALEAYKRRFPNSAMTALAKSMFPES
                     EYVRFVETSNGGIHTCDYRKL"
     CDS             complement(371348..372703)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35460"
                     /product="hypothetical protein"
                     /protein_id="BBN83561.1"
                     /transl_table=11
                     /translation="MVFKLPELSLVNKITLSMLVVVTLCVALTLIFIGLPLAHALVIL
                     VLAITLSAIVSSFVCAPIRQGLEALELGLHNFKDGEFSNNLAYQSNDQLGRLCQLYNQ
                     TAEQLRKEKQWIYQRELMLDKVLESSPQALVLVNSNNIVVFSNLSARGLLQSSTHLEG
                     ISLSQALEQAPPELKQAINSGQDGLFNMLSEQEEVQTWHLATGQFLLNNQEHKLFIFK
                     QLTRELNRQEVAVWKKVIRIISHELNNSLGPMSSMLHSGKILTSQLDEPRLQRVFSTI
                     EERIKHLSEFVQGYGKFAKLPQPKLAEIDWQQLVSELAEQWQFNSQLTLPVTPCFADI
                     MQLQQLLINLLKNAHESGSAADKVSLSIEQYGQGMMISVTDEGQGMSEQVMANALVPF
                     YSTKTSGSGLGLALCREIVEAHHGYLSLHNASNIKSNTIGLLVKVFIPFGKPSAGQFS
                     E"
     CDS             complement(372706..374046)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073484.1"
                     /locus_tag="PA25_35470"
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="BBN83562.1"
                     /transl_table=11
                     /translation="MGKILIVDDNPAILEALSLLLEIHDYAVVTAQNAFEAQQMVQYQ
                     NIALVLQDMNFTSDTTSGEEGKTLFYRLREINPHLPIILITAWTELETAIELVKAGAA
                     DYIGKPWDDQKLLTSIANLVELGKAQASNANYKRQQAEREAPKAEANLAGLVYASTAM
                     ERIVDMALQLAKSDVSVLITGPNGSGKERIAEIIQANSLLKDKPFLKVNAGALPQELI
                     EAELFGAEAGAYTGANKQRIGRFEAADGGTLFLDEIGNLPLAGQMKLLRVLQTGEFER
                     LGSVQTRKVNVRVISATNANLLKDIQNGQFREDLYYRLNVIELQLPALCERPDDILPL
                     VNHFLPNRPLSHTAQLALTAYSWPGNVRELENACKRAAVLKPDGELGEQDFTLQNDAP
                     LYTAKAAKTKQEPTKQELEEAMRAHQGVIAKVARHFGMTRQALYRRLQKFEIEY"
     CDS             complement(374108..375313)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073485.1"
                     /locus_tag="PA25_35480"
                     /product="ABC transporter permease"
                     /protein_id="BBN83563.1"
                     /transl_table=11
                     /translation="MSELKPIFNALCRTKVGPILLLLQIAITTAIVSNSAFIINEKLA
                     YLNQDTGYVEENIFSFQMMHFGQSVDYLRQSQMDEARLREIPGVVDAVMANSIPLSGG
                     GAASTFRLKPTGEESKGLNSTVFEANEHFLNTLGVKIIEGRNFTESEIMLTTDYSKYP
                     SIGIITKEVADELFENGDAIGKTLYRGDHAIQVIGIADMMKGPWLKSERKDRSVIVPF
                     VTAEKLTQFIVRTEQGRRAEVMQKIEQTMLDLDRERVVEDIQGLEQLKADYVASDRLT
                     MRMLLVMIVVLTLITALGIFGLTLFNISKRTKQIGTRRALGARKSDIIRYFLIENCLI
                     SVVGLVVGSGAALLMAQQLMKHYSLSQMPIIYVTVTALSVLCVSLLAVVGPAKRAANI
                     SPSIATRTI"
     CDS             complement(375325..376638)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073486.1"
                     /locus_tag="PA25_35490"
                     /product="ABC macrolide family export system permease 2"
                     /protein_id="BBN83564.1"
                     /transl_table=11
                     /translation="MFLHYIDLSWRSFKRTPMVSLLMVLAIAIGIGVTMTSLSIHHMM
                     SKDPIPKKSAVLHHLQLQTMDEGETYWSKDDVPFQVTYKDAINLQNANLPYLRSAMYK
                     AGFSVHLNSPEQKPFVEAVRLSSKDIFEMFDLQFIHGGTWTQQQQDDIAPVAVISKTI
                     NEKLFKGQNSIGQSFYLDDIRVQVVGVIEDWETPVKYYDTNNGSFNSAEQIFIPITLG
                     AAHEVVTWGNTNGWKDEPDDTFKDLLVSESLWLQFWVQLNNQQEKEEFERYLMSYMQQ
                     QQALGRFNREQLNYNLFDVMELMEYRGVVREDNKIMVTLSFMFLVVCIANILSLLLAK
                     FLRRASEVGVRRALGASKRQVFYQHLVEVSMIGLMGGVLGIIVAQIGLWGVRISHRGY
                     GDLASMDVTMLLSAPVIAILACMIAGLYPAWVVCKTTPAIHLKSQ"
     CDS             complement(376641..377345)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073487.1"
                     /locus_tag="PA25_35500"
                     /product="phosphonate ABC transporter ATP-binding protein"
                     /protein_id="BBN83565.1"
                     /transl_table=11
                     /translation="MLTMNNINKIYQTDMVQTHALRDFNLQVNEGEFIAVTGPSGSGK
                     TTFLNIAGMLESFTTGQYLLDGVDVGGLNDNQRADLRNQKIGFIFQGFNLIPDLNLFE
                     NIEVPLRYRGIKAAERKRRVEQRLEQVGLASRAKHLPQQLSGGQQQRVAIARALAGEP
                     RFLLADEPTGNLDSLMARQVMELLEQINREGATIVMVTHDAELARRTPRNIQVVDGQL
                     ADFTLYQGNPAKVVGA"
     CDS             complement(377387..378643)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073489.1"
                     /locus_tag="PA25_35510"
                     /product="RND transporter MFP subunit"
                     /protein_id="BBN83566.1"
                     /transl_table=11
                     /translation="MIKDTSGQDQVIVTKSKFGKRFVIVSAAAVAIATSAYAVVNTSN
                     AQHSLASDEVKFATVERGDLVRDIAATGKIVAANAPQIYSPEQGVISLLVKAGDKVEV
                     GQNIAKVVSPELQNALQQQNSELQRLKGELERKKLEARRETLSLNKSLDLAQVELSAA
                     ERENRRAQLSIKKSLISQIDLEKAVDDLSRAKLTFKHAKQEVELAKDTLAFELKSAQS
                     TVLRQQLVVTELERKVSNLDIKATVTGIVGNLLVQPQALVSQNQALMTLVDLTAFEAQ
                     LQVPESYANELGLGMQVSLKIGLNEVMGELSAISPEVNQREVTTRVRFSQDGLSGIRQ
                     NQRLSARILLENKQNVLKVKRGSFLQAGGGFVYRVKDGHAFKTDVAIGAVSINAVEVT
                     EGLQAGDKIVISSYEPFKKAEQIMLR"
     CDS             379310..381394
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011118665.1"
                     /locus_tag="PA25_35520"
                     /product="acyl-CoA synthetase"
                     /protein_id="BBN83567.1"
                     /transl_table=11
                     /translation="MGKSTHLFHSRDLVQCEANSLIDLIAVDTYNKPNQEVFHFIDEK
                     GESVEVFDYQTLSNSVSRIAKSLLQIQQRNTEHQDQALIVLPQGADFVTSFYGCMAAG
                     IIAVPSFPPKNQLQIERLQYAIEDLGKPIVITNNAVLPLLKEQLAHLPIRWLLVEECE
                     AIEPQPLHNFKTKEQDIALLQYSSGTTGKPKGVIITNQNILENSELIRQSFGHQEDKT
                     RMMLWLPPHHDMGLVGGVMQGIYTGYPTMLMPTDLFLRSQFRWLKAVTDFRATTTGAP
                     NFAFDLAVKNIRESRLAELDLSSLQNLFCGAEPINAQTVNQFFDKFAQCGLKPEAFLP
                     CYGMAEATLMVSGKPHSQQYKQLCVDEPLLKRGMVKAVDTPSARSQWLVSSGKVHDSI
                     DAKIVDPNNHIALADGQVGEVWLQGNSISPGYWQDKERTDANFGLTLAGHSETYHRTG
                     DLGFYHKGELFITGRLKEVIIIRGANFYPQDLEYEASLAFPELKNCRSAAFSVTEEGK
                     EVLVMALEVPRNVSDFDIFAKTLNGRLIERFGVKADQILFLPRKTIKITSSGKLQRVA
                     IKQAYEQGTLQAYHRFSLEAQVNDSQTISDGAVTELDIFDIASVEHWLVCKVSELTGV
                     SIAQISPKDSLANVGLDSVLAMEILFKLEQLTGIYLAPDVLYSCNTPHLLAKQITTVA
                     SKTSKTELDPTC"
     CDS             381388..381660
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35530"
                     /product="hypothetical protein"
                     /protein_id="BBN83568.1"
                     /transl_table=11
                     /translation="MLNESVQSVSAKLCQFITHSYLDDDELIAPDTPIIELNILDSAS
                     IFDVVEYIHREFALRLPVIDIHPDNFASVEVLSKLVEHHRNKENTL"
     CDS             381657..382766
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011030519.1"
                     /locus_tag="PA25_35540"
                     /product="oxidase"
                     /protein_id="BBN83569.1"
                     /transl_table=11
                     /translation="MIPNQWYAITRSQDVKKKPLGIKRLEKLLVLYRDTQGKLICMDD
                     KCPHKGVKLSLGEQHGDLIACPYHGFQFDQQGDCVHMPVLGKNGDVPKGMCVKTYKVT
                     EAYGLVWFWYGEQMAEEDYPEVPMFKQFKEYDGYYSYYGWDAPINYTRYVESVCEIYH
                     IPFVHKGSAINIWDPKGGRVDDFECKVDGTLITSDFILRPDDERTAAETLVARKPWTR
                     GWRFGIDVQMPNLIQIRSEVFDVIFIPTPIDENTCWVCVCYQEPKRDLLLPLIKPLPI
                     PFWRPVRPWYMCRIERFVQQAKDMAVIAHQEPKVSSPKANRLIPIDKVNAHYIRFREK
                     LIREAKEQQAHNKIKEQPHFEAPTLEQIIGIEEVN"
     CDS             382767..384389
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011030515.1"
                     /locus_tag="PA25_35550"
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="BBN83570.1"
                     /transl_table=11
                     /translation="MELSMTKNNDLATAVQSLVLDIVKEQTCYSESDLLPDVPMEEGL
                     GIDSIILASIVDELQQVFVFEHKLNSASFNTINDLLARCEGVALSEKGQAKLVTLGIN
                     HDVPVNDVSVNECPTAQEGPSHTTMRDFVSDGSPDLFSKVRKFNDFYETQAQTGNFWY
                     GMPLSSRCENRATIFDAYQNKEREFLMFASNNYLGLANEPRVIDAICKAAKEYGATNT
                     GCRLIGGTNHLHLELEERLAHFKGREACIVFPSGYSANLGTISALTGPKDTVITDVYN
                     HMSIQDGCKLSGAKKRIYKHNDMASLEEVLKGCADSEGGKLIVADGVFSMHGNIVKLP
                     EMVRLARKYQARILIDDAHSTGILGATGSGTAEHFNLKHEVDLELGTMSKTLAGMGGF
                     VCGDKDVIDYLRFYANSYVFAATIPAHIAAGLIQCIDIIEKEPERIERLWSNVNYLHS
                     ALKELGFNTGDSESAIIPIVIGDEALAMKMGHAVRQQGMFCQTVVFPGVAVGDARLRI
                     SVLSQHTKADLDGAIEILVNAARSVNLPNFKG"
     CDS             384400..385935
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011030516.1"
                     /locus_tag="PA25_35560"
                     /product="D-alanine--poly(phosphoribitol) ligase"
                     /protein_id="BBN83571.1"
                     /transl_table=11
                     /translation="MKEMLPTALHQALFYWANKQPQQPFLLAEPALCYRQSANYVSAL
                     ATQLSGSQRVAIWLEKNNHYALSILAALSAGACYIPIDSKQPINRVDLILTDAQADTL
                     IVDDKHLLQVTPLLAKYPQLKIVLIGEKCVQQAANTSFFDWRLHLETELAHTNEPWHK
                     NSLAAVLFTSGSTGRPKGVQLTLGNIQHFVSWCQDNMSLDSCDRFLNLASFNFDLSTF
                     DLFVCLAVGGSLYIANDDAPKQPMTLANVLNEHQISVMYCVPSLLNLMNRIGLWQQAE
                     PLALRHLIFAGEAMPKPCLKGLASALPSTHFYNFYGPTETNVCLAYKVTEADVLNNEP
                     IAIGLPIGDTQAWLIDEQGNPVTNESGAMGELVIQGSCVTPGYCLESQKLANHALQIH
                     STGDIARYQNGQYYYHGRCDRMVKISGFRVELGEIEACLLAHPQISEVAVRYCANTSK
                     LIASYALNDAQSKIGTLALKTYSAQHLPTYMIPHKFECFGTLPKNANGKIDYPTLAQV
                     NDD"
     CDS             385925..388111
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35570"
                     /product="hypothetical protein"
                     /protein_id="BBN83572.1"
                     /transl_table=11
                     /translation="MMINKQQHAIALLDLQSNVGTQNGYLDCLSDLKHYSKFAIPPIY
                     RKAINRMQLPLLQLSMALCERFDAFVHDGRTDVIVCSEPCADRQLANHYRVTSQALLA
                     ELIATTDNETIKKQLHDLKPTELVSSHDKVGEMATTMATRIAQSAKLKGRAFAINSGD
                     ESLSKAVALAYDALLNHKADAVLIAVANDWQTPSDIQPLAASTLLLVRTDKAIDNAKA
                     YLQYCHQHSFVPAKHDSSSNAGVVNSALQLSSWLAKNPQDTWPISPQFSFSTSPCWYK
                     ALEQTAITICDKQIWLADRLGTKAYWQGLNDKRGGIASLEHNTMVSGTLFKPDGETQD
                     SYYCRQAAKLSSDHLDTLAHASYDNALNTMLNEWQHLALPSDKNTLVITATNLGPYSE
                     RRKLLHAKFSSLVEQCQEILTAYNDDAGLVQLQKWQSQFTQDAQSEHNQALGLSLQLA
                     QHFQLKNYDALALESACAGSMAALDCAINALQSKRVDYAIVAAAELPVNLHDLCLCSK
                     QQMLSHSVIATFSEHADGFTPGDGLGVVILTRDDIAIAKNYPRLARIEAIGSSTYSKS
                     MIAPNSAGQVEAMQHAFAQTALTPSDIDWVETHGTGTPIGDLVEIQALSEVYQRRDNN
                     SLKLGALKTQFGHTFATAGLASLIKALLSFEHNSIPHNLLRGKLRDELNLETLNFDPM
                     ASAKPYAQPQGKRSASINGFGTGGVNYHVIISDCTSETTQGTHDEL"
     CDS             388101..389267
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003973142.1"
                     /locus_tag="PA25_35580"
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="BBN83573.1"
                     /transl_table=11
                     /translation="MNFDFTEKQQHIAQQAARLAQSLELNDLSKRDLAGEFSKPLFRQ
                     LITQGVGKWLMPKTMGGDDLNASELCAGIESLAEHCEDTGLIFALSAHLCACIHPIRA
                     FANEQQQLHWLSKIQQEAWLGAHAITEKTAGSDIYAMSTSATKTQAQFILNGAKHYIT
                     NAPFCDFMVVHLRTANKGNYFDYSTFIMQSTELGISVTQNPHSKSGLRTTAMGDIQFN
                     QCELSEDALIGRQGAGAPIFQISMEWERVCLFALYLGQMKRQLHKTAAFIQSRSQFGE
                     PLSEFQAVQHQLSDMYLNYESARLLLYKAAWSLDKGDMSGVSSALAKIAVSHAAISNA
                     QMAVQLHGAQGVLSGDIERMLRDAMPSAIFSGTSNVLKNNLSTTILKRFQANWL"
     CDS             389281..392106
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35590"
                     /product="hypothetical protein"
                     /protein_id="BBN83574.1"
                     /transl_table=11
                     /translation="MQIRIGQEILSREALLDSAGLLAEFVQANGDTLIWQHDEQRIEV
                     LDLVGGFGSTLLGHNHPELVETMQHSLRANRPMWVQGAQRPIAKQLREALAEKLSTET
                     GKQYQLIILNTGTEAVEAALKHAQYEYFQRLSQAQTRSADNWREFMARLSRNELSISE
                     AFFSKAEQLLGQEPIESIEELQRALQYRNQQAFNLPAKVAAFKGAFHGKTRGSLATTY
                     NRDARLPFIANNPDAVFIEDCDSFKQTLSAWQSQYWHIEFEPLRLVAKPINQLAAVIY
                     EPIQGEGGVVPLAQQYIDLLHEIKQSHPDTAIIADEIQCGLGRTGHFLESVARQVPND
                     YITLAKSLGGGLCKISAVAIDASRYHQEFSMLHSTTFADDDLSSAVALKTLALLERDD
                     IVHKTQSLGEAFLSALQGLANDYPDMITEVRGKGCMLGIELASQSEHPSATISGLDKE
                     NVLSMALAGYLLHRHHIRILPSLGKRRVLRLQPSSYFAHENIAKVVNALKAAFELIRA
                     HKIAPLMSHLIHTDISELAYHERLHHPVREENTPSGIEKVAFISHLIDQDSLNEIDPG
                     WRVFDEYEQEELNHHILPVTIPSVLARRKIISLSGREIELVLYGIQMDAESIEADRRF
                     NRSTIIRSQVHEAYRQAREEGCKLVGFGGYTSIVTSNCCDFTYNTPAATSGNALTVAA
                     SINTVLSSATQHGIDLKKATVAICGAAGNIGQVHSAILAKHCHKLILITRNASATNMN
                     DTLRVICEQLYLGIEQQISGGKLLESCKEWLTPRIGDDKPEVIQRELKSILLARGLVV
                     ISDNFNDCQQADVIVSNTSSPTTVFRAEHINAHKPVLISDVAVPRDVPEDIVLTRPNV
                     KLIRGGVVNLTQNPEFTLPGMLLPKGQVYACCGETILLGLAGAFSHFSMGALTCAQVE
                     QVQALAAIHGFELDQEKPQNDSLQAVS"
     CDS             392081..393163
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011030511.1"
                     /locus_tag="PA25_35600"
                     /product="RedV protein"
                     /protein_id="BBN83575.1"
                     /transl_table=11
                     /translation="MTHCKPLANVVSECIELAKLVPSSHNCQPWRVHLHHAGMPFDGT
                     LNISIDSEHTINALSSLKNEMLMSLAGFSCALINLLEASGVVCEVQSNTANLSVIDNE
                     DTQVFSVYLTLKPDSEDKTRFVRLSQLLQNRYTHRGELHTDKPLQWQQDILATKLWPN
                     EQLHWLKVTSQKQTQIAKLVARFAALDFSHRKAWQETYQFIDFAKGKHVKKERGFNIQ
                     QLMGPMSAFKRRINQLLLHPNTMLVLNKFGMAQKMADMLAMLSEQSAQLICLCHSNKA
                     DTTAWLAAGEYMLEAWLQATEQQLAVHPLSVLLQHSDAKTALHHTLGAQHSPMFIARV
                     GKSNAEQSFIAQFRYRTSLSRILTQH"
     CDS             393174..393935
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35610"
                     /product="hypothetical protein"
                     /protein_id="BBN83576.1"
                     /transl_table=11
                     /translation="MKQLFFFFIILLSSNAIANSKDQLGSWIDSAERILRAKTSASVL
                     SMAINKAEYQRDFTLLVLTDDRSEQQKVMVRMLGPALWRGNVTLKVDDRISFFEPRNK
                     RTTVMSSSMLASSWMGSHFSNDDLMRETDLATHYAYQAAKSWHQESRDYHLIELTPLP
                     SAPVVWGKVMYRLYIDDGRVFPEQVSYYRRNSDEQPERTLTYSDVKQMDGFKVPTMME
                     MRISDKPDEYTRMHYQKIKFNSDLAASKFTEQAFL"
     CDS             393944..395353
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35620"
                     /product="hypothetical protein"
                     /protein_id="BBN83577.1"
                     /transl_table=11
                     /translation="MGLYIRLAWRNLLRNTKRSSVTALGITLGIGFCITTLAIMDGLS
                     HDLITGTTQGQVGHIQVHEQDYLAKRQLQQTIENNSQVLLELRDLNSVKAAAARLYSF
                     GYLSKDDKSIGVSLLGVEPKHERQVTSLAEQIVDGSFISEPTPWPKGQALSEAQLALD
                     EQLTEQAIANAFAELDGLDTTSNELQLHTNELIDTLAPLPFTLPQVVLGVKLAKNLQA
                     NVGDEITLLFETAQGAQQSLQLQVAGISRQGTDLIDRTRMIFHLEDLQKLLQLPNQSH
                     EIAISTMNLQKVDFAQQVISDVLGSSYPQLSVQTWSQLRPDILALIQSNQALMGTLVF
                     IIFLIAGVGVMNAMLVSVMERRKELSLLKALGLKGPNVVWLVTVETLVLTFVASIAGL
                     AMGIVLGSYLQKYGWDISQFGEFSLAGVGMTSALKAKLTLNNLLIPVIVMFVIALLAA
                     LYPAFSAARLEPAQGMRAS"
     CDS             395350..396606
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261736.1"
                     /locus_tag="PA25_35630"
                     /product="ABC transporter permease"
                     /protein_id="BBN83578.1"
                     /transl_table=11
                     /translation="MIHKLALRNLLRNKRRSLLTSLIIVFAFSMMILFMGLSDGGHKA
                     MIDIGVRMGLGHVVVQHPEYRDDPALSHLLDNPEQLKQRLKATDARLTPVARLRSDAL
                     IQAGRHGVALTISGVEPLLEAQVSAIADDKAIVQGETLAAFTNSATLQRLSGIVIGET
                     LAQNLEVRIGDTVTLTVKPASGGDLARSAFEVAGIFKTGLHELDTFWAEVPIDDLQAL
                     LEVPDQVSQIALYTSAGSDNVAQLATALTAQFPTLDILPWQTAAPELYSAVTLDAAGM
                     YLLMLIVYVVVAVGILNTVLMSTFRRQKEFSMMIALGARTSTVTQVVLLEAIYLSAFS
                     LTIGLVLGLWGHHHFATQGLDFKEVFGTAMEAGGVLLPEKFYSTLELSKLSLSVLFVF
                     VLTILVTLIPAIRAGHRSPVAASQES"
     CDS             396616..397320
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005482754.1"
                     /locus_tag="PA25_35640"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBN83579.1"
                     /transl_table=11
                     /translation="MIKLTQINKIFSDKHQSFHCLKDLDLEVNQGEFTVIAGPSGSGK
                     STLLNIIGLLDKPSSGSYEFDGQDVAKLNSNRLADIRREKIGFVFQAYNLMPVLTALE
                     NTEMIMEFCNVDKKVRRQRAIETLEAVGLGDFKNRFPAQLSGGQQQRVAVARAIAAQP
                     LLVIADEPTANLDSRSTESLLDLMQSLNEDLGVTFLFSSHDPRVIERAHRVIHLQDGQ
                     IVKDVSTHNNGQQVAV"
     CDS             397322..398515
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35650"
                     /product="hypothetical protein"
                     /protein_id="BBN83580.1"
                     /transl_table=11
                     /translation="MKSLLLFIACTSVQAIGFEADEDFAELFGEAPTSNSQVSGVFEA
                     NLVSVDTPLQNSWGSNQFARLEYQHKQDDNVWVMHTQLDFDYLEDGSLLSLFAKQPVA
                     DRALDLDWQERHDRQLWYAQVDWAYWQRAFNNASITVGRQPVTVGLGRLFSPLDPLGA
                     FNVFDLDRLYKSGVDAIKLDYFVSDTMQTQSILTVNQNDKLQGLQTIKGNLEQGVWLL
                     SAAIREEQHYISASLQRYQAWLDADVYGELLYGDLTSSAQAQFTTSQQKRALLGMSTK
                     VGANGSLTFEFLYQSLAADEQTDYRLWQQRYAHSQITPMGLAKRYMALSYSNEWRDLT
                     RYELLAMHNLVDSHSTLSAVVTHSASDNLQLRLALAWTPKQGIRNSEFEQFADLLQLG
                     IRYYF"
     CDS             398524..399540
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003973125.1"
                     /locus_tag="PA25_35660"
                     /product="methyltransferase"
                     /protein_id="BBN83581.1"
                     /transl_table=11
                     /translation="MQLTTLKKLIFEKNIFAFLRLGKHVDTVYRTSFVTAANASGLLE
                     SLQQGNKSLEQLQQHLRLDGTKQEALSAWLECGVRLKELTYKNGQYALKGKLSKHLAK
                     QENQIAAAMFEEAIRYHYDALLSAPTRMQNNQAYQLADQDGSLIARSSQILEPFVEEA
                     IEWCLKRVSTEPKHILEVGCGAGQYLVYLHNRLPACEITAIDYQLAVVEQAQRTLSAN
                     QITNIDLRHESFFELAGESSYDLITLHNNIYYFPQTQRMQVLNHAYKLLKPGGQLLMT
                     TSCQGGSSAISALNLWFSLSDVGGVLPDAEQLTNTLKQAQFKEVQHKRLMPGESYFAF
                     AATK"
     CDS             399568..402270
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35670"
                     /product="hypothetical protein"
                     /protein_id="BBN83582.1"
                     /transl_table=11
                     /translation="MNNTVVKSSTSITEHVVGFANAPKNNVSLFGGKGAVLCDLYQAG
                     LPVPNGFCISIDMFKAFIAHYDLLAKHPINEGIEQWRSLAKAIIESSMPSELADLITC
                     ELVNLSGPVAVRSSATDEDGQSHSFAGQHLTKLGQQGESEILDAVKACWASAFSDAAY
                     EYRKATGQQTELPTMAVVVQQMKFGDVSGVAFGQHPTSLNKNEFLIEGCFGLCEGLVS
                     GQVSSDSFVIDKQTNELISQSIQNKQQQIVYLDGQIKKVDIPKQMQSEPTLDPMTIKS
                     LGKLLHQVEDFYGKAQDVEWTLSEGKLWLLQSRPITSIAQDNSDDNFYLGNRSEQLQK
                     DILWSRMDIGEIFTGRMTPLGLSFARYYQSNVHIECGKGLGLLDLGEADETMAYYRGH
                     VYLNVSYTAWQLAQTPVGKDQTPFLVRFSSEAIDLTGYKNPYGEQHSHPNYSSGQCVR
                     HWIKQNIREFFQAKRRAKTMVESRFREYDRVQLQNIDAMDLSALQREMTHALKYFKAM
                     HEGYLPYYINAFACYGLLEELSAQWLGDKSKHLQNQIKGDMSNLRTVASAQELWQLCQ
                     TLEQWPNVRDAFASQTISEIDSFLNNTTEGLRFSQGPLAKFMRENGVRAREEMELTHP
                     RWLDDRTYVLQMIKLYLAQGYEVDEALQQQQQQQQLTSEDLLKELSWSKRWVIKRVIA
                     LYCGCAKLREETRMSMITSIWLVRRVVFEVAKRLVEAKHLDHIDDVAYLNFEQILQYL
                     EGMISATELTSNQALQARRAQYQSWLARPEPPLTFIGKPSSQPDLILDPTATSLQGLA
                     TSKGFIEGKACVITDLANQVGEFKKGDILIAPFTDASWTPLFALASAVVTDIGSMLSH
                     SSIVAREFGIPCVVNTNHASALIKTGDHIIVDAETGLITLKKDD"
     CDS             402271..402582
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35680"
                     /product="hypothetical protein"
                     /protein_id="BBN83583.1"
                     /transl_table=11
                     /translation="MSIIIDKIKLKSADNRAAFEQWVTDTDYLACHDLASVERFVVSK
                     VTDTDCDYDYVEVVKVTSLAAFEQDMQTPLFQSLVARFSELADVVETIQSDALAPGYQ
                     W"
     CDS             402584..403258
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35690"
                     /product="hypothetical protein"
                     /protein_id="BBN83584.1"
                     /transl_table=11
                     /translation="MPLLTCYYPSTNSAVYIVHLDVLQRRLSVPSQRQYLLAQLSEDE
                     HAQYMRKPYKRQALAWLGARLGAKWLLKNTLFSTLPSAKIQIQKTANGAPFCARSGRP
                     LSISHSNTLAGAAISNHPVGLDLEFSERFSALPTPWISPQEKQAHPNLTISQLWCIKE
                     ALYKAAGFGPFTQFCRAIELEHTTHKQLTVRHTTSKKQPIQKTWRYNRWQLKQHDILF
                     LEPYYE"
     CDS             403251..404951
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010947935.1"
                     /locus_tag="PA25_35700"
                     /product="isovaleryl-CoA dehydrogenase"
                     /protein_id="BBN83585.1"
                     /transl_table=11
                     /translation="MNEHNNAFIHAAQHLENNLSDPTQDTSVINFARSVAIDEQQEFP
                     REYLSHLHSLNYFDQFVPHSLGGTLSDLSELLMACRLVSRRDLNAAIASGQTMLGALP
                     VWLCGSDAQKKRLSSHILQGHLGCLALTEKKHGSNLLASEVTATVDQDGYRLNGEKWL
                     INNATQGHTMTLLVRKIEPNGRESLAVMLLDKAKLSDYENIEKIATHGIRCADISGIR
                     FHNTLVAKDCLIETAEPGIFGVLKALQISRILCAGFSLGAFDTCLRVTYEFAQNRALY
                     QKTVLSMPTVQQGLGRSFAKLLLAEILATASIRAVSHASRSLSMYSAACKYWVPRQTE
                     LALDELKVILGARYYLREEHCSGIFQKMLRDNAVVSLFDGSSQVNLGLISAQTNAISA
                     QLLKTPSCHEELSQWFSLDESKPFAALDQQQFAVNNAGQDPILSAFLARFSDGSQNHL
                     PPSVMTQCLILKQRILSWCDDVQTLQQTEQNEPTSVVRFNKAKQYTTLLSAACCALFI
                     IHNETHPLLGNADIATDLLSLVLNDDDMWLPSKALLEALDEQNQHHKLFSLFPISLAK
                     "
     CDS             405037..405525
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071056.1"
                     /locus_tag="PA25_35710"
                     /product="phosphoglycerate mutase"
                     /protein_id="BBN83586.1"
                     /transl_table=11
                     /translation="MKIKSLFLPLLLLSNAALALPEHIILFRHAEKAKGTNPELLEAG
                     QQRAHHLATLFSELSISHLFSTDYKRTQQTIAPLAHTHNLPVQSYDPSNLKAFAEQLK
                     KLKGNIVVAGHSNTTPELVNFLSAQQVSISEDEFNKVFVVSFSDKNKAHVLTLSSDIK
                     GK"
     CDS             complement(405512..406993)
                     /codon_start=1
                     /gene="mocR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014208163.1"
                     /locus_tag="PA25_35720"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BBN83587.1"
                     /transl_table=11
                     /translation="MREIVVHPIDFKASKSRGAIYLQLAQAFRDAIKSGKLLKGTKLS
                     SARAMSVAYQLNRHTVMNALQLLVAEGWLESREKSGYFVTRSLPIESSSQQKKQPAYE
                     KMNLSFADPLPEPKTININDYKYNFAGGLPDINRFPFNEYKRAVTKACRHIDINQLHY
                     GEIAGVSELKAQIQDYLVRARSLKCNDLLICNGSQEALFLAARSFISPGDYIACETLG
                     YPPARRAFSSCGARLVDIKQDEQGLCVDDFAKQLKQYKIKMLYLTPLHQYPTTVTLSP
                     TRRLQIYRLCYEHGVVIIEDDYDHEFHYQCQPLQPMAADDPAGIVIYISTFSKLMFAG
                     ARVGYVTACGQILAQMRAHKQLINHKNDVLTQLAVAHWMSSGDFERHLKRTTKLYKVR
                     YQAMADTLTQCQRQGLPLQFLQPDGGMAMWVNCQVNVQDVKRRAHEQGIYLQTEDEFY
                     FAHSVRSLKPNTCDVSHIRLGFAGQSEAQMHAGLMALMRVIYP"
     CDS             407122..407697
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072768.1"
                     /locus_tag="PA25_35730"
                     /product="GCN5 family N-acetyltransferase"
                     /protein_id="BBN83588.1"
                     /transl_table=11
                     /translation="MLEKRTLSTDKVSLKPLLEQHLDELFNAGQDPKLWRWILDNYCK
                     TPQRLSDWFHKTAQFDAQQQLVMGIYCNTQQRIVGTTRLFRLDKHNLSAEIGHTFVGV
                     PWQRSCINTHSKYLLLKYAFETLKLVRVTFGTHESNQQSRDAIARLGARFEGIQFKNR
                     KLVDGSFRNSALFSIIDSQWPQIKQQLESKL"
     CDS             407694..408284
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010931020.1"
                     /locus_tag="PA25_35740"
                     /product="transcriptional regulator"
                     /protein_id="BBN83589.1"
                     /transl_table=11
                     /translation="MTYPPRHFQDDNQERILALVEQAPLATILFGPENEQLNDAVYAP
                     LIFDSSKQLFIGHIAANNPLAQHQSTVVKMLFQGPNGYLSPNHSDALVVPTWLYANAQ
                     LSGQFQMVNDYEQKLSMMNLITDHFERTFDRPWPVSALDDAKRDTMFKHIEFFTVDVQ
                     HWQGHFKLSQNKPQRVREQIKQSLSNQGYKELATLI"
     CDS             complement(408392..408880)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35750"
                     /product="hypothetical protein"
                     /protein_id="BBN83590.1"
                     /transl_table=11
                     /translation="MHVSMDRITPNHGCVFVNNLNVDAQKSSLFSRIIRRLFGEKRIV
                     QLGNDVHTQCSAELGLRHVTKYRFNKRSVYVKHVFIEHIGGIVKPKLTSSDINFFRAL
                     DKVSMRCYVLVYVKNAYTHNYDHAVLLDDFEAIQGIKSAEAARRLVDLSQASQVIRNI
                     LL"
     CDS             complement(409224..409940)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35760"
                     /product="hypothetical protein"
                     /protein_id="BBN83591.1"
                     /transl_table=11
                     /translation="MKITKRVSEIALLGKFSYVQLRLTSSAHSYIAVAKLQEFDSNLL
                     INVRGQPMRNCSFAIFVLSALLIAGCASSSGKSVEQKRAAVESMRSDVLSKLYTQKPD
                     VQQQIASSAGYAVFDNANVNVIIASFGGGYGVAVNRQTGAKTYMNMAEAGIGFGIGAK
                     DFSVVMVFHTSAALQRFIEHGWAFGGNADAAAKHKHQGGAVAAEVVVDDVTVYSLTET
                     GLALQAVLKGTKFWVDDELN"
     CDS             410331..410903
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35770"
                     /product="hypothetical protein"
                     /protein_id="BBN83592.1"
                     /transl_table=11
                     /translation="MFKRLATTTCFTLAAIYISTSFASTMQKEQPVNAISDDDYRIVV
                     FENCEKVLEQPLNNAQVSSFLALEEQSKLMKQLEAPVQKVSAQMGKLGHQIEAISDKA
                     FVKHGDKLTIDKALLAEQKSVSQQLEALADAHSDDFKALEKQGKHVESAAKHFESQIK
                     PMIGSLENAQIQILEPGELAKPCSTYITRS"
     CDS             complement(410997..412697)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35780"
                     /product="hypothetical protein"
                     /protein_id="BBN83593.1"
                     /transl_table=11
                     /translation="MSSSQLKHAQNLLTAQQYAQAAKAFENIVDEQTQNVAAYTGLAL
                     CNLSLGNHFEALGCAVDACQFGGYQPSELVVLLKVLTSGRFSSYLKPVEKALHKALEH
                     KYLEGQAVELLRIQLMSKYKKVLEESIVELNEPLEDMLGDPTFYHVVSRTIIANHQLE
                     KVILLGRKELLRCIANNLDARHYLPTMAAIACQNLLNDGLYHTTEEEEQLLAQLEACE
                     PVFKSEAVALKLCYASFDEAMAIWAQADDAFDNYKLNELATDLDFYQSVRSGAIEIAS
                     ELNNETSKTVQSFYKENPYPKYKVVNMSALSVTQCMARLGMKAVPAPNILIAGCGTGL
                     QVIELAFANPDGHITAIDISPMSISYAQQMVKRYQLSNVEFRLLDILEAKQLAQQYDF
                     IISTGVLHHMASPESGLKVLAELLKPQRTMVLGFYSELGRRELPHIRKSVLSFFGSDN
                     ITKEQLPLWRSQWSEQQKSEAWFNSNDFFNSNGMMDAIFHPQEAYYDLPTLEKMLTTA
                     GLNFGSMALNNVQKARYQRALDDFEPLKSGESLSHWAEFEQLYPDFFMGMYNFFAIKQ
                     "
     CDS             412905..413222
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005479981.1"
                     /locus_tag="PA25_35790"
                     /product="hypothetical protein"
                     /protein_id="BBN83594.1"
                     /transl_table=11
                     /translation="MSDNVFEIVEFKLAEGVSEADFLPLSNAFESFLAQQPGFMYRSL
                     ARGNNKAGYVDISYWQSAQDLEQCEKAFEGSTVCKEFMTVIDSESVVMTRHAIIAQTQ
                     CNG"
     CDS             413261..413959
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005479958.1"
                     /locus_tag="PA25_35800"
                     /product="DNA-binding transcriptional regulator"
                     /protein_id="BBN83595.1"
                     /transl_table=11
                     /translation="MHKSERLFQLVNLLKGRRLAITAKQLAERFEVSERTIYRDIESL
                     QDSGVPIHGEAGIGYIINDHPLPPMMFSIDELTALLLGSKMVSAWTDPTLSNHAKAAI
                     EKIEAVLPANLKQQSENSPYLVSSFNHGKQQQAFSASLRKAIETSLCVELHYQDVNQA
                     LSNRVIEPLGLVYWGGKWTLVAFCLLRQDYREFRLDRMQSVTVTQTSFTKHKEKCLEH
                     YIALIRAKYANQCD"
     CDS             complement(414261..414863)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35810"
                     /product="hypothetical protein"
                     /protein_id="BBN83596.1"
                     /transl_table=11
                     /translation="MSHWNEKQALAYDQQWGELDFHRQIPSLAGVSNNTRVIEIGCGG
                     GFLSVCLANHAEGVSVLALDPSDKMIELANKRKQQSGLGKAQLAFLQAGAESLSVDAQ
                     SIDLVIAAFSLHHWSDPKLGMQLVFNGLKLGGKIWLCEDMNTPTGGELKVNDDLKAFA
                     GIKLLLEQFNFANIKKQLLWTPEGEFLIVEATKTATINSQ"
     CDS             415018..415821
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35820"
                     /product="hypothetical protein"
                     /protein_id="BBN83597.1"
                     /transl_table=11
                     /translation="MTQYVNINAGYLEVDELDNEDHHAHEEYVITLLLSGYVTLKSNN
                     ATLIKPGTLTLVPSGFAHTLVKGKAMSVHWLSFGITDEQHAQNNDLFLPFTQIRQGAL
                     PIAQVSKTRLPFIITLFEEVQRACSENKPDVVLESLINLIISEAASASSISPVYLGHE
                     TKVSKAMQFIERRCCDGISLKDVAQAVHVSPAHLTTKMKASTGYTVGQWIIKHRLKVA
                     INRLETTADSIEHIAQKLGWSDVTHFIRQFKKAYQITPAAWRRRHTIKP"
     CDS             416117..417022
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071093.1"
                     /locus_tag="PA25_35830"
                     /product="GGDEF domain-containing protein"
                     /protein_id="BBN83598.1"
                     /transl_table=11
                     /translation="MINAEQMSAVLAALPDPVFLLSRSGKYVAIFGGKDERYYHDGSN
                     LIGHTISDLIKKDKADWFISIIERALDTQALIIEEYELSNKDVKGLPDEGPSEPIWFE
                     ARVTPLDFKVDDEDVVLWVASNISPRHKLETQLREQSDTDLLTGLYNRRRLERELNYH
                     FSAFQRHGHCVSLLMFDLDHLKVLNDTQGHQAGDQAICKVAQTCKDTLRQTDIACRFG
                     GDEFVVILPHIKVAQATQTAQRLREAVENVFYDKNKANKKPITISVGVTEMVTSDTSY
                     SQALKRADVAMYDAKHNGRNTVICK"
     CDS             417222..419369
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013225776.1"
                     /locus_tag="PA25_35840"
                     /product="hypothetical protein"
                     /protein_id="BBN83599.1"
                     /transl_table=11
                     /translation="MIKWFKWVGSLIVICITIITILILWPQLAEDEFTHRQVRSIAPS
                     ENNLLLDFYPHIAKVQRPDETFQFPIEIGQVGPAESLYSGPNQYPFFCMTLDSGLGQP
                     QVDNQLGHGVAVYDKHNQVIGYSKDCGVKTRLEYYTIDNNLDPQSLTLTQAQTFSGPL
                     FRVERGSINRFIYTLVMPITKDEVGDRSAQSQWNQRLIYQFNGGSGIGYRQGRQHAWK
                     VMQRQANQLLDGYAVISSSGNKTSYTYNMLLAEDTARRVKKQFTSLYGQPLYTVGIGG
                     SGGGLAQYLIAQNSTGILDGLIPLYSYPDMITQTTYALDCDLLNNYFTFRADNKKAWR
                     DWERRRLIEGMNAINDFPQKAGFLQPLNQLMAGFVPSFPDGNSECINGYFGLSAFINN
                     PKQGFLRQFFAKPVVEQTNWSYWQDMQHVFGKDKHGFGNSTWDNVGVQYGLNALIDGK
                     ITFAEFVDINTHIGAWKAQNEMHQEHIVTPLGTKIPLWLSLWGSDNITHAEQSAAPRH
                     QGNLKAMEAAYRSGQVFIGKVTLPIIDARHYLENELDMHHMSASFYSRLRIDKANGHS
                     NNHVIWVAHKDHDPTTQAFALMDQWLLNIKEHSAEGVLSAKPKQLQDACFNEDGSVHA
                     KGEHVFDGQWNNKPDGACQSRFPMYSTSRIEAGAPWAGDLFKCALMDINTAVQQGLYG
                     DSISPDDINALKRIFPHGVCDYSKPDVGRPIDI"
     CDS             419432..419770
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003021110.1"
                     /locus_tag="PA25_35850"
                     /product="gamma-glutamylcyclotransferase"
                     /protein_id="BBN83600.1"
                     /transl_table=11
                     /translation="MEALFSYGTLQQTQVQLDTFGRTLSGTKDTLLGYVLGEVTITDP
                     KVIATSGKDVHPILVHTGLASDQIDGTVFLLTDDELTQADNYEVDEYVRVQAQLASGN
                     RCWIYAASKK"
     CDS             419767..420051
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35860"
                     /product="hypothetical protein"
                     /protein_id="BBN83601.1"
                     /transl_table=11
                     /translation="MTKTEKRLEKQLIQLLTQACEELKDDLANFLYLSHSASLKNLTN
                     TLVVELFCSQSLSHSELAKASTTLNFYLSKLNCAVKPASLKVTLVTQANN"
     CDS             420155..420934
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35870"
                     /product="hypothetical protein"
                     /protein_id="BBN83602.1"
                     /transl_table=11
                     /translation="MPQFKLSAVVLCAMLASACSSETTNSNLVKTEAIWSDIYVTSNG
                     NDSRVIAELNVSSRNGNNLNLVAGDKLSVVASNDALSQNMTKDMTKDIEFFDIDYRAT
                     FPYHEADTQYEVKLYRSSEKKTLTSIVTLPESIFVIAPQQAQRFEVDQPLELRWAKAL
                     KIKGNQSLEIQLTSLCKKDDNEISNAYTFTDVADTGMKTINFDDINIFKNDELNSSFD
                     CSIDFEFERKRYGTVDSRYASGSRAYAKTHATLKDIKITLK"
     CDS             421291..425154
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011204838.1"
                     /locus_tag="PA25_35880"
                     /product="protein kinase"
                     /protein_id="BBN83603.1"
                     /transl_table=11
                     /translation="MSLTQFSDAFITSSFNSEHYELLHKIGEGGFGKVFKAKHKNTNQ
                     LVAIKFLAIEPHCEEQKKQRYIERFKRETELSSQLQHPHIVRLLDRGQVNDNILYGVF
                     EYVEGVTLREYLTTEHALDSVTATDVMLQVLDALIHAHSKGIIHRDIKPANIMLSKMG
                     AKTYAKILDFGIGTLAQDTRAVDYHTLTLTQETLGTPSYSAPEQLRGEPASAKSDLYV
                     WGLVYLECLTGLPAVTGNSIASIYHKQLSDVHIPIPSALLGHPIAELLRRVLHKNATE
                     RVVTGAEVYSELANINVSNLVGVLADASARHGFDDTTVMIRDDDPNHRAIADYTALTE
                     RKQLTVLAVRLSVKALNNNDKDYDVIDAVYKSQRNHLIDIATRYGAYHVGNLADTCLF
                     YFGYPIASDNDTRLCARTALEMVGELTKRNALMQEAHNVAINAHVGIHTGVFITYANS
                     VPEGHNANIAIALSREAGEKQILCTFESRSILDAYSEFNTYGQVQLGPIFEPVTIFNL
                     MGERRVEAFGFMRGTRNHHELIGRHAELEQTLSIINAQNQQTRIAHIHGEAGIGKSRL
                     LQEIRANAPQYQHLVAQCLPEHQNNALYPILTLIRYLYNTPSLDVDSASTLFSNLLEK
                     QNSALNIDQALPILLVWLNIDLGDKLQPSALAPEAQKELLFESLSALLLTNQHSLSDH
                     KLYIVEDIHWADSSTLEFLHHFAQQLTQGHVLLSTSRQNIPTVLQDLTLLEVNLKKLT
                     EQATEDFIVKLFDGHSVSRNVLDILVSRTDGIPLFIEELVGMLKQKGLVADSANNIDF
                     VNPDKLDQVPTSLRESLQQKLDSLQFAKETAQLAATIGREFEYDLLVAASPLSENQIQ
                     NDLKELMENDLIIHQRRVDNDSYIFKHALVRDAAYESMDTEKILDYASKIYVHLITLN
                     DSSEDLTRIIRLAQFAELAGKLKNAVELFSHAGNLSFKLPHGKLQAHSLYNKALSIVK
                     LDNNKDDMVWDKFNLYSQIGLCEILLKGWNDPATAQYFNECLHLVNTIDDLELAMKMS
                     KNAFMYHYARAELKLAEQYSSQINALNVNDNPIYQLIYLECQAQVKFISGEYEAVINI
                     AAMADEIEHKNGVLDTQKFGHDSVLVCRSFASFALCLSGNIPQAYDLMSDVLEESETR
                     STPDVISSFHGQLGLLSLFSFLSSGDEKNLEQCLTHSKLGASLSARYGFKFYELFNLL
                     NLACAEAFKFPSVQGVEVIESRLEAMLGLPIHAPFYLYTSLRICNLIGCENKLNYINQ
                     KFTQSLHASDVQYINTFLQENQPSC"
     CDS             425148..426656
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35890"
                     /product="hypothetical protein"
                     /protein_id="BBN83604.1"
                     /transl_table=11
                     /translation="MLRTSLFLTASLISNLTLAQDTAQIYDVICPTDDVITQVLPNQR
                     NFKFCSFIDANYPERRPDIDKLYHSFAWDAFEALLKESNFPDNANWDEQETYIPQKCT
                     NYSADSFSDFLKPTWHQQASVDANIALPKPHNPLWDQAGNQVVLTAYLNDIATSNYSF
                     GNNKNALKSASDQFELYTKSNKTLYIKNWQTDKSNGPLSIKLAWKQLTASDKEQQYFV
                     WYNPKNSKKYGLVAFHLAAKLASTNNYWVWTTFSHINNLDGEHPSFTNPDCPAEQCPV
                     NMCPQIVNGKRKTQLARVTPIAKPIIEYNQIRQDNAAKAKSVSQYYQLVGVQRPLNAF
                     GFTANKSSEVTPFSDKEFNESVAIPSGNILANEIIEWDRQANSSCMSCHSKAVIWANI
                     STSNDKNCDSISDASIERIGDSQQAEIFNLIKGKKCAYANSYQLGPDKKSQCLQKSSG
                     NDNCPQVLFLDRGWYGQGFQFTKDSLTGHTPASDFIWSLYDAKLQTKQKGNK"
     CDS             426656..426925
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35900"
                     /product="hypothetical protein"
                     /protein_id="BBN83605.1"
                     /transl_table=11
                     /translation="MSNQEIKKQEMEEKYSYLASLYEMYVNGGIDKMTDVGLNKYIED
                     YCPFMPEKLQNMLQDMPIGGQFDQSQLTELLKSAEEQMLDNPITW"
     CDS             426938..427891
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35910"
                     /product="hypothetical protein"
                     /protein_id="BBN83606.1"
                     /transl_table=11
                     /translation="MQLLNKTQLENLGSLFASSVAASFSKVQNIAETFNSTFYFESRI
                     SDDDQVDFLARVERLNAIELKEFLISNDLQSSHFWLIDIIDSWTQTTHPFRNKLESIW
                     LEWDNIASLDEGRFGISFTFHPKIRNKPETIKRWLLANIPNTMLQIESLNRYASQALP
                     AELIHFTLMLQRENVENKFYTHVQLGKLELFYEFIHWTPLNLTNERDQSLANVLGTTS
                     LFFDVDLSDVRRKIPHRTSVNFIMSEGMVEHLGRSTQLPSHFLKVYSLWNCNNEVQPR
                     QKQLSLVQTRWLELKWVYKHGEFTEIKAYWGFHKPSVKLFT"
     CDS             428244..428837
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35920"
                     /product="hypothetical protein"
                     /protein_id="BBN83607.1"
                     /transl_table=11
                     /translation="MNKLLCAAALGAALFSVPSFADIGITAYAGQTLNQKISTSKGQE
                     HEIVDDTHFAVSVDRHIDGAKYGIYYSVFESELENSPTHKVDSELLLFQSAVKRPVTD
                     NLQTYLGAHLGVNRISTNFVKDDTFFATGLFAGLDYQLGAGFSVGTEVRWVATIVKNT
                     SAVSCDNNPDTADTCSWHFDNESLSQFQASANITYRF"
     CDS             429042..429224
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35930"
                     /product="hypothetical protein"
                     /protein_id="BBN83608.1"
                     /transl_table=11
                     /translation="MAAQTDVNGQITDFVTQTHTKVLGGKATYSLKKLAVAIHQAQVK
                     ALPPVNGQVTDLKRTC"
     CDS             complement(429491..429697)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35940"
                     /product="hypothetical protein"
                     /protein_id="BBN83609.1"
                     /transl_table=11
                     /translation="MKTLNVAFTTLVLLASASAMAGTFADFDTNKDGVISKSEAAASE
                     SLMKLFDELDANKDGELSQEEFNK"
     CDS             complement(429709..429930)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35950"
                     /product="hypothetical protein"
                     /protein_id="BBN83610.1"
                     /transl_table=11
                     /translation="MKLTSVFTLTSVFLASAVAFAAEYSFASLDSNNDGVISPTEAQV
                     SSELASQFRKLDSNKDNELTPVEFAQFKQ"
     CDS             complement(430013..430237)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35960"
                     /product="hypothetical protein"
                     /protein_id="BBN83611.1"
                     /transl_table=11
                     /translation="MKNSLITISFIALSAAALTAQAGTSFSVIDSDGDGALSLSESKA
                     LPKLMAQFKDLDTDGNGVLSPEEFAKFKSE"
     CDS             430548..431984
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015703178.1"
                     /locus_tag="PA25_35970"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BBN83612.1"
                     /transl_table=11
                     /translation="MDIEWLKWPQSLYFSKIKNSPAKFFSQSLGQQARLAMLLALVPI
                     IALTLWYAQQLANHQQETNHIYQINQSLILKFTTLKSDISALEKAHLNNQLLNNAKLQ
                     KTIENKWLTTKKNIEFLKNSLPFEPLVAKWQQLQKLTPKIGAVDVNYEQLRQQLNGLE
                     ANFNQAIQSRLTDRASAFAKINRNFLFGLLLLIPLLSVISLLVIRKVTRQLNAFETVI
                     LQLGGGDYTHPIELHGSEEFVALGKELDWLRNELQRSQKQKDAFLRHVSHELKTPLAS
                     LKEGNSLLQSDNFGHITSAQQRIIQIMDKALFRLATLIDDLLNYSAANHTLAHQFCTF
                     EQLKCQVLQHFEEQLSSSQLNIEWIYRQNHTVLPYLPAKLILTQLMGNALQYANSMIK
                     IKFYAQQRQIFINVIDDGPGIDPSEQHQLMQPFYRGKHSNNHQGSGLGLAIVAECVKQ
                     LRGTARWQQTSAGAHICIQFPEQGDKHA"
     CDS             431977..432504
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_35980"
                     /product="hypothetical protein"
                     /protein_id="BBN83613.1"
                     /transl_table=11
                     /translation="MRNGLIILLLCALVACKSTTDKSKAFIGPSNSKQQQFAPLSVLV
                     QAHLSTCENHSQTALAGYRGHQTLRLFLDSFCKERSTTTQLRLIKKLHLQEDWPQDYR
                     NYFALLYQHTAKLRQYKLDNLSLKKHQAAQKQALLDAELALEHLKQKLAQIEQQRLAS
                     PATLNSKGNELGVNP"
     CDS             432501..433811
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005172694.1"
                     /locus_tag="PA25_35990"
                     /product="transcriptional regulator"
                     /protein_id="BBN83614.1"
                     /transl_table=11
                     /translation="MSSTLLLVDDDTSLIELLAMRLEANNYHVLTAHRGTQALQLLQQ
                     NSVDLVITDLRMAHMDGFELFENIKKNHIGLPVIMMSAHGSIPDAVDAMQQGFVSFLS
                     KPIESLSLLEAIKNTLKNHKKRNSVLNKHHFHGLAYQSSLMHQVVQQIQALAPSQASI
                     LIQGASGTGKEVTARAIHKASNYASGPFVAINCGAVPAHLLESELFGHKKGAFTGATH
                     DKVGLVQSAHGGTLFLDEIGDMPIDLQVKLLRVLQERTVRPVGGYTEQQVDVRVLSAS
                     HKDLYQAVTNQEFREDLYYRLNVVSIHLPSLHARPEDIPLLANRFMQQLTDDKKVISP
                     QAMTCLLNYHWPGNIRQLQNVIEHAVANSSAKLITADIIKSAVPQIGETSFEGLNDAK
                     KKFEHDYIKKVLSLCQGNVAEAAKLAQRNRSDFYKLIKKHQISC"
     CDS             434057..436009
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011267518.1"
                     /locus_tag="PA25_36000"
                     /product="chemotaxis protein"
                     /protein_id="BBN83615.1"
                     /transl_table=11
                     /translation="MRMRQKLIISFLLTVIVPILAISAVSITKTKEESLNSFLDFSSS
                     EIRQIENTFVLFFEQMKNNARFLAQHKTVSDMPDDIAQYFGAEKPMTPHKNSPQEGEI
                     FEFYTAFGQTHPELLFVYMGSEYGGFIQYPAEPLGNYDPRKRPWYKNAKQSPKDVVIT
                     EPYQGVTGQAMVSVATGIFNNNKFLGVQSLDVTLSTLTDIVSNIKLGETGYVILLDGK
                     GTVLADPKRPENNFKNINELDVPLYKKIATADDKPYISVEMKNKTVDAKVYHSEKLNW
                     RFVAVIDEDEILSSAYSMSWSITLIALVMLMIFGIIAVTLANKIVYPIERVSEGLRDI
                     AQGEGNLSKRLQVIGNDEISELATWFNQFLNSINALVKDIQQNAHTLNSSAQHFETQI
                     NDIRNQCRSQQGTANQAANNTEAVHHMAQNVSDNCQGSLDEIAQTDQFAHSGNTLISN
                     TVNQVAQLNSSLDASAAEISQLESESNNITNILGVIRGIAEQTNLLALNAAIEAARAG
                     EQGRGFAVVADEVRTLAQRSHDATQEIEQVLTKLIEQTRSVSSKMTESVNASNQAIEQ
                     SEEAHQAFENIASSVTKVKELITTIAHDAQQQGSSASQTHDQIAGLTESVVQVSQASD
                     SLSDGAKSLVELAKSLDQLVGRFHID"
     CDS             436116..437909
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000370883.1"
                     /locus_tag="PA25_36010"
                     /product="DUF4153 domain-containing protein"
                     /protein_id="BBN83616.1"
                     /transl_table=11
                     /translation="MQTDVTNPTEAVPTDTAHAELQNTPTQRRWLLLCALVQALGLVL
                     LHQALSFDWQITQSPSMLLASYAALLTGPTLLIYGVTTITKRHFYPIVVGFTITAALL
                     GAYTGSQTLYPEYPDLAAHSFNFAAIMSLLTFKIFIFSASITHQNGQWQLSYPLLIGN
                     TCKLIITVLLASIFTLIVWLIAVLWAELFSTIDIHVFKDIFYEPWFVYPTLSLAHAIG
                     VLKVRNSSKVVTTANHLIKTLSFALLPLLLLLSSVFLVAITFQGLDALWDNGGSNLVF
                     VLTLLILLTLNLAFQDTLTAPNIARIANIALLLGIVILPVYLAISGYGLWLRVEQYGL
                     SVSRLWAIFVWIFLTFYLGCYSICIIKDKLNWVRALGTINTRLGLLLALALILTQSPL
                     LNFKYISAQNQLARIHAGLTDVDDIDVYYFAHDLGVAGTEALIEIEAHYAQQYPQLGV
                     RIKAALENTQFDDLHDQPFDITDALQIIGSAPDTELPSSLIQKLQQYVLEYKAIAANS
                     IELLILPIELNDDKQLEYIFIAKQDNYSDLSLFYLDQKQWQRRALHFNHSDELSDQEL
                     VDLLIQGTYEVAPAQFKDIKVNGVKLNAFAY"
     CDS             438055..439416
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073676.1"
                     /locus_tag="PA25_36020"
                     /product="MFS transporter"
                     /protein_id="BBN83617.1"
                     /transl_table=11
                     /translation="MASLVAFMKSFPSLYFTNFFLVGGTGLLTTYLALYLGQHDVSTF
                     WIGLLTSCYYLGLLLGSKLGYHLIKSVGHIRAFSASTAIVTACVASHGVSDNIYFWLL
                     LRFVVGLGMMCNYMVLESWLNEQAAPEQRGRVFSFYMLTSYLGMVGGQFALSQFPELG
                     YAPLFLICIALSFGIVPITITRRIHPKPLKPIQVSLVGFFKTIPQSLTAVCFAGVING
                     SFYGLAPTFASQAGLSAEEIAMYMAVTIFAGLLAQWPMGVISDKVRRSILLRTNAIMI
                     GLVSLGLFFLPTQAPFSYWLTFAFGLFAFTLYPLSSALANSRVDDEHRVGVSSALLVA
                     FGAGACVGSASLAQVMTYFGPHSLYATFAVLTVIMYAALTYINARQKEEEPEPTDYVA
                     ATSDITSSPLAATLDPRIEDKTAQEQMLIVDGHIINTDIFSDDLDEELAQHAQSKESE
                     PSK"
     CDS             439987..441888
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36030"
                     /product="hypothetical protein"
                     /protein_id="BBN83618.1"
                     /transl_table=11
                     /translation="MADQSPTNKLTKVLSYDLPNKWRIDELNEQLLVNSPSEDLTMHV
                     LQLPRTQNKPSEIALSAWKKVSPDVTLEVSFEEPELSNQGWEAQHHVELVGSNNNVYQ
                     ATLLIGQKEVYAILLKTTPSEFDKRYAEISLFLNSIHLSGYKAPDYSSLTAKALDAND
                     IKNLQSFIAQSASTLSVPGVAFAISQGGKVVFEGGTGFTNTRKQQPVDAKTQFMIASN
                     TKGMTTLLLAKLVELGKLSWEDRVIDHFPTFKLGNSKTTEQILVKHLVCACTGLPRKD
                     FNWMFANTKHTPASSVFDDLAQLEPTSELGELYQYNNQMAAAAGYIAGHVLYPDMPLD
                     EAYDTAMQHYVFEPLHMNDTGFSFNNALRSNFASPHDLDIYGNIIEVHQNEHQGFNHT
                     ITPYRPAGGAWSNVSDMLRYAQNELDKGQARNKKRAFNELALLQRRANMITYDVLAHY
                     GMGLAKESLFGLEIIQHGGSLVGYKSDFYVIEQAGIAAVIMVNSTEGQPLLKAFLHKL
                     LELVYERKGQAQSMVKIAKEKQQMYTQEFISYIDSSTNQSIKNNLAPAYKNEALGVIT
                     FDSQTQKIRINSGQWQAEYTTISSDGTSKLVFIDPVLKGLELEVGNDNAKRTLTLHGP
                     QHRYVFYEM"
     CDS             442128..442334
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36040"
                     /product="hypothetical protein"
                     /protein_id="BBN83619.1"
                     /transl_table=11
                     /translation="MVVHNRNVVTPSTSNDDILLNNKAFSRSNSALLQVKITQRVSEI
                     ALLGKFTYVQLRLFRHNFKNDAIT"
     CDS             442500..445190
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36050"
                     /product="hypothetical protein"
                     /protein_id="BBN83620.1"
                     /transl_table=11
                     /translation="MKPVNISKGLALSVLTLALTACGGGSSDTPATPDSNEVTTPVTP
                     PVTPTEPENQAPVIEAASALQVQERAQFSFTAQASDADGEVTSYSWEQTAGTGIELSS
                     LDSDTIEFLAPEITEDQNITLTLTVTDDKEATTSQEFNISLKAYGQPSSDSITDSALL
                     SCIQNAELDFGATNIECNGTQVAQLTGLELFTKLTSLSVEGGKLQSIETLSSLTQLER
                     LRLKDNAITDFAAANSLVNLTELSLSADSSNTLSNLDFTNFLNLKSLGVFGLENSSHI
                     QFDLSTLPVNLTALSLHQVSNVYSSDLSAFTQLEKLSLKLKNNIESLSFLTKMPNIQE
                     LEIELRDSYNSFSDPSAFAVTPNLTKLSLVYSNISDYSFIGDLTQLKQLNITNGYRYN
                     ARPLDASSMSSLTSLESLKLNGVKLENHGKLSQHSALKELQLSYNLINSVGFLESMSE
                     LTSLEISNNDIIDMGWLKFAPKLEHLSLKNLSTDAQFSTVSSLPQLKSLHIEYDSYYN
                     TSFDVKDLEQLSNLETLRLDIQTITNIDKLQSLSKLKSLDLEQSGLSLLPNISNLKEL
                     ESLTLINNYSSDTAPEDLTGLGTSASLKHLTLKGFRKVSDFSALESYTQLTELKLSNF
                     DASDITPISTLTGLKTLVISNFNELIYVNSLSNLVNLQSLDLSSNNFLYCTDVETLKT
                     TFADIDSSEFPYNCIDKPIDYSVLVDENLRNYFRSNNYKDASKVNYLTIEMSEVSSLA
                     GIEQFENLQGLTFRHLTDLSVIDSATLSQLPNLNKIRFDYNRFTTLESLSLPSTVTEL
                     HIEDHNVTLSLKNFNAPSLTKLSLRWLTLSDTESLSGFTNLTSLDLYRANITDLTPIF
                     TLTNLQQLDLRDNSNIGCDQLAQLKAKLTNTNIYSPYQCR"
     CDS             445548..446069
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36060"
                     /product="hypothetical protein"
                     /protein_id="BBN83621.1"
                     /transl_table=11
                     /translation="MLFISVLLALTSLLLIINKPFKKRINQYGETYLIPVYIPLDNVR
                     AGKLALYCALLAATCAVCITYILDITTAETEDMMVYWVIISVTGVLIALISNAFFAVY
                     LAKKLIEHLDKAALKYEGICKPFSDRVGVMVGIASFYLFLYDMMMRIPALKNGIDNFF
                     SFLGDALHYVVIW"
     CDS             complement(446418..447392)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071997.1"
                     /locus_tag="PA25_36070"
                     /product="transposase"
                     /protein_id="BBN83622.1"
                     /transl_table=11
                     /translation="MATARKRQISLVDTKYYHCISRCVRRAFLCGDDTITGKSYEHRR
                     QWVEDKLLALAKVFCIDVCAYAVMSNHTHIVLYVDDKKAKRLNDKAILIRWHKLFKGT
                     LLTQKYLQGDKLDKAQQFFLNRTIADYRERLADISWFMRVLNEDIARKANKEDNCTGR
                     FWEGRFKSQALLDEAAVAACMAYVDLNPIRAKMAKTPEDSDHTSVQKRIKAAKDAKQP
                     KQLARFAGSPRKHIPKGLPFELKSYLELVELTGRCMREDKRGHIEQRTLPILERLNIA
                     PENWLKLTTQFTKVFKGAVGRPNKLDGYYTHLEVKRRTGISHCEKLFG"
     CDS             complement(447565..447870)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36080"
                     /product="hypothetical protein"
                     /protein_id="BBN83623.1"
                     /transl_table=11
                     /translation="MATARKRQVSLVDTKYYHCISRCVRRAFLCGDDTITGKSYEHRR
                     QWVEDKLLALAKVFCIDVCAYAVMSNHTHIVLYVDDKKAKRLSDKAILIRWHKLLNK"
     CDS             complement(448058..448396)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36090"
                     /product="hypothetical protein"
                     /protein_id="BBN83624.1"
                     /transl_table=11
                     /translation="MNNPLAGTDPSGYKWEKKTGSNVRTKTADVSTTGKISASDTVQS
                     VEVKGDTITIKTDNGSMTVNDVTADEVSNIVDMKGAANKKNGSANLRKNKQDTHFYLY
                     IFRSLPIFYL"
     CDS             complement(449148..459296)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36100"
                     /product="hypothetical protein"
                     /protein_id="BBN83625.1"
                     /transl_table=11
                     /translation="MTATRVILSCALFLLCASAKPALSAGFDFPTHLQFMLKNLRDNA
                     QDNSAPTVTEDHITLSEDQTSLLDLLGNDIDADKDTLKIVSVSAKFGEVLLLPNGQVK
                     YIPPANFAGQDEITYMLYDGRSNPVTGLAYITVNAVNDAPIAKNDAATLIANTATLVY
                     VLDNDSDVDGDALTITQVSAKHGQVLVKSNAIEYQPYFDFDGSDVIDYVIKDSAGATA
                     SAKVLITVLKENKTAPEITAQQPLVMDEDTSFTLDIEHITYIDRDSLPEDITLEVTQG
                     QNYTFDGLTITPITNFNGELIIPITLFDGKHLSSTFELKITVNEVNDHPQAGQIIWES
                     VKDEKFTIYMRGMMHDPDFDFWPLGRNDPRLKEFKYIFSKNAVREDHGGWTDKGGRFV
                     HVPGARDDVFEYTPPSGFVGRDNVFFFVYDEHGAPSGRGDITIDIKEHKDSPVIIRHH
                     DIAAVQEDSAFSLSINDLYIRYKGSFSNNDALSLVVQDMPGYYTFDEASGLVTIDPFY
                     EENVLNIFAKVTDGVSVSNTHRISVPIISVNEAPVAEDFEQTLSELEGVEIDFRSKLV
                     RDPEANKSPNLLDQFTYQFMSPQGITNNKTNNGQLVRVPGKPHGVFKYIPNQRFATDI
                     FAFWVTDNEGLQSNKGTVVVKPPIPAVPTTPTLVVNGRDVQLQWGNVDFATSYLVEAH
                     SQWQNEQPIKKQHTTEDNVFTLINQPRGNSKYRVKACNELGCSNYSQFSEQITIRTKP
                     DAPAAPGVYLDSQNIKVTWNKTIDSQYYELAVKVNDNDWSQPEPYRFEDSDYSGEQVE
                     VQWGNIAAALRSYKVKACNELGCSEYSPVSIVTKNYIAPPRALLIGSRDVAVSWDTSI
                     QSKFDIQVKYNTNDWTEPGRFISDSKSISWSDLPSGYRIYKVRGCNSDLSKCTDWSAE
                     SNKLEVPVWIHNVIVDGSTTTLEWGPVPGVEYYDISVKFNDNNWSEPGRFSVPHGDDL
                     ETNRVIHHNLDGGVRSYKIRSCTGATCSAWSAPTDEYQTVGLPADTPKLQVSVPARTF
                     IDSTEQITWEFESPATLALNATLYVMQPNTTEKVKLASSSSGSAKPFTKAPGKYQYLF
                     AESGTYRFFAQACGNVDVTHKACSDSWLTEQRVEVINQEFAPQNSGAELTWPSVPGAT
                     RVVIESAACADASNCDMTSLDWSELEALENGETSLALSNSEGKVYRIKVCFSDGSCTS
                     WVKVESDISTLGYAAISAKELNDAEFSDISAPNISAVGTFGGQASVSGGAASYSLPIQ
                     IAPGRNGVQPSVSLNYSSRSGSGIAGVGFNLSAGSQISRCSATYAQDGFTQNPQYNDN
                     DRLCLDGQRLIAVSGNYGEDNTIYRTEIESFVRVTQSGAINGTSTDFIAEYADGTTAY
                     FGQDNDARVIHNGRAQTNAWLISYQHDATANNYIHYSYSNGGLGEKLLSKIAYTGNEQ
                     TKTGSQYVQFNYKARSQARSGYVAGGYYESTQLLSSIGVYSNNSLVRQYKLDHTTSAI
                     SGRDLLTSIKLCVDSSNCLPATTFTWQNSSAQTLKFEPMSDANGTMLYQGVETLSSVL
                     PRGDHNADGVRDWQGYYVDAEGNAVANTLTFNACRLNIFTRQHECHDGDFDQDGKSDQ
                     WRVEANKLVLQLSSSGKQFNTDINMPAKKISALKQYSHIRQIGDFNGDGFPDILVFIS
                     DEQPNVDLYYHTKNINSPYESEASHSWQLKTYPEGAPTGLLTELSVVGDISGDGTLDV
                     MLASTGFAEKAAYIQPLPIEFWLGDDDYKKAVESPFEQTDSSPFTPNLSYFIDINGDG
                     LPDWIGGNSEGATHSLSYRLNQGGGVNFSAEDTFEGNAGIENRLESFSNGSDGTDVRN
                     IPKYYAAFKIEDIDYDGIPELLMPGTRVYESCHKVINAGRADRRCGANIYSNYFPGEG
                     GEGAAQSPINAQRNDKSIYQFDALKFSKNQNGTYAITKVPTDFIGSAYDSAFVDVYGT
                     GLRSLVFNHHLGGTHSMGEEQVNTQFSQHAQVQGIYINRNYGAGGGTSGADYAPIDML
                     QQVENGVGVVSKWTQRPLSSSSTDYEIGATNTDNQQGYFNFASSMYVVTQFEQSNGVG
                     STRTKQYGYYGAMYNAQGRGFMGFKSVIEKDVALGVVTRSDFDQIFPYQGKLIRQAQF
                     KAADYTLRSNELLASATTETTAISHTDNTWEKTGRYVYLSEQTTIQRDIDSSYTNMFT
                     NALTVDTIDECGNVTKSTQTRSDAWGKYITTTEATVDDTASCSNTINETWWPHKLESK
                     TVTKSKITERNSDDPVMDSANTVLDSKVSIVTEFSEYQANRKPKTVTVSGKVGDTGSG
                     KGKTTTTIYNIYGLPTSVSETAQVRNSAGSWVDSTRTTSMTYSKNGTSEASDGYFPLT
                     VTNAKDHQVTTHTDVATGQPTKQLRQVSATGWVSTSYGYDKFHRPFSQKTDGMPIQYT
                     AIQSVTGDEHKPAHAVMVVKQSSAGAPEVRVYKDKLGRTIRTASQAFDGTWVYQDVSF
                     DHLGRTSFESMPYKSGGNRIGTSYSGFDELNRPTTKTVAQECGQSSTGTMTVSYGYSG
                     LQTTIDVSESCNSITLGQMSRTYNSLKQLVHTQDAKNGNTYYGYNSLGLPAVIEDAAG
                     NQIKATYNALGRKTKVDDPNQGSTTFAYNGFGELQQEVRGNGTKVTYLTDALGRVSQR
                     SATGEQTLSYSYDGTNGYGQMTSASGNGVTHTYGFDALGRPSSHTVAGSGKSYTTTTF
                     YDGNYGRVKGVRYPNDLTLEYTYNDLGYQESVKNAAYDYVYQSVTTQDILGNITQSTL
                     GNGLTQKQFYSLASGQMTGSYTETEHGGQLMSLNYTQYDGFGNLKAMTVTTGSFDNQH
                     SFSESYEYDNLHRLTSNQIDGIPTISYAYDAVGNLTKKSDYASEYNYGTLQDGLPNAV
                     KKVHKTDGTWVDFSYDARGNMTQGDGLTSAIYNAMDKPTSLTKNGITSTFVYGPDHMR
                     FKQVKGNTTTYYAGAYEEEVEGSKTTWRAYIGDIAVVSQGSNESAVIRYTHRDRLGSA
                     RLFTDRNGKVIAERNFDPFGKPRQSSGGSKAVSQLEDKDLAKTNRGFTDHEHLDELEL
                     IHMNGRVYDYNLGRFMSVDPVIQSPGNSQSINPYSYIMNNPLAGTDPSGYEAKLTGSH
                     VKSAGEASSSNLSIATYDNSEERAINRANFADKSLARGWTNYHNKKSNGAGTSSTPSS
                     KETTDIGGEGEKEKGGNLDSLSKNILSYAEQNPTPIQNSGWEYTGKNDKGMKTYQTVH
                     DVTKDDGLSLGKLNDNFITPAGLTAGYIQNTYGQTKNRWSDRFRNHGKIWDKARLVGN
                     YAFIIGSAITAGTTFMDLINMRQKDSSVEKMALRGLDGIADIAAGTLAFAGPIGWAGA
                     AIYYGADYLSGGNLTEYLYRSILGRREEEHGI"
     CDS             complement(459318..460238)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36110"
                     /product="hypothetical protein"
                     /protein_id="BBN83626.1"
                     /transl_table=11
                     /translation="MITLQQLKWSQSHMTCAAKAPVLLNNTGRVNRRNTILIHPTNKQ
                     QESYFMRYLSTAFFTLLAPCAAMAASTVAELNVSGDVATFTLSEPKTHAVPSCVNSDK
                     QNHWAINLNSLQGQAMYSLLVTAVSKEQLVSVQSAGRCEAIADVEQVQSLSLSTNSNK
                     STGSGGAWLYKGDGVTKVGKILSAANNTYYYSPVEGTKTIVFYSPSTTENFSSLYFLD
                     PECKVDPYKDYYGYPVLSYFKNVGEYFTFSDLNSEANRLSSHGSKPVYIIQNNSCIRN
                     QSYIAQDHNRAVKLEKTEHPLCGKTPCWIK"
     CDS             complement(460162..460953)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36120"
                     /product="hypothetical protein"
                     /protein_id="BBN83627.1"
                     /transl_table=11
                     /translation="MTYRLIILLTILFIPLLSHAASKIKQLEVQGETAIFTLADPKSH
                     AVPSCVSSDNQNKWAINLNSLQGQAMYSLLVTAVSKGMEVDVTSANRCEALPNVEQAA
                     YLALNVSQTAQTAQGPALYKSDGVTKLGNIVAMPQHNSYYYVPDDGRKGADSYTLYED
                     NQNMLFLNAQCTGDAYVDGTIYRIPSYSRRLDLYIYHTSGSQSENRLYTKGNIPVFYL
                     EQIPPYHEFNYTCTNSNRVASDYTAAVKVVTKPHDLCGESACIIK"
     CDS             complement(461116..461451)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36130"
                     /product="hypothetical protein"
                     /protein_id="BBN83628.1"
                     /transl_table=11
                     /translation="MKTLLLVLTALASWACFGTQQQYLVTDVQIKNDTVLFKTHPKRD
                     AITAAACVSSQQLDHWLIDLHAKGSTNMFSILLGAFDSATPVLIEGEKSCFADTNVEL
                     VKKVTVYSN"
     CDS             461822..462112
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530552.1"
                     /locus_tag="PA25_36140"
                     /product="transcriptional regulator"
                     /protein_id="BBN83629.1"
                     /transl_table=11
                     /translation="MKIEQAATQLAELGHVTRLEIYRILVRAGQNGLAVSAIQQQLDI
                     PGSTLSHHISRLVKVGLVSQTREGRVLRCQAQYQQLEGLIAFLSEECCADSC"
     CDS             462166..462582
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36150"
                     /product="hypothetical protein"
                     /protein_id="BBN83630.1"
                     /transl_table=11
                     /translation="MFTSTQWQSAIEFFIGAFIELGILFVLISFIVSIVNHYLPMNKV
                     RTLLSGNKGYGIAMSLGAITPFCSCSTLPMMVGLLKARAAFGPVMAFLFTSPLLNPFI
                     VALFWATFGAYKNNKTAIFKLTRQRINCTRYFDIST"
     CDS             complement(462710..463684)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071997.1"
                     /locus_tag="PA25_36160"
                     /product="transposase"
                     /protein_id="BBN83631.1"
                     /transl_table=11
                     /translation="MATARKRQVSLVDTKYYHCISRCVRRAFLCGDDSITGKSYEHRR
                     QWVEDKLLALAKVFCIDVCAYAVMSNHTHIVLYVDDKKAKRLNDKAILIRWHKLFKGT
                     LLTQKYLQGDKLDKAQQFFLNRTIADYRERLADISWFMRVLNEDIARKANKEDNCTGR
                     FWEGRFKSQALLDEAAVAACMAYVDLNPIRAKMAKTPEESEHTSVQKRITAAKDAKQP
                     KQLARFVGSPRKHMPKGLPFELKSYLELVELTGRCMREDKRGYIEQRTLPILERLNIA
                     PENWLKLTTQFTKVFKGAVGRPNKLDGYYTHLEVKRRTGISHCEQLFG"
     CDS             463992..464291
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36170"
                     /product="hypothetical protein"
                     /protein_id="BBN83632.1"
                     /transl_table=11
                     /translation="MKCKTTKLSMLLSVIFSKIISAQPLDHGSELSGNSALENSRVTP
                     QLSFIISTGTGATFSIYGTYVDIQRNRNTHTRHEKHAHVLNRAKKIGLLANRINQ"
     CDS             464425..466806
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36180"
                     /product="hypothetical protein"
                     /protein_id="BBN83633.1"
                     /transl_table=11
                     /translation="MKKVSSLAYWTFASVLTTSVATAKTEDAFESSSFPINQPHYFDE
                     NDSLSGGIGTSAFDPVSVAVAIVIGAYQIYQKQEQIDQDAEFYKTSLAQHQKFATETI
                     SLLNQNLDLTKKVLDKIDEQNFKAAYQRVSEFKRDFNIYLGDIKHPEDRYKISRQKDI
                     EKLERYTKLASDIITIYDTAKNTNLLQEEQVITFISDLLMMAHSFYVEAGFQEVRREE
                     EDGLTKDKMEVLADYVSDQMIGMFETPNHKGTTLVDILNHIVVNIPAYSVEITRNYLR
                     SSTEQRKNIFKNDYDVSYLPILNGSNVTAKLLDGAFVNKVSGCVYKVNPYFKHGLYGY
                     NIWSQREARMNFEIKGSAFSHLIGSAGYLFKREPQNCDFPYSEDNSSAVNHFLKNKLN
                     FNDYPELVMPVYIKELNEVYKPLSNSMRSILDMYDYKYGDRTCYYQRQKCGKVEYIDK
                     LAVIKTNIAAPYDAKVYVPELELSVSVNDKGTPIASWALKGNPEYDYQPQCAMYRNGI
                     YTGNIPSSQTNWGLGKLFKNETVYLSCKVTFDYGSGYEHTINVNSPRYTHTHESALDE
                     LMGDVLDINVTRNDKDETAIYDSSSNNFKGLIEGNVDFVPGRRGLPDQAIRFNGAGRI
                     VFPAFNNYLFGSNFTVSLWAKRTGGFDSYAGLINTGYASTGRWEIRMGSENSGQNIGG
                     GVVTQNDPSVWDHSLLSISNNEWHHIVMTYNGEDVRFFIDGVEQYGRDQQGTPDFGPV
                     VYKDKPLIIGQAGWGTMNNPEYFIGEIDDIKVFSRAIELIEVKALHLARDLYE"
     CDS             466999..467289
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530552.1"
                     /locus_tag="PA25_36190"
                     /product="transcriptional regulator"
                     /protein_id="BBN83634.1"
                     /transl_table=11
                     /translation="MKIEQAATQLAELGHVTRLEIYRILVRAGHNGLAVSAIQQQLDI
                     PGSTLSHHIARLVKVGLVSQTREGRVLRCQAQYQQLEGLIAFLSEECCADSC"
     CDS             467343..468320
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011263073.1"
                     /locus_tag="PA25_36200"
                     /product="hypothetical protein"
                     /protein_id="BBN83635.1"
                     /transl_table=11
                     /translation="MFTSTQWQSAIEFFIGAFIELGILFVLISFIVSIVNHYLPMNKV
                     RTLLSGNKGYGIAMSLGAITPFCSCSTLPMMVGLLKARAAFGPVMAFLFTSPLLNPFI
                     VALFLATFGASLTITYAFFVILMAFSSGFLLQYFGFERYIRPELFIDQPNASTQCGSN
                     SSASSCGDTNATCTPAATCAQPKQSKLSLGITLFKGALSQLKSMLPYMILGIAIGAVL
                     HGFVPSELFASLSGMHTILLIPVCALVGTFLYVRASTMIPIAASLVAKGLSMGAVMSL
                     TIAGAGASLPEMIMLKKLFYWPLLLAFIALIFITACLTGMSIELLNLQP"
     CDS             468332..469486
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003688558.1"
                     /locus_tag="PA25_36210"
                     /product="hypothetical protein"
                     /protein_id="BBN83636.1"
                     /transl_table=11
                     /translation="MAQVHIDTDFDGGAIEVLSAKNAQNILLNIKKDSQACTKQWFYF
                     AVQATQSELHHVVIANADEASFANAWQGYQAFASYNNQDWFRVNTHYQNGQLLIEHQA
                     TEHTVYYAYFVPYTQAQQTKLSQNMQSCSNINEQNIGYSVLGQAIKLTTFGNTRSDAK
                     KIWIIARQHPGETMAQWIADGLLNHFLSNAEQFTQEAHNIRFFVVANMNPDGSNLGNH
                     RTNAAGANLNRQWLTPDLNTCPEVYCVKQAMEATGVDLLVDVHGDEQLAYNFMMVEGQ
                     HPVGESIKIALAKRNRHFQLRYDYANQPCSNKTGCCGPSADKTSPCDTPCKSAATATS
                     YVYQQFDVPAILLETSFKALNTQHNQTAWDHIACQNLGADLLEVLHAQFT"
     CDS             complement(469623..470345)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36220"
                     /product="hypothetical protein"
                     /protein_id="BBN83637.1"
                     /transl_table=11
                     /translation="MKAHFVLFVISLTCSGLSFASTFEPHSTLTALKERVELAIDKFE
                     RTQPQDWSYRVERFEDEEGNITNRIELFDPSLERPKQWQLLSINEQKPSQQQSIEFVK
                     HKQELASKEQQQFSVKLRSLIQLDTLKFTAQDRQYVYANFDVKIEELGEDASKVLKGS
                     LIYDKNNGYIKTIEVVNTASFSPVFTASIHELKLVFSFLNINDSVLLKQQALAMKGRF
                     AFFTEINEVSTDTFYDYRYVGQ"
     CDS             complement(470409..471485)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36230"
                     /product="hypothetical protein"
                     /protein_id="BBN83638.1"
                     /transl_table=11
                     /translation="MLKKIIISIIVLFVLGWGSLTGAKAYLKSLLPDKAHFQAIKQAQ
                     TSDLSYLNEGTPEYRGKILAVVTSADTMWNGKATGYEHTELARAYWVFSANGFDVDIA
                     SPKGGKPPVVLDGDDMGEYDYAFLNDPAIQNKVENSIPLAEINPDEYEAVYYVGGKGT
                     MYDFADNQDIKRITKALYQSNKVVSAVCHGPVALLNVQLDNGKMLLAEKKISAFTNQE
                     ELFLIPDAQEVFPFLLEDKLIEQGAQFQAGVDYLEQVSRDGNVITGQNPWSVWTMAEE
                     VVLALGYEPKAREKTPEERSVELLLTYEKLGLAAAKAQITSESHSYQQMLLVMHSFLA
                     LMQFELGKGMDILSLAQAVKASQQ"
     CDS             complement(471752..473770)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36240"
                     /product="hypothetical protein"
                     /protein_id="BBN83639.1"
                     /transl_table=11
                     /translation="MNNSQREPLQKFSLTWRLVLSVCSIVSVIFIILSIIAVNRIKQQ
                     STERVKSGIARAIETEASNVEELFLSRYKVLQTAFDSTTMQNWLSSRTQAWAPLDSEP
                     QYADVNQFLTRIVNSEPEIISVFYSPERSREYWDESGRIPQKVMTRPITDIPWWRLTE
                     AQGRGVVNEPFEDSRTQVVSAAISKPVLDSQGRRIAIAGIDLKLEAIQKQVTNNTKYQ
                     GIGYAFLYQDDGRLITLPPNTNLQPENRNLQELNTLTGNSGFNALNNLSEHLSYFSVQ
                     WQHKDYLAAVIKVDMDEPMMNWRLVLLYPQAKIDEPINNAIWQLILMTVVLLIAIALV
                     LTWSIRLGLKPLQEVTNAMARIVSGDGDLTQRLDVKSNDEIGKVASLFNDFVDNINEI
                     VANSLRVSNSVSASSANMQQMMVKAEQAVKEQDAQLDMVATATTELSHAVSEISRSSQ
                     SSSDATIEVKRQVEHGMNLATQADQQINQMASSFRDNEVLLNELNESSDRIGEVLDVI
                     GSIADQTNLLALNAAIEAARAGEHGRGFAVVADEVRTLAKQTQESTHNIQTIIDSLRE
                     NTKRVLEAMVVNRSQAEDSVQHAQAIHQKLTELTAQVEQIQMQSVEIATATHQQSTVL
                     EDVSKNIVTTKDLSHNTSTLMQTANTAGGQLQEESEALLQSLQHFKTQ"
     CDS             complement(474407..475372)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36250"
                     /product="hypothetical protein"
                     /protein_id="BBN83640.1"
                     /transl_table=11
                     /translation="MGINDDQSSWRAENLSSNAFKAIPAVEQRMAQLAQQYLALQTEP
                     NAADHCDQERAASSSSIRQINASALATQLGKHWQVIGDYLCPEKTFVYGYTSLSSKLR
                     DHHLTLDELTDFEAVMTNLPKIKTALNELDSFESMVLHEQLYSEIRLNVDQLKTLIEH
                     KLTPKNSDFYSMIFRLPIEQQKLLLVEQQYNLANTNALGFSLITQVFEKALRNPKTSK
                     RMVDELIPYLLSQGVPLTSSDKDIDPLWFKLHSLNNHEDPNAELASNALASLIDHTPI
                     NDTHIDAMYKIKNKHQALYQRLVDQFPKLHFDEPNALIEIKCTPE"
     CDS             complement(475273..476196)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36260"
                     /product="hypothetical protein"
                     /protein_id="BBN83641.1"
                     /transl_table=11
                     /translation="MQQRKIIILFLFFTFCALLYFIISTAEQSSIGSQAVNDVRQVTD
                     SHNPRQIQNQPPTLLEETNHKESVRCEAFEQAQQSAAWIKFNFIGLKAVNWYFQGVDK
                     YQIAQTLAALYGYDKAMLWIKQVNGLSQYHEKHEELTQFIEGLDYSFSLGSERPSLQA
                     LEDYGVNTYVEGFDINKQLNFYPDTELKLWLGALTQALGDTDLQKSLSVIERLQKFSQ
                     NQVFFEHPLRDSNNVVLLSSFGKQQARQLLKAMFDLAPVYFDGLESGSASFFLNKPLW
                     ASMTTNLVGVLKTSLQTHLRLSQLLSSEWHN"
     CDS             complement(476311..477783)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36270"
                     /product="hypothetical protein"
                     /protein_id="BBN83642.1"
                     /transl_table=11
                     /translation="MKIWEKDFFRHVVMAIMFTVVLVACGSNNTTPLIKQTDKPALVT
                     KSAIIVGAGLSGLTAAYELEQQGFKVTVLEARDRIGGRVATIDMGTQTGEIGGELIDG
                     ETVHTELHRYASLFNVELADVGYDDNVEEGAYYIDNQLISYTDFDNNYDKTVVNDYLR
                     FKDSMKTLAAAVPDPENPSQLALAKEYDVITVQNWLDNLQLNPIAKQMAEQFVRGEFD
                     EPRSLSLLHLAHYAKVYQNVSDDDVESFRFLKGGRAITNAYSDNINGDIILNEPVTNI
                     AQVDNKITVTTAPQKKYISDVIVVTVPLKVLNKIEFSPALPVTLTQAADNINYGTHSK
                     VLLRYSKRFWLDKNLGGDTAVASLPTGWTWETTERQGGVGGILIAYTSGDFSEMQKHW
                     TDQQIIAARLDEIEQMYPGSSQHFIEAKAQNWLNEQWTQGGYLAYGPGQVSEYWKLFY
                     NPVGRIYFAGEHTDTLYLGYMEGAVRSGVRAAEQIKELGL"
     CDS             478040..479362
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011022902.1"
                     /locus_tag="PA25_36280"
                     /product="dicarboxylate/amino acid:cation symporter"
                     /protein_id="BBN83643.1"
                     /transl_table=11
                     /translation="MTSHFSIEPLLNRKRLWLQIIIAMVLGISFGLLISPKGAAFVSP
                     QIAEQIAQWVALPGKVFLALIQMVVIPLVLSSIILGVAGNKDTNFLKKVGIRIFPYFI
                     TTTFIAVLIGLLVVTLIEPGNYVDSQLLTNLNSQTTEVPVSVMEPKSLPDRVVAIIPE
                     NITRSTLDKDMFAVVMYACFIGIALTTLSIKQKTLLLDLTEAAQSLSLRIVNWAMLLA
                     PFAVFGLLCDITIRIGIDALIGVSAYVGTVLLGLLVLLTVYIVIAKAVGQVSPMRFLS
                     AIRSAQLLAFSTSSSAAVMPLSMRTAEIELGVKKPISQFIIPLGATINMDGTALYQVV
                     AAIFLTQVFGIQLSDNQIVLLILTTVGASIGSPSTPGVGIVILASVLANFGIPAAGIA
                     LILGVDRILDMCRTVLNVTGDLTACLVMNRLIGESIDMHTHPVTPTSS"
     CDS             complement(479384..480496)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36290"
                     /product="hypothetical protein"
                     /protein_id="BBN83644.1"
                     /transl_table=11
                     /translation="MKKVNWHFQRKALAESYLQTVYQGAMSRIALLDVRRTGKTTFLL
                     KDLYPIALENGFIPVYINLWGEPDSPTLAITQALNNTLSALNQTVKGKLTELANSEIK
                     KLEVGNNVFGKATIEFSDQNAHKPSESELFKIGQQVEALFNKCGDKALIIIDEIQHLA
                     SSNKFLSVQHALRTALDTYSDICVVFAGSSRSGVNAMFADKDKPFYDSAFMIDFPRLG
                     EEFVQHCCDTLSTHFDLNYDALAVKAFYEEIDKSPFWMMKLMTYLMAHKASLNEGTEY
                     IKALMIQDGDFEGLKKRLRELDIEVLQLIRKEKTSLYSAQTVAYLSQKLHTEVTTSAV
                     QTSVKKLKGMAVISQYADKYYIESPGFIRYLEADCP"
     CDS             complement(480890..481738)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011029684.1"
                     /locus_tag="PA25_36300"
                     /product="alpha/beta hydrolase"
                     /protein_id="BBN83645.1"
                     /transl_table=11
                     /translation="MNLITKIVLTGLTFITVTAFANNAEHPHDYKYVQVNENKLAYLC
                     KGEGETTALLIAGMGLDAHGTYQNTFHNAQPKGYRLCFYDRAGTGRSTFAKPRVRTML
                     ELTKELELFTQKTNMKQLVLVPHSFGGLIARAFAHRNPDKVKGLVLVDTVHESWYEQM
                     KGKMSAKGWGIMKWIIDWERDEHSLEDFVEASQHSDIYTVDKSTPVTVLSRGIPHVEV
                     LTTGMSYDDVDVFTNTWNESQQKFQSMSSDVNAVTMKYASHLFDKTDPFIVLKHIDEM
                     VGKTKT"
     CDS             482001..482495
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36310"
                     /product="hypothetical protein"
                     /protein_id="BBN83646.1"
                     /transl_table=11
                     /translation="MTQPPVLLSFSARALDEHAEDQACQHALQYDTLKLEYQSLGLPF
                     LCELPFDAQLGDVIALYATSVQARCASFSAEAPLTKEALETGHQSLQLKGQGESGEYI
                     VQLSLIGRHGMVKNSVEYNAYINSAVEQENVTTDKSSVMSNSVASALKRHTTNLMASV
                     LAIF"
     CDS             complement(482620..483810)
                     /codon_start=1
                     /gene="anmK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q2RZV7"
                     /locus_tag="PA25_36320"
                     /product="anhydro-N-acetylmuramic acid kinase"
                     /protein_id="BBN83647.1"
                     /transl_table=11
                     /translation="MHPHIEKLYLSAAKPERLIIGLMSGTSLDGLDVALCRISGHGRY
                     TDVTVEAFTTCDYPQEVKDKITQVFAKQVVNLEYLTLLNAWLGQYHGQLINQCLARWQ
                     VSADEVDVIASHGQTIYHSPKHQHAYNEFGNATLQIADADHIAVTTGITTIADFRQKH
                     IAGGGEGAPLAQYGDYYYFASADENRILLNMGGIANLTYLPKGAEINDVICSDLGPGN
                     TLMDAYMRLHFSKPFDEDAKVARQGAVNQLLLNELLNAPFFALKLPKTTGPEIFNLAL
                     LEQAQATSQTQQLSHQDVMATLSALSANIIAKYINELSSTDTAVYCSGGGVHNVWLMQ
                     QIKRQLAPHVSLKNSDVLGIHPDAKEAVLFAILANECLAGTPANKQVSEVPNITMGKV
                     SFAD"
     CDS             complement(483834..484241)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36330"
                     /product="hypothetical protein"
                     /protein_id="BBN83648.1"
                     /transl_table=11
                     /translation="MKPKCLCVVLLFMSVHVQAQERVYTFDNTLTNIPSNAFTNDQRK
                     YPKESDFKVQAYASMSSADGERAALVTIKNTSSGNRFFESPHIMALFADGQRVAPKMS
                     ADKYTVGGHDTLTLTLEFGRYNYPIVNVYTSNN"
     CDS             complement(484304..486259)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072362.1"
                     /locus_tag="PA25_36340"
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="BBN83649.1"
                     /transl_table=11
                     /translation="MQHGQQLLESLSQHFGFASFRPGQSQTISQLLAGHSSLAIFPTG
                     SGKSLCYQLTALHLPHLTLVVSPLLALMHDQVIFLKGKNIHAATLDSSQSNEQSQAVM
                     QGVSSGDIKILMVSVERFKNERFREFIKQVNVSMMVVDEAHCISEWGHNFRPDYLKLP
                     DYRRELNIPLVLLLTATATKKVKFDMAKRFDILPEHIVQTGFYRPNLDLSVLSVTESD
                     KLQTLLQLIRGYHGAGIVYVTLQQQAEQVAKQLQAAGVKAAPYHAGLKDEVRANVQQQ
                     FMSNDIQVVVATIAFGMGVDKSDIRYVIHHDLPKSIENYSQEIGRAGRDGEQAYCTVL
                     ANLDGVATVENFVYGDTPERRGIETVISQCLQEQVNGKWELQELPLSKASNIRILALK
                     TLLVQLEILAAISAKYSYYADFRFKFITSESKLLSQFDPARASFLEQIFAHTQFKKVW
                     GSVDMQSLVRSGADRQRAVAALDYLHQQGLIELESKRMVQVYQVDVDKLRQAELVDTL
                     YNYFKEKEQAELKRIAAMLRFFELDRCLSANLAYYFDDKNVPAQCGHCSVCRGQVATL
                     TRSQELSMPDDETLRNYVFALQKHLRQGGVVASKDTVIRFLAGVTTPFIIQYKLKQLP
                     GFACCEGHRFLDITNKVAQLALVHDTD"
     CDS             486386..487903
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36350"
                     /product="hypothetical protein"
                     /protein_id="BBN83650.1"
                     /transl_table=11
                     /translation="MSNPSTPSLLVFSFDGTGSEPRDAQQYSAEQFKEDCEISNVLKL
                     HLLLGGRIHPEATSHFASQKCFYYSGIGNQGSAVKKILNQILAPQSSDVASILSQAMR
                     DFEAQYQTGDQVLLIGFSRGAALARRFAKCLEKHINNNVFLCVFDTIASIGFSKITKA
                     TCGTEHVIFADHDAANNVSAALHCVSLDDKRRAFEATLFNHAPHIHELWFAGSHSDIG
                     GGFYRSGLSDICLRYTLEWLQVQPININLLTREQINYSGLLPHDGALLIDADDLAITP
                     DPLAPSHQHDYFWGNVNFKATNRLCVVMQNNQVSDIPPLIHHSVAKRIYNSSSYRPES
                     LKGTLHRLEYASGEQLECTGITPHIELPTQQLNILQVGEKVQIKVFACEAYNHTGLWL
                     EKGATYRINPITSQVWFDKDTQVTASGWQRGNRTVGVKQLPIEMMEPYKRLPGRPWFS
                     LVGCINADDSFAFSLNGGGDIKVNQHGEFTPFANDINCDYGLNRGAIELEVVRLG"
     CDS             complement(487880..488551)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36360"
                     /product="hypothetical protein"
                     /protein_id="BBN83651.1"
                     /transl_table=11
                     /translation="MYDGERYFGMDIEATQYIFNKAGLCVNFVRLPSSARGITELERG
                     FIDILPSASYNEQRAKIAYFSAQYRRERMRLFTLSTMDDVKSLSQLFERGYLFTANPG
                     AYYGQELASILKVDQFKNNYFEVASLSQRMELVRRGRVDFLIEDEASGVYYKHQLGYD
                     KLRIHPYVVHDNGIHFMLNKSAFSVEQIAQINRAISATDNQLKRIEAKYLSKLPDSLS
                     QANHF"
     CDS             488783..488971
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36370"
                     /product="hypothetical protein"
                     /protein_id="BBN83652.1"
                     /transl_table=11
                     /translation="MIVHNRDVVTPYTSNNEILLNIKAFSRSNSALLQVKITQRVSDI
                     ALLGKFTYVLLRLYTLPK"
     CDS             complement(488996..489214)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36380"
                     /product="hypothetical protein"
                     /protein_id="BBN83653.1"
                     /transl_table=11
                     /translation="MPSLKHRVTFTLLLSFFLSVLMTLWVTYINLGVSAHFFANWGKA
                     FVLAWPAAAVISFFSAPIAQKITNKLIS"
     CDS             complement(489407..491905)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005482861.1"
                     /locus_tag="PA25_36390"
                     /product="chitinase"
                     /protein_id="BBN83654.1"
                     /transl_table=11
                     /translation="MGWIQHVNKVEKEMKIKHLTAAVALAMMSGAVIAAPSTPSLSWE
                     AQQYSFVEVNLDGQGSYKDLVNAKEQVNISIKWNAWSGDGGDGYKVYFDDMLVNEGTL
                     PAGTKSGVIEFPYESSGRHTLYVELCEGDTCARSAGKAIVIADTDGGHLEPLPMNVNP
                     NNKNYGTNPNYVTGAYFVEWGIYGRNFDVTKIPAQNLSHLLYGFIPICGPNESLKEIE
                     NGNSWRALQKACAGSADYEVVIHDPWAAIQKALPGVDSKDPIRGTYAQLMALKQRYPD
                     LKILPSVGGWTLSDPFHGFTEKANRDTFVASMKKFLKTWKFYDGVDIDWEFPGGGGPN
                     GNLGDPVNDGPAYVALMQELRAMLDELEAETGREYELSSAIGTGYDKIEDVDYQAASQ
                     YMDYIFAMTYDFFGGWNNVTGHQTALYCGSHISVDECNGTGVDDNGEPRKGPAYSTDN
                     AIKLLLAQGVDSKKLVVGAAMYGRGWEGVMEANATIPGNPMTAPGNGKFKGSTTEGVW
                     EPGIMDYKGIVANLLGPNGTGINGFEAGYDEQAEAAYVWNRSNGKLLTFDNARSVKAK
                     GGYVKVNDLGGLFAWEIDADNGDILNAMHEGLAGSVPPNRAPVVSVDSQVTIANGGTA
                     TVTASATDADRDTLTYSWSADASLSLANANSASVVVTAPTLTSDANYTLTVTVSDGTV
                     SVSKDVTVTVSTSPNSAPVLAPIADVTLEENTSVNVSAVATDADNDALTYTWNVPAGL
                     TVSGSGASVSLSAAEVSQDTTYTVSVSVSDGTESVSRSFQVTVTDKAGPVDTWERNKV
                     YVGGDTVVYGGKNYRAKWWTRGEEPGKALVWQAL"
     CDS             complement(491984..493420)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005482868.1"
                     /locus_tag="PA25_36400"
                     /product="spindolin"
                     /protein_id="BBN83655.1"
                     /transl_table=11
                     /translation="MNKMLVNTPLLVATVSTALLSSLSFNVNAHGYMDFPKARQSICE
                     AQGGYWWPEDGSNIPNQGCRAAFLESGYVQFIQEHEFSVNTANYNDQAAVEANVPDGA
                     LCAGGDNAKRGMNLPSEYWQSTEITPNANGEVAVRFRATTPHNPSFWKFYITKPEFNR
                     ATDTLRWEDLELVTELGNVEFVKDPDGKRFYEMKVSIPQNRVGDAILYTRWQRIDVVG
                     EGFYNCSDITIVRDTGPVNWTSAGYFVAQGQQAQVGDTVWARVFDGTGKELVSKSLKV
                     SDFNQGNWAEQLAQMLNLDHASIMQVGVKQSDDQIVFDPQNLLSNEVYVSNENYTYNL
                     TIQAAPDNTPPKIHSPEPLVMDELSTATLHVHAFDDEQQDLTYQWQVPSELTWTGSGA
                     TIELTAPEVSADMQYSITVTVSDGQLSTSADVSITVKDSDQSQYPAWSQSKTYVGGDK
                     VSHKGKNYQAKWWTRGEEPGSALVWLKL"
     CDS             complement(493465..496590)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261622.1"
                     /locus_tag="PA25_36410"
                     /product="chitinase"
                     /protein_id="BBN83656.1"
                     /transl_table=11
                     /translation="MSSQKILKSALKLSVLTLGLMGAQSHAYDCTDVPEWNAGMTSTA
                     GAVVQQNNVAYEAKWWNRTEPETHSGPWQEWLNLGACDSVVINKEPKINQLNPADGSE
                     FNVNDSVAIVANATDEDGSVAKVDFYVNGSLFLTDTSGTNDNFEASWQAVEGTHTISV
                     KATDNEGAVSSMLSHQVIVKSDTPVNKAPVAVLDIVNMPPELVVGSSVKFALSGTDED
                     GTISKLSFAVNGTEVVATNGGATEHTWQATALGQVTFTLTVTDNEGATGQISKSVNVI
                     DPGADADACRPEGLYQTPGVNTPYCTIYDQNGRELMGPDHPRRVIGYFTSWRNGANGQ
                     PSYLVNDIPWDKITHINYAFAHVDANNKVSIGDPNAAGNPATNMEWPGVAGAELDPSL
                     PYKGHFNLLNKYKKQYPDVKTLISVGGWAETGGYFGPDGTRVQSGGFYTMTTNADGSV
                     NHAGIDAFAKSAVEFIKKYGFDGVDIDYEYPSSMDDSGHPDDFPISNARRAGLNASYQ
                     VLMKRLREELDKAGEADGQHYMLTIASPSSGYLLRGMETFQSVKYLDYVNIMSYDLHG
                     AWNSHVGHNASLFDTGEDSELKQWNVYGTKEFEGIGYLNTDWAVRYFRGSVSAGRINI
                     GIPYYTRGFQNVQGGTNGLWGQAAFADQANCPPGTGKGDKNKCGNGAVGIDNLWHDKN
                     DVGLEVPAGSNPLWHAKNLQDGVMPSYAADYGLDPENDPTDKLTGTYTRHYDSVAVAP
                     WLWNDQKKVFISIEDEESMAAKVDYVINNGLGGIMFWELAGDFDYDAAKGEYFMGSSM
                     TSLAYSKFNQNGSKYNVHQGNVNFQLPEKSVDVSFTAKDFPAGDANYPISPTFSFKNN
                     SQIDLTGAKISFDVPVSTSAIFKSNWNATEKLKMAVDENGSNAAGNNIGGFENEFHRF
                     SITLVNEWGSVPKSFAPGETVNAQVMYYMPISGPINFVVEKDGQQYAFKSEYPKLPEA
                     QPGDGNGGDPVTKCEGTPIEDIVVYPTLPRGTHASGGDLVRQGQAVYKAKWWTNKAPE
                     GSSDYQKVCSL"
     CDS             complement(497168..498127)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072198.1"
                     /locus_tag="PA25_36420"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BBN83657.1"
                     /transl_table=11
                     /translation="MAKLSEDYYRAYLREKQARDELELLLEEKTRALYESNQELEEKV
                     QQLQTQQAVLMQTEKMATLGTLSAGVAHEINNPLAYVMSNLESLSYIKPVLSELLCIS
                     HDFIGGKITNTDVLTALKRLNKQQAFDFLMTDIDELLDDSQEGLRRIGAIVKNLLSFA
                     RPKNNLLAMSDITLSLESALKLLHNQLKNTHLICHVQPLPQSYCNLATLNQVIVNLLL
                     NAKQACDGQVQGAEIIVELYSKHKTIYLSVTDNGCGMSDETIKHIFDPFYTTKPVGQG
                     TGMGMSIVYSIIQEHQGQIVIESTLGIGSKITCELPILNIPEL"
     CDS             complement(498128..498673)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072197.1"
                     /locus_tag="PA25_36430"
                     /product="hypothetical protein"
                     /protein_id="BBN83658.1"
                     /transl_table=11
                     /translation="MKGVVFRGLEALVIETQGMAAWEGLLDKHAPEDRVYISAQSYPD
                     EELFAMAKDVADILEKPFVDVLRIFGEYLFGYLTEKHAGMLQQFSGFQSLILGIDSVI
                     HAEVAKLYHEPNLPLISSELIKPGCILLKYSSCRKLCFCAEGLIYGAGSHYGVNTQIE
                     HQQCMHDGYDHCRLLLTFEEG"
     CDS             complement(498689..499801)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072495.1"
                     /locus_tag="PA25_36440"
                     /product="response regulator"
                     /protein_id="BBN83659.1"
                     /transl_table=11
                     /translation="MEELVLNILLVDDDELVLRALSRSLSQFYDNTVIISVQHPEDFE
                     TCVLEQGEPDIIFCEELLHGACGHELLNSARMICPRAVRCLFSDNLQQECKWQIDNTI
                     HFHLAKPFTRSHLLQVIDSALTIKSLPLNEAARVKLGQLSGLPCLNSNVSELLEKLNN
                     GAANATELAKLVNHDPLLVGKLLQIANSAFMGYQSTTQDVKEAINRIGLIAFTAIVTC
                     YEISNMFINQTKQSEIEAIMDAAFTKALMGQSLSGCLGLDLLVQQKVFACCLLSAIGV
                     LTKVCVFNDERLAASVSCYDIAAYLLALWGYEQDIVRAQLVHQLPIEPSMSIVVIHAL
                     VEQLTLNNAFDMSTHLVSIVSACDELQKVEQWYINY"
     CDS             499889..501229
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072498.1"
                     /locus_tag="PA25_36450"
                     /product="two-component system response regulator"
                     /protein_id="BBN83660.1"
                     /transl_table=11
                     /translation="MQDIESFKDQSQHPAKVLCVDDDASVLRSLSRLLKHNKIDVVTL
                     TCAQEALSELKTKEFEVVISDMRMPKMDGIEFLSQVKELAPDTQRILLTGYADIDSTI
                     SAINQAKIHAFLNKPWENEHLVHVITQASEKYRLKKHNEQLQAHIVEQNKQLNNLNHS
                     LEQLVEKRTKQIRQVLKQLETSHKHEQNEHKATVELLYNFINANPYLDGKLASKIART
                     CRLVAKHMQLANKQVQTAGMAGFLAQVGLLAMDPALYKVPTNQLTDQQKKLFYTHPAT
                     AQLMLMPAQHLNDVTEAIYHQFEKYNGEGIPKGLAKDQIPMCAQILAVARDYWQYINN
                     NHKTDADKHADALSHIKAFNEHLYHPKVVRALEKCASQLQKKPDHAGSMQIITSEQLI
                     PGMILGLAVHNHQGIMLLPKGHIFTAVSIAKLKQLELQKPTPFRLMVTPPASDA"
     CDS             complement(501192..504368)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261108.1"
                     /locus_tag="PA25_36460"
                     /product="acriflavin resistance protein"
                     /protein_id="BBN83661.1"
                     /transl_table=11
                     /translation="MIAFFARHPTAANLLMLIICIAGLSALPQLKRETFPEFSSDKVL
                     VSVIYPGASSTQVEQALCIVMEEAVDGLDGIKALSCESREGVANLTIEAQHGFSIEML
                     LSDVKTQIDAIDNFPKQIESPIVRELGRDQHLISLAIAADLPIHELKLYAQSIKNKLK
                     RQPGVDIVDIQGFSDQQIKIELSLFKLREYGLSAADVVALLQRQNVKLPAGEISNGGQ
                     TMLVSFDQQKVTAKSLQFLVIKSLSNGEQIYLKDIAYLSEGFELDEEQVLFDGKRVAL
                     LDIKKTKSQDAIALVDVVTQFVEQQRVQAPKGVSLTLTQNTAQIIEDRLAMLLNNGWQ
                     GFVLVLLVMYLFFSFRYSFWVSMGLPVSFLGAFALMMLMGVSINMISMVALLMSIGIL
                     MDDAIVIAESIAAKVEQGEDIDADAIKGVLQVGPGVFSSFLTTIVVFIGLAFISGDIG
                     KVLKDIPLVLIATIFVSVIEAFFILPNHLIHSLHTSNSGNNNQHEKAFESSKSNSAQY
                     FLSLVWKLKTQFTTSFERFRETTLVNAVHWCVQYRYQFIGATLLLFLVSVSLMAGGVV
                     KFKAFPQLEGDTIEMRLLMPPSTPLMQTMGIVERYVDALERVNQRLSEQESSKLVQHV
                     TVEYNQNSDAYEQGEHLATVRVDLLTAQQRNTRLAQLVSHWQKQAGDIADIQAISFKE
                     PVLGPAGRAIEIRIHAEQLKTLMGAAAQIKQELNQYAGVSNIMDDLRYGKQRWQVSLQ
                     PGSLAQGVDGQAVANQLRSALFGQVAGEVQRNDNSIELYVRLLDNDKRSLDSLHNFPI
                     TLNSGLQVPLASIAQLTLEQDVTRINRVDGQRTVTITADVDPLVTNTNEVMAQLKKHS
                     ISPLLKADQTLRVSYEGEIKTGSQTGKSMAGMFLLGLIGVFIILSFQFRSYFEPVMVM
                     LAIPLALIGVVWGHFILGYDLSMPSMIGFISLAGIVVNDSILLVAFIKEHESDGVELE
                     QAAVLAAKARFRAIFITSATTIAGTLPLLLETSLQAQVVQPLVVSLVFGMAISTLLIV
                     FVLPAIYVLLEDFNLTAKHHLQEGSPLA"
     CDS             complement(504365..505702)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261107.1"
                     /locus_tag="PA25_36470"
                     /product="acriflavin resistance protein"
                     /protein_id="BBN83662.1"
                     /transl_table=11
                     /translation="MSRFKLNQKYWLLVLPLVGVMVLIAFVKLKPAPKQHDNALHIPN
                     VAVAKATERALQYSIVGYGRAQAKQVWHAVSEVSGRVIYKHPDLEVGAILKADTILLK
                     IDPVDYELKLAQAKYDLSAAQERVDMIAFNKQKLKQSLALESERLALLQQELTRLTGL
                     LKRGSVSQSAVEQQQSQLFSQQQKVLELQTSLNLIPSDLALAKASVSAQKARMQEAQN
                     LLDKTVLRLPRDSRITQVNVELQQAVNTREALLEASHLGVMKVNAQFNMSQARQLLSQ
                     VWFAQNKDNQTQDFPNVAALDLHASLHYYSINSGANSALQWPAKVTRLMQSAQHSNSL
                     QVTLETKNQWLNFDPINHPPLLENMFLEVQMSSSAQPYLSVPLSAIHENTVFIVKEQK
                     LLKKPVKVLFSTAQFAALDSQLVGTVSIGDKVLVTQLLPTIEGMHVNVVEEVP"
     CDS             complement(505704..506354)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000175326.1"
                     /locus_tag="PA25_36480"
                     /product="TetR family transcriptional regulator"
                     /protein_id="BBN83663.1"
                     /transl_table=11
                     /translation="MSPSSSKKLGRPVKDNEQARAALIQAARHKFTKKPYDKVSIREL
                     SDAAGVNSALIKYYFGNKLGLYKAMILEVTGQVMSNIKTHLAGNEFASISDVFRSFTK
                     VMALSPEFPLLMLKEVILNQGVCREFFLEQIGSSHLKVIDGVYLYFASKGLIKENVDP
                     VLFRLSLMGLLIYPWYMRELMFKMEGVEYDESFLESLIQHNTLLMTSGLFNTNERL"
     CDS             complement(506465..508015)
                     /codon_start=1
                     /gene="aer"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003087330.1"
                     /locus_tag="PA25_36490"
                     /product="aerotaxis receptor Aer"
                     /protein_id="BBN83664.1"
                     /transl_table=11
                     /translation="MRLNQPVTQREKQFAPHVKLVSITDLQGRIVDCNDHFVAISGFT
                     REELIGQPHNIVRHPDMPPEAFATMWAQLKAGKPWMGIVKNRCKNGDFYWVDAYVTPV
                     TENGKIVGYESVRRCPDKETVARAQALYASLMNNKNSQFKWPKLRVLWPLLMVIVGVA
                     LWFSGAENAAFFWVVLNSMSICGYNLWRDSEQLKRLEHSLEHSFCDDVAKQVYSTWDG
                     KMASIQVRMLSEQAHLDTVITRIEHSAKEVTSGARQALERAGDSYKHLQKQQLETEQV
                     ATAMNEMSTTINDVSGNVQVSAEHAQSALLMADENARIADLTKHAIESLGETVLQIRD
                     SVLGVSKQTTRIADAAQMIEQIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRHLA
                     QRTQQSTKEIHTIISELSDSTQHAVSIAQQGEQESVSGIDQLAQSTDMLMQIQQAVRQ
                     IHDMSMQIATSVEEQAAVSDDINQQIVNIAGLAHDSLDSADTVKQVSAQLSDVASDMY
                     ELVVRFRR"
     CDS             508367..509386
                     /codon_start=1
                     /gene="hemH2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EBZ7"
                     /locus_tag="PA25_36500"
                     /product="ferrochelatase 2"
                     /protein_id="BBN83665.1"
                     /transl_table=11
                     /translation="MSRFSAITDNPHDGRFNQKTGILVTNLGSPDAPTPKALRTYLAE
                     FLSDPRIVEIPRLVWLMILHGIILRVRPKKSAKAYQSIWTEHGSPLIHISQQQTDKLA
                     ALIKQHGFSNTEVVMAMRYGNPSIEAGLEALRDKGLTRIIVLPLYPQYSSPTTGSTFD
                     AVANVLKKWRWVPELHFINGYHKNSLYIESLANSIAEDLKANGTPQKLVFSYHGMPKQ
                     FLDNGDPYHCLCQQTTRLVVEKLGLDKSLVETTFQSRFGKAEWLKPYTDATLESYPQQ
                     GIKDVAIVSPAFSADCLETLEELEEENREIFEHAGGEKYRYIAALNDRDDHIEALYDV
                     IKPLL"
     CDS             complement(509432..510172)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070499.1"
                     /locus_tag="PA25_36510"
                     /product="membrane protein"
                     /protein_id="BBN83666.1"
                     /transl_table=11
                     /translation="MEYIHKLAVYLHIVLGSFALVLFWIPIFATKGSKTHNRFGQYYN
                     WSMYGTSVLGVIACILVLFDPMGVKPKTFVDMAEQATYINNTRVFSLFLLMLSLLVLV
                     SIYHGDRVLKAKANNALLRTPLHLGLFCALVITALISMVLGFMHSQTLLIVFSVVSLL
                     VVSRYIRYVFTAKVQPRAWVIEHLVAMLGSGIGVYTAFSAFGGRHIFSYLLGDHAAFL
                     SWIVPSVIGTVSISWSRRYFEKKFRIAK"
     CDS             510340..511446
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011036327.1"
                     /locus_tag="PA25_36520"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BBN83667.1"
                     /transl_table=11
                     /translation="MFKYPLSSLVTVLLTWAAVAIPSVFDASRLDVSLIEYVLHSLVI
                     VFTLLVINESTRYGYTFRYCLLTFLFLSIAYLMFLVPFSIILIYSVMYCSILAFYAPT
                     RLCYAYIFVSNGLFLLAHALYWQTGWQWASVGMFMAFHFFALVMTQRMISERSAKEEL
                     ALSNAKLEATQNLLRNAAAQSERLRLARDLHDEVGHALTSLIINLDIARRTCTPEQQT
                     QLQACYKQAKQALATTRTIVSDKRNDSDFDLVQSLTQLCERTPRVAVHLEVDSEVAQV
                     QLDTAQCLLKCVQEAITNTLKHAPTATDMNITLYRKSAHLALCIKDNGILKETVVLGN
                     GLKGMQERVTQLKGQLDIDTSKQGLTLTIRVPYE"
     CDS             511439..512083
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011036328.1"
                     /locus_tag="PA25_36530"
                     /product="DNA-binding response regulator"
                     /protein_id="BBN83668.1"
                     /transl_table=11
                     /translation="MNKIKIHLVDDQPLIRQGMRSLLQLTDTLDVTGESSSGNTFLAQ
                     LSDNKIDADVVLLDMRMNDGSGLEVLNAPIAQQSVLKFLILTTFNENDFLLGGMEAGA
                     SGYLLKDVSLEELVDAIKRVHAGEIVLQNELTQQLLKAKRQPQHTLDEPLTEKEQQIL
                     ALMVSGLSNKEIATHIFKAEGTVRNHVSNILAKLQVRDRTQAILKTLELGLLNE"
     CDS             complement(512294..512917)
                     /codon_start=1
                     /gene="rhtB_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261935.1"
                     /locus_tag="PA25_36540"
                     /product="flagellar biosynthesis protein FlgM"
                     /protein_id="BBN83669.1"
                     /transl_table=11
                     /translation="MELESWLSFCAIALLATATPGPAALLVSIHSVSFGFKYSLATIV
                     GNISALFVMSAVSILGLSALVSYSAIGFTVLRAIGAVYLIYLGIRLWKSGVKINSPIK
                     NLNEQTSVTSLYVQGLLVALTNPKAIIFTTALFPQFITLKAPLLIQFSILVSTFMGLS
                     LICLSVYSFFASQAKTKISKSISGSFLGKLFGGTFIGAGCYLASNSR"
     CDS             complement(513172..513642)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011122325.1"
                     /locus_tag="PA25_36550"
                     /product="acetyltransferase"
                     /protein_id="BBN83670.1"
                     /transl_table=11
                     /translation="MQVRQYRVSDLEAVLDSWEVATRLAHDFMTDEFIAQERKNIAEI
                     YLPNTDTWVAQIGGDVKGFIALMGNEVGAIFLQPDYHGRGIGKALMDKAQELHGNLEV
                     EVFKANSIGRNFYSKYGFEYQEEKFHEPTGQQVLRLKFTANKFKHSDGAKAVNG"
     CDS             complement(513717..514133)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36560"
                     /product="hypothetical protein"
                     /protein_id="BBN83671.1"
                     /transl_table=11
                     /translation="MDFIVPYNITVLVMGLSGLLIWLQLAVVDVAAIMAKHTPGYAIA
                     EDHRSFLFRAHRAFANTNESIGVFILFALFSILSLASPEWLNGFALLYLSGRVAHMLF
                     YYFGQKLLRSTGFAISYIALLGMFGTGLFAWLNVSS"
     CDS             complement(514179..516302)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36570"
                     /product="hypothetical protein"
                     /protein_id="BBN83672.1"
                     /transl_table=11
                     /translation="MAQQYWVGDFFVDVSRNQITKKEQAQTIAPKALSVLTYLAKNQG
                     KVVSQDELLDAVWQGTIVSPNTLQRSIAQLRKVLGDDGKEQVYIKTHAKKGYSLECNV
                     QWQAGKLQVSSANHSQSEKGLPNAQNDNKKATKPRAVATIFILFLITITAVGYHFWTN
                     SQTPTLTISQIRALTATDNKESSGIYSHDGQFIIFHRFSEQACINNIWAKNIKTQQEF
                     QLTKDLGVYSSHSLSPDGKKLTFISMGDCEEPVLQKKCYKLVSLDFNEALKGPLSPTV
                     LMECKSSEIRNPIWLSNDNIALMHKSADSWKLVNYSVSNNSSEVIYEVENGSVTDYDF
                     SVKKGLIALMSVHQDGQYYIEMLKPNGDVISSNRVQYPEQIGKFRYIYPNFSSLERQL
                     IFSTGKRLFTISTDGKVQSISLPLDQPIGSPKVHPSGGKMLAIKGYYDSDVISVPIAD
                     YATLNLDRDSLKERVMHRSNVSEDNAKFQPGGEHIAFTSVRSGERQVWLSDGNSAWQL
                     SQFPLDTYIFSIEWAQDGQSILVNADKELVQLFLDGTERKFALPHSVDKLFQWDSENQ
                     TALSLIWLNGAYRLAEIDLPKPSNSVVYDKSAVWAQKSASGSLIYTDLLGRFWQPGPV
                     EDTLISELNGQGSEKRFVITGETIIGINDDLQLWSYSLDNAYFEVVGNAPSNIDFLTD
                     TDGDQLLMSIQIASKKEVVELTFTH"
     CDS             complement(516559..519096)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36580"
                     /product="hypothetical protein"
                     /protein_id="BBN83673.1"
                     /transl_table=11
                     /translation="MDLSVSRFYNLQSSEQRYQYTLSTLYKRLHANHCIMGKFINEGS
                     QVKTLHYLHDGQVAKNFVYDLADTPCCDAKELDCVCAFEQNLQTLYPQDELLQLFNIN
                     GYLGVTLRAPDHKPIGILVCMFENPAVLHEQDKLWFAEIGCIVATELSHNLEMSAKEL
                     ILKQLANGERIAKLSSWTWYIGQDLHWFSQEMCSLLNNDSDEVSFDDFLSHLRIDDKQ
                     RVTSQLELIKQGKIDHFDILVCHKQMSTTQGLFHIVGEVELSTEHLNERILRATVQDV
                     TYTSSLSRQLELTNVVFENASEAFMITDHRNKIMMVNRAFEEQTGYSAAELYGEDPGI
                     LSSGKQTKQFYQQMWQQFRQTGVWKGEIYNRRKDGQVFPEELTLSTVKGVDGKVINYV
                     AIFRDISDWKRNEAQLTFYANHEALTGLLNRRSFMHNLEKQLTKYFRLHDMCLIFIGL
                     DRFKEVNDIFGPEIGDRVLIAVADRLQNTLRRKDMASRYGGDEFALLVLQKTISEAIS
                     HAQELKRLLSEPYYIEDLTIELTVSIGVAYLNAGEYLAGSTLVKNAAHALSNAKKLGR
                     SRVALHDEAIQNAYLNKIKLRDKLKKALKVGALQVYYQPVVSVKTGRIAKFEALIRWF
                     DEELGAISPASFIPIAEEFGLIHLIGQYVLETSCCDLAMLHKAGFKQVSFSINRSINE
                     FKASNNQTELIPAAIERAGLPYSAITIEVTESMAANKYTWQVLESLSELGVTIALDDF
                     CTGYSSLSNLIENQVDYVKIDKSFVDSMGVDHNKQVMVKCLIDLSSQLGIKVIAEGVE
                     HQEQQQMLADFGCHLIQGYIHSPAKPIQACLQMLKEEEQAAVADFVD"
     CDS             519363..519770
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36590"
                     /product="hypothetical protein"
                     /protein_id="BBN83674.1"
                     /transl_table=11
                     /translation="MKNLIIAFTTTLLLAACAHHEDVRPGDSQHYVVVKSVDRNKGIK
                     EALGQAEHFCEKSSNKLVVLNEKVEYRSEQAEKDYLDSRSTTEFVTEASAWLWVLGDG
                     YVDDVAAVATLAGVGALESMGAPYLVTLNFRCA"
     CDS             complement(519839..520471)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015065048.1"
                     /locus_tag="PA25_36600"
                     /product="hypothetical protein"
                     /protein_id="BBN83675.1"
                     /transl_table=11
                     /translation="MNIEFYLGYCVVIIALLLSPGPSVLLCINNGIHYGKKKATFGVL
                     GNVAAFQLLLILSATGAGAVLLASSALLTALKVGGATYLCYLGVKSIRSPVTRIDMKK
                     AHRPLSKQGAIIFKQAFWVTSLNPKALLFVCALLPQFIDSSKALVPQVVMLCLTSAVI
                     HFVIYFGYAALANSVRDALDNESGRSLYNKLSGFIFIAFGVFLFLSNYAD"
     CDS             complement(520461..520796)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015065119.1"
                     /locus_tag="PA25_36610"
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="BBN83676.1"
                     /transl_table=11
                     /translation="MIVVIFEVIPKAEGQQAYIDIAARLKSKLHAVEGFISVERFQSL
                     ANPSKLLSLSFWANEEAVKRWKRDFEHQAAQQEGKRTLFTSYRISVAHVMRDYSSHSN
                     KLGLAQDEH"
     CDS             complement(520793..521134)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011088100.1"
                     /locus_tag="PA25_36620"
                     /product="NIPSNAP family protein"
                     /protein_id="BBN83677.1"
                     /transl_table=11
                     /translation="MKITCFIEYQIDPHKVHLFEQYAQNWGEIIPQSGGELVGYFLPH
                     EGTSNVAYGLISFESLADYEAYRHTLRHSQLGGRNFDFAQSEQFIVSEKRTFLRAVPA
                     TYLLTKKGGCN"
     CDS             521221..521901
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011974742.1"
                     /locus_tag="PA25_36630"
                     /product="transcriptional regulator"
                     /protein_id="BBN83678.1"
                     /transl_table=11
                     /translation="MEPNIAYLGTLVGDSTRAKMLTALMSGKALTATELALEADITPQ
                     TASSHLMKLLEGELIVVRKQGRHKYFQLRDLQIAEFIEQMLSISASMSGSNITTGPKD
                     NRLKRSRICYDHLAGELAVELFNTLINNELLIIEDTEQLKLTDPGLQFFTNIGFDASV
                     ANKSRRPLCKSCLDWSERRSHLAGYLGKWILSDVVTRQWASRDLDSRAIEFNAHGLQA
                     FKKKYGIW"
     CDS             522042..522227
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36640"
                     /product="hypothetical protein"
                     /protein_id="BBN83679.1"
                     /transl_table=11
                     /translation="MKNKKVNPLVSKFTIAFLLLAALWMFVTDKEMLILGNSLILVYI
                     VTALASRMLKKQKPKKK"
     CDS             complement(522267..524435)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005459357.1"
                     /locus_tag="PA25_36650"
                     /product="oligopeptidase B"
                     /protein_id="BBN83680.1"
                     /transl_table=11
                     /translation="MKQSAICQLALTCVILATGCQSTSIETQTQTSSASAQSIAAPLA
                     AKIPHKTNIHGYELIDNYHWLRDDTRSSERVISHLEKENNYTNAMLASSEDLQSQLFS
                     EIKAKIVKDNRSVPVQKGRYFYFRETQGDQEYASIYRSLKVDGSNPELLLNINELAKA
                     HEFYALGDIEVSPNAKLLAYTEDTLSRRIYTVRVKNLETGETLKDELTGVQDGVVWAN
                     DNQTLYYIKKDPVSLLGTQVFRHTLGTSQAQDELVYEEADNTYYTYLSRTKDGEQILI
                     HHYSTESKGVSVLAANDVKAQPKRLINREKGLEYFVSKHGDWYYILTNLNAVNFKLMK
                     VKVDAAANKANWQTVIEHQPNVKLEDINLFDNHLVYQSREQGQSKITIRELSNNKEHQ
                     IKFNDPAYNVSMIGNNTLSRGRVRVQYASMTTPKTIFEVDLNDHAKVTLKQDQVLGEF
                     DSNDYLSERIFVTARDGAKVPVSIVYKKSLFKKDGTNPLLQYGYGSYGYTIDPGFSIS
                     RLSLLDRGFVYAIAHIRGSQMLGRPWYEDGKKLNKINTFNDFVDVTKALVAQGYGDKN
                     RVYAQGGSAGGLLMGAVINQAPELYHGVHAAVPFVDVINTMLDESLPLTTNEYDEWGN
                     PNEKTYFDYMRSYSPYDQVSKQAYPNMLVTTGLHDSQVQYFEPAKWVAKLRELKTDNN
                     KLLFKVDMEAGHGGASGRFKSIKDTALNYSFFIELANGRL"
     CDS             524702..525067
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36660"
                     /product="hypothetical protein"
                     /protein_id="BBN83681.1"
                     /transl_table=11
                     /translation="MQLRDKGPIEDYQALFTQNATFNIPKLNIALTSSAQIAQRAAQA
                     IKNKKTIHMITSTDIQASGQSALSSTAHFILYMSDKNDLSAATKIFNGRYIDSLIIDK
                     GRCLIANRNVLIDRVDTLH"
     CDS             complement(525070..525681)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36670"
                     /product="hypothetical protein"
                     /protein_id="BBN83682.1"
                     /transl_table=11
                     /translation="MHTALGLLDEIMSNKARQSAFELSKNIEQPYDLYNHVPYRIAVA
                     SNLLAIDRDAYIKNLTGLETREIRVLLNIGSYGPINAADIAYQSRLDPYSVNRAINTL
                     MKRELISADNDHEKQRSKFVKLSEKGAPLYLKVIEHMQAREADVLQGITDKEKALLLS
                     LLEKIELKAEAALARSAQQLESQGHTITRDQKELIRWHKRSSK"
     CDS             525758..526357
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011121856.1"
                     /locus_tag="PA25_36680"
                     /product="fusion protein"
                     /protein_id="BBN83683.1"
                     /transl_table=11
                     /translation="MALVTPLAQDANSEVAELAKFFNETLGFCPNSVLTMQIRPHIAK
                     AFINLNKAVMENHGKVTSELKRLIGYITSANTGCRYCEAHTILAAKRYGGEDERLQNI
                     WQFRDSKLFTDAEKAAFEFALAASSVPNAVDATIEEQLKAHWDDGEIVEILGVISLFG
                     YLNRWNDSMATTLEPGAVDAGETYLTHNQWQVGKHTTNA"
     CDS             526972..529386
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010921290.1"
                     /locus_tag="PA25_36690"
                     /product="TonB-dependent receptor"
                     /protein_id="BBN83684.1"
                     /transl_table=11
                     /translation="MFQPSLLSLAVSSALTSALLIPTLSQAQEAQVQQGKSLEVIQVT
                     ATRRSGSVQEAPLNITALDSDVMRDQNIGELADVARWVPGLTVTDQGGRSGSPIIVRG
                     LNTNSSGPSSDGGTVATYIGEIPVGIDMRLTDIERVEVLIGPQGTLYGAGTLGGAIRY
                     MLKAPELDLTTGKVYGDLFQNSESDSLGGESGFIFNTPLINDQLAVRASVNVYKDPGF
                     IDYNYVVKEAGVSKPDPDWSNQSDVDQNLRKVKDNNGETTTTGRISLRWAPNDWLDST
                     INYFYQKQESEGRSIVHHGSLNPNNGLNAKIGKYESAYRYEEPRDKEDSLLSLEVKAD
                     LGFAELVSATGFSEFEADGQRDQTDLLIRLDYGYEEFPSFSSFTREVEQEETFTQELR
                     LVSQGDSDWNWIVGGFYNKYKSDGSSKEYTPGFSQFAVANFGGAQVRPDSLEYYSADR
                     SEITEQAIFGEVGYQINDKLTITLGARFYEYKVNADSAVDFPLLSTVFGDAGPNDVNL
                     DFKNSYAEDDGSLFKFNASYQFSDTVMTYATVSEGFRIGGSNGLAPCPDPLPANQAGC
                     GKPNEMLYKDDTTINYELGLKSTWLKNRFHFNAALFNVDWKDAQVGGATEVGQLPYTS
                     NAGSANAKGVEIATRAMLSDSFTAYATYAYTKVELTEDAPFLFNTDGSDGGVKGDRLP
                     GSPEHQFSLGINYQTEVLEDKLLDINYGLTAQSDFISKVGLHDNGETLPGYALSNISA
                     KLTGDQWSTTLYVNNLFNKYAFTSVRRSNADITSANGREIQRNYGHYLNRPLTVGIKF
                     DYQFEL"
     CDS             529458..531029
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010920964.1"
                     /locus_tag="PA25_36700"
                     /product="hypothetical protein"
                     /protein_id="BBN83685.1"
                     /transl_table=11
                     /translation="MTLNVKHLHQQAIKALNQGQLQQAHQYLVELVQTDPQHADGYFL
                     LAMVNTQVGQIKKAIKLIEKALEFSQSIEYFAQLAKCYALDGQLGKAKNTALNVNVST
                     IKSALSADTIAVALSHVGLHEQAVSYYKKALELNDANPQFFYNYGVCCKFLGEFEHAK
                     SAFESAIQIQEHHHQAHFALSDLTKVTEQDNHIERLTKVFKKVHSPDAKLHIGHALAK
                     EYQDLALYDNAFNALQNAKAEKLKHARFDEHASDKLFSTLKSLSTAASSNNSTGFQSD
                     EPIFILGMPRSGTTLVERILSSHSEVMSAGELQDFGITTKRLTQTNTPHVLDEQTITN
                     AYTLDFEQLGKQYLNATRVVTGSKPHFIDKLPFNFFYVDLIRKALPNAKIICLLRNPL
                     DTCIGNYRQLFTINNPYYRYSLDLMDTARFYARFYHLIQHWQTVHSSQFKILHYESLV
                     AQPQFHIRDLLAYCNLQWQESCLNFHLNAAPVSTASKVQVRQPLNNKSIGRWRNFESQ
                     LAEVKAYLNENQVPC"
     CDS             531069..532106
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36710"
                     /product="hypothetical protein"
                     /protein_id="BBN83686.1"
                     /transl_table=11
                     /translation="MFEASLVNLLQAASFGVASLSILILGAYRRYRVICGFFALTCAM
                     AIFNLLEELNITRTIHLITPVFVIGLGPMLYLVVKSLTNKLNKLEYLHLAPMILALPF
                     TQFTQQVILVGTVWRFVYAGLALYHIYQFNLRLQDYRSDAQEVTLRWLGWLIVIMSLN
                     NALDLVRLNVQPYLSHEINVLGQGIGTAVNLLLLMLLTTKLNREHAVICTLSEVPKSS
                     LDVKNNKESANSYKAIFEHLDQQMNENTWYLQSRLTISDLARLCDLQVRDISRAINLN
                     TKQSFNDYINAFRVAHVKQAMSKNPSESLLTLAINAGFNAKSSFNYSFKKQTGMTPSE
                     FKNSLNIASES"
     CDS             532198..533580
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_007054367.1"
                     /locus_tag="PA25_36720"
                     /product="imidazolonepropionase"
                     /protein_id="BBN83687.1"
                     /transl_table=11
                     /translation="MNLTPNKLLWLIATLLLTTSLNGCHSHIAPPKSSDFIITNVNIV
                     DPVKGVIHQQQSILVKNGNISLINNKLKDKASSLKVIDGHNGYITPGLIDMHTHFYDP
                     SALMSNLAHGVTHVRILNGAPEHLKWRNQERSGLLLGASVTVSSPILTGTNNGPLAEY
                     INDAKDARQSVIDAKNAGYDLIKAYGSLNEEALSSLINTAKELGIPVAKHGPNLSGNM
                     SWQDLAGLQSLEHTEEILQSALGHQFNQEKLTSVLLQLKQLNVPITPTLNIFWQLTRI
                     SEDKEAFLNTLPKHYISPILAYAEEKDQIKRWVNASAKMARYNRKTLNQLIDITKQMH
                     SHGIEILVGSDAGVLWSPHGLATHQEMALLAQAGLTNFEVLKAATYSPAKAMKLEHQT
                     GQIKEGLSADFIYTKRNPIDDLSVLKHPDAISKRGIWLTQAQLTDLQAQAIENRSLAS
                     ELWILLTKQF"
     CDS             534032..534448
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36730"
                     /product="hypothetical protein"
                     /protein_id="BBN83688.1"
                     /transl_table=11
                     /translation="MIHLIYISSATRWLTDEELTQLLSQARVNNDKKNITGMLLYDNA
                     TFIQVLEGDEKDVHEVYHKIAQDPRNTGLVKLVEKTIETRDFPDWSMGFKNLQSCLSH
                     PIPGFVDIFNGKLNKEIAKRNHVSVERLMKSFAVNI"
     CDS             534745..535386
                     /codon_start=1
                     /gene="betI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8ZGV8"
                     /locus_tag="PA25_36740"
                     /product="HTH-type transcriptional regulator BetI"
                     /protein_id="BBN83689.1"
                     /transl_table=11
                     /translation="MCNPLTFIFIERSINKNMPKVGMEPVRREQLIKATIESVAELGL
                     QGTTINSISKKAGLSSGIISHYFGGKQGLIEATVRYLLSSLKVELMAKVNSETPPEQR
                     LMYIVEANFALVQQRKDTTRTWLSFWAQSMHDPELHRLQNVNSKRLYSNLASSFRQLM
                     STENSKRAAQLSAAMIDGLWLRAVLSQSDKDQFKHSEQLAKDYVHSLISQYGA"
     CDS             535388..536866
                     /codon_start=1
                     /gene="betB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87H52"
                     /locus_tag="PA25_36750"
                     /product="NAD/NADP-dependent betaine aldehyde
                     dehydrogenase"
                     /protein_id="BBN83690.1"
                     /transl_table=11
                     /translation="MTTMTYNVPVYQNFIHGQYMANQTGESFEVKNPATDEVIYRIEV
                     ADESIQTAAIESAKQGFAIWSAMTPIERSRILLKAVELLRARNDELAKVEVLDTGKPW
                     QEAECVDVQTGADVIEYFAGLAPAQVGQQQMVGNDFYYTRKEPLGICAGIGAWNYPLQ
                     IACWKSGPALAAGNVLLFKPSEETPLGALKLAEIFVEAGVPAGVFNVVQGAAEVGQWL
                     TGHPEIEKVSFTGEVGTGKKVMSSAASTLKDVTMELGGKSPLIVFDDADITQAISAAM
                     LGNFYTQGEICTNCTRVYVHRSVYEQFISELKTRTEQNIIAGDPMNPEVNLGALISKP
                     HQQLVMDYINKGIAEGAKLLTGGKALNPESAPNGYFVAPTVFVECTDEMTIVKEEIFG
                     PVMSVLVFDDEHEVIERANNTHLGLAAGVFTKDIQRAHRVIHQIQAGICWINAYGNSP
                     AEMPVGGYKHSGIGRENGIETLDQYTQTKSVYVGMNKIDSPF"
     CDS             536878..538545
                     /codon_start=1
                     /gene="betA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87H53"
                     /locus_tag="PA25_36760"
                     /product="oxygen-dependent choline dehydrogenase"
                     /protein_id="BBN83691.1"
                     /transl_table=11
                     /translation="MTQKYDYIIVGAGSAGCVLANRLTENGQHKVLLLETGGSDKSIF
                     IQMPTALSIPMNTDKYAWQFHTEPEPYLDNRKMHCPRGKVLGGSSSINGMVYVRGHAK
                     DFDEWQQHGAQGWDYQSCLPYFKKAESWYLGENSHRGSQGPLGVNNGNEMENPLYRAF
                     IEAGQQAGYAKTNDYNAAQQEGFGPMHMTVKNGRRCSASRAYLDPIKRRSNLTIITGA
                     QAQKVLLKNKQAQGVEFKVKGKVQTALAKREVILSAGPIGSPHLLQLSGIGDKAILEK
                     AGVDVQHHLPGVGQNLQDHLEFYFQYKCKQPITLNGKLGLISKGLIGARWILNKDGLG
                     ATNHFESCAFIRSKPGVEWPDIQYHFLPAAIRYDGKSAFDGHGFQVHVGHNKPKSRGA
                     VTIASNNPDNAPKIQFNYLQHPEDIEGFRACVRLTREIIEQRAFDDYRDDEIQPGKDI
                     QTDEQIDEFVRQAVESAYHPSCSCKMGEDEMAVVDSQTKVHGINSLRVVDSSIFPTIP
                     NGNLNAPTIMVAEKAADHILGKKLLNNLDVPVAMESQWQQVQRRSEI"
     CDS             538720..539937
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010969412.1"
                     /locus_tag="PA25_36770"
                     /product="choline transporter"
                     /protein_id="BBN83692.1"
                     /transl_table=11
                     /translation="MTLWLSAGIIFTLLAIALIIFKWGNLQCVGVTPVKTFTFIAILF
                     TSGLDVGLIMFPLTEFAGYADIKASPEYAFANPLAIEFGFWGFLIWGFYFLTCFYFCV
                     IEPKVKFFEIPWVKLVNNVIIIGTCAFTAYLLLSNLPWYLPEVGDGSSIIPTFYLVVL
                     AAICFAVYSSTSLKYVRFLSISTTWLFIGLIAFMWGSAFIFGDSGMQSFANKFALLGD
                     YFVNIDQFVLPLNDYHEFYLFWWFAWSIMIGQFTSRFVGGLKTYQVLAAMLVFPSIPI
                     AVWFSVLYHYHEAGISTAGIKNFAMVFVGVVFVINSLDSLIRLYTDNLNLTVKRLGKR
                     NYMLFNIVALSLLTLLFKLEFLQIQWVGALVIGLFFSCVTYIGYNKFKTVSQIDSSPK
                     DNKIDYSKIETAS"
     CDS             539951..540649
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073341.1"
                     /locus_tag="PA25_36780"
                     /product="TIGR02001 family outer membrane protein"
                     /protein_id="BBN83693.1"
                     /transl_table=11
                     /translation="MTTSKTLLLGALALASTQALANLSTTITAASDYTFNGVSQTKND
                     PALQGSLDYALNNGVYVGSWASNVDFADNTDLEWDFYVGKYTTLNESWSVDYGIAYYS
                     YHGGDNSSNGNYPEVYSKFGFANSLGQTEFNFWYSWDYFGTGADHTVAMVAHSVEVAP
                     GHTLRASFDVSNSLDGNKYMWDAGDKSYTHYRLAYQTSYAGFDVEVAAENTSLDYDTA
                     DERVVLSVSRTFNL"
     CDS             541208..541684
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704876.1"
                     /locus_tag="PA25_36790"
                     /product="XRE family transcriptional regulator"
                     /protein_id="BBN83694.1"
                     /transl_table=11
                     /translation="MITRKLRLQRGWSQDQLAQLSGLSLRTIQRIERGHTPSLESLKS
                     LAAVFETTVADLQQELKMKPHNSDISLTEQEQTVIEHVKAIRDFYSHALTYAIIIVFL
                     FILNYITNPGYIWAWWAALGWGIGLASHGLSIFEVFDFFGPRWEKKQIEKRLGRKL"
     CDS             complement(541681..541935)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36800"
                     /product="hypothetical protein"
                     /protein_id="BBN83695.1"
                     /transl_table=11
                     /translation="MLKSHKKACCINVMGYLSVSVDNTGTMMAINDRTDNSVHFLILK
                     LTILSGYYRSNMNGFALGKVLLNWGSLAPPARHFRKCLHY"
     CDS             542458..543273
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36810"
                     /product="hypothetical protein"
                     /protein_id="BBN83696.1"
                     /transl_table=11
                     /translation="MDKHYTALQTDFGDLVKEAYCLLTQRAQDYKPLHKLSRRSAAAA
                     SIFVLISACYLLAGLSLFKSTPIADIKALGDIVIFDVGDSAQLETLCWSFKLFLAYLL
                     INLIFAFIRMKTNKLCSCKQSKKDEDDKNKGSEKTLSENIKCKIFSILYEQTYRIYFL
                     IVSSGISALLFFEWQQLMPVFFAVGLIIFILSYSINRKFGYTRAWSRNRLYAEKIRII
                     DARYKSGIIFRDKAHEDLLKLLEQYEEQTHQDTVNDYISYGNSALNTLKGLRK"
     CDS             543277..546018
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36820"
                     /product="hypothetical protein"
                     /protein_id="BBN83697.1"
                     /transl_table=11
                     /translation="MSQTHILNLDKNEFRDDFIGKDNLNELWQDEAREGLISRLQTCL
                     AEAKHYAKSRADNPHKTWLSHNAILVSGQRGTGKTVFLRNSEAIWKNASQQSDNNKSA
                     LYFLDVIDPTMLVNDDSFANVIVAQIYSEIEKHMLHLAHVSGSSSKQADKNKFTQALK
                     KLADSLGKSSEFNGHTGIDKVQHYKSGIHIESYFHEFVEISIKILGCNALVLPIDDVD
                     MALDRAFEVVDDVRRLLGCPYIIPIVSGDMRLYEHMTQVHFDDKAYKKHRHNPALINE
                     GKAVTKELTTAYLTKVFPNQMRLSLLPISRLVNSLEITQKVGNKSLGYPIKEYDKLLF
                     QAFYPLCHNNEVLQNWPEPESSRELVQLARAIPPSHIDTSLSEKNVPQPDSKTLWESY
                     ASWAEQKKNGVAYTNAASYLTLVNRNTEQPFDIQKLLSFNPKMQMDKELYPWARVAFY
                     KQQTAEMAKIESEKDRTNNRDILDSVFNAQSLTLRSMPPLEFFDFKLFISNKTIDNTP
                     KTFLQDDQTGLSSSVRDRVSTEQLLLDIFTHKDFYSTMSNTYRFVFMSRAFEIIAYSF
                     LSPTADHKQLADNIMAILSRAPFYSIFNMNMTKAVFNDDDDAETEELEHNNSTQASTA
                     AELSNRIANWHINNKTLFEQIDTRKLTELLAYMFNKTFTAFNLFKYQRLLKTEERRSL
                     FKKNQGYKDEHLSDLVTRFNYMLLNSAYSAGVQGEAIAANVAMTDNYTTIRDNSEFER
                     FDRTLMRNRAFLEEQSKSSDLTAGDTPSLTLAFCQALEQHPIIKLNHLDKGKTLMLGK
                     YKETAVAINDAIFGQLPQSAPTVVLSEEIDDKIYTTLVELLALYHMDEQTRASTARLR
                     NWLTQNTDNIIKRSSAFKWLFQYPKEILQQFKENRGLNAQSDEGKVLSALIVSGLFK"
     CDS             546015..548534
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015705077.1"
                     /locus_tag="PA25_36830"
                     /product="hypothetical protein"
                     /protein_id="BBN83698.1"
                     /transl_table=11
                     /translation="MICTSDKSVVAAALLTSDRLLKTADNLEQVLTRSEAPEHNASFI
                     NAVEDYQKYVSHTLRTDDIRHMLTLHGTSDIDGDPEQLLSKLADYYLQWQGNSFEVKP
                     KKLDQWLELLSLIDPSWVVAQAYKDITSQHGVSYLDVINAIVNEQCPFALPNDRFGRG
                     YADNHVHLGGHGYIGPSLLSFALYGEQLDDAIVWPRRSEYTQFESGVYKKQSLPIWCH
                     YLGCKLIERTFNVSDKPFIPFSSEEAKKAEHNILVYLNEDEAQLPSQPYFVAAHNRSA
                     PSAKRWLLYCLGILSTHSNLNLLKSQFIRTSNILRNYMVVSGVGLSQFVNHSRFKARD
                     VRALKHQTNSALDALNADMHQNYREFRATSKVLLGSECFPSNPDTLAKVLNGLYKISL
                     AERVHFVLHFTRSGERSDKYQEGFRKRLKQQVNMLQEFACSTTFSEVESNKSGLSKAQ
                     SELTFDLRKAIRGFDVAGDENQLPIEVFAPALRVLREAKYSSKGMFSNRMQRPFLTVH
                     AGEDFSHLLSGLRAIDEAVYFCDYQAGDRLGHALALGVLPKKWAKRQRVAYLTLDEHL
                     DNLVWCYQKALEVVQQVPQFTGVLQLLNEKIQYWSSLLHGQEYTCRTLYEAWKLRKNC
                     PLAVSNKNLMGPGWAIDFDENKPSNTSNKAFELWKQYTDNSLLSDNNQKSVMIHCIPK
                     QGEEPFGTEQGMYFDSISAAELELYEAIQDLQMEKYAAQEIIIEACPTSNVYIGRFKH
                     HREHPIFRWDPPEQEWIKVGEKFNQFGLRKGAVAVCVNTDDSALMPTTIQNEHRILQQ
                     SAIEYYDVGVNKAEIWIERIRKKGIDVYKSNHLDWVNNKLS"
     CDS             548648..550711
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36840"
                     /product="hypothetical protein"
                     /protein_id="BBN83699.1"
                     /transl_table=11
                     /translation="MKECIWLFLSLSIFLCTSINAQLPDEEFSQLRTQVSKAGGQSPL
                     AGIDQAETIINEYSQKLANFQTIRLLYLKAWYQINADRLDAAMDTLAQARLMARDIDE
                     PGILYSYYSISASAFSNAELYDLALKSNLKAYQEAPLLNRPQFIAQTENNIGHVYLKL
                     GLLDEAENYFQRFYNSAVELNLASQKSTGLNNLGEVSYLQGKLEKAKKLHQEALEIRR
                     ANGYDYHLSWSLYNLGRVYASEGDFRQAEQYLKEAITNWQNKSAHSKTDKPLLALVDL
                     YLKQGRLDEAQAKITQVIELAQQHKHSSSLQKALKLKSELKRQSGELDQALQALEQYH
                     AVYEAFSKKQASIGLAYIVSQTELQTKEMALKQLEQTHQITLAKAESERRQGWIIMFS
                     ALTIILVTWGFVYRLNKKRRQLQALLTQLTNTQEKLVESEKMRAMTTLVSGMAHQLNT
                     PLGLVITADSSLQSLVEKLAKQFSSQSLTQKLLAQFIDEATELLALSQKNSEKAANMV
                     QRFKMMSAKLQISELGSFCILSFLQSHTKTLITTQTKSIDLHLDGENIEITNYAPLLL
                     KVIAQLIENSVKHGFTNTDKPKVDIFVEHDTTDHVLIHYKDNGSGVAIEKRKQIFDPF
                     YTTRLGEGSLGLGLNIIYNCVVHIMCGQIDCIEDSEGAHFVIRIPKEIAHDTVVDASP
                     VESHG"
     CDS             550930..552042
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000337598.1"
                     /locus_tag="PA25_36850"
                     /product="choloylglycine hydrolase"
                     /protein_id="BBN83700.1"
                     /transl_table=11
                     /translation="MCTNFVITTETSTNEQSLSTSPKAVIVGRTMEFGNRYVADGKVT
                     ILPKGEQLYSYGSTKADHKYCIVGVNIHVTNDDPNKEDNSPTVQLLANCLTDGLNEAG
                     LTCGSLWLPGSEYMTTHKFLESDIPVYLFTNWVLGNFSSVEEVKQAVNSNDYRFFEVE
                     NLPLPLHFPITDKSGKSIVIEFSSSDGEPSVYDNELGILTNAPTYPEQLANLNAMLRE
                     HKFSPYNPAQVPCSIKAPQGEGYGLAGLPGDPIPASRFVKTAVLKQFATDAQAGYEIK
                     NAADAKTLAYHLINAVDLPKGVTRYGDAHSSDGSDYTQWIVVKDLSHGEFQIRKYDSP
                     IPYKIDFETISQLELTEPMFIDVPQNADALSLIPNH"
     CDS             complement(552075..552521)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36860"
                     /product="hypothetical protein"
                     /protein_id="BBN83701.1"
                     /transl_table=11
                     /translation="MVDSQALQLVSKAAKVHNSISKYLSGYLQNKGFIGATPSALNFL
                     SALECGENYGSQIARSLDVSRQMVAKSVKEMCSLGYLEQKTGHGKQKVIVFTELGEQL
                     MAEARLCLSGLDKLFCEQMAPHAVDSTIANLEQIQLSIEFLAGSKC"
     CDS             complement(552581..552823)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36870"
                     /product="hypothetical protein"
                     /protein_id="BBN83702.1"
                     /transl_table=11
                     /translation="MSNLGGDCLDDAQIRCKPLIINTPAKIHITYSGARCSALRNSET
                     CWGIKANIVANSKQLAAFARKTAFNVIIRASLCILG"
     CDS             complement(553206..554525)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010971260.1"
                     /locus_tag="PA25_36880"
                     /product="6-aminohexanoate-dimer hydrolase"
                     /protein_id="BBN83703.1"
                     /transl_table=11
                     /translation="MKLISFAVLFSCALSLVAQESWANSNTNYLSAQQSDPKKLGWMV
                     GSPPAPDKLITQPQSNYFSFPKLRWTVCHIREFLPTKNVSRGLGVPTSLMYALDNNID
                     AVTFKPLGQQQSMTWLESLDANYTDGILVLHKGKVVYEKYAGCLDEQRKHAAMSMTKS
                     LTGLLAEILIAQGKLNEHAQVDSIVPELKGSAFGSATVRQVMDMTTALDYSENYADPN
                     ADIWIYSKAANPLPKPKEYQGPEGYFEYLQSVVQKGEHGEAFAYKTVNTDALGWIVSR
                     TAGKDVSTLMSELLWQKIGAEQDAYMTIDSKGTPFAGGGLSASLRDLGRIGQLMLNEG
                     EFNNSRIFPKSVVKNIKQGGDKQVFSKAGYKSLSGGSYRSMWWMLHNEHEAFAARGVH
                     GQTIYIDPTANMVIVRFASYPTAKNAQIDPTSLPAYQALAEYLIKQK"
     CDS             complement(554589..555602)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001882600.1"
                     /locus_tag="PA25_36890"
                     /product="threonine aldolase"
                     /protein_id="BBN83704.1"
                     /transl_table=11
                     /translation="MIDFRSDTVTQPCQQMRLMMSNAPVGDDVYGDDPSVNELEQWAA
                     TRHGFEASLFVSSGTQANLLAILSHCERGDEYLCGQNAHNYRYEAGGAAVLGSVQPQP
                     IENEPDGSLCFNKLEKAIKPDDSHFARTRLLSLENTIGGKVLSLQYLAQARTFANKHQ
                     LALHLDGARVYNAAVALNVDIKDISQHFDSMTICLSKGLGAPVGSLLLGNHEFIKKAR
                     RLRKMLGGGMRQAGILAVAGYYALTHNVSRLAEDHDNAQYLAYQLNSLKGFSTESYQV
                     HTNIVFADIDERVDIQRISEKLKAQNIVITPGYQGMRFVTHKDISRDDIDMLLAALRT
                     ELP"
     CDS             complement(555613..556923)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012639931.1"
                     /locus_tag="PA25_36900"
                     /product="Xaa-Pro dipeptidase"
                     /protein_id="BBN83705.1"
                     /transl_table=11
                     /translation="MKKVKTVLLLASTVLASFSAFAKVDGVIYAGKVLVKPEEDALTK
                     QTLVLEDGKVSAIHEGYILPHKLGLKDVKLYDLKDYYVMPGMIDMHVHLTFERDKQVN
                     PHAWLTQDDADYALNSIPYLQKTLDAGFTAVRDLGARYQVIFPLKRAVEKQLITGPRI
                     FASGNAISATGGHGDMHGYRRDLTETMNTSLGICDGAADCQRAVREVIKYGADVIKIT
                     ATGGVLSNTAAGVNQQLTDDELNAIVNTAHNLGRKVTAHAHGTQGVNAAIRAGVDSIE
                     HGSYLDDESIALFKRHGAYLVPTLLAGHTVSKEVLNNPNMPKAIADKVRQVAPVVEKS
                     FRNALKNQVNIAFGTDSGVSRHGDNAKEAQLMVEFGMTPKQVLVSATRSAAKLLGQED
                     NLGSLEVGKYADIIALKANPEEDISALSEVSFVMKNGVVYKNQL"
     CDS             complement(557001..557894)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003402385.1"
                     /locus_tag="PA25_36910"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBN83706.1"
                     /transl_table=11
                     /translation="MLRITLEQWRMFRMVAEHGGFNQAAEHIHKSQSSIHNAVSKIEQ
                     SLGVKVFYIEGRKTRLTQAGKMLLRRANYLLDEAQKVESVAQTLAKGVETSLRIAVDE
                     VFAKHLLYQALDATSEKFPLLRIELFESILSGAHELVENNEADIAISPISMTGGFSEQ
                     LCSVEFVAVSSPAHALQQYNRALTFEDLKSFRQIVIRDSAHNKRSDSGWLEANQRWTV
                     SHLRTSIDMICEGLGFAWLPESAITEHLNSGRLKRLPLTHNATRTSALYLVFQDSDRL
                     GLAAQAFIEKLREQCRNLKAQ"
     CDS             558086..558610
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36920"
                     /product="hypothetical protein"
                     /protein_id="BBN83707.1"
                     /transl_table=11
                     /translation="MRNTVILFSSANENGNTYKLVSQIMAQCRPEQVKLLTLDNLNFA
                     DYNYANAYPEDDFYQVAESLAWADNIVFASPVYWHSVSANMKRLIDRMTELTENPTIK
                     PIGKALKGKQGYVLTTSAHEQVCEIFSGFFDKLFGYFGINNSGLLHVPCNNGFALTTN
                     ALNQFTQHLHSQKA"
     CDS             complement(558799..559440)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36930"
                     /product="hypothetical protein"
                     /protein_id="BBN83708.1"
                     /transl_table=11
                     /translation="MQLLDYLNDNFISLSQLLSASGASEQELRLYQLNGMMPKASYVL
                     NLHLSCNSFFGHHQEQTECEYYAKGYLYWLGIVQANADPEFIYQAFSQRYQQTLDALK
                     AQGYQCNDEKLSTKLAEHIESEWQHFLSGSYGLCTRSGLPENIAAKELAIAQINELTR
                     NENLGANELSALTKAVDLLDKASACFAPHERQRSSRHRLVDEVRRQYQLVSPM"
     CDS             559587..560174
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36940"
                     /product="hypothetical protein"
                     /protein_id="BBN83709.1"
                     /transl_table=11
                     /translation="MDQAISTKLSLSCQCKKMQACVEPIAPKLANHLTCYCRDCQKFA
                     VALNRADDVLNEYAGTTILQVPIAHFKFLEGKEHLGCLRLTKKGLYRWYAKCCNTPIG
                     NTLNGGWPFIGIIHSFIDDNKLVEKAGVVKGSVHIKEASREIPVQRLGPCGHTQLVLA
                     TLQKLALWKLQGKHKPSEFFDNHGQPIVTPQIQAH"
     CDS             complement(560171..560596)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_36950"
                     /product="hypothetical protein"
                     /protein_id="BBN83710.1"
                     /transl_table=11
                     /translation="MRYKHLILGITSALLANSNAQAQEASVSFEVIAKSTKSWDGSLL
                     PAYPRGQPQITMLKVTIPAGATVKKHKHPMINAAVMLSGELTVRSQRGEVLKLQAGDP
                     IVELVDKWHEGKNEGNIPVELIVFYAAIEGQPLSIKHTD"
     CDS             560868..561284
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073406.1"
                     /locus_tag="PA25_36960"
                     /product="glyoxalase"
                     /protein_id="BBN83711.1"
                     /transl_table=11
                     /translation="MRLEHVNLVVSNLEKALHFYQAAFPHWRIRSKGSGQWFAKPRNW
                     VHFGDDYNYIAFSDHGEGNNRTLEGHQVGLAHFAFEVKNISALIHRLVDAGYPIDKSG
                     SNNPHRKNVYFIDPDGFEVEFVEYLSDLPFERNNDD"
     CDS             complement(561359..562405)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013230085.1"
                     /locus_tag="PA25_36970"
                     /product="acyltransferase"
                     /protein_id="BBN83712.1"
                     /transl_table=11
                     /translation="MQIRKLNTLRALAALIVFFTHFSDITNWLGGALGGGSGAYGVML
                     FFFLSGFLMAHLYLDKPCNKQNITDYFLARIGRVIPLYLVIVFASYFLTQAEKNTLYN
                     IADFNTVIGHLLFVYGESVLWSIPPEIHFYLIFTLLWSFSQHRKGYIYAAVVVVMLVL
                     FFTNFPKIFGDFYGIPYNLFSILRTLPFFFIGVIFGLHYKQLKIPAYLRSHWFVLALC
                     LIPLMYPEFSPITSDAKNRMWLSYEVLFVMATVFFCIVFLVPDNNILLANKLGDFLGK
                     ISYSLYLLHMPIIEMVNTLSLSIEQKLIVSLLLSIFVAYLSFNFFEKPVAKMIRNRAS
                     TRQRHAMSTGIKQA"
     CDS             complement(562579..563994)
                     /codon_start=1
                     /gene="agcS-2_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011706925.1"
                     /locus_tag="PA25_36980"
                     /product="sodium:alanine symporter"
                     /protein_id="BBN83713.1"
                     /transl_table=11
                     /translation="MVNEVIASINGLLWGDGQLLIYILLFAGVWFSARLGLIQLRQFT
                     HMFKLLKSSGNADKEKVSSFQALCTGLSARVGTGNLAGVAVAISLGGSGAIFWMWVIA
                     LLGMATGFAESVLGQVYKVRDSEGEFRGGPAYYIQLGLNKRWLAIAFAVCLFLGYGFS
                     FSAMQTNTITDALSFAFDIPPLYSGMVITVLAGSIIMGGFKAIARFAERVMPIMGILF
                     VSAAVLITFINFKHVPAMLEDILLSAFGLQEAGAGAMGAAIKNGIQRGLYSNEAGAGS
                     VPHASGAASPIPNHPVTQGYIQMLGVFFDTIVLCSCTAVIILLADVDISGEMEGIRLT
                     QNAMTAHLAQGGVYFVAGAITLFAFTSVVANFAYAESNLHLFKLDNKVGRSIYTAMYL
                     GMMLWGATATLKEVWSLADMALGLMTLVNIFAIIQLTPTIVAVNKDYNTQRKQGKEPE
                     FNAKQVAIQGQCEPGIWDKSS"
     CDS             complement(564027..564935)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015887957.1"
                     /locus_tag="PA25_36990"
                     /product="hypothetical protein"
                     /protein_id="BBN83714.1"
                     /transl_table=11
                     /translation="MSALQTPNAVVMIRPHHFVSNPQTMQDNAYQVEAQSVHASELAY
                     KEVTYVADTLKNAGVEVHLFEDESRLTPDSVFPNNWFSTHSDGQLVTYPMYAPNRRAE
                     RRLDIVEFLKQHYYVESITDLSKLAQSHLFLEGTGSMVMDHIHKIAFAVESKRTCAKL
                     VEKVCQQLGYQAHVFNAFDEQKVAVYHTNVLMCVATEFVMIGLDMVPKEQQSALLAHF
                     KQQNKAVIRLSNAQVAHFCGNALELQGEQGRILALSQTAFDALSDEQKHTIERSASLL
                     PMSIPTLESAGGSIRCMLGGVHLQKR"
     CDS             565198..565629
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015887955.1"
                     /locus_tag="PA25_37000"
                     /product="AsnC family transcriptional regulator"
                     /protein_id="BBN83715.1"
                     /transl_table=11
                     /translation="MQPYLYDTLDKALIAALRKDGRASISTLAELLNVSRGTVQNRLD
                     RLVSCGAILGFTVRVHEEIDSDAVRAVMMIEVVGHSTSQVIQKLKGIPELTRIHTTNG
                     AWDLIAEIKAANLGAFDGVLREVREIKGILNSETSIMLSST"
     CDS             complement(565626..566234)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37010"
                     /product="hypothetical protein"
                     /protein_id="BBN83716.1"
                     /transl_table=11
                     /translation="MGIFADIFARLAQLTGHEFEFVATSVARGQRFFDTGQVDIEPGV
                     SWQWRAHQKVPGIYTLSYAKSVEILLANHSNTLEVVSQAYGSLVGRVRGYRYGPFERH
                     FGEDKLIVYDNISEKELLGQLAYGRLDYVLIGKDTAHYYMANNPKYRQFKDAYTIETA
                     QVSMRLQPHLIELKEQLNTALTTMINNNEIDTIYKKYTDYQH"
     CDS             complement(566440..567279)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37020"
                     /product="hypothetical protein"
                     /protein_id="BBN83717.1"
                     /transl_table=11
                     /translation="MNLNYINLTTRVCVCLSFVLLGLSLLFNGSEREMTTMVGFFKLG
                     SWISAHYFGVLFGSLMLLASVLVIVANKQKLSMLSFGLVLVVAVLPLLTLFDASRYIE
                     SLGGFPILGSGQGVIKYAALIPLALALFSSRLSLTQLAWFNYLPVAMVLIWIGGLKFY
                     EFEAKGIVSLVSTSPFMFWLYELFSVQWASNLIGSYDILFAVLLGVALKIRRSELLII
                     AMLGCSAVFVMTQTFLFTAQGAFSAQTLLSGLGQFVIKDLWFIANLLVILNYTLQLNS
                     KKA"
     CDS             567453..568307
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37030"
                     /product="hypothetical protein"
                     /protein_id="BBN83718.1"
                     /transl_table=11
                     /translation="MRAIFMIKTLILTLMVLSIPCHAIVTRHDIASERYLAEPSDFKP
                     LATFYIDGAHGTLIKPQWVITAAHATFCLGAGKNISINKKLHQVEQVFIHNKYAPGQS
                     HDIALVKLTTPVNDIRPATPYKQTNENNQSIWFIGIGGTGNGLTGQTIDNFENKGILR
                     KAQNKVEQAIGPLLKFKFDKGDTALPLEGVSGGGDSGGPAYLIDEHGELHILGISSRF
                     KGSAIGKYGITEIYTRVSYFHQWINYIINGDTKERNQISTTILSHLPAGLTTALLPTV
                     CKDINLKP"
     CDS             complement(568363..570456)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37040"
                     /product="hypothetical protein"
                     /protein_id="BBN83719.1"
                     /transl_table=11
                     /translation="MKVALVGNPNCGKTTLFNRLTGSKQKVGNWPGVTVEQKVGQCSL
                     PSGLDIELIDLPGLYSVEQIEPGQDEQIAIDFLRQGKADLIINIVDASNLERNLVLTT
                     QLQELGTPIIVVANMVDVATQRGKSLDVQLLGERLNLPVIEVVGSTGKGVDSLKQALC
                     DDASKSKPKVDVTTKQQGESHDPVSETVARYKRVRSLTQGVNIISPKRSDITDSIDKI
                     VLNRFLGVPIFLAMMYLMFTIAVNFGAVFIDFFDIFVGALLIDGVKEVLGGIGAPQWL
                     SVLLADGFGAGVQLVATFIPVIGVLYLCLSLLEDSGYLSRAAFVIDRLMSSIGLPGNA
                     FVPLIVGFGCNVPAVMSARTMNRESDRLLTIIMAPFMSCGARLTVYALFAAAFFPTNG
                     ANIVFALYLLGIVVAVGSGFIFRKLVFTGEKTPSYTEMPAYHLPVWRNIWLTTWHRLK
                     GFIARAGKTIVMVVMLLSMLNSIGTDGSFGNENTDRSLLAKAAQVVTPAFKPLGIEED
                     NWPATVGIVTGLFAKEAIVGTLDALYIGEEQQTTEYSLTNATVEALGTIPSNFIDLLG
                     NLGDPLGLGALDEQDANSNALLTQMASQFNGQLGAFSYLVLILLYTPCVAVLGAVKRE
                     SGARWMWLVIGWTTSLAYILSTSIYQLANFAQQPLFASTWLAVMGVIAFAWWFGLRGL
                     GKQLNKPPTYQINLS"
     CDS             complement(570466..570696)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37050"
                     /product="hypothetical protein"
                     /protein_id="BBN83720.1"
                     /transl_table=11
                     /translation="MTLNDLKLRQKALITALEHQDVALASRIMALGLVPGELIELMNV
                     APMGCPLQVKVGDTLVSVRKADASLISITANS"
     CDS             complement(570904..571161)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071035.1"
                     /locus_tag="PA25_37060"
                     /product="DUF2999 domain-containing protein"
                     /protein_id="BBN83721.1"
                     /transl_table=11
                     /translation="MNPILAILKEHNISDVQIKELFQTLTDNPMMAMGVITQLGIPQD
                     KLQQLMGLVMQNPALIKEAVDELGLDFSKVEQAKEKLNQQQ"
     CDS             complement(571264..571893)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004530934.1"
                     /locus_tag="PA25_37070"
                     /product="LysE type translocator"
                     /protein_id="BBN83722.1"
                     /transl_table=11
                     /translation="MIAFDTVLAYTLACILLVISPGPDNLLAIGRGLSQGRLAAIVSG
                     LSSGAGILFHVITATLGLTVLLQTSEVAFYVVKFVGAGYLIWLGIKVLRSKSLFSLAH
                     TVPKQSLRTIFVTGFLSAALNPKPGLFVLAFIPQFVNPALSSVSAQMVGFGIWFAVLT
                     ALGFALMGVFASTLTTWLSTKPKVVAALNTGAGLTFVSSGLAVAFMRQR"
     CDS             complement(571998..572573)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000680361.1"
                     /locus_tag="PA25_37080"
                     /product="N-acetyltransferase"
                     /protein_id="BBN83723.1"
                     /transl_table=11
                     /translation="MWIKNEPLNGRHVTLEPLNLSHVEGLQSAVADGELWTLWYANVP
                     TPEQMKEYVERAMMKAEKGGVAFAVINNASGRVVGTTRYYQVDSSNKRAAIGYTWYAN
                     RARRTAINTEAKLLLLQNIFETYGAIAVEFKTHFFNLPSRNAIERLGAKLDGVLRAHQ
                     IMPDGSLRDTAVYSIIASEWPAVRNNLFHRL"
     CDS             572699..573733
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37090"
                     /product="hypothetical protein"
                     /protein_id="BBN83724.1"
                     /transl_table=11
                     /translation="MLPNIAILIALLQGVPPDLAELKSQFMLEPHELAQRYYAHTSLP
                     ANTGSAQFYQLTLRAAIVSNQPKLANDIALKLAQPLWQSHIENHHAKLVSNLGVLLRI
                     NGHYEDAMRAYQCALALNNGDKSFSFHTLLNLQSAMVHAKQYNKAKAILDKAAKLAVN
                     EQQHLRVKINLANHYLDTNNLKEAKALFKALYRDLSLAGETETAARIGLNLLNTEILL
                     ADYSQFWRYQNSVRQTIFSIAGSNHHYYYHFVLMRAFVNAMQAPNNTQYKRFAYAIEH
                     GSFLFEYGQQESIEQYVNILDVPWISSQFSEQVFEYKRIRPKKVVQMDLLEQHCSTQE
                     VAHSRTKLLQ"
     CDS             complement(573748..575751)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37100"
                     /product="hypothetical protein"
                     /protein_id="BBN83725.1"
                     /transl_table=11
                     /translation="MTTLNKISKLSALSGATLLCLSQSVHAQPTTFVHLFEWSWPDVA
                     QECETFLGPKGYAAVQVSPPNEHITGDPWWTRYQPVSYQLHSRGGSEAQFKDMVQRCK
                     QAGVDIYVDAVINHMAAGSGQGVAGNTYGIKQFPMYSPHDFHESCAINGEDYGNNAWR
                     VQNCELVGLADLDTDSAYVQSQLSGYLNSLVNAGVAGFRLDASKHMPASDIATILSQV
                     NGTPLVFQEVIDQGSEAVSASEYFGNGLVTEFKYTTKLGETFKGGKLAWLNNFGEAWG
                     MMPSYKAVVFVDNHDNQRGHGGAGNVVTFADGKLYDLANVFMLAYPYGYPKVMSSYEF
                     NHDSDAGAPSVPVHDNGQLNCSAQQWQCEHRHSMISGAVDFRNNTTGHWQVSNWWDNG
                     NNQIAFSRGNEGFVVINRESGALSQSLQTGLAPGVYCDVLSGNLSADKSSCSGRQVNV
                     NAQGVASILLSQMDALAIHHNAKLAQGTTTDLQRTVVFIKAQTSSGQDMFIRGGIDHN
                     YALSIGKDCTQDPALCMLKISHNNLKNSTTSGWKAGDHYLDWAANESGQSPTAQGSPL
                     DWTTNAWPTDWGIKRTVENDGYGETPLNQYGQHYWMLDVQMDCSNTINGWFELKAYVK
                     NGQGWEGDIRQPNAPYESNNHFAQCGKINVFEFGKHAATYAHF"
     CDS             complement(575843..576190)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37110"
                     /product="hypothetical protein"
                     /protein_id="BBN83726.1"
                     /transl_table=11
                     /translation="MIMINKDKKVERKVGPQESARMVEVLVGCKWSLTVYQLLAAGIN
                     RPGEMVRKTHGLTTKVLNQCLKKNVEFGVLKKQSFAEIPPRVEYEVTELGEQFLSILN
                     ALEQLQQQINQAQ"
     CDS             576304..577068
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010947852.1"
                     /locus_tag="PA25_37120"
                     /product="glucose-1-dehydrogenase"
                     /protein_id="BBN83727.1"
                     /transl_table=11
                     /translation="MLFSNSGYAMIVGGSSGIGFATAQLLLKHQIPVCIVGKNATKLQ
                     SALTALDSANASALLADLSTSEGTNVVATYIAQHTAPIQYLINAAGYFNPKPFIEHTE
                     VDYERYFALNKSLFFITQAAVKVMQTRQQGAIVNVGSMWANQAIKATPSSAYSMAKAG
                     LHSLTQHLAMELAEHNIRVNAVAPAVVKTPIYEHFIDAKEVDDALASFNQFHPLGRIG
                     TPEDIANSICHLLSEQSSWITGTVLNIDGGVMAGRN"
     CDS             complement(577208..578212)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KT26"
                     /locus_tag="PA25_37130"
                     /product="threonylcarbamoyl-AMP synthase"
                     /protein_id="BBN83728.1"
                     /transl_table=11
                     /translation="MSADLETKILSTNDPQSLETAYEYLKSGQLVAIPTETVYGLAAD
                     ASQPEAVSQIFAAKGRPADHPLIVHVDSVEKLKDWACEVPNSAKVLAEAFWPGPLTVI
                     LQKAEHVSYVVTGGQDTVGLRVPNQAAVRTLLARLNTGLAAPSANPYKRISPTTAEQV
                     MFGLNKKIAAVLDGGPCDVGLESTILDLTSDTPIILRSGPITKSQIEAVLGCEVKLPT
                     SHNVAVPGNVKAHYQPTKPVKLMTSNSLLEQLSSHSTLSQNDIAVLYYSDTLTNSLDE
                     TSALQMKLSSDKAAYAQNLYYALYQLDNADIKHIWIELPPDKEQWLDVLDRLSRAAAS
                     "
     CDS             578560..579231
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37140"
                     /product="hypothetical protein"
                     /protein_id="BBN83729.1"
                     /transl_table=11
                     /translation="MRRIGLPWSEQLMARTFTAPLGTLKAAQLALQHGIACHLAGGTH
                     HAHYDFGSGFCMVNDLVFTAHELVATRQVHNVLIFDLDVHQGDGTAAMLAHNPYVFTC
                     SIHCEKNFPFRKHASDLDIGLDNYLEDQPYLHIVKETLTGLIDDLNPSLVIYDAGVDI
                     WQHDSLGKLNISWQGLQKRDALVLSTCQARGIPVATVIGGGYDKDHHRLAQRHSIVVE
                     QAALL"
     CDS             complement(579353..580072)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707502.1"
                     /locus_tag="PA25_37150"
                     /product="hypothetical protein"
                     /protein_id="BBN83730.1"
                     /transl_table=11
                     /translation="MKKFWLVLILFSFAINAEPKLNVVTEEWVPYNFTNEEGEVVGRA
                     TKKVREVLDAAKIPYEIRSYPWVRSMKMAQRNANTMIYSIYRTEEREALFLWACPLLN
                     PVKEYLFKLRSRDDIKLTTLDDAKNYIISLVRGSISHEYLLAQGFKNGVNLDLTADPS
                     ASPRKLLARRVDFIITTEYTAYERMRELGRPFELLEIAHEVKNANERRACMAFSKNTD
                     PQIVKRVQEALAKHNQQFDSP"
     CDS             580221..581093
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011263914.1"
                     /locus_tag="PA25_37160"
                     /product="hypothetical protein"
                     /protein_id="BBN83731.1"
                     /transl_table=11
                     /translation="MKSFFFLLCICLLSFGVNAQQAAKLTETQQDKALEELQAPMYKP
                     LLERYILDELKAVRYDQQKLREDLTKQVTHSQLDAADRAITYTTDTINNVLFIITATA
                     SILVVVGWTSLRDIKSKVEDLVKERVGNITQEYEQRLQVLESKLKERSEEILNNHKKI
                     TITNEVHSLWMRANLESDMNSKIEIYDEILKRKPEDVEAIAYKADALLELGETGVAIQ
                     LCNQALEMDNDYGYAYWQRACAFAMLHQHADAMADIRMALEYAPNLKNELLHEAAFAS
                     LHDNASFNELIEHA"
     CDS             complement(581247..581564)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072363.1"
                     /locus_tag="PA25_37170"
                     /product="hypothetical protein"
                     /protein_id="BBN83732.1"
                     /transl_table=11
                     /translation="MSEDKRIRLLYRVEPGCLGPTGVEFVEGFCQYANTKIKPPVYAV
                     FSFVPRYDKSLPEREYKVGNKNLSESQVMAYLARLDKEKDQFEEQIDELLSHAIDAYL
                     KRL"
     CDS             complement(581635..582375)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015369139.1"
                     /locus_tag="PA25_37180"
                     /product="ferredoxin--NADP(+) reductase"
                     /protein_id="BBN83733.1"
                     /transl_table=11
                     /translation="MSQWVTGKILDVNWWTPSLFSLKISADIEPFKAGQFTKLALKIG
                     DKRVARAYSFVNSPQEPVLEFYLIEVEDGSLSQKLSELKVGDEIDVSVQANGFLTIEE
                     VPDCDVLWMLSTGTAIGPFLSIIAQGKLWDRFKRVILVHGVRYNDDLTYQHQIITTEK
                     LFKQFTYVPVVSREEPELGLSGRITDLLETGKLGQYCGLSELPKSSHFMICGNPQMVK
                     DTTKLLMNDGFKRHRRAEPGHITVEQYW"
     CDS             complement(582525..583514)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37190"
                     /product="hypothetical protein"
                     /protein_id="BBN83734.1"
                     /transl_table=11
                     /translation="MFINAMLLSSLLMLPVSSVQIDELKKLSSSEPDKAVQRYSELLK
                     QAQIDNTDKQVLTDLHFEGLLAALNASQWSTFVSIVKRLSSPELSIYVEPIKFNLVTR
                     IGVAYRFNYQLEQARKHYTCALDLSASDIELATLKVNLAIVYRLSEQPAMAYQLINSI
                     DQKQLSMRVKAGYFVVRGNILTSLGKFEEAVSSFEQARGFYGKLGNAISAAGVTLNIL
                     GASLSGNLLSTFSHYRQGYETLVDEQDMESLQYLQWLDLIAQAIKTKEVTLAQERWLA
                     EHVKPLIKRGFGADVKAHLKVVDKAYLYPKQKPIRLGKTLLPESMAQPWCPTL"
     CDS             complement(583721..584422)
                     /codon_start=1
                     /gene="deoD-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPE1"
                     /locus_tag="PA25_37200"
                     /product="purine nucleoside phosphorylase DeoD-type"
                     /protein_id="BBN83735.1"
                     /transl_table=11
                     /translation="MSTPHISANSGDFAETVLMPGDPLRAQYIAEHFLEDARQVTGVR
                     NMYGFTGTYNGKPVSIMGSGMGIPSMSIYARELIVSYGVKNLIRIGTCGGISKDIKIR
                     DVIFAQGASTDSNVNRARVRGYDFAAIADFGLLENGVNAARKLGIAAKVGNVFTTDTF
                     YQADGTFYEQLDKLGVMAVDMETAGMYGVAAEYGAKAMALFTVSDHVITGEATPAEER
                     QSTFNEMVKIALESI"
     CDS             complement(584439..585653)
                     /codon_start=1
                     /gene="deoB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EHK2"
                     /locus_tag="PA25_37210"
                     /product="phosphopentomutase"
                     /protein_id="BBN83736.1"
                     /transl_table=11
                     /translation="MARAIILMADSLGIGAAPDADKFGDVGANTLAHLLQAYKKETGK
                     ALSLPNLSRLGLLDACEAAGGESCEVSERQTPQAAWGYAKELSSGKDTPSGHWEMAGV
                     PVLFDWGYFPNTTPCFPQAFVDELCKRADIPGILGNCYASGTTILEQLGEEHVNTGMP
                     ICYTSVDSVFQIAAHEQSFGLDKLYQVCEIARALLDEMNIGRVIARPFIGTSSADFIR
                     TGNRRDYSVLPPAPTVLDKLAADGGEVISVGKISDIYAHQGITQKHKAPGLMNLLKKT
                     SELVDSAPDHSLIFTNLVDFDEKFGHRRNAVGYAQALEQFDAFLPTILNKLQSDDLLL
                     ITADHGCDPTAPGTDHTREYVPVLAYTPGMVNAPLGERQSFADIGQTLAQWFKLSALE
                     YGEGFVTSLNRA"
     CDS             585957..586586
                     /codon_start=1
                     /gene="udk"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KT67"
                     /locus_tag="PA25_37220"
                     /product="uridine kinase"
                     /protein_id="BBN83737.1"
                     /transl_table=11
                     /translation="MTRTIIAIAGASASGKSLFTQTIYNELVNELESGAIAIIEEDAY
                     YKDQSHLPFEHRTQTNYDHPDAFEHDLLRTHLEQLRQGNAVEVPTYDYAQHTRSNVTR
                     TVTPAKILIIEGILLLSDPALSEEFDIKVFIDTPLDICLLRRMQRDIEQRGRSLPSVV
                     EQYQATVRPMFYQFIEPSKHNADLVVTRGGMNRVAIDIIKSKIKYLLQE"
     CDS             586616..587827
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EHK7"
                     /locus_tag="PA25_37230"
                     /product="nucleoside permease"
                     /protein_id="BBN83738.1"
                     /transl_table=11
                     /translation="MSLVGMLMLLSVAYGFSTNRSAINKRTVGVALAMQVSIGGFVLF
                     VEAGKNALASMSSAVSAVIGYANDGIGFLFGPLADKSSLGFIFAVQVLPVIVFFSALV
                     AVLYYLGIMEWIIKILGGGLQKLLKTSKPESLSATANIFVGQTEAPLIVKPFIPTMTK
                     SELFAVMVGGLATVAGSVMAGYVAIGVELKYLIAASFMAAPGGFLMAKMIVPETEQPK
                     QNLADVNAEEDKPVNVIDAAAAGASSGMHLALNVGAMLLAFVALIALLNGMLGGIGGW
                     FDYPTLTLQEILGYVFAPVAWLIGVPWDEAVTAGSFIGQKLVVNEFVAYLDFMNYRDG
                     LSEHTQAIVTFALCGFANLSSIAILLGGLGGMAPSRRKDIARLGLRAVLAGSMANLMS
                     AAIAGFFLSLA"
     CDS             complement(587946..590558)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37240"
                     /product="hypothetical protein"
                     /protein_id="BBN83739.1"
                     /transl_table=11
                     /translation="MNWLLVVSDTVDVIAFFVVENWSAVLGFIMAVLGILFAFQLPRK
                     YVLSKLSFGSKQSLPIGFDDPEWLAGKEGLRARLCADIQAYVAAPKELGIFKLLSYLE
                     DHTRPLVITGDGGLGKTRLALELYRASGFRGVLVQKHASLEDVKSIIEDARLNRCRTL
                     LIIDYIEQMGALYDGVHQAIISQSEGYAVLVTTTRTLSNGSAAMQGPEYLNSRTCQEV
                     SLNEQLLLPWRKHVCEEILSNAKVPEPLRSQAINSAVPLIATLVSYDFSNHGMTDSKS
                     DNDDGYWLVKRLRRHIDSNLTEEDFTFLLCLYPMDKAVREGLSKPLRKASDMLQRQGW
                     VSTTGSGKAMQWHLGHDLLCDIPLVYFLVTEPDIALRLEAIERLGEYAKPLNASGNLA
                     TAISRALKKIIMDTQAQHIVPTLAACAQQIAFTYKERDTALEMVDKCIYSLSLGLGEK
                     LRIITELRSLSRFQVDELLSTFNEELQAFIKLTDEHPADMYSLVGRMSMGNEQAYNRL
                     CSFYALTQHQQPCAPLGLRGKHFPELYSINNDCTKLLDEFPADDSLSDNLRVRVAENL
                     FQYANRIKRDELLQFVVVRYIDSSNIELKLVAVKAMFVKAQIMAERDRCPEAYNEVID
                     RFCADACDEIRLRAAMAAFNQANGFSKRDSDPDAYNKVIEMFGNDVCDKVRHQAAMAA
                     FNQANGFAKRDSDPLAYNKVIETFGNDVCDEVRHQTAMAALGQANAIAKRDRDPRAYN
                     KVIEMFCDDVCPKIQANMRDARAVRIGWSVVAQQYSQAIKFADEYLVDYASDCVDGSV
                     VAFLAWLANRTQDNQLRYEKIVQGLGKQPTHWTFDEFAELIDSLPEEDKQYALQAIER
                     LERTYENEAELESA"
     CDS             590773..591255
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011030654.1"
                     /locus_tag="PA25_37250"
                     /product="N-acetyltransferase"
                     /protein_id="BBN83740.1"
                     /transl_table=11
                     /translation="MKTYYLEMQSKNNFIPSALSNNLSIIEVEALQPEFNQFLYSFVG
                     KPWDWTDKLTWPVEQWQSHLTDNHIRTWVAYVKGAIAGYYELSQQSEGNVEIAYFGLT
                     AQFIGHGYGKALLSHAIESAWAIDSTKRLWVHTCDLDHPSALQNYQSRGFEIYNIVSE
                     "
     CDS             591514..592104
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011263915.1"
                     /locus_tag="PA25_37260"
                     /product="amino acid transporter LysE"
                     /protein_id="BBN83741.1"
                     /transl_table=11
                     /translation="MQDALFSLLFMTLLLFGSPGPAPISLLASGANFGYRRNLPFLTG
                     ILVGLGLAMVLVNLGLSTLLETSPKFASGLSLLCVGYLVYLAYKLYIQDPRKQSNEQL
                     PGFKQGIILNIINPKAYASLITLFSQFSIGNVQQIEALMLTGLVCICFVAVIDAVWLL
                     IGAKLGRVVKSRRHIKRLNSICSLAILLVASVLISY"
     CDS             complement(592094..593293)
                     /codon_start=1
                     /gene="rsmB_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011962856.1"
                     /locus_tag="PA25_37270"
                     /product="RNA methyltransferase"
                     /protein_id="BBN83742.1"
                     /transl_table=11
                     /translation="MYAERQCVETQILALEQIIFTEQYADKVIERVLSEQPYWDQTKR
                     QIFVTDTYNIIRWWRKLVVALGCDEDTRPSMWLIWGAYQLLNAQTLPEWSEFAGVDID
                     QLNSNLNSATPAQLNSYPDWLWQRALNELGEQWDCIAQGLNVPAKTYLRTNTLKTNAP
                     TLVAELLQERIACEPLANSDTLEVTQYGPLFKSKAFTQGWFEMQDAGSQQIAPLLNVK
                     PGLRVVDACAGAGGKSLHIASLMQNKGYVLAMDIHQHKLEVLKKRAKRAGIHMLETRL
                     IKNSKTVKRLKDKFDRVLLDVPCSGTGVLRRNPDAKWQLANDNIENLITLQGEILQRY
                     SQMCKPGGRLVYATCSILPSENQLQVQAFLANNPEFKLAEELTLLPGINTDFDGFYGA
                     ALERVNN"
     CDS             complement(593848..595290)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005483021.1"
                     /locus_tag="PA25_37280"
                     /product="chitinase"
                     /protein_id="BBN83743.1"
                     /transl_table=11
                     /translation="MFKLTPMVVALNLAAISSVSAMTIEPDPQNPGGYLISKEELQDT
                     VAAKTSDPMYATWAKALETRSNTVVEAILPGRSDNPSNVKRVERVFPQAQWDFLTKMA
                     APEYTYTRFLRAIGKFPAFCGDYTDGRNADAICKKSIVTAFAHFAQETGGHIAKDNVS
                     DNPQRLEEWQQALVHVREMGWSEGQPGYTTGCGQNDWQNRRWPCADGQGYFGRGAKQL
                     SYHFNYGAFSEVMFDGDATVLLNNPGLVADSWLNLASAIWFFLTPQAPKPAMLHVIDR
                     TWQPSQREQDAGIGYGFGTTINVINGGIECGEQNKTKGQPVNRIRYWEGLAHYYNIPI
                     ETDEENTCWQQTPYGSLNLNGATDVLYTNWEGDWAYHADRPGGFSFECKLVGYQTAYS
                     ALVPGDYEKCVTNFYQSHASWPQVRVVDELTPPDDEPPVGGVAAWDANKVYLKGDQVS
                     YKNKIYEAKWWTKGNTPDSSQPWKFIRDAK"
     CDS             595571..596128
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37290"
                     /product="hypothetical protein"
                     /protein_id="BBN83744.1"
                     /transl_table=11
                     /translation="MVITQLLPEHYKAVVKLANQVHGDNYLDMPGIKKMVEQGTKFDI
                     NACFVALDEKGNLVGFRTSYAAQQWPIDKWCTPKAWPVLPSQMAYFKCIAIAPEAQGQ
                     GIGPKLLHASVVALRQQGALAGIAHLWKQSPGNGAVKYFTKAGGELIKVHNDRWLENC
                     INDGYVCTICATECHCQAAEMVLMF"
     CDS             596148..597488
                     /codon_start=1
                     /gene="tauD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011331272.1"
                     /locus_tag="PA25_37300"
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="BBN83745.1"
                     /transl_table=11
                     /translation="MSPNYYDPLTHKNCQASGYAPSYWASTIDLPLPCSAPKTNAHYD
                     VAIIGGGFSGLLTAYYLARHFNISCCVLEANQVGFGASARNAGFVLKGSGRLSYPQMA
                     KKWGMDVCKGIYDEFSEAVTRVESLITDHNIDCQPQAKGYLKIAHNHKAMQALKAQAS
                     FLKQLGTHDTQFLTTSELEQNYMYNHQAFGAMRMADGFGVNPLKLLLGYREIALKAGV
                     TLYENALVSKVDSTPHQHTLFVNDISISANNVVYAGNAYNNKQSHSLINNRYLPILSS
                     ILVTRPLTEEELSQTGIKTHQVTMDTRTLKYYYRLLPDKRILFGGRGAVFAKHQDSPV
                     YLNNLKNGLAESFPTLKNIDHDYYWNGFIAAALDDMPHICLQDNVGYILGYCGAGVSF
                     SAQAAFRMAQMLAKQTVPDLPLYQTPLPYLPFAKFRRFGQLAYYQYAQVKDKIG"
     CDS             597721..598914
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37310"
                     /product="hypothetical protein"
                     /protein_id="BBN83746.1"
                     /transl_table=11
                     /translation="MKHSALTLGVLLALPLLNSNSVLANDSHLATCDFTIPSSHYLVD
                     GAAMNIQPGNTICLAAGERGPLKLKNILGSADNPIIVRNADGVVTTKPYEYSIAVEQS
                     KWLRLTSVSPEPAQPYGIRLGGTLSIGQLSEQVEVDNIEVYRARFAGMLIKTDPNCDP
                     ATWAENFTMTGINIHHNYVHHTEEGEGMYVGYTGKSRKLECNGVATTVYPHKLENIRI
                     HNNKLEHTAADGIQLNSVTGNAQIYSNKIYRTGVSPFAPVWQNTGIQVGGDDVQVRDN
                     LIYRSGGNGMMLDGDNLQVINNKIIYAGENGIFARNSAQQNAQISGGLPHSYKDNLIV
                     QPATYGLKLYATNTASAHLISDNTIENDGRLDAANRPMTFSFLNDQVERVLLNNHHYI
                     ESTNN"
     CDS             complement(598960..599364)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37320"
                     /product="hypothetical protein"
                     /protein_id="BBN83747.1"
                     /transl_table=11
                     /translation="MDFKALFIMLMPLIAPYLSIKIFEVSSKKTLYRFVGYYNLWLYF
                     FVVDNYQYYSVSLVFIVACTSLLVILSLYAKESLVPNVREIALYLGVFSFLFFVALLK
                     GYQGLQWFSANIILMQFVFMAFGKLFNKRSES"
     CDS             complement(599409..600128)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37330"
                     /product="hypothetical protein"
                     /protein_id="BBN83748.1"
                     /transl_table=11
                     /translation="MTPLDDSGHLNIVCRYSCDIDRELRYIFSFYDTYFGQQQVFNFF
                     EGDELINSISLEDYLHTFYPNSQRTIDEGVQPLDMPLDCRYDPDYSCEQWVQSDFLDY
                     VINKKVEFTVTQEFIDGNNDARRIAISLVTANVVGKVAARVAAALRVLISSRLVESTT
                     ATMLNEVLTGTNWYRTDLQVGDTLVIKAGRLLEIRSGSSSGGGSDGGGGGWDGGRERQ
                     FICVTVWTNSGGGDVAQKVCY"
     CDS             complement(600765..600941)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37340"
                     /product="hypothetical protein"
                     /protein_id="BBN83749.1"
                     /transl_table=11
                     /translation="MIFECKRSAQLSPYVESFILQWISSRVSYLPQDEFDLLINESHL
                     NYPAYTQILSRLFG"
     CDS             complement(600978..602450)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011074292.1"
                     /locus_tag="PA25_37350"
                     /product="transcriptional regulator"
                     /protein_id="BBN83750.1"
                     /transl_table=11
                     /translation="MRKSHFLGTKIRNLRKRNHLTLEDLSARCIRVDAHSAPSVSYLS
                     MIERGKRTPSQEMLENLSEVFQKPVEWFLDSEPEAESITPDKGNHGGVLGMALEPNFL
                     FSNDILQIAIPEMLSQTGISGRQFAHLLIRAHQEHHQNHFPDLERAAEEVGHKNLYLS
                     SDDLITIAQQYDLQLRWFEQADELIFGGSGEASKHLLTSYFEAPNLVYLNTLLKNRES
                     RLKYDLAVHIGHAVLHNREGLHCRLTIGGSEHNEEAHHNTPNAQDILNAWRDFEASFF
                     AGALLCPKVPFRQLLDSHGYEISVHKLLNISPSVVMRRMTVVSPYPHWHYFDAYQPGK
                     LKAVYRGNGIPLPWGNMRTVQDPCQHWAVFRKFAEVSNQSSTQLSILLVEGKPRLYCC
                     ESIQVEDLAGNPHVLCAGIDLNPAIAAQGMNVDEVVMQLQALCIKHGGASVIPHQLKQ
                     QLMGVAKILNIAWVERSLSADVRVICVRGNACPRQPQCYS"
     CDS             602638..603111
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011074293.1"
                     /locus_tag="PA25_37360"
                     /product="malate synthase"
                     /protein_id="BBN83751.1"
                     /transl_table=11
                     /translation="MTALTRSSLKTQPITCEKLDIAKEYLDQHCPLDQGSHLHATHYV
                     VYYNHLMAFFADGSHCGLKFPKQFVALCGHRDDPTAILLKKDDQLHIELSFNRCGDSG
                     RLDRANVDDIQVETPLSTVSTGAEHKKFWMSFLSGVQDTTHHKQYTAKDGNDYSL"
     CDS             603385..604248
                     /codon_start=1
                     /gene="kynA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q81CK2"
                     /locus_tag="PA25_37370"
                     /product="tryptophan 2,3-dioxygenase"
                     /protein_id="BBN83752.1"
                     /transl_table=11
                     /translation="MSCPYHSDNKPSNYRAMEKDIHTDFKDDMSYGDYLNLEQILNAQ
                     NPLSDQHDEMLFIIIHQASELWLKLAGHELYEAIENIKTGNFGHAFKVISRVKQILSQ
                     LTQSWGILSTLTPVDYLKFRDALGHSSGFQSYGYRKIEFLLGNKNTELLKVHESNPAV
                     HQELSDILHKPSLYEEALKALKQQGLPIDDEVLNRDFSQPYEANQSVLDAWITVYRDA
                     DKYFHLYELAEKLVDIEDSFQQWRFKHMYTVQRIIGNKVGTGGSSGVEFLKKALDISF
                     FPELFELRTHL"
     CDS             604266..605453
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013228728.1"
                     /locus_tag="PA25_37380"
                     /product="kynureninase"
                     /protein_id="BBN83753.1"
                     /transl_table=11
                     /translation="MTLDLALQLQPHYSDFKVSERILLSGHSHQAWPNAAKNGLIECY
                     QDAATHVDDKWGKAFEKAQRVKNFYAKLLGEQNAQITLGASTHELLLRFLSDLECFKK
                     PPGRAIKIVTTDGEFHSMRRQLNRFKQLNMQIEVVSVSPSHTLAQRLVDKIDSQTDAV
                     MLSAVFYGSSEIFRDVGLVAQHAHQLNVPCLVDTYHALNVVPFDIKTWQLEHAFIVSG
                     GYKYCQAGEGNCMMRIPQGYNGSPIITGWYAEFSVLDQAPGQVSYGAGAHAFEGSTYD
                     PSSHYRAAAVFDFFEQQNLEINTLRTINQQQIAILRSGIESAPKLSHAFALASHKHED
                     NGGFLALTTPYASQWVSKLHEQGIQSDSRGEQLRLGPAPYVSAKQLEQALSIMEDIVS
                     DIV"
     CDS             complement(605507..605680)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37390"
                     /product="hypothetical protein"
                     /protein_id="BBN83754.1"
                     /transl_table=11
                     /translation="MIPISGIIDANVLLFEQLSYVELIGALLILTGLFIGVWGPKVRA
                     WRAAQKLNSLIER"
     CDS             complement(605677..607164)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011103517.1"
                     /locus_tag="PA25_37400"
                     /product="dipeptidase"
                     /protein_id="BBN83755.1"
                     /transl_table=11
                     /translation="MIRFVTLAAAMFAHVVYAKIADVSQATAEYAVNSYQQAQIHTLA
                     NMVSFPTVNEEGVATPDNPVFIGFKQLLKMKAAQLGLDYQDKGHTVLIGLGKQSQKVT
                     VVTHGDVQPADASKWQKSPFELDTTSEPGKLIARGTEDDKGPIATALYAMKAIKDKGV
                     ELNNRIELMIYLAEESDWEPLKAFMKTYEQPKYAITIDASYPVVVAEKGWSLIEPTFS
                     GSAEQTGVYVSELKGGAFKSQIPEDASLILHHASTELLDKLKARASNFSAKVQFIEQP
                     EGVKVLVKGISAHSSEPEAGVNAIAHLAALFSGVTLAPNSDGQAVMFMSELIGTDLHG
                     KHFGNIAYSHDFMGPMTVSPTLLSRQGDDLTLSINLRRPVGKTATQLESQIAQAITLW
                     QQAHNVTLAELEVELGEPMLLDSAPHAQKLLDIFKHYTQDQDAGFVSIGGGTNAKLFD
                     NAVSFGPSMPGKPYTGHSEHEFITVEQLKLNLRMYTAMMIELGNM"
     CDS             complement(607240..609114)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012640139.1"
                     /locus_tag="PA25_37410"
                     /product="Tat pathway signal protein"
                     /protein_id="BBN83756.1"
                     /transl_table=11
                     /translation="MRKASLVSLAVIFALAGCSSESNSTSSAAGSAVEVSNSVSAASV
                     DDVVEQYTQTFITHQPALATSLKLSAEQYGDYANRLPNYSLAGMQALQIDMNKAAEQL
                     KSLQSAQLSDDALLHVKVNEVLARYYAGHSQFSAGYIDTWGGHLPYIVNQLSGPLVDI
                     PNVLKDQHGVESKQDAQDYLARLDAFANMTEQVRSKVMADAKKGVILPKPLFANTLGY
                     LDNFTSPAATEHPLVSSFAQKLGDVADLSDKAKQDYVSQATAIVEQKIYPAFAKVTAD
                     MKTLEGQAPTKVGIWAQPNGEAFYQHAITYLADSDMSAEEIHNIGVQEVERITQRMDE
                     ILKANGYSEGSVGDRMKQLNEEERFLYEDSDEGREKLLTFLRGEIETINKKAPTLFST
                     LPPQKVEVKRIPKAVEAGAPGGYYNGPSLDGSRPGIFAINLKDMKAVPSFAMKTLTYH
                     EAVPGHHFQIALNMLQTDIGLMRQNASFNAYIEGWALYSELVAYEMGMYENDPFGDLG
                     RLQAEVYRAARLVVDTGLHHKRWTRQQAIEYFAQATGTAMSDVTAAIDRYIAWPGQAL
                     GYKLGMLKLVELRDKAKDALGDKFDIKAFHDLILLKGARPLAIVEDDVNRWIEQQKQA
                     "
     CDS             complement(609463..610578)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37420"
                     /product="hypothetical protein"
                     /protein_id="BBN83757.1"
                     /transl_table=11
                     /translation="MSANTLEKMLVIQKFKDGVAGIDGLDNPRSVKRSKDGKFVFVVS
                     GDDNALASFKVTSDGLLQPLGFLKSTPSKGIYLEGASSVVSFSQGTRIAVASFYDGAL
                     SIFELHNNATLKPSKSFSDHLPPNVVFKSKDSLSKIDRMGLLGAWEVIKSHDEKQLLV
                     ASYKSDSVIICNVGTNSIELSSQVKRLAAQPKSLGNPVSMALSSSGDRLFVAGFEGNT
                     MTIFNRHEDGTLTFFQQLENNPDLEKVLSNPQKVITSTDAKHFYVANAGSKSIAVFSY
                     ENDAYKHKHSVYAEELNGVGALLLSKNGQYVFAAAEHGHGILQFKVQKNGALSSPKYL
                     NTADNSITGVSSIEQLDEQRLLLTGAKADTLYLVQLP"
     CDS             complement(610835..611065)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37430"
                     /product="hypothetical protein"
                     /protein_id="BBN83758.1"
                     /transl_table=11
                     /translation="MKLSVQKKNLKKLSLDKHTISAGVTPKIAGGVLEPDTDRCHTDP
                     YFCGDYTKRCSGNTDYTTGPSVPSSKPMTCYC"
     CDS             complement(611295..611723)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37440"
                     /product="hypothetical protein"
                     /protein_id="BBN83759.1"
                     /transl_table=11
                     /translation="MKKLLVLCALTASSAVCANTPISFDEMKDIDVQDISQLQIDGKT
                     KVGDVLSGEAVSKGQIIIGDNGLSAYEATGEVLIQLASFADADEVAKAHGLTLKQAYK
                     SFYVVTASEQNLTAVIDNLKKDGTVVSANLGLKNLNTKIN"
     CDS             complement(611735..613540)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005480219.1"
                     /locus_tag="PA25_37450"
                     /product="peptidase S8"
                     /protein_id="BBN83760.1"
                     /transl_table=11
                     /translation="MNYKKKILAVSVLAATCAANANTTPEQDLIKRDPLTFQQWHLQN
                     TGQTGFSLSAGNEGEDLNLDFADRMGIKGRGITVSVIDTGVEISHPDLKNNVVPGSKN
                     LIDGSDYPVDTHGHGTAVAGLIAAEEGNNLGGRGVAPYANLIGFNYLDEQSIESWMLS
                     HGLNEDFRALDRFTDPRVFNQSYGITPSAPMNGDTSLDPVYALQQTVLQDITLNSHWG
                     RGSVYVKSAGNSFALYTTYINGERFYVLPFENNQILNNQGLPFHNANISNLNTTFWNL
                     VVSSLNAEGKLASYSSAGANVFLSAPGGEYGQDKPAMVTVDLTGCDKGMNVSGTHKNS
                     LHGGSELDPNCNFTGVMNGTSSAAPNTAGAVATVMSANPALSARTVRHLLATTARKVD
                     PQHEGVTLNFESASGETLSYDAIPAWQTNAAGYNYHNFYGLGAVNIDEAVYKALFTSV
                     SLPELQITDWQEKSANVTIPDADLSGAQSTMAVDENLTIEAVQLKVNIDHTRLRDLAI
                     ELTSPSGTRSVVMSARTGFLNGTDGGYTDTVMLSHHFYGEQSQGNWTIKVLDTDKGTS
                     RTLIYHPSRGFFGTNGNNNADLGVLKDWSLRIYGH"
     CDS             613789..613974
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005480281.1"
                     /locus_tag="PA25_37460"
                     /product="DUF2986 domain-containing protein"
                     /protein_id="BBN83761.1"
                     /transl_table=11
                     /translation="MGMGMNRKKKIYETLKKKDKRANAKLHKSNKPRYISKAERAAML
                     AQQQTEESVTLLQDTSE"
     CDS             complement(613977..614864)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37470"
                     /product="hypothetical protein"
                     /protein_id="BBN83762.1"
                     /transl_table=11
                     /translation="MKLTRTAIALSVFALGLSIYNILGEPNRSQAAYQPIQQQSNRVA
                     ENVTYEQVISQLSAQVLDLEARLRALESKDPTTMNSSFAQADFEQAVLEVIAQKQARD
                     KAEMLSKDPAYAFYENLPQDYELKLKTDPDYAMQVNKELHAKILDSSLSAQVRLSAMG
                     QLQMNMYVLNKTQMHHYNHEVVDAIMRIAQQNPDEALKVQALEVIVNTPLTDARVADS
                     FASIIEKEQNEYLRSMAADGLMLQYYQAKNKQPELQRRLAQQILSLYQQGDSKLQTLF
                     KNNLFSDDMLAELSAQAGN"
     CDS             615077..616777
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37480"
                     /product="hypothetical protein"
                     /protein_id="BBN83763.1"
                     /transl_table=11
                     /translation="MKKISSILVVLLPTLALAQPEVHYEQCKSSFNYLGADYQGTTNK
                     NNDGSQWCYLKNAQEGAYWGHVKVETIPQFKTKSGKTCRAPSSYQGEQFYGCSSRNHT
                     TPWCYTSESDWEECDVVEPAEMLSHTHPKASKRLDRVALGSCFKTKGDMPEALARLIT
                     QQPDLFLWLGDNIYADTTDMSLMRRKYNEKKQNQEYHAFLEAKIPVMATWDDHDFGRN
                     NDGKHYPERENAQKEYLRHFDVPQSDPRLNGRAGIYEAKMLGNAGEQTHVITLDARYF
                     RSPTFSNYGKCEGEQSTMLGDQQWQWLETELAKPSELKLIASGIQVLPPLYQGRSMSN
                     YCAYGQGEQFKAAIDALGEQDMSGTSYESWAEMPSERARLLRMVQKSINDGKTKAVIF
                     LSGDQHWGEILQKDIPAHNEYGKQTTVYEITASGFGQNWPYHIENALRLPIYADNKGD
                     GNYTKQCKLPFNYAGTTYQGCITRDHDKPWCYTELDENGKGIASKWGNCAPSGAKIPT
                     GYVGNISANINNLTTSNRHLINKSGSNYGMLDIDWQNRTIKMSIQTADEEAVSTVITF
                     "
     CDS             617104..617547
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q89D50"
                     /locus_tag="PA25_37490"
                     /product="alkyl hydroperoxide reductase AhpD"
                     /protein_id="BBN83764.1"
                     /transl_table=11
                     /translation="MTMRLNYIEAAPGAMDILLTQERYLKEQFAASKTLSLTILELIK
                     LRISQINQCAFCINMHTKEAIAQGEKPQRIISLNAWRDMPIYNTVERCALAWAEQQIQ
                     QVPITLQDVETALETFNEQDLVNLTVAVNAINSWNKFAKAFNPSI"
     CDS             617564..618412
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37500"
                     /product="hypothetical protein"
                     /protein_id="BBN83765.1"
                     /transl_table=11
                     /translation="MGTGLSFKIFKPKGRLSRYIQAIWFASINDQDPVHWHLNSDGCT
                     GLIFNLGEAICLDNTVLTMGVSTLPLSTKTTHIMLPARCRLVGVRFNPAVSHPSVDIT
                     KRQPTQLNLSAKQNELYKNIFHTLLALSKPQVHLVAIYRWLSDSLAIICPPPNALAYT
                     IQSINHKTALISQRQLERQFKQWLGITPKHFQRIIRVQKTLNTLKKKPFLSLAQVATM
                     NGFADQSHMTKELKQIALITPKQYRSIICDYAKLPNQAQLNSHTDSNNQRFTSIGYST
                     DPEIAN"
     CDS             618454..619083
                     /codon_start=1
                     /gene="nqO2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014207528.1"
                     /locus_tag="PA25_37510"
                     /product="NAD(P)H dehydrogenase"
                     /protein_id="BBN83766.1"
                     /transl_table=11
                     /translation="MNVHLIVAHPNPDSFNYALHKTALATLKNCNLLVSESDLYKDNF
                     DPVTSDKDTPNFPALEYYSVAKAQRWAQEHQGFEASIEREQAKLMACDLLILQFPLWW
                     WSFPAILKGWIDRVLTAGFAYGQGATLAPKKVMYSLTTGGASNEQERAYYQAKIDGLY
                     QDVFGFMGWQVLPPYIAHGVQKINDDARIELLDNYKQHLNCVLKQVSDT"
     CDS             complement(619194..619409)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015366962.1"
                     /locus_tag="PA25_37520"
                     /product="hypothetical protein"
                     /protein_id="BBN83767.1"
                     /transl_table=11
                     /translation="MYKFNVFGSEMSVFRKENEWQLFKESTTGIRARVYDVVIPQSLE
                     PGEIAQYLDDIFHEMASKKHPTVERLS"
     CDS             complement(619493..619696)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q74CX1"
                     /locus_tag="PA25_37530"
                     /product="tautomerase"
                     /protein_id="BBN83768.1"
                     /transl_table=11
                     /translation="MPYINVKITEEGVTNEQKQAIIKGCTQLMVDVLDKNPQTTFVII
                     EEVDTDNWGIGFEQVTALRQRTL"
     CDS             complement(619735..620109)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37540"
                     /product="hypothetical protein"
                     /protein_id="BBN83769.1"
                     /transl_table=11
                     /translation="MTHRQSEQSDLAVVISLVEKYFYGLHHGDTKLLSNLFHADVCLK
                     APNSRRNLQQWLADVSNRDTPAQLGHAFDYAILAIEIVKDQAMVKVQCPLFNFHYVDF
                     LGLLKEQGNWLIVNKMYTDISA"
     CDS             complement(620141..620755)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011090583.1"
                     /locus_tag="PA25_37550"
                     /product="glutathione S-transferase"
                     /protein_id="BBN83770.1"
                     /transl_table=11
                     /translation="MYTLYYSPRACSLAIQVVLRELGQNFELVDKKDVADFSAINPVG
                     NIPVLVDETKIMTEGVAILLYLLHKHSSPMLPVDPQGYQSAVQDMLFANATMHPAYSK
                     LFFIAQNVNDEQVKQDMLHAASARINQLWQVVESRLAQNAFLGGEQPSVADILLCVYS
                     HWGSFFAVDIVIGKHTRAMLSRIEAMDSFQRAIAAEQPHSSAAL"
     CDS             620921..621814
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529752.1"
                     /locus_tag="PA25_37560"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBN83771.1"
                     /transl_table=11
                     /translation="MDKLRAMRLFVRLADLGSFTQVAEQINSSKSMISKEISRLESEL
                     GVRLLHRSTRNVKLTDIGHGYLQRVREILHKVDEADIFAQDLQQNIKGKLKINAPMAL
                     GITDLATLFADFMQSNPDIELDIHLGDESIDLVEQGFDLGFRASSTPIDSNYVGRPLT
                     QFSYKVCASAEYLNRHPCINTATDLKTHNCFVYSYFQGKNVWPLEGGVAIGGSLKVNS
                     TVFMMESIKRGLGIGFIPDFVCQTDIEQGEIIELLPLATRPKLTLYALYPARHFVPPK
                     IIQCIDYLQQWFSNKSGTNTM"
     CDS             complement(621822..622070)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001890111.1"
                     /locus_tag="PA25_37570"
                     /product="TIGR03643 family protein"
                     /protein_id="BBN83772.1"
                     /transl_table=11
                     /translation="MDCSESKQSRIIEMAWEDRTPFEAIEQLYGLNESQVIVLMRRNL
                     KPSSFKLWRRRMNGRVTKHKKLRHPDIDRGYCPTQYKR"
     CDS             complement(622376..622537)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37580"
                     /product="hypothetical protein"
                     /protein_id="BBN83773.1"
                     /transl_table=11
                     /translation="MKVELRVKSKRLKELSQLDVMNVYGGLQITDNARGRGRGKPTVK
                     VTSHNSLRC"
     CDS             complement(623126..623641)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005477468.1"
                     /locus_tag="PA25_37590"
                     /product="N-acetyltransferase"
                     /protein_id="BBN83774.1"
                     /transl_table=11
                     /translation="MQAIISTERLVLRPFKQSDATRVAKLAGDKCISEMTKNIPYPYS
                     EVMAVQWIATHKAQFESGNSVVYAITRTQSDDVIGSLGFVEINEGVGTLGYWLGVDFW
                     GQGFALEAVKGLVHYYRNEKGLRGLEATHFAENTRSRTVIEKFGLQYVQDSKIEVRGE
                     QRAICMHRVQF"
     CDS             complement(623682..624149)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37600"
                     /product="hypothetical protein"
                     /protein_id="BBN83775.1"
                     /transl_table=11
                     /translation="MNMALVLAKDAHIAQLMAWFKNEPQLTEWAGPNFRYPFEPKSFK
                     ADLQTDRITSCALQSQQGLLLAFGQFYMRFGRCHLARLVVNPEQRGQGVANLLLNALC
                     KRGLQSLNAKQCGLFVYNDNHSAIHAYEKFGFVIHQSPEHELVEHCVYMVMSS"
     CDS             complement(624183..624773)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37610"
                     /product="hypothetical protein"
                     /protein_id="BBN83776.1"
                     /transl_table=11
                     /translation="MELIISLVLTTALLLGSPGPAPLALAGVGASFGFRRGVGFLAGI
                     LTGLLVVIILVAAGLGTLFTAYPSLKLLCQLTAGGYLLFVAYKIATAQGGVTSQADQA
                     PVFREGFVLNLINPKAYAAFLAIFANNMLQTQSPLLSAALTGAVCFLVAVVVDTLWMA
                     AGAKLRPLFAKPQQAKWLRILFACALAGSVVIALVD"
     CDS             complement(624859..626031)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014207520.1"
                     /locus_tag="PA25_37620"
                     /product="putative methylaconitate Delta-isomerase PrpF"
                     /protein_id="BBN83777.1"
                     /transl_table=11
                     /translation="MSFKPQIKVPATYIRGGTSKGVFFNLTDLPPEAQVAGPKRDALL
                     LRVIGSPDPYAKHTDGMGGATSSTSKTVILSKSTQVDHDVDYLFGQVAIDRPFIDWSG
                     NCGNLTAAVGSFAISNGLVDPSRIPQNGIAVVRIWQANIKKTIIAHVPMTNGEVQETG
                     DFELDGVTFPAAEVVVEFMNPADGEGAMFPSGNLVDKLEVPNIGQFDVTMITAGIPTL
                     FFNAADLGYTGTELQEAINGDDKALQRFETIRAYGALKMGLISSLEEAASRQHTPKIA
                     FVSGPQSYVASSGKHISNDDIDVCVRALSMGKLHHAMMGTAAVAIATAAAIPGTLVNL
                     AAGGGERESVTFGHPSGTLRVGAAAKLVEGQWQAEKAVMSRSARVLMEGHVRVPQD"
     CDS             complement(626095..628698)
                     /codon_start=1
                     /gene="acnD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EJW3"
                     /locus_tag="PA25_37630"
                     /product="2-methylcitrate dehydratase
                     (2-methyl-trans-aconitate forming)"
                     /protein_id="BBN83778.1"
                     /transl_table=11
                     /translation="MDVVMNTKYRKLLPNSQLSYYDTREAVDAIKPGAYDTLPYTSRV
                     LAENLVRRCESEQLDDCLTQIIERRRDLDFPWFPARVVCHDILGQTALVDLAGLRDAI
                     AAKGGDPSKVNPVVPTQLIVDHSLAVEHAGFESDAFEKNRAIEDRRNEDRFHFINWTK
                     TAFKNVDVIQPGNGIMHQINLEKMSPVIHARDGVAFPDTLVGTDSHTPHVDALGVIAV
                     GVGGLEAESVMLGRASYMRLPDIVGVELTGKAQPGITATDIVLAITEFLRAEKVVGAY
                     LEFYGEGAASLTLGDRATISNMTPEYGATAAMFYIDQQTIEYLKLTGRDDEQVRLVED
                     YAKHTGLWADSLETAQYERVLKFDLSSVGRNIAGPSNPHKRVATADLAKAGISGVVEN
                     EEGKMPDGAVIIAAITSCTNTSNPRNVIAAGLLARNANAKGLLRKPWVKTSLAPGSKA
                     VKMYLEEANLLPELEQLGFGVVGFACTTCNGMSGALDPKIQQELIDRDLYATAVLSGN
                     RNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIEKDVLGHDQDGHPITLKDLWPSD
                     EEIDAVIAQSVKPEQFRQVYEPMFDLTVDYGEHNNPLYDWREMSTYIRRPPYWEGALA
                     AERTMKGMRPLAVLGDNITTDHLSPSNAILASSAAGEYLAKMGLPEEDFNSYATHRGD
                     HLTAQRATFANPKLFNEMVRDENGEVKQGSLARLEPEGQETRMWEAIETYMERKQPLI
                     IVAGADYGQGSSRDWAAKGVRLAGVEVIAAEGFERIHRTNLIGMGVLPLEFKAGTTRN
                     TLNIDGTETFDVEGEPSPGATLTLVINRKNGERVEVPMTCRLDTAEEVSIYSAGGVLQ
                     RFAKDFLEAHA"
     CDS             complement(628763..629884)
                     /codon_start=1
                     /gene="prpC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EJW2"
                     /locus_tag="PA25_37640"
                     /product="2-methylcitrate synthase"
                     /protein_id="BBN83779.1"
                     /transl_table=11
                     /translation="MAKVLSGAGLRGQVAGKTALSTVGKSGSGLTYRGYDVKELAEHC
                     QFEEVAYLILKGHLPTQAELDSYKSELRAMRGLPLALKEVLERIPADAHPMDVLRTGC
                     SMLGNLEGETSFDLQGKVTDRMLACFPSIICYWYRFSHDGVRIDVETDDDSIGAHFLH
                     MLHGKKPNELHERVMHVSLILYAEHEFNASTFTARVCASTLSDMHSCVTGAIGSLRGP
                     LHGGANEAAMDMIESFTSADDAEEKMMGMLERKEKIMGFGHAIYSECDPRNEIIKLWS
                     EKLAKDVGDTVLYPVSVRCEEVMWREKKLFCNADFFHASAYNFMGIPTKLFTPIFVMS
                     RLTGWAAHVMEQRADNRIIRPSAEYTGEELRPVTPISQR"
     CDS             complement(629972..630862)
                     /codon_start=1
                     /gene="prpB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EJW1"
                     /locus_tag="PA25_37650"
                     /product="2-methylisocitrate lyase"
                     /protein_id="BBN83780.1"
                     /transl_table=11
                     /translation="MTGFTSAGKKFREALKANHPLQIVGTINAYSAIMAKKIGHQAIY
                     LSGGGVANASYGLPDLGMTSLNDVIADVQRITAACDLPLMVDIDTGWGGAFNIAKTIR
                     DMEKAGAAAVHMEDQVAQKRCGHRPNKEIVSIEEMVDRIKAAVDARTDPDFFIMARTD
                     AFAQEGLEAAIERAKAYVAAGADGIFAEAIQTQEHYRAFSEALDVPILANITEFGKTE
                     LWNKEELGQWGVDMVLYPLSAFRAMNKAAELVYQTILTDGDQKAVIDNMQTRMDLYDY
                     LGYHEYEQKLDSLFAQGKNK"
     CDS             complement(630874..631539)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005464619.1"
                     /locus_tag="PA25_37660"
                     /product="GntR family transcriptional regulator"
                     /protein_id="BBN83781.1"
                     /transl_table=11
                     /translation="MDFFQEQAVTSSDKAFFRLRKEIVEGVIPSGTKLSETELSTKYQ
                     VSRAVVREAINRLEACNIVERKANIGARVVSLSPEGLIELYQVRESLEGMAARLAAQH
                     MTAQEITELNALLNSQSDEVKNAELYYQEAGDLDFHYRIILGSKNSHLISMLVNGLYH
                     LVRMYRVQLGMAGPRVTSAFDEHRHIVQAISNRDPELAEMLMRRHITYSKNNIEAKLQ
                     NSL"
     CDS             631871..632731
                     /codon_start=1
                     /gene="oxyR_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010945934.1"
                     /locus_tag="PA25_37670"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBN83782.1"
                     /transl_table=11
                     /translation="MRPSFDDLAYFSEVANTLNLSRAAQRLGISQPSMSAAIKRLEQV
                     FDTQLLIRSRNGVKFTHAGKALAQHSRKFMTEWEQLHSNVIRASTDMIGTFSIGCHPS
                     VALYTLPDLLPALKNKYPALKLNLVHDLSRKITEQVVNGEIDFGLVINPVHHPDLVIH
                     KLFLDEVTLWQSDALTTHSAPNEHTILYCDPNLKQSQALLKILDLTHYQVEYSNNLEV
                     IASLVAKGIGAGVLPERVAKKCAEPLRRIEQNNAMVIDELCLIHRFDIQNSTVSQNLK
                     HEIKHVLAEP"
     CDS             complement(632733..633239)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37680"
                     /product="hypothetical protein"
                     /protein_id="BBN83783.1"
                     /transl_table=11
                     /translation="MQINAVSHTLKKMALPIIAGLMASPALASPSDWFDASSNFATLD
                     TSASQVQFGLQYPQMHGGNCGIGIALNGFNSQERYYKELLEYIDVKSIYLTDQGTYEL
                     TPASVSRSGILYAFNYYAQYYRTYVTISTKDGSSFGDVFKRLSAYNDIYAITSAVTCQ
                     QLDEIKRN"
     CDS             633540..634313
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010972156.1"
                     /locus_tag="PA25_37690"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BBN83784.1"
                     /transl_table=11
                     /translation="MGYPVVRFTQHAIFRLLYLLFFCSSIESVSASSLPTLTIVTELS
                     PPNQTFNNGKVEGTSTELVKLILQRAHLQAEYYIYPWARAFKVASKKPNTLIYSMAKT
                     PQRERNFHWIGPVARFELGFVTNKYRYDVVINSLEDAKKYRLAVQRGDIAAVELKKLG
                     FDYVLTADIERSYKLLITNKVDLVLDDPRYLQSMANTLNVPIDHFRFLYSVSALSVNG
                     YLAANIDTSTDIIKRLRVAFTNVERTQTYKNVILGSHTP"
     CDS             complement(634365..634574)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005375625.1"
                     /locus_tag="PA25_37700"
                     /product="cold-shock protein"
                     /protein_id="BBN83785.1"
                     /transl_table=11
                     /translation="MSNTVTGTVKWFNESKGFGFIAQENGPDVFAHFSAIKGDGFRTL
                     AEGQRVEFTLATGQKGPQAENITVI"
     CDS             635073..636152
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37710"
                     /product="hypothetical protein"
                     /protein_id="BBN83786.1"
                     /transl_table=11
                     /translation="MDKKKSGLEETAFFSQLMSNCSVLQLLKQVLMHSHHAIVITNAD
                     HTQGYPIVYANKVFCHHTGYELAELVGHSPRILQGPESNHKVIAKITPALKKNGYFYG
                     SSINYRKDGSVYPVEWNISEIKNEEGEVTHYISMQKDLTNLKRIAEQIKDTNELFKRF
                     YAIQAKKNEDKEELDRQVVETIKNNEKIYNANLRSQENETLFEDAFFDFSPDEMGALG
                     NKIEKSPISAIEFWQESPIDDDDVISLTESIKELDTEIGMAEALNNGVNYLNIANYMK
                     EIANNLYFCVEFNDGALMIDEVANTLHKLQDKEEQIPIEMLSMFNKDVAEWIDSVFIH
                     RNAENIFSGENNTVAAGNQLLSFIR"
     CDS             complement(636383..637210)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37720"
                     /product="hypothetical protein"
                     /protein_id="BBN83787.1"
                     /transl_table=11
                     /translation="MENNIKSLIKACDELGFEYQFIDVDHNFVRVKMNKGWQYFELNK
                     TPFNTEAAFCICKDKSHTYQLLKDIVRIPKTLDFLDFNVSSKYSQYKHCNSIAAALAA
                     IDDNLDYPIVMKQNKGALGTHVFLCNDALETESAFQEIFNHQSKDYDYVALAQEFIRT
                     KAEYRLLCAFGKPVFAYRRGSAAATFNVKYWESGEQAQLLTDVDLFTQLADFVEPIHN
                     EFPMGWVGYDIIVDEQDELYLIELNASPQFNNFIEHNSSTPVIELYKHALSELSKRV"
     CDS             complement(637342..637911)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E5C9"
                     /locus_tag="PA25_37730"
                     /product="elongation factor P-like protein"
                     /protein_id="BBN83788.1"
                     /transl_table=11
                     /translation="MPKASEIKKHAAIEYNNRVMIVRDIERSVPQGRAGGSLYRMRMY
                     DVVNGAKVDETFKADEMLNLADLVRRPVMFSYIDGDEYVFMDEEDYTPYSLNKSSIEE
                     QVLFVNEDTKGLLAVIVEGSPVSIDLPSSVELVIEETSPSIKGASASARTKPATLTTG
                     LVVQVPEHISTGDKIRINTDEKKFMGRAD"
     CDS             complement(638010..638168)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011262271.1"
                     /locus_tag="PA25_37740"
                     /product="Pmp3 family protein"
                     /protein_id="BBN83789.1"
                     /transl_table=11
                     /translation="MNKLVLIILAIIFPPIAVALNNGVGKDLAINILLSILFIVPGII
                     HAFWLILR"
     CDS             complement(638206..638400)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37750"
                     /product="hypothetical protein"
                     /protein_id="BBN83790.1"
                     /transl_table=11
                     /translation="MGVTSFHKLFGAFTVVDKATMLINHSMVIDSTLVTLLCNLLAID
                     VAKAFFWISLKLGKLIGSNA"
     CDS             638557..638973
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37760"
                     /product="hypothetical protein"
                     /protein_id="BBN83791.1"
                     /transl_table=11
                     /translation="MINVSVKTLSLYWLCMFICYVALTTFYSELSFSIESLLASVLVI
                     FIPHLVQRQNTKLVKEPLKHVVFKEGYLLIEQHKINVNRINRVALSKTPQCATFALPY
                     NYGNEGKLIDFNFPIGDYEPFKNYLSSHIPSVTFID"
     CDS             complement(639027..639740)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37770"
                     /product="hypothetical protein"
                     /protein_id="BBN83792.1"
                     /transl_table=11
                     /translation="MANKLQIPLLLLITLLGAISGASRADGMVVDKVYHPYVLPFERE
                     VEWRLLSRQTDEGNILAQRAGLGWAIAETVTVEGYMIGERDQLDNFDLAAYELEARWQ
                     MVEQGRYWADWGMLFELEKQHKTSAYEATIGVLFEKEFGRMSLTLNAFAVREWGSEIK
                     NEWESEFRAQLRYRFTPAFQPAIEIYCGEDFVGIGPAVIGLYRFKGQRQLKWEAGFVS
                     EISHFGKDHSFRLALEFEF"
     CDS             complement(639730..640497)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37780"
                     /product="hypothetical protein"
                     /protein_id="BBN83793.1"
                     /transl_table=11
                     /translation="MLLNSVIISINQFLPLALLWVLLHHSDFGQTRDKLPFLPTLLLC
                     VLACAVFLGFADTISQWFDYKGLEVFKILLLLGMYGCVLAVLYCGARVYKQIAIVLAS
                     VMYLSHFVMYVSSYWQLDTEQGIVIGTILGLGICLSFCTLLFFTLAWFKAHRAWTVVL
                     ALLSAHSASKVANAVDLAAQIDLLPSSEAVFDLRFLLDEYGITGRLLKALLGYEATPS
                     YANLVAFTSALALCTVMVIWRMRLIEQNTVKGGDHGQ"
     CDS             complement(640484..640819)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004530211.1"
                     /locus_tag="PA25_37790"
                     /product="hypothetical protein"
                     /protein_id="BBN83794.1"
                     /transl_table=11
                     /translation="MYFCMLFGMFTSVKAAATDSVTIVLKNHLFIPAQVEVPAGKKIR
                     LIIDNQDDTAEEFDSFDLNREKVLFPKRKSIIYIGPLSVGEYRFFGEFSPNTAQGVVI
                     VKEITDAAQ"
     CDS             complement(640831..642159)
                     /codon_start=1
                     /gene="qseC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014207509.1"
                     /locus_tag="PA25_37800"
                     /product="two-component system sensor histidine kinase
                     PmrB"
                     /protein_id="BBN83795.1"
                     /transl_table=11
                     /translation="MLNNVNAQKQKARLSISRRLTMILLSGVILTAFMALMNGYQRSM
                     DEAQKQLDIQLMNMANVLIVTPVRHWPEQSDLFAQLWQQQSQIYSAKLLKNLSISALE
                     QPGLATQNISGTRLRTFVLHKDDKRLMVAEPIHKRFMLSESLILSAMTPLVLAMPLLA
                     IFIAWYIRKALRPLRTLSNELKERQANDFTKLEIVSEDAEVAPVIERLNSLFAKVEKA
                     YLRERYFASDAAHELKTPISSLKINLHNLSDDIQHSSLKAMQQGIEQLNHIVEQMLTL
                     ARTEPDRWRTNFHPVDITELSQNVVAQLYERIDQKHIQISLDAQQYWLRGCEFTLNTL
                     FINLLSNAVKYTPNDGYVKLSITCLDCKILWAVEDSGPGMDDTQIARIFDRFYRVGGD
                     KHPSGEKGAGLGMAIVQQIAEIYGASVGFERSQLGGLKVKIEFPKEHTCE"
     CDS             complement(642149..642805)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004189255.1"
                     /locus_tag="PA25_37810"
                     /product="DNA-binding response regulator"
                     /protein_id="BBN83796.1"
                     /transl_table=11
                     /translation="MKLLLVEDDALLAQGLIHSLQKEGYSVEHVQTVSMAKSMLDNDE
                     IELVVLDLGLPDGDGLEVLKAIKKRRVALAVLILTARDSIEDKITGLDLGADDYLPKP
                     FEAKELFARLRVISRRLGSQTSSILQCQNVQLDLASHQTLVAGEPLILPRKEFMLLKA
                     LMENAGRVLSKTQLESKLYQWGEELGSNAIEVHIHHLRKKLPKDFIKTLRGIGYIVAK
                     "
     CDS             complement(642802..643455)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011706996.1"
                     /locus_tag="PA25_37820"
                     /product="hypothetical protein"
                     /protein_id="BBN83797.1"
                     /transl_table=11
                     /translation="MKKFKTVIVAALLVSTSGFANADFNQELSAIQKVWASVNYELQD
                     EAQEKAFEALVKDSQSLVANYPDKAESHIWHGIVQSSYAGAKGGLGALGLAKAAKAEL
                     EAAIEIDESALSGSALTSLGTLYSQVPGWPIGFGSDKKAQQLFDKALKINPTGLDVNY
                     FYGQFLYDEKHYKEALEHLKKAKNAPARLGREKADLYRQHEVDNLIAKVERKLKHKR"
     CDS             complement(643452..644255)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011706995.1"
                     /locus_tag="PA25_37830"
                     /product="short chain dehydrogenase"
                     /protein_id="BBN83798.1"
                     /transl_table=11
                     /translation="MDKQKLAVITGASGGIGAAIATQLSQAGWRCLLLGRDENKLQLL
                     QRALGEEHQYLALDLTQPVSGQRVTMHAMTLGGAALLVNCAGCNEMRSFQNEQLEQIQ
                     QQINVNLLVPMSLMHHLLPQLSSVKGTVVNVGSAFGYIGYPYQSVYCASKFGLRGFSE
                     ALSRELDGQVAVKYLAPRATDTRINPENVRALNRALGNKMDTPEEVAHNFMRLLNSKK
                     RRWVVGFPEKLFARVNGLLPELVDSAIIKQLKIIKSYISCQLNTKESSS"
     CDS             complement(644255..646408)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37840"
                     /product="hypothetical protein"
                     /protein_id="BBN83799.1"
                     /transl_table=11
                     /translation="MNALIQKLKDTPPEQIVFVDEQHHICAKQLILQVELLAEFINAQ
                     QVSCVAHNIANGLAWVAFDLALTLTRSAALPLPTFFSQTQCDFAIQKAGAQLFISQSE
                     LEAHIALDTLTVFEQKLWVYYLPKQDDVALFAGTQKITFTSGSTGQPKGVCLSLDSQL
                     AVAKSLCERINLSAPKHLCILPLGVLLENIAGVYAPMLSGGQVKVLPIEKLGFCGSQL
                     KDGEALLSAISHYQPNSLILVPELLKFLLLACEQGWQPPSSLAFIAVGGAHVSMSMLE
                     KAKIFGLPVFQGYGLSEASSVVCLNTKAQQDGSVGAPLDHIQIKTIESQLYIKGPIFL
                     GYLGEAAHPKEQWYATGDLVNVEEQTGTTTVTIIGRKKNQIINSFGRNIAPEWPESLL
                     QNASFPIQVVVCGEAKPYLCALIWAPENISNDLLSQHVEDINRLLPDYAQVARWHRLD
                     VPLSTQAGLLSANGRPKREAIAHFYAPQINALYSFEQEKPMTTFYDELQAQTQTEREY
                     LLSAPIIKDVFEGQITLGQYGSFLQQAYHHVKHTVPLLMACGSKLDESKEWLREAIGH
                     YIEEEMGHQEWILNDLAQCGFDKEAVRHSTPSFATELMVSYAYDSINRVNPLCFFGMV
                     NVLEGTSIALADQAAQSIGKQLNLPQKAFSYLTSHGALDIEHIDFFKGLMNKIDCQQE
                     RQLIIHSAQCFYRLYGDVFRSIEAQPSIDLTQEAS"
     CDS             complement(646405..647046)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37850"
                     /product="hypothetical protein"
                     /protein_id="BBN83800.1"
                     /transl_table=11
                     /translation="MGAMTIHDLKMPSSALHWAKYSQSGRLELEMQVKTGFAKAYAAN
                     LHEFYPLLSRLNTPQGYCVLGLRIAAESLFVEQYLEQPIETFLPQCTYRSEIAELGNL
                     YSTHRSATLGHFIVAAQALLSQHIRFLTFTGTVQVRKLMALCQVPICELTPAQPNKVA
                     SAKDYGSYYEADPKVCVVDLENVQQVINTTKLYSKLEEQYRNEVNELVLGLQS"
     CDS             647432..648049
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37860"
                     /product="hypothetical protein"
                     /protein_id="BBN83801.1"
                     /transl_table=11
                     /translation="MFNQNDAALAVRNFVRVANIVANLDTILQEAKNLSLTAKNARVV
                     ALRAGDSAFGFKPITNFIDEFSELTIKTTKNISLLSSNLFSIALSVVRHSDFQQRLSV
                     AAHVCQDSDIQQLQQQSHLEFMRTVKQLESAIIHLEGYFEDILKQMRSAEYIAVTSRV
                     EASNAGEFSESLQSVSNFIAGAAKNIKYAINQNLKEINLLRGTLR"
     CDS             648046..648780
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012870402.1"
                     /locus_tag="PA25_37870"
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="BBN83802.1"
                     /transl_table=11
                     /translation="MKSTEIYSSTTHSWVVMGRDPHKSEKIIDTNQYLIKSAEEAIIL
                     DPGGIELFSPMLACLLKHVKLEQITTLFASHQDPDIISSLGLWDKALPKATLHAPWLW
                     EGFIRHFGMDNIAYQPIKDEGGEIKIGKATLKFIPAHYLHSSGNFNVYDPKAKILMSG
                     DIGAALEKNEPPMFVEDFASHVKHMEYFHRRWMPSNRAKNNWVSRIRELDVEMMAPQH
                     GRIFKGEMVQEFLDWFAKLDVGSASE"
     CDS             complement(648954..649301)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011705537.1"
                     /locus_tag="PA25_37880"
                     /product="glyoxalase"
                     /protein_id="BBN83803.1"
                     /transl_table=11
                     /translation="MQDHINYVEFAANDLAATERFFSDVFSWQFEHYGPDYIAFNNSG
                     IDGGFYRSEQVSVSANGGALVVLYSNMLEQTLEKVQQAGGTISKDIFSFPGGRRFHFI
                     EPSGNELAVWTAC"
     CDS             649420..650613
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37890"
                     /product="hypothetical protein"
                     /protein_id="BBN83804.1"
                     /transl_table=11
                     /translation="MIKNVLRAVSILILLCFYSYSYASSCSEINEYPNWTRANWAGVY
                     DHATAGDKMHHEGVLYQANWWTNSTPGTTGAWQTLGVCEQSPPPKKGAYSRYGKLNVC
                     GTTLCDQNNQPVQLRGMSSHGLQWFGLDKCLTRESLKVLAQGWQADIIRLSLYVQEGG
                     FETTPQKFTDQVNQLISLASELDLYVLVDWHQLNPGDPNENLQLAKRFFNDIVQENSH
                     RENIIYDIANEPNGVNWQRIYDYALEVIPVIRQLDPDAVVLVGTHGWSTFGASDGGSY
                     LDVVNNPLQFNNIMYTFHFYAASHRDFHRNMLDKASDVLPVFVTEWGTQNYEGEGPND
                     FNSAQEYIDLMHRKNISWTNWNFSDDWRSGAVFKTGACQQGKFDDSQLKEAGHWVKQQ
                     IKLHR"
     CDS             complement(650693..651100)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001271117.1"
                     /locus_tag="PA25_37900"
                     /product="hypothetical protein"
                     /protein_id="BBN83805.1"
                     /transl_table=11
                     /translation="MSKYFVASTLLALSFSIQAEVAVIVNPSNGATLDKDAIAKIYLG
                     KAKSFSDGTKVNAVGLNSGGAVDAFTSNVLGKSSSQYKAYWSKLIFTGKGTPPETLDS
                     EQAVIEFVAANADAIGYVESAKVTGAVKVVGKF"
     CDS             complement(651110..652303)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001882133.1"
                     /locus_tag="PA25_37910"
                     /product="hypothetical protein"
                     /protein_id="BBN83806.1"
                     /transl_table=11
                     /translation="MKKRLIAMALICAFSGVSYASDLRINGFASIVAGKASDNNMAMF
                     GYEDEVSFSPESMFAVQVSSDLGDGISATAQIIARGSEDYDAKFEWAYVSYDINDNLR
                     LSAGKMRLPLFRYSDFLEVGFAYRWIRPPQSVYNFAFSTPTGISLLYTSQLGDWDSTT
                     QAVYGRFEGDFRAITGKDEGKLNDIGAINWTLSKDWLTLRASYVVAETTISLANSPSL
                     SGLSNALKTYNLQNDYNNLLINEDSGTFIGLGFAIDYNNFLFDGEYTEIEVDNSLLPE
                     QTQYYVSFGYRMNDWLVHLTYERNDDAHPDSRFNQVPEFITLANGNQVRVSIDPSNPN
                     SRLIKDAVNGALKATHNDTSTVTIGARYDFHPSAAFKVDWSRLDNDLSNQDNDVITVA
                     VDLVF"
     CDS             complement(652521..655031)
                     /codon_start=1
                     /gene="ybbP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072830.1"
                     /locus_tag="PA25_37920"
                     /product="ABC transporter permease"
                     /protein_id="BBN83807.1"
                     /transl_table=11
                     /translation="MWVKLAFKLFSREFRRGELTIIFAAIALAVLTVFSLSSVTQRIG
                     LNIEQKTSDFIAADRRLSSNHAFEPHILAKGSEYGLETAKMLYFDSMLFANDELVLGS
                     VKAVSPEYPLRGQVTLKDSLNSAPYEVRGAPEKGNIWLSEGLFYSLGLKVGDKVELGA
                     GLFHVEKVLVNEPDAPFFSLAGNRRVLLSYDDIEATKAVQPGSRVFHRLLFAGEEQQL
                     TDFYTWLKPNLKANQSWQGIKDRQSPLGDNLARAERFLLLAGLFGIMLAAVAMAVSAK
                     RYCERQYDPVAMMKTLGGSRRVIRNIYLLHLSLVTGFSIAVGLLIGFALQHVGAEYLA
                     KFMGAELPAAGARPWLLSVFIGVVCALMFSLKPLLDLFDIPPLRVLRRNLGDKLALSR
                     IHMSLSLVTIFLLMWMFSQQLLTTVILFGSTLLVIAVLFALSRLIFSAGRKLGLSPGS
                     SWSLAIATLQKRANANAIQLISFALAIKLMLFLVVLKNDLISDWQTQVPEDAPNMFLI
                     NIGQNEVQPLGEFFAQNNILHEDFFPVFNARVDAINGEELARRVSRQEGEEQGEGERE
                     GVNREPNLTWLTDLPDGNEITSGEWFDSNSGNEQIEVSVFEGWQERLGLKLGDTISFL
                     VNEQRFDAVVTSFRSVDWGTLKPNFVMILSPNMAGKIPVTYFSAAKLDETHTQAISRM
                     LQRYPTISMIDIKSRLEQAQSIIAQVSLAIGFVLGIVLVSGALVLVSQVQASLAERMQ
                     EVVILRTLGAKGRLIKLATLYEFLLLGATAGLVAALVSDVTLLVIQQQLFDVDGKMHP
                     YVWILGPATGAGFVAMIGYLMVANTMRQNTQGLLRKLS"
     CDS             complement(655021..655734)
                     /codon_start=1
                     /gene="ybbA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072831.1"
                     /locus_tag="PA25_37930"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBN83808.1"
                     /transl_table=11
                     /translation="MSVLSQLNIINVTGLTKSVNTLEGELTILSDINFSVKSGESVAI
                     VGASGSGKSTLLSLLAGLDVASDGDVSIDGEKLSELGEEARAQLRAKKVGFVFQSFML
                     VQSLTALENVMLPAELAGDSNAKQQALELLEKVGLSHRLDHYPSQLSGGEQQRVAIAR
                     AFIGSPKLLFADEPSANLDSKNGHLVEKLLFDLNKQNGTTLILVTHDEQLAKQCDRII
                     HIEAGRLETIRDGAAAYVG"
     CDS             655814..656365
                     /codon_start=1
                     /gene="tesA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_002348000.1"
                     /locus_tag="PA25_37940"
                     /product="multifunctional acyl-CoA thioesterase
                     I/protease I/lysophospholipase L1"
                     /protein_id="BBN83809.1"
                     /transl_table=11
                     /translation="MIIGDSLSAGYGVEQAQAWVNLLQNKYDANQKPIELINTAISGQ
                     TTDNALLKVDAWLNAHKPSHVLIELGGNDGIRGFPVKLLKKHLTELVTKSQQAGAHVA
                     LMEIHIPPNLGPRYTTMFTKSYEQVSNKTGAYLMPYFMIPIAVKPELMQEDNLHPNTD
                     AQPLIRDFMEKEIDVWLQKTQGN"
     CDS             complement(656456..656629)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37950"
                     /product="hypothetical protein"
                     /protein_id="BBN83810.1"
                     /transl_table=11
                     /translation="MSYEYNGSLIQIAQPVLSISVNKSNVIFADKTGSKNTRFSTASE
                     ARSFIRWLTQITA"
     CDS             complement(656957..657469)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37960"
                     /product="hypothetical protein"
                     /protein_id="BBN83811.1"
                     /transl_table=11
                     /translation="MHKKAVALVATVLLSACQSTSSQSVNTLIGEPTRLVVKISNVDS
                     EQGQLLVMVYDNSADYHADLNINDPQANFFAKKIVPPQNPFTPVVFDNLPAGRYAINV
                     IHDKDSDGELDRMVFPFLGMPSEPYALSNNIYNHFSKGDFDDALVEIRSPSHQIELSL
                     STHLSKVTGL"
     CDS             657615..657890
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003812024.1"
                     /locus_tag="PA25_37970"
                     /product="hypothetical protein"
                     /protein_id="BBN83812.1"
                     /transl_table=11
                     /translation="MSKPCISIHYCVLCQWLLRSGWLAQELLSTFSSELQQVSLVPAS
                     KGVFKIFYDDELIWCRESDGGFPEAKILKRRVRDKLDPSRNLGHIDS"
     CDS             658063..658554
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_37980"
                     /product="hypothetical protein"
                     /protein_id="BBN83813.1"
                     /transl_table=11
                     /translation="MKFSFSHFEFDCESLVLTNNGKVFSLNEKPAKLLALLLMESERI
                     HSKDEILEAVWPGRTVTNQVVFQSIGHLRALFGDDAIKTFSRKGYQWQLPLTLVTENS
                     TPTEAPTTQLDEVSEQVDTLTPPSTEEPVAEISKSVAKNKAILPITVAAALVLIAAVY
                     FLV"
     CDS             658775..659314
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011706500.1"
                     /locus_tag="PA25_37990"
                     /product="isochorismatase"
                     /protein_id="BBN83814.1"
                     /transl_table=11
                     /translation="MLRAENCGLLVIDIQGKLAKTVAHSKDLIAQTQALILGCKALEI
                     PVIWLEQTPDKLGATTPEIAQLLQPGKAITKTTFSGYANSAFVQRLTNENKQHWILCG
                     IEAHICVYQTACDLLSQNLGIVLIEDAISSRNLAHKTLALTKLQQLGAQISNVEMCLY
                     ELLRDSQHPKFKTILNLIK"
     CDS             complement(659355..660170)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001219484.1"
                     /locus_tag="PA25_38000"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BBN83815.1"
                     /transl_table=11
                     /translation="MNISVTKAVIFCSLKLVIWVLYTSAFSNVYAQPQHRVTILVDES
                     YPPYTYVNNGEPAGIYVDLVKQAARLMDDKYIIELHPVPWKRGVAALEHGDAFALMPP
                     YKHIKRRPFIWPYSVPLLEEVVVAFCNTGISLANIETKDTTVNPINVGLNAGYMILDD
                     VLDQASKQGKIKLWENKDTYSNVIKLAKKRIDCYVNDRLSTLLGLRNVKRLHPELELS
                     TIVEDRVVLRRTAHIGYVKDSLNKYPFKHDFIQKMDEALQAVLDSQAVELANE"
     CDS             complement(660257..662140)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005462077.1"
                     /locus_tag="PA25_38010"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BBN83816.1"
                     /transl_table=11
                     /translation="MQIRTKFSVTSAIVILLIISVTTISTYWFVSDSVRAKTQAYVSD
                     SAQLLAISIDNWLTIKANQVNVIRSQLEQEFSVDKFNEKINTPFLKREFLLTFGTLAN
                     ESQLRSNDPNRQNPPNVDFRQRGWYQLGKNEQKTVFTSPYADAATGELLLSVVSPINA
                     NGKLQGVIGGDLSLDVIAKSVNAVNFDNTGYAFLVGGDGKIITHQNPQFNGEDIDSID
                     ANLSISQVGQLNEVNTKEGTKLFYLHKLANQYGTDWYLAILIDKSLAYETLFDITLNS
                     FIIAVIAVALGVVCVRALALHLLKPLKDLEQAITEIASGGGDLTQCLNIVNEDECGVV
                     AQQFNLFLASLRRLVASVKERADEVVSSSDSAKQLSSDSMKKLDEQVMLIDSLATAMH
                     QMSTTSTEIAGNAQQAASSITQVNDKTLEGQHVFLQAKEHITALAQDIDQSHVLSTQL
                     AEYSQSIENILSVINGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLASKTQE
                     STTEIKSMIDQIQASSSQVQQSMGSSRDKTQLCVEQTEHATDMLNEITESVKELMDRN
                     IQIATAIEQQSVVIEEINKNTNHINDISVEVGSFADKQYCASDKLAEHAHEQEALLSK
                     FTV"
     CDS             662317..663396
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_38020"
                     /product="hypothetical protein"
                     /protein_id="BBN83817.1"
                     /transl_table=11
                     /translation="MADIEALEAQLAELKARFLAQSSNTTSATSTSRSEPASLKPQQT
                     KKPPVSDETTQVDAYATIRPTFGLIDNQAQSNWDVRDALSHAGFKVSHEFKPGWSAQL
                     HGEWGIDLANEGNFGKSRRAYTAISTPYGRFGIGKQRPAQYLFIAEYVDIFNHSSSPF
                     AYDPESIFFVDNLLSYRFDSGPLTFVAVGQFDGSKGDKQTDLFNAGLSYDADGLHAAL
                     TYQQNDIYDSTEQLGQNRIWAGSLAYQFTKRLYGALSYQGKDYERNQNTLSRNGHTFD
                     LSFAYQLAKHYKLKTGIFEFDDGYASTDPNNHSFDGYNITLEWLPTRPLRVHLEYLNK
                     SFEHQDDMQSISVGFRYDYKQQWQY"
     CDS             663484..664626
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_38030"
                     /product="hypothetical protein"
                     /protein_id="BBN83818.1"
                     /transl_table=11
                     /translation="MGSCIHVKVLLLLTLSNFKAIANEQSVSWAEIQALQNKITQLKQ
                     HLNMQHKSPTTVQTAILEKQRSQQPTQDHTILFSYATIRPTFGVQNKHAGSHWYVRDS
                     LSYVGFKAIHPFAKKWSAQLHGEWRFDTANNNSIVSARRAYTAITSPFGRVAIGKQRS
                     IAYQFIADYIEMFNYSSNPLTYPPDTDFFIDNLLTYRYQQEPFTLIAGAKFNGAGNDN
                     QSDLVNIGVSYDNNDLHTGISFLSKEHYSKAQWLGQDNVWVGTFVYKFNPRLYGALFY
                     QAKHYQRYLETTDRNGFTLDLSLSYQLAKQYKLKTRAIAFDNDFPYSDIRNQAYTGYA
                     LTLEWQPSPPLRVHIEYLNKDFDNQPDINALAVGLRYDFRHRLEVK"
     CDS             complement(664651..664809)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_38040"
                     /product="hypothetical protein"
                     /protein_id="BBN83819.1"
                     /transl_table=11
                     /translation="MRFWRKQQSSLTGSGLGLAIVKEVVEQHQAHLEVIGRNEYGGAT
                     FKVHFAAQ"
     CDS             665012..666124
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_38050"
                     /product="hypothetical protein"
                     /protein_id="BBN83820.1"
                     /transl_table=11
                     /translation="MKILSVDDNPQNRAVLEKALSKQYEITSSDGSEPILALMETHQP
                     QVVLMDIMLGTDYTGYDLVKEIRANSAYNNCEIIFISALTSSEDKLNAYGSGGDDYIA
                     KPVDFQELREKLRRVELRQSERDGLKDMYEMASNTAFTSMQQASELGELVTFFTDNLE
                     VTDLEILFGNIKQYYANAGVKCCVEFRVANEYYQYPKETISDLEREILELGRSAKRIV
                     PFGSNLLFNSHACSMLVKGIHFNDDEVIGRLRDNFAILLTIVDSRIDFIEEQIEKRSI
                     RQKAINSLKNQLTDDFSTIKSLCLSQDEQISKLVNDLSQAVQLKIITLGLDEEQESEL
                     MGLVDETKEVVAETLGLSFVLEDKLKSITERLKAVE"
     CDS             666213..667268
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071150.1"
                     /locus_tag="PA25_38060"
                     /product="two-component system response regulator"
                     /protein_id="BBN83821.1"
                     /transl_table=11
                     /translation="MKEIRNNSVILAIDDNPTNLKLLDRLLSAKGYKHIHLLSDSRDA
                     VSTYLDLQPDLILLDINMPHLDGFEVMDALFALEQTLVPPIVVISAQQCLESTLKALQ
                     KGARDYVTKPFEKNELLMRVQNLLDAHLAHKMLNDQAQVLEKMVDLRTKELHDTRLSV
                     VQRLGMAAEYKDEETGNHILRMSHMCMLLARKLGWSDYQCELLLHASPMHDIGKIGIP
                     DSVLLKPGPLDPEQWEVMKKHAQIGGELLSGDTSDLMIMAKNIALCHHEKWDGSGYPS
                     GLKNEQIPIEGRIAAIADVFDALTSVRPYKDAWQADKAIGYIQEQSGRHFEPRLVEIF
                     VNNIEEIINIKNQFQDQ"
     CDS             667333..670011
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_38070"
                     /product="hypothetical protein"
                     /protein_id="BBN83822.1"
                     /transl_table=11
                     /translation="MYIEQNLLHKLTLLKEQLAEQENVALELINRVYKLIDERCDDQR
                     GSGIYPESYLSYELVNHLSDYTQQPNEHNTAKLKTSIEDICHILSQNHMFSNSMRVEV
                     MEQTNRVLNEKILIVDSLHNEGTKLVGILETSGFDCHILKDIQRLSGYLHANQDTEMP
                     IMVIFKWNSPLEEQAIINSISEIKRMLPHDTLLLLMSKPIDMQFRLKALRAGVDRYIR
                     IPNHEVYITSIVNSLSDAKKGAPYKVLIVDDSKSFLHLYTDLLTEHEFEVYAFDNPLK
                     VLEQLHSLEPDVIILDYHMPNIIGPELSTILREQPQFVDVPIVFISSDTDYTAQLYAL
                     KTGADDFLLKPVEQEHFCGSILVRARRHRLKKALKENLQKEVYERDKEHLAINSHAIV
                     SITDHRGDIIYVNDYFCRISGYTREELMGQNHRLIKSDLHDDSFYKDIWRTIKSGQVW
                     RGDICNKQKSGGLYWVNSTITPMIGKDGRPYQYVSIRTDITTNKMLQQALQAMVISTS
                     TTIGTEFFEETTMGLTIATGATTSFIAVPSEKPGMLKTISLAHQGEVIDNYEYELRAT
                     PCEKIKNGGVCFYKEKAYLSFPEDEWLVQQKIEAYIAVPLATIGGDILGYIGLMSSNK
                     LYNCEYIKSLLAVFADRVSLEMVRLKNEEKLIQAKDEADRANQAKSEFLSNMSHELRT
                     PLNAILGFGQLLESSENLCTDDAEDVTEILKASRHLLNLINEILDLSKVEAGKFKVDN
                     RQHDISKTLNECIKLIESDCAKKGLTLNVAGIESVSAICDPLRLKQVLINVLSNAVKY
                     NRDYGSITISTEQTSTHCTISVCDTGQGIRQSDIEKLFEPFNRLGAERSETEGTGIGL
                     TLTQKLMKLMNGELLVESKYGLGSTFTIQLPKRAVQ"
     CDS             670047..673115
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_38080"
                     /product="hypothetical protein"
                     /protein_id="BBN83823.1"
                     /transl_table=11
                     /translation="MKWFESIPYPYVIAVISSTLLCTLFIVVQNSPLAQTSEPSTKEA
                     QISLIQKELNHFKQLVAAQHSDPKHTFIIWQTARTEQTQSKVTEYLLPQELLINAYEQ
                     PPKEPIVNEPIQLDYLTELTHLTPHIHQTKQHLVGTLNFCNLQAQCYYYLQVRRIPLP
                     QASGSHLIYVGNWLLITISLILLIIAYLKFRMRNLKKAVSKHFDKPPGFSLISVRDDI
                     FHITESIINNKKSTNKTNTTTQESSQMDDLSAQLQSQFSRLSAVINTVIDGIITIDSS
                     GIVETFNPAAERIFGYKAEQVIGQNVKMLMPDPYQGEHDSYINNYLTTGDAKVIGSGR
                     EVLGQKADGALFPMELSISEMSVDGQRMFTGIVRDISDIAEQKSLLNDQVSRIKAIIE
                     TVIDGIIAINEKGIIDSFNPAAEKIFGYKESEVIGKNIKMLMPAPYQQEHDQYLVNYI
                     TSGEKKVIGSGREVLGKRKDGSVFSMSLAVSEMNVNGQRMFTGIVRDISDIVEQKSLL
                     NDQVARIKAIIETVIDGIITINEKGIVDSFNPAAEKIFGYKEGEVIGHNIKMLMPSPY
                     QQEHDQYLVNYMTTGIKKVIGSGREVLGRRKDGSVFSMSLAVSEMLVGDKKMFTGIVR
                     DITEQKKYETALTQYRLDLEEQVQQRTSELEAATIQAQSANRAKSKFLSRMSHELRTP
                     LNAIIGFTQLLEEEDLTDNQADSLKEISTAGKDLTLMVNEILQIASIETGDVSLSIEE
                     VLLNESLQDSISQLLPAANRKHISISFDEKHQYYVKGDYSKLKQVITNIIDNAIRYSD
                     ENAQITIKLDKMHDCIHTRIKDTGKGISSDRLKNIFEPFERGVDEYSAEQGIGIGLTI
                     AKEFIEAMNGEISINSIEGEGTTVTFTIPLAREEVPNENDVHTVLYIEDNATNRKLMT
                     RLIKRFENINYHEAIDGLSGVAAAKKLTPSLILLDINLPDISGYEVFEKLKQDECTKN
                     IAIVGISANAMATDKEKAKDLGFSDYITKPIELNELTTLFSSLFDKQPKH"
     CDS             complement(673219..675027)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005478447.1"
                     /locus_tag="PA25_38090"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBN83824.1"
                     /transl_table=11
                     /translation="MSEPESLYTTNERDTNLVDVSNSEGIKSLRPIAAFVKPYKVMVI
                     LALIALIVTAAVTLSLGQGVKLVIDSGFVASSKPQLNTAAMTMLALIMLLAIGTFFRF
                     YLMSWLGERVVADLRRAVLEKIVFLHPNYFEENRSGEITSRLTTDTSLLQSIIGSSFS
                     MALRSSLTLLGGLIMLFVTNLKLSLIVIAFVPLVLFPMFAFGKKVRKLASSSQDAIAD
                     IGTYAGEIIQNIKVVQSYTQEQAECKAFNKEVESAFVVAKARIKHRALLIAIAIFVIF
                     SAITVMLWVGGSDVIAGQITAGELAAFVFYAVMVAMSVATIAEVYSELQRAAGAAQRL
                     LQLLDIKSDLHSAVSCQKLDIAKGISIDIKQLSFSYPSRPSQLALNKVNLTINQGEVV
                     AVVGPSGAGKSTLFEMLQRFYDPQSGAILINDIDIRALSLKQLRGLMGLVPQNPVLFS
                     ADVMHNIRYGNPCASDEEVKNAAKKAHAHEFIEALPDGYQSFLGEQGVRLSGGQKQRI
                     AIARAILKDPSILLLDEATSALDSESEYHVQAALIELMKSRTTLIIAHRLSTVKHADN
                     IIVMDNGKVVNQGDHQSLIKSDPLYQRLCQLQFELD"
     CDS             complement(675304..676554)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003094037.1"
                     /locus_tag="PA25_38100"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BBN83825.1"
                     /transl_table=11
                     /translation="MKITQLRNRIVTYFVGSTLLTSILFGLSSFFIAYNVEDEFFYDL
                     LKDEVKVVQAQISQGQSPKPRLNFVRYIHKQEQLPASVLTLLREEPNRREFSGENGQH
                     FHLLSLHGQQGYLLAEVSEHLVVRKFTEGMVYFLLIIFAFACLIAIVMGFASYKISKR
                     LLKPLDDIMEILTNAPVDKLPQGFASNFNNDEIGAFAKTLESALARIRAFINREQLFT
                     RDVSHELRTPVTISQGALTLLKQTELNKQQTSLVQRIDLAQQQIEQSLSILLALARED
                     TLVRGQSRLLLAIEQSVIQQYEHLADKDIKLAINVDAQVEVPIAQASLLILLNNLLGN
                     AFKYTTKGKISISYRDNTLCIEDTGQGIGNDQQMQVFEAGVKGENSQGLGLGLNIVKR
                     LCEKLELHYQLSSSGSGTRVEITF"
     CDS             complement(676561..677265)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003094039.1"
                     /locus_tag="PA25_38110"
                     /product="DNA-binding response regulator"
                     /protein_id="BBN83826.1"
                     /transl_table=11
                     /translation="MPTSPIKVLLVEDQQNISRNVAEYFESKGAVVDFAFNGEQGLSL
                     ALSNYYDCIVLDLMLPKMDGLQVCMQVRKHADRHIPVIMLTARDTLDDKLQGFEQGAD
                     DYLTKPFALEELWVRCMALSQRHTLNTSHTLTVGDIALNKQTHHVVRADKEVVLQPIP
                     FKILRVLMESHPRAISRSELCEKIWGDEPTDSDALRSHIYQLRKAIDKPFSAPVIKTL
                     HGVGFALDATVSESKG"
     CDS             677403..678077
                     /codon_start=1
                     /gene="ybbA_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /