LOCUS       AP021846             3887303 bp    DNA     circular BCT 12-OCT-2019
DEFINITION  Pseudoalteromonas sp. A25 DNA, chromosome 1, nearly complete
            genome.
ACCESSION   AP021846
VERSION     AP021846.1
DBLINK      BioProject:PRJDB8578
            Sequence Read Archive:DRR187481
            BioSample:SAMD00180048
KEYWORDS    .
SOURCE      Pseudoalteromonas sp. A25
  ORGANISM  Pseudoalteromonas sp. A25
            Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
            Pseudoalteromonadaceae; Pseudoalteromonas.
REFERENCE   1  (bases 1 to 3887303)
  AUTHORS   Kitaguchi,H., Mitsutani,A. and Fujii,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2019) to the DDBJ/EMBL/GenBank databases.
            Contact:Hirotaka Kitaguchi
            Fukuyama University, Marine Bio-Science; Sanzo 985, Fukuyama,
            Hiroshima 729-0292, Japan
REFERENCE   2
  AUTHORS   Kitaguchi,H., Masu,N., Mitsutani,A. and Fujii,K.
  TITLE     Draft genome sequence of Pseudoalteromonas sp. strain A25, a
            bacterium with algicidal activity against diatoms
  JOURNAL   Unpublished (2019)
COMMENT     Annotated at DFAST https://dfast.nig.ac.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Unicycler v. 0.4.7
            Genome Coverage       :: 70x
            Sequencing Technology :: Illumina NextSeq500; Oxford Nanopore
                                     GridION
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3887303
                     /chromosome="1"
                     /collection_date="1994-07-12"
                     /country="Japan:Kyushu District, Ariake Sea"
                     /db_xref="taxon:116092"
                     /isolation_source="coastal seawater"
                     /mol_type="genomic DNA"
                     /organism="Pseudoalteromonas sp. A25"
                     /strain="A25"
     CDS             1..1401
                     /codon_start=1
                     /gene="dnaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8Z2N6"
                     /locus_tag="PA25_00010"
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="BBN80016.1"
                     /transl_table=11
                     /translation="MYLSVWQSCLYVLQDELPSQQFSMWVRPLQAESTEDTLTIYAPN
                     RFVLDWVREKYLNRINELLIEICGNEAPELRFDVGSKPILDQAVTQERSSQQSTNMQS
                     GNQAPAAPKLPAGNEKVEPAPKSAYKPNIKENYTFDNFVEGKSNQLAKAAATQVADNP
                     GSAFNPVFIYGGTGLGKTHLLHAVGNGILDKKPDAKIVYMHSERFVQDMVKALQNNAI
                     EEFKRYYRSVDALMIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEIEG
                     VEDRLKSRFGWGLTIAIEPPELETRVAILMKKAQQSNINLPHEVAFFIAKKLRSNVRE
                     LEGALNRVIANANFTGRPISIDFVKEALRDLLALQDKLVTIDNIQRTVAEYYRIRVSD
                     LLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKVKALRDES
                     HEVKEDYQNLIRTLSS"
     CDS             1416..2519
                     /codon_start=1
                     /gene="dnaN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEE7"
                     /locus_tag="PA25_00020"
                     /product="DNA polymerase III subunit beta"
                     /protein_id="BBN80017.1"
                     /transl_table=11
                     /translation="MQITISREQFLKPLMQVSGAIERKHTLPILSNVLLEIKDGTLAM
                     TGTDLEIELVASISLEQPSADAKVTLPAKKLLDICKSLPDGSELKLESQEHQLLITSG
                     KSRFSLTTLAAEDFPNLEQWDGEVEFQCSRLELRKLLESTHFSMANQDVRYYLNGMSF
                     EVDNNEIKTVATDGHRLAIAQKTLNASVNTQRQLIIPRKGVQEIMRLLPADDESITIQ
                     FGANHVRLIDAEFTFTSKLVDGRFPDYRRVLPRGGDKLVHANREWLRSAFQRVSILSN
                     EKFRGVRLNLSSGFLKISANNPEQEQAEEVVEVGYQGDDLEIGFNVSYVLDVLNTLKT
                     EDVQFTLLDSNSSALIEGVGDEEATYVVMPMRL"
     CDS             2521..3609
                     /codon_start=1
                     /gene="recF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8Z2N4"
                     /locus_tag="PA25_00030"
                     /product="DNA replication and repair protein RecF"
                     /protein_id="BBN80018.1"
                     /transl_table=11
                     /translation="MSLTHLSLGDFRNIEALAFEPSPDINIIHGANGSGKTSLLEAIY
                     FLSHGKSFRTNKPKILIRHEQARCVVHAKKQIHNLSIPVGISKDQAGETKLKIQGQSS
                     RRMSELAQLIPVQVITPESYELFFGGPKERRKFLDLGVFHVEHAFFSAWRDFNKILKQ
                     RNALLKSKPSNYTEQVQYWDKEFVNLAEQINNHRKAYISRFEALFFDKIADQIPIFSG
                     LELRYDAGWKNCLATQLKEQFERDVKLGYTSKGPHKADFSFFSQGHGVENILSRGQLK
                     LLLYALKVSQNSLIESETDKQSILLIDDLPSELGEETMQSVSALLAKCQSQLFITAIT
                     AESISAVVEPMQRACSMFHVKHGSLITK"
     CDS             3622..6045
                     /codon_start=1
                     /gene="gyrB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EKS9"
                     /locus_tag="PA25_00040"
                     /product="DNA gyrase subunit B"
                     /protein_id="BBN80019.1"
                     /transl_table=11
                     /translation="MSENYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
                     DNSIDEALAGHCDDIFVTIHTDGSVSVRDNGRGIPTSIHEEEGVSAAEVIMTVLHAGG
                     KFDDNSYKVSGGLHGVGVSVVNALSEKLQLTIRREGKVHQQKYTMGVPDAPLAEIGES
                     DTTGTELRFWPSGETFSDINFHYDILAKRLRELSFLNSGVSIILNDEREDNKQDHFKY
                     EGGIQAFVEYLNRKKTPVHQSVFHFTSEREDGISVEVSMQWNDGFQENIYCFTNNIPQ
                     RDGGTHLAGFRAALTRTLNTYMEKEGFNKKAKTTSNATGDDAREGLTAVVSVKVPDPK
                     FSSQTKDKLVSSEVKSAVEQAMAEKLTEFLLEHPADAKTVVGKIIDAARAREAARKAR
                     EMTRRKGAMDLAGLPGKLADCQERDPALSELYIVEGDSAGGSAKQGRNRKNQAILPLK
                     GKILNVEKARFDKMLSSQEVATLITALGCGIGRDEYDPEKLRYHRIIIMTDADVDGSH
                     IRTLLLTFFYRQMPEIIERGYVYIAQPPLYKVKKGKQEQYIKDDAALTVYLTSLALNG
                     AALYPSEGAAAIEGEALAEIVNDYQNTVKIIERLNRKYPASVTNRLIYQAELTESDLS
                     DQAKVKAWTESLVADLVDCDEDATIFSSEVSFDDERNMYYPVVKIRQHGVDKAYTLDY
                     NFITSKDYVRIAQTGKNISKILGKDGYMQRGEKTYPVDNFVDALEWLIGESKRGLYTQ
                     RYKGLGEMNPSQLWETTMDPSARRMLRVTIEDAIAADQLFATLMGDQVEPRREFIETN
                     ALRVVNLDV"
     CDS             6223..7122
                     /codon_start=1
                     /gene="glyQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EKS5"
                     /locus_tag="PA25_00050"
                     /product="glycine--tRNA ligase alpha subunit"
                     /protein_id="BBN80020.1"
                     /transl_table=11
                     /translation="MQKYDVKTFQGLILALQDYWAQQGCVIAQPLDMEVGAGTFHPLT
                     FLKSIGPEPMSSAYVQPCRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSL
                     AAMGIDTLTHEVRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECAPVT
                     GEITYGLERLAMYIQGVDSIYDLVWTDGPMGKVTYGDVFHQNEVEQSTYNFEHADVDA
                     LFAQFDQCEKESEKLIAAGLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRA
                     LSKACAQAYYDAREALGFPLCKD"
     CDS             7125..9194
                     /codon_start=1
                     /gene="glyS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E8Y5"
                     /locus_tag="PA25_00060"
                     /product="glycine--tRNA ligase beta subunit"
                     /protein_id="BBN80021.1"
                     /transl_table=11
                     /translation="MLTDNLLVEIGTEELPPKALRKLAEAFRDNMAGELAALELGYQA
                     IDWYASPRRLGLKVTALETQQQDKIVEKRGPATKAAFDADGNPTKAAQGWARGCGIDV
                     SEAQTLETDKGAWLMHRATVKGQQTVELLADAITKALAKLPIPKPMRWGAYKTQFIRP
                     VHTVAVLLGSTQVQGEVLGKQISNELQGHRFHHPERVTVKHADEVFDVLKAAYVIADY
                     QARKEMIRAQIEAAANAVNAQVAMDEDLLEEVTSLVEWPVTLTASFEESFLDVPAEAL
                     IYTMKDDQKYFPLLDSNGQLINKFLFVSNIESKDPSVVISGNEKVVRPRLADAQFFFE
                     TDKKKTLESRLASLDSVLFQKQLGTLKDKSERISALAGYIAAQVGADKVLAERAGLLS
                     KTDLMTEMVMEFTDVQGVMGMHYARIDGEAEEVALAQNEQYMPRFAGDDLPSNPISYA
                     VALADKFDTLVGIFGIGQAPKGDKDPFALRRAAIGALRIMVEKELALDINDVVAKSRE
                     LFGDKLSNDNVAEDVLEFMLGRFRAWYQDEGISVDVIQAVLVRRPTAPVDFDRRVKAV
                     SHFRSLPQAEALAAANKRVNNILAKNNVTSDAQVNSALLGEDAEKVLAEQVAALTTEL
                     APIYEQGDYQQALTRLASLREAVDTFFDNVMVMADDEAVKQNRLALLSQLSRLFLNTA
                     DISVLQN"
     CDS             9325..9768
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00070"
                     /product="hypothetical protein"
                     /protein_id="BBN80022.1"
                     /transl_table=11
                     /translation="MKKLTLVVLSLLLAACSSQINSPDSHVSSQSVVDVFDRTMYLRG
                     DFTLWDAEPHYILKPRTAGVYSVKAKFMSPGKVYEFKIADEQWSKGYNCGYKVQGNLK
                     LGQPQLADCNTIYNYFSFVPNKKGWYIITFDYSDSQSPTVTVNKA"
     CDS             complement(9785..10024)
                     /codon_start=1
                     /gene="tusA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EKS1"
                     /locus_tag="PA25_00080"
                     /product="sulfurtransferase TusA"
                     /protein_id="BBN80023.1"
                     /transl_table=11
                     /translation="MPFSKADHTLDAMGLRCPEPVMMIRGMVRKMNDGETLLIIADDP
                     STTRDIPSFCEFMDHTLLAKEVEQAPFRYVLKKGR"
     CDS             complement(10211..11392)
                     /codon_start=1
                     /gene="fadA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87TP0"
                     /locus_tag="PA25_00090"
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="BBN80024.1"
                     /transl_table=11
                     /translation="MSAMQQAVIVDCLRTPMGRSKNGVFKNRRAEDLSAHLMKGLLDR
                     NPSVDPASIDDIYWGCVQQTLEQGFNVARNAALLAGIPHSVPAVTVNRLCGSSMQALH
                     DAARAIMTGAGDTYLIGGVEHMGHVPMTHGVDFHPGLSTSIAQAAGVMGLTAEYLATL
                     HGISREQQDEFAYRSHQRAHAATVEGRFAKEILPMEGHDENGVPVLVEHDEVIRPETT
                     VEGLSQLRPVFNPASGTVTAGTSSALSDGASAMLVMSESKAKELGLPIRARIKSMAVA
                     GCDPSIMGYGPVPASKKALQQAGISIDDIDVAELNEAFAAQSLPVLKDLGLLEVADEK
                     VNLNGGAIALGHPLGCSGSRISTTLINLMEEKNAKYGLATMCIGLGQGIATVFERVDL
                     D"
     CDS             complement(11394..13556)
                     /codon_start=1
                     /gene="fadB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEL1"
                     /locus_tag="PA25_00100"
                     /product="fatty acid oxidation complex subunit alpha"
                     /protein_id="BBN80025.1"
                     /transl_table=11
                     /translation="MLYKSESFVVDFCKGKIAEFKFCMPGSVNKLSQQTLKECAIAFK
                     ELSQRDDIDAMVFTSDKDHFIIGADIFEFLPTFQRPEEELVGWIKDATDVFDAIEDLP
                     FPTASAIHGLALGGGCEWLLATDYRLASNSAKIGLPEVKLGIMPGFGGTVRLPRLIGA
                     DNAMTWITTGKENRAGEALKVGAVDGVVAPDKLLEGAISVLEQAVAGKLDWRAKRQVK
                     LEPLKMNRVEQGMSFAMAEGMVMGKTKGHYPAPVMAVKTIQAAANATRAEAMAIENAN
                     FAKLAKTKEAAAQTGIFLADQYIKGVAKKQAKASSVEIKQAAVLGAGIMGGGIAYQSA
                     YKGTPIVMKDINQDALDLGMNEAATILGKKVQRGHMAMDKMVATLGKIKPTLEDRDLD
                     HADIVVEAVVEHPKVKQTVLAGLEAQLPEGTILTSNTSTIRIDELASALKHPEHFCGM
                     HFFNPVPKMPLVEIIRGEKTSEATINAVVDYALKLGKSPIVVNDCPGFFVNRVLFPYF
                     AGFSQLVVEGADFSKVDKVMENVFGWPMGPAYLLDVVGIDTANHCTGVMADGFPERMA
                     RQEKDPVAVLAQAERFGQKNKVGFYQYAPDRKGRLKKSKDAASVELLSSICEPSKEFD
                     KQTIIERCMVPMLNEVLLCLQEGIVASAQEADMALIYGIGFPPFRGGAFRYLDQIGLA
                     NFVAMADKYAHLGAIYQVSEQTRAWANEGKVFYSVEGQ"
     CDS             13828..15714
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003113975.1"
                     /locus_tag="PA25_00110"
                     /product="lytic transglycosylase"
                     /protein_id="BBN80026.1"
                     /transl_table=11
                     /translation="MKSWILQVAATGLAAMSWFSFASSDHEAFKQAERIAWSGNYSAF
                     TQALNQLDHPLKPYVEMAFYERHPRLKYEQKIAHFLMVYESTPLEWPVRESWLKYLKR
                     RGKKALFIDYYQPSSDVELQCTYLQYQLDLGAPKNAILDQVSDLWVVGQSQPRACNSI
                     FEQWQQAGYLTDERVWARITKAAQGGQVSLLRYLKTLLPKNEAYLADLYTTVRRDPSA
                     SAGLYRYKTRSEKEAQIAVYGVRRLIWRDPKLALKAWDKLQTMFNFTEQQTDSVAYRF
                     ALALASKGHPEAKFWLNKVKPQKQDAKLRQWMMSNMLKEQDWSGIAALFTGMKDLSHG
                     QTYWLAYSYAQRGELDKANQLWQQIAGERDYYGFLAAGRLGLDISLNQKSLNVPPSLV
                     AKVSEAPGFKRAKALYELERYTSARREWNYLTNTSSVAEKLAASILAAELDWYDSTIY
                     TLAQIQAWDYVDLRFPMAFEKYFSRYSKRNHVDMAWSIAIARRESSFAPDARSHANAY
                     GLMQLLPSTARYISKQRVSKRNLLQPATNIRLGTDYLEYLKKKNHGNEMLATASYNAG
                     YHRIKRWLPDEAMPAELWIELIPYRETRDYVKNVFAYRQVYHTRLGREGNIVAQLLDM
                     QIGG"
     CDS             15834..17156
                     /codon_start=1
                     /gene="pepQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EKR8"
                     /locus_tag="PA25_00120"
                     /product="Xaa-Pro dipeptidase"
                     /protein_id="BBN80027.1"
                     /transl_table=11
                     /translation="MEQLAHYYAEHIATLQQRTKTIIEQEGLEGLVIHSGQAKRQFLD
                     DMYYPFKVNPQFKAWLPVIDNPHCWIVVNGTDKPKLIFYRPVDFWHKVPDEPNDFWAD
                     YFDIDLLVQPDQVEKFLPYDKANFAYIGEYLEVAQALGFTNVNPEPVMNYFHYHRAYK
                     TQYELSCLREANRLAVLGHKAARDMFYAGGSEFAIQQAYLNATEHMENDTPYGNIVAL
                     NENCAILHYTHFERKAPQHHRSFLIDAGANFNGYASDITRTYDFAQQGEFAELVKVMN
                     DHQIQLGKALSPGKLYGELHIDCHARVAQVLSDFDIVKLPAQDIVAKGITSTFFPHGL
                     GHHLGLQVHDMGGFMADESGTHQAPPEGHPFLRCTRKIEAKQVFTIEPGLYFIDSLLG
                     DLAQTEHKKYINWDKVEQFKPYGGIRIEDNIIVHEDRLENMTRDLDLD"
     CDS             17222..17836
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704168.1"
                     /locus_tag="PA25_00130"
                     /product="YigZ family protein"
                     /protein_id="BBN80028.1"
                     /transl_table=11
                     /translation="MSEYHIPSGSLSYHEEIKKSTFIVHLAHTPSINDAKAFIKQINE
                     QYPDARHNCWAHVAGQPGGSHVYGFSDDGEPNGTAGKPMLNVLIGSGLGEVTAVTTRY
                     FGGIKLGTGGLVRAYGGTLNNALAQLQTSLKIPSVQLVGDSDYALQGIIEQYLNSHFT
                     VLNIDKLYGAHIQWQIDIDHRQAQQAKQEILDLTHGVVELKIKA"
     CDS             17885..19336
                     /codon_start=1
                     /gene="trkH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E8X4"
                     /locus_tag="PA25_00140"
                     /product="Trk system potassium uptake protein"
                     /protein_id="BBN80029.1"
                     /transl_table=11
                     /translation="MQFRTIIKILGQLVALFSITMVPPALVSLIYKDGGGVPFVLAFV
                     FSIVIGLIAYYPNRKERGDLKAREGFLIVVLFWLVLGFFASVPLIFLQSPNLSLADAV
                     FEAFSGLTTTGATVLTGIEYLPKSVLFYRQQLQWLGGMGIIVLAVAVLPMLGVGGMQL
                     YRAETPGPVKDSKMTPRIADTAKHLWYIYVSLTLACTASYKLAGMGWFDAICHAFSTI
                     AIGGFSTYDASMGHFDSPVINIICVVFLLIAGINFSLHYAAVSSRNVRTYLRDPEFKV
                     FLLIQLALVVICFAVLSSNQVYSNGDETLDQAMFQAVSISTTAGFATDNFSAWPLFLP
                     ILLIFSSFIGGCAGSTGGGMKVVRVFLLYLQGVRELNRLVHPRAIYSIKLGRKALPDK
                     VVEAVWGFFSAYALVFVIIMIALLGTGLDNITAFSATAACLNNLGPGLGQVAAHYGDI
                     SDAAKWILTLAMVFGRLEIFTLLVLFTPTFWRG"
     CDS             19469..20149
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00150"
                     /product="hypothetical protein"
                     /protein_id="BBN80030.1"
                     /transl_table=11
                     /translation="MLKSKSSTGFQKIELITVGNLVDLEILMPTSSKRVKTEFIGYLA
                     GQYIIINYPEQKQLGRAATFIQEGATVIVRAVADHSDGQIIAFKTDIKAVTYTPTKLI
                     FLYPPKKIQSQGLRNQVRIPTLLPAMLMTKRSNCEGVIKDISRTGLLFSLSGDLVDLP
                     VHDKSCHIVITGKDKQQISLQGEVCSTTHQEDITLLGIKLIADEGKVDEILQQCLIDL
                     SVLHKSGR"
     CDS             complement(20146..21522)
                     /codon_start=1
                     /gene="trkA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704263.1"
                     /locus_tag="PA25_00160"
                     /product="Trk system potassium transport protein TrkA"
                     /protein_id="BBN80031.1"
                     /transl_table=11
                     /translation="MKIIILGAGQVGGTLAENLVGEQNEITVVDIDGDRLRELQDKYD
                     LQGVTGHSAHPDVLRQAGAEDADMIIAVTSSDEVNMIACQVAYSIFNTPTKIARIRSE
                     QYLKYKEKLFQNDDLPVDHYIAPEQLVTKYIRRLIDYPGALQVLQFADGMLSLVAVKA
                     YYGGLLVGYALSALKEHIPNVDTRVAAIYRQGKAIKPLGTTVIEADDEIFFIAATKHI
                     RAVMNELQKLERSYKKIMIAGGGNIGAGLARSLERNHSVKLIERNQQRATQLSEMLDN
                     TVVFCGDASDQELLSEEHIEQVDVFIAVTNDDEANIMAAMLAKRMGAQKTMVLIQRGA
                     YVDLVQGGEIDIAISPQQATISALLTHVRRGDIVNVYSLRKGAAEAIEAVAHGDENTS
                     KVVGRTIAEIKLPAGTTIGAIVRNDEVLIAHDDTTILSGDHVIMFLIDKRQISVVEKL
                     FQVSALFV"
     CDS             complement(21532..22818)
                     /codon_start=1
                     /gene="rsmB_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KVU5"
                     /locus_tag="PA25_00170"
                     /product="ribosomal RNA small subunit methyltransferase B"
                     /protein_id="BBN80032.1"
                     /transl_table=11
                     /translation="MANVRALAAETLFQVVDKGQSLSTQLPYAAKQLNPKDKALLQQI
                     CYGVLRHLPTLEHYCQQLLDQPLKGKRRVFQFLLYVGMYQLQYMRTPEHAAVAETVNA
                     LQSMRAPGLKGLVNAILRTFQRQFTELQDSANRIPVCQYNHPGWFIKKVQAAYPDKWQ
                     DILEANQEQAPMWLRVNRTHYSVDEYSELLDEAGIAHCLEPRFEDGIVLDKPCDVYNL
                     PGFREGACSVQDAAAQLAARYLAPQDGERILDACAAPGGKTCHILELANAHVDALDAD
                     SERLLRVEDNLKRLALQANCIHADASTPNDWWIGQLYDRILLDVPCSATGVIRRHPDI
                     KWLRRNSDIDDLAQLQKQILNNIWPLLKPGGTLLYATCSVLPTENQEQVAAFLQSTHD
                     AMHQPLHDNDTPSTPGLQLLPGISDGFYYAKITKQQ"
     CDS             complement(22818..23762)
                     /codon_start=1
                     /gene="fmt"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E1Q7"
                     /locus_tag="PA25_00180"
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="BBN80033.1"
                     /transl_table=11
                     /translation="MTKPLRIVFAGTPDFAARHLSALINSHHEVVAVYSTPDRPAGRG
                     KKLKASEVKMLALEHSLPVYQPESLKTPEAQAELAALNADVMVVVAYGVLLPKAILET
                     PKMGCLNVHGSILPRWRGAAPIQRALWAGDEQTGVTIMQMDEGLDTGDMLHIATCPIS
                     AQDTSASLYDKLALLGPVALLDTLEQLSHGTAVATKQDDAQANYAKKLRKEEADIDWQ
                     MSAKQIALNVRAFNPWPVCFTQMQSQTVKIWQAEVLDSQGIPGTVLSSDKEGIVIACG
                     EQALKITQLQPQGKKPMSAQDFLNGRADWVTPGSKVGH"
     CDS             complement(23812..24318)
                     /codon_start=1
                     /gene="def1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KVU3"
                     /locus_tag="PA25_00190"
                     /product="peptide deformylase 1"
                     /protein_id="BBN80034.1"
                     /transl_table=11
                     /translation="MAKLEVLRFPDERLRTVAQPVAEVNDEVRQIVKDMLETMYDENG
                     IGLAATQVNIHQRIVVIDVSEERNEPLVLINPEIVRKEGSTTSEEGCLSVPHSWAKVD
                     RAEEITVKALNEKGEQYSYDADGLLAICTQHELDHLMGKLFIDYLSPLKRQRIRKKLE
                     KEAKFAAR"
     CDS             24438..25562
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704267.1"
                     /locus_tag="PA25_00200"
                     /product="peptidoglycan-binding protein"
                     /protein_id="BBN80035.1"
                     /transl_table=11
                     /translation="MKHSFTALIMATCLALPVFAQDTITVKGDAPVQYTVKEGDTLWD
                     ISKLYLSSPWQWQTLWQQNPQLSDPHLIYPGDVLSLQFDKQGVPILTLDKGVKKLTPQ
                     ARIAVQKSTAIPTLPMSLIQPLISFEQALSEQDLTSHPYILGANYNVKLATQGHTVYV
                     KGDLERYTHYGIYNIGGAYRDLKSNEILAHEVRLVGTARVLDEGDLSQGQPAKVKVES
                     AKQEIRPRDILMPLSKGHSFSVQFNMLRPAHDIQGSIIASENKLREFGATAVVILNIG
                     KEQQLKEGHILDINKRSPTVIEGTKGPRYVEDANSLEKFTKSVRELFGTENSDISVVW
                     TMPEEKVGELMVFKVYDKVSYALVTNAMQPIRVGDSVTVN"
     CDS             25589..26680
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010948297.1"
                     /locus_tag="PA25_00210"
                     /product="DNA protecting protein DprA"
                     /protein_id="BBN80036.1"
                     /transl_table=11
                     /translation="MGNVSILQCLALHVCKGLGVATIKALQAKCDLSSLFELSLKDLK
                     QLGLSDTLAQQLHHIDWPYLRRVAAQCTQLDIEIISYFDTRYPPLLKEIASAPLLLFC
                     KGNTQLLSQPQIAIVGSRNATATGLQIASDFAYQLNQVGLIVTSGLARGIDGAAHKGA
                     LAHSGATIAVLGTGVDIVYPRRHNILYQQVFERGLLVSEFLPGCGPQANHFPRRNRII
                     SGLSLGVVLVEAEIKSGSLITARFALEQNREVFAVPGSIKNPLSQGCHYLLKQGAKLT
                     ECAEDIIEDVSFLSQNGLYSIESVMKNDSPQEDCPVLQNLGFEVTSIDTLTQRTQWPV
                     ERVAARLLDLELEDKVERVLDGYIKLARG"
     CDS             26683..27156
                     /codon_start=1
                     /gene="smg"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EKQ5"
                     /locus_tag="PA25_00220"
                     /product="protein Smg"
                     /protein_id="BBN80037.1"
                     /transl_table=11
                     /translation="MFDILMYLFENYIHSEADIFVEQNELTDELLRAGFNQEEIYKAL
                     DWLEQLADLQHSDEIPYLNSKADSAIRIYTEQECQMLDVECRGFLMFVEQVGVIDSIT
                     REMVIDRLFALEKSIIGLEDLKWVILMVLFNVPGKEQAYAQMEDLIFDEPSGYLH"
     CDS             27236..27811
                     /codon_start=1
                     /gene="yrdD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070452.1"
                     /locus_tag="PA25_00230"
                     /product="hypothetical protein"
                     /protein_id="BBN80038.1"
                     /transl_table=11
                     /translation="MSKIDHSLFDANRHALEKEYEVCPDCGSELVMKHSKNGPFLGCA
                     SYPTCHYIRPLTQHDNHDIKVLDDSPCPECGEPLVIRNGRYGMFIGCTGYPQCHYIAH
                     DEQDNEVEQTVDCPKCQKGVLTKRKNKYGKFFYSCDRYPQCKYSLNQQPVAHSCPKCG
                     WAVMMQKQRAGKAVLQCPQKACQHKIESDCE"
     CDS             27804..28373
                     /codon_start=1
                     /gene="tsaC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEX6"
                     /locus_tag="PA25_00240"
                     /product="threonylcarbamoyl-AMP synthase"
                     /protein_id="BBN80039.1"
                     /transl_table=11
                     /translation="MSNSPNNLEEACQALSAGGVICYPTEAVFGLGCDPDNQEAVNKI
                     LTIKQRKVSKGLILLADNYGQCLPYVDDAKIPMDKRTALFSSWPSAVTWLLPAKASTP
                     KWLTGEHDTIAVRVTAHPQCKALTRLFGKPLVSTSANLSGEQPVMSLDEARRIFNELV
                     DCYVHGELGGNAAPSQIKHALSGAVIRGN"
     CDS             28382..29296
                     /codon_start=1
                     /gene="hemF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEX7"
                     /locus_tag="PA25_00250"
                     /product="oxygen-dependent coproporphyrinogen-III oxidase"
                     /protein_id="BBN80040.1"
                     /transl_table=11
                     /translation="MSKVNLETVKSFLLSLQDSICAGLEQADGQAKFVEDAWQREEGG
                     GGRTRVIRDGAVIEQGGVNYSHVYGESMPASATAHRPELAGRSFHACGVSLVIHPKNP
                     YIPTSHANVRFFIAEKEGEEPIWWFGGGFDLTPFYPELDDVKHWHKVAKNLCLPFGEQ
                     VYDDYKKWCDDYFFLKHRGETRGVGGLFFDDLNQWGFEKSFAFMQAVGNGFLDAYLPI
                     IERRKDTEYTEHERQFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLARW
                     EYNFTPAKESPEAKLYDFYLKPQDWLAL"
     CDS             complement(29351..30958)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001088888.1"
                     /locus_tag="PA25_00260"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BBN80041.1"
                     /transl_table=11
                     /translation="MRVTSIQHKIYALLAVTGILVLVASILSSSSQQQQLAQDTVAEN
                     IRLLADNYFDSINTMMLTGTMANREILSQKLRAHPNIEDAHIIRGSKVVKMYGAGNTN
                     QSPNGDAEHQALNGKESLFIETRDDSRIMTYLRPMIAQADYKGTNCLGCHQAQEGDVL
                     GVVRISYSLDDIDSSVQANTWLSTALLTGIFVVTFVILGTLFRKLFITRLKTLGRTMR
                     LASQNKDLSLRIDDNIDDELGRLASNYNKMMASFKDNIGQVSHTSKVLIQSAETIYTS
                     ADTTERAIQQQKQGTDSVAAAINELESSSSEVKNTTHFASEKSDSSNHLAEESMAVAE
                     RTEQSINQLAKDVRLAATQVSQLQAQTLEVGKVLEVISSIAEQTNLLALNAAIEAARA
                     GEAGRGFAVVADEVRTLATRTHDSTDEIRRTIDKLQSEAEQTVKAMSASCEEADDRAT
                     QVKQVAQALKNISNQMHEINDLNVQIADATEQQNLAAEEINQSVIAIRDNAEQSLVDA
                     HGSKQVSEELLSLARSLDEQVRSFKLD"
     CDS             complement(31053..31559)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070455.1"
                     /locus_tag="PA25_00270"
                     /product="globin"
                     /protein_id="BBN80042.1"
                     /transl_table=11
                     /translation="MGDQKPHICPRTRPEVIKFMKQLIKRIFNKDARQEKTNGSPTPE
                     KTPYEIIGGESGTRALANRFYDIMASDPYAKPLYDMHPQPLDRIRQVFFEFLSGWLGG
                     PDLFVGQYGHPRLRQRHMPFPIDQSLRDQWMHCMNKALDMEIDNPLLREGLRQSLSQL
                     ASHMINQD"
     CDS             31529..32350
                     /codon_start=1
                     /gene="aroE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E1R6"
                     /locus_tag="PA25_00280"
                     /product="shikimate dehydrogenase (NADP(+))"
                     /protein_id="BBN80043.1"
                     /transl_table=11
                     /translation="MDKYAVFGHPIKHSKSPKIHQAFARQYDEQISYEAILAPLEGFK
                     ESVNTFFASGGKGANVTLPFKEEAFRLADKLTERAKLAGAVNTLKRIETGELLGDNTD
                     GAGLVADLLRQGACLENAQILLLGAGGAARGCIFPLLQAGVSCVVIANRTQSKAQTLA
                     QEFSQFGKVVDCGLDNISNVDFSIVINSTSSSVTGDIPNIDPIHIQKCVFAYDMFYSD
                     QPTSFLNWVATYNSSAQLVDGLGMLIGQAAEAYSVWRGKYPDVTKVINAFKQGSL"
     CDS             32351..32593
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005421512.1"
                     /locus_tag="PA25_00290"
                     /product="transcriptional regulator"
                     /protein_id="BBN80044.1"
                     /transl_table=11
                     /translation="MNQSILFNDDIYVDAQTKELRFSAMVNGMMVLCRIITPLTDIEE
                     ALDHFKAKQFDYEMLAEQLIEDEDFQSDGSILLSFL"
     CDS             complement(32576..33109)
                     /codon_start=1
                     /gene="yrdA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070458.1"
                     /locus_tag="PA25_00300"
                     /product="gamma carbonic anhydrase family protein"
                     /protein_id="BBN80045.1"
                     /transl_table=11
                     /translation="MLRSYKGIRPTLAEGVYVDESSVLVGDITIGSDSSIWPLVAARG
                     DVNYIQIGERTNVQDGSVLHLTRASNNNPDGYPLIIGDDVTVGHKVMLHGCTLGNRIL
                     VGMGAIIMDNVIVEDDVIIGGGALVPPNKTLKSGYLYVGSPAKQARPLTEDELTFLKV
                     SAQNYVQLKDEYLKEGQ"
     CDS             complement(35047..35238)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00310"
                     /product="hypothetical protein"
                     /protein_id="BBN80046.1"
                     /transl_table=11
                     /translation="MIQPQVPLGLPCYDFTPVMNHSVVNVLPKVRLSTSGATHSHGVT
                     GGVYKARERIHRGILIRDY"
     CDS             complement(39253..39636)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00320"
                     /product="hypothetical protein"
                     /protein_id="BBN80047.1"
                     /transl_table=11
                     /translation="MKQQLSFILIALVGVLLGGCQITWTTQDSTKKSNDEILDALIAD
                     KACDASYQCKVLAVGERPSCEGPSQYIIYSTKRVNKQKLDDIVTKITEQERMNNESTS
                     SSDTCKAVLPITPLCIKQQCQTYKP"
     CDS             complement(39645..40166)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00330"
                     /product="hypothetical protein"
                     /protein_id="BBN80048.1"
                     /transl_table=11
                     /translation="MFKLSQALILSICLAGCNQVSSQNSSQTQPSKEENKAQPLAAAP
                     ANKELHSPGVKAEKLPQPILDKVSAEDIKQLHSQLKALTQDVTCDTTMQCQVEAVGSR
                     ACGGPSSYIVYSNKSADSEAVKKLASKITHYESSYNAQNRLVSICQHLTRPSAQCVEN
                     KCVKLTNTSQETF"
     CDS             complement(40262..41641)
                     /codon_start=1
                     /gene="fumC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KRR3"
                     /locus_tag="PA25_00340"
                     /product="fumarate hydratase class II"
                     /protein_id="BBN80049.1"
                     /transl_table=11
                     /translation="MSKTRIEKDSMGALKVPANALYKAQTQRAINNFPISDLTLPAPF
                     IRALAYIKQSAAHTNANLKHLPSDKADAIINAAQQIIDGAFPDQFPIDVFQTGSGTST
                     NMNVNEVIATLASQNSAQAIHPNDDVNMGQSSNDVIPTAIHVSCVIELTTQLLPALKH
                     LSQAISNKSATVEDCIKTGRTHLMDAMPVRLSQTLSGWQAQVDHAAGHIQTQLASLCA
                     LAQGGTAVGTGINADPAFAESFNKNLSKRIGIQFTPSDNFFFSIGSQDSVVNLSGSLK
                     TLAVAIMKISNDLRWMNSGPLAGLCEIELEALQPGSSIMPEKVNPVIPEAAAMACAQV
                     IGNDTTITVAGQSGNFELNVMLPVIAYNILESIKILANTSHLLADKAISTFKVNNDNL
                     QATLSKNPILVTALNPIIGYEAAAKIAKLAYQQNKPIIEVAKEHTTLSEDELTKLLNP
                     EKLTKGGLS"
     CDS             complement(41869..42048)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00350"
                     /product="hypothetical protein"
                     /protein_id="BBN80050.1"
                     /transl_table=11
                     /translation="MFISTITHMPICESGLIAEHDDNLFVQSDDYRKEVQDILTPSEQ
                     EDAPNTAQVFILGYN"
     CDS             42225..42812
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072123.1"
                     /locus_tag="PA25_00360"
                     /product="methylase"
                     /protein_id="BBN80051.1"
                     /transl_table=11
                     /translation="MDKPFSQACENNKAPILSVIEPYLRHYDYVLEVGSGTGQHAVYF
                     SEQLPHLRWQTSDREQNHGGICSWIEQSCAQNVLEPIRLDLNHPWPVEQVPVIYTANT
                     LHIVSKVLVDKFFQSVKAHLANGGLLCIYGPFNYQGHFTSDSNAQFDAFLKANDSDSG
                     IRDFEWINSLAQQAGLSLLKDQAMPANNRLLLFKR"
     CDS             complement(42792..43931)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003114811.1"
                     /locus_tag="PA25_00370"
                     /product="hypothetical protein"
                     /protein_id="BBN80052.1"
                     /transl_table=11
                     /translation="MMQCQTMFNHKFVNSIEDVSPHDWAQLCTDNLFCSYPWLKAFEQ
                     SQCVHSSCGWQPHHLLIYHTQQLIAILPGYLKGHSYGEYVFDWSWAEAYQRYGLNYYP
                     KWLCGVPFTPVTGQRILCKNLTAELTEYICVTLKETCAAYSWSGAHINFFTDNISPSR
                     DFITRHGVQFHWFNNKYKDFTDFLNALTSRRRKMIKKERQQAQRYKLTIRWLTADQID
                     NLVLARFFQCYQSTYIKRSGHQGYLNLTFFKEVLNTMPHIVRLCAAFDDQKLVAASFY
                     LCDDHTLYGRYWGALEAYQSLHFELCYYQGIEYAIKYNLNKFDAGAQGEHKLTRGFQP
                     VTTYSMHHIAHPVFGPAIADFIQREKVHIEQYKDQCAQVLPFKQQ"
     CDS             complement(43900..45210)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00380"
                     /product="hypothetical protein"
                     /protein_id="BBN80053.1"
                     /transl_table=11
                     /translation="MLANQTLAATAKSALNCLQIAQDWQNLIKAQQNGLYRFAINQGP
                     VTWPVKHSAPFSEYVAKTKAIINSRNKRAKQSCPVLTPTAKTLGYSKEQLTVLDLIAP
                     FELRQANRERAILLIHGLTDSPFTFHFLADTFYQQGYNVRAVLLPGHATAPSDLQLVK
                     LSHWQALINYAITRTAEDFEQFAVVGYSTGAALAVSHVAQSDPENLRAMALISPATEP
                     HNKHAWLAKWIARIPFLNWLDEDADYDFAKYESFPWQAAALADAAMQGLKTASLPDDL
                     PLFTAFSEVDSTIDSNASIAMLKRFASTNPSPKKQVLYYYGNPNSATAQLPDGYKVLT
                     PYCEHASCNKVIDMSHIGILQPPSHPYYGWKGIYRSCGGYLENPAKYLECKQHSAPLL
                     GERTQSNMSHAVPLQRLTFNPAYGDFANHLSSFINDAMPNHVQP"
     CDS             complement(45254..47959)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00390"
                     /product="hypothetical protein"
                     /protein_id="BBN80054.1"
                     /transl_table=11
                     /translation="MNFKHQWQSQLSYIILMLSYFVFGKLLTVFAFQDQVLPIWLPAG
                     VALVGVFFWGWRFVPGLAVASIAFNWTTAHGWSFTELSVPNTIAVSMIAFGVILQALL
                     GGYLLRAWLGHPLHLKSRLQIAYFISLVGVIINLVSANIGVFALSFYHPEYSFANHWH
                     NMLAWWLGDSLGVLIATPALLIALQPWLADSKPLNNVASTFSACIVLCMSVALTTFLY
                     NQSNVKSASMNAQREMQILENIVYRYVNQSMLAIQALANQLQAREHFSRQEFDAIASK
                     LRNQYSFLRALSWNVRISAKQRDQLNTQLTQLYGDGIKVKGEPITPLDPLVVVKYITP
                     LNGNKGALGFNVYSKNNRKQAMINASQTTEPQASDIIYLIQDSRPAPAYLLFSPVFDP
                     SATNTEYAIKGYATAVIQVETLLTEALKQAQAKLFNIAFYDVSNNDVFYQNFGPEQLI
                     NEQEKKIITLFVAGQKWRMELSVKDEYASRLNQKLTLMLLILQLSITALIIYILLLFN
                     YQHHALNALVEQRTRSLAKAKAQSDRANQAKSRFLANMSHEIRTPLNAVIGFASLASA
                     THNNLELKDYIKKIGSASKTLLNLINDILDIAKIESNRLQIDKHPFDLQELLNRIDTM
                     FSSSAQQKGISWQITHNLPGPTWVLGDEMRIEQVLINLCSNAIKFTQRGGVTLDITAE
                     YGTKQVHLLFNVIDTGIGIEANKQHTIFNAFSQADNSTSRKYGGTGLGLAIAKELAEL
                     MGAKLRLKSDVGQGSTFTLEMKLLNSSAQNKQLEQIDISQIHCLHVLVAEDNPVNQVV
                     IKAMLNSFDIQHTIVANGQEAVEAVKNRQFDLVLMDCQMPIMDGYQATAVIRQFKGID
                     ELPIIALTADVMPEDKAHAIAIGFNRHLAKPLERDKLALCLAHYC"
     tRNA            complement(48212..48304)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="PA25_t00010"
                     /product="tRNA-Ser"
     tRNA            complement(48324..48414)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="PA25_t00020"
                     /product="tRNA-Ser"
     CDS             49023..49862
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010948052.1"
                     /locus_tag="PA25_00400"
                     /product="transcriptional regulator"
                     /protein_id="BBN80055.1"
                     /transl_table=11
                     /translation="MLVVVKPGDSQCKQAHIHWLQRQNEVKKLHCYWFYTTPNFNDDL
                     NKLRRLVARHCLLVVIGGDGTIHLAANALVGSSCELAILPAGTGNDFARQFNRTTMQW
                     RESVFSHRKSQIDVGFINQRYFINVMGLGYSAHVVNAVNKSSKRHPLSYIWAALKALF
                     SYQGVFVRVAGSKVNKKVMMLLFANGQYFAAGIKCAPNATLHDGCLQVVSVSPDSHWA
                     RVKTFLMMLCAKHEKISCVSVSCGRHFDIVTPDLDIEADGELVGKTPAVIGIRQKALT
                     LRG"
     CDS             complement(49925..50722)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00410"
                     /product="hypothetical protein"
                     /protein_id="BBN80056.1"
                     /transl_table=11
                     /translation="MKKIALLAAMTLSSASFAHSQADNTHVQFSSEQCEVDFQNDVRI
                     TPDELFITNSNNNSKLRITDNGQVFIDGAVIALNTEQQTAVANYADELRAKLPQVANI
                     ALDGIKIAGVALEEVANAFELKEFGSLSSLLKDVESEVSETFYQQGAFVMGEKTFNEF
                     GSNFEQQFEERIETAVEGAMMESIGSILMAIGSQMSNSGGDMAAFEQRMKDMGQQIED
                     KVHMQAQNIEQQANALCGQFSVIAKTESQLQQQIPAFSGYQLFNLKH"
     CDS             51037..51219
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00420"
                     /product="hypothetical protein"
                     /protein_id="BBN80057.1"
                     /transl_table=11
                     /translation="MGKTFSYDALDDDFVDDEYENLGRNQHDKQKRKVKKKLDDYLEQ
                     KRLRKNLGEDDFDYLD"
     CDS             complement(51257..51736)
                     /codon_start=1
                     /gene="bsaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H2WFT3"
                     /locus_tag="PA25_00430"
                     /product="glutathione peroxidase"
                     /protein_id="BBN80058.1"
                     /transl_table=11
                     /translation="MSNLYQFTATTLQGQPFDLEQLRNKVVLIVNTASECGFTPQYEG
                     LQALHQQYQAQGLVILGFPCNQFGGQEPGDAVQIQQGCLINFGVDFTMMEKVEVNGPH
                     AHPLFTYLQNTLPGVFGKRIKWNFTKFLIGRDGVPQKRFSPTTKPVKLVKHIELALK"
     CDS             complement(51774..52649)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070732.1"
                     /locus_tag="PA25_00440"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBN80059.1"
                     /transl_table=11
                     /translation="MVIWQGLEVFLAVVEQGSFSKAAEKLETSTSYVSRQIQQLEKRL
                     GTTLIQRTTRSQNLTDAGRQYATKLKVIQQELIDATNHVQGVQNTPKGQIKIAAAGEF
                     VANHVTPRIAEFIKVYPEVSVDIDFNNRNVDLVEEGFDLAIRFGLLQDSNLIARKLCP
                     RPMTWVVSKGYQNIHGNIRHPYELCQHNCLSASQGRWRFNICDQIEEIKVAGNWRSNN
                     SFALINACLAGLGVAHLAKDIAQPYVDQGKLEYVLESFQVNDGATWLVYPRRDLMPYR
                     VRLLIEFLIDSFATP"
     CDS             52722..53984
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000787713.1"
                     /locus_tag="PA25_00450"
                     /product="alcohol dehydrogenase"
                     /protein_id="BBN80060.1"
                     /transl_table=11
                     /translation="MSSVFVMAAFDYTSILKRQAGINLPYDCDEQFMERNMLNFSFVN
                     PTQIHFGEGQISSLTSSIPQDAKVLVVYGGGSIKKNGVYEQVSNALNAHTWGEFAGIE
                     PNPSYQTCMQAVAMVREQGYDYILAVGGGSVIDGCKFIAAAALFDGEPWDILGKGAEV
                     KSALPLGVVLTLPATGSESNSFSVISNKDTNDKLPFATTLVQPQFAVLDPDVMKTLPE
                     RQLANGVVDAFVHTMEQYLTYPVNAKVQDRFAEGLLLTLMEEGPSVFGQDVSYEVRAN
                     VMWSATMALNGLIGAGVPQDWGTHMIGHELTAVYGLDHAQTLAIVLPRMMEEQKEPKR
                     DKLLQYAQRVLGLDTSDPDAAIEQAIAKTEAFFHSVNMPTRLRDYGLGEEVADKIVAQ
                     LERHGMTALGEHQSVTLDKSRNILLRSV"
     CDS             54180..54821
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011263283.1"
                     /locus_tag="PA25_00460"
                     /product="hydrogenase"
                     /protein_id="BBN80061.1"
                     /transl_table=11
                     /translation="MTKVWDGFIRGFHWLLVIAIAVLYVSGEEGWLDVHFVAGYLLLA
                     LMFTRLIWGVIGSDTAKLSALIHSPKAAILSLRSNEPSAGHNPAGSYMVLLFFVLILV
                     QLFSGLMSTDDILVEGPLVAYVPSSWSEVASSLHHDNIDILLFAIALHVVAIVVYRLR
                     GKNLAKTLLTGKESNVLQQPRMVSGKWAYLIFIVLSVGILSVWGGEPLSSLFS"
     CDS             complement(54864..55307)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073278.1"
                     /locus_tag="PA25_00470"
                     /product="cytochrome c"
                     /protein_id="BBN80062.1"
                     /transl_table=11
                     /translation="MKKIIIAAVALMTFNANANTLFESSEDAIEYRKAAFQLIRYQIG
                     DMGDMLKGKIPFDAKRFEKRANSAAQLSTMPWEAFIAGSDKGDTDALPAIWSDKETFD
                     KKAKMFAQYAQELAVAARSGDKAVIGPAFKNWAKGCKDCHKSFKD"
     CDS             55642..59139
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073572.1"
                     /locus_tag="PA25_00480"
                     /product="serine protease"
                     /protein_id="BBN80063.1"
                     /transl_table=11
                     /translation="MSNMIKKTAIAAAVGGVILSASVSAQTAQLVNKYSSFQADRINV
                     SDVQKQKPVSYLVVLKATSSADLFAQGTYQAGDARATIAQIERIQNAVSLELSNLDIN
                     AKVIGRTKVLAPTLIIEASEKTVEKLKNDPRVSKVLPMFESDLHIEESSDYVKATPVR
                     TGGVATGMGQKVAVLDTGIDYTHAIFDGAGTVEAYEAAQADPTSVSWPQGQVKGGYDY
                     MRDDADPIENDPSIGPAEGDPTSHGTSVSHSVTGIAPDVELYVYSVCGGGCPGAAQAA
                     ALEAAMDPNGDGDISDRVDVINMSLGGEYGDTYTLSGTQFLIQRAVDLGVNMVISAGN
                     DGDNPFRIGGPSTTPNALSVGAMTHPTIPEPIASGTVAGSETVIQGASFGPQGAFEMT
                     SDMAPLVYPDVNQNGCDAFADDVDFTGKAVLIDRGACAFVTKVLNAQAKGAAFVFIAN
                     NNNDGSPAPMGGSSDAVTIRSVGINFEAGAALKEQLAAGAATYSVKVEMKNLVGAVAD
                     FSSRGPSMDGLLKPEITAPGTNIMVAATGTQNGLAPATGTSFSGPMTAGAVALVREAL
                     PERNAYEIKATLMNSANLNVTNEAVTVNPDSELAPISMIGAGLVDVEKAVNLPVAAWV
                     HQEKYDTNQAALSFGLVHVEGTAEYTKTVTLKNFSAQERTYNLRTEARYTNDADTGAI
                     SWNIPESVTVPAGQTVEFDVTLTIDASKLPEWKLGNPLDADDLAAFSPALTLAEFDGA
                     LVFDDPATEGDHDLHLVYHVLPKAHEGIKVGYELVDGKVMVTVENNGSAEFTPMTEQL
                     VAQRDAMSKEEKSSNLVATTFNVYENESCNSGLWFTNSLVLRDSLAHQRQVGGYETRL
                     DVDGDGVQDYLLAQYSDVGRSAAIPGRTRTAVAPLVDGAPNWGQAWVTPFAHEGGSNT
                     VTFTGCAEMIGLSSDNLGQEIAFESRIGFGYDLGMYFPEYDDELSGTAKFATSSAKLV
                     TASGEAVAKLAPGAKAYVSADAPFALASADLSGVVAPMTDAVLNNPMPFDAPVLNGVE
                     VSVAENTETGTVIATLAAEEVENTLDISEFYLKSSTHAGLSVNAAGEIVVANGELLDF
                     EAGNNEAKLVVTAIDVMGNISEPAEVVVNITNVVDTEAEQPPVVDVTPEPKKSSSGSL
                     AWLALLAAPFAALRRRKQK"
     CDS             complement(59204..59707)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00490"
                     /product="hypothetical protein"
                     /protein_id="BBN80064.1"
                     /transl_table=11
                     /translation="MIKKVNHFILTTALLATMTGCSTVYADSAPPKNYETYITKGERF
                     KHNTFTAINGEKVALANKRKLIILFATWCSDSQRAMNELKASPLINDKNLQIIAIGRN
                     ENNESLAKFNDEYQLPFALIADPEREIYSQYANAGIPRLILLDEHNQVVKTLIGEEPN
                     VIDKILW"
     CDS             59780..60217
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005764689.1"
                     /locus_tag="PA25_00500"
                     /product="membrane protein"
                     /protein_id="BBN80065.1"
                     /transl_table=11
                     /translation="MWLYSGLFLSALSSATLLPGSSEVLLSGLALTQNANLLMLWLIA
                     TLGNVLGSCINYWLGRHVMHFKDSRWFPVTQRQIEKANAQYARFGSYSLLFAWVPIIG
                     DPLTVFAGIFKMRKGLFLLLVSLGKGLRYAMVIALAVGIEQLF"
     CDS             complement(60222..60581)
                     /codon_start=1
                     /gene="folX"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P0AC21"
                     /locus_tag="PA25_00510"
                     /product="dihydroneopterin triphosphate 2'-epimerase"
                     /protein_id="BBN80066.1"
                     /transl_table=11
                     /translation="MQNAIINITNLRLRTYIGFNPEEREKKQDVVVNIEIHYPADTAC
                     VTHDEVDHALNYKTVTKAVIKLVEDGHFLLLEKLVSDILTQCHRHPTVTYAKVKVDKP
                     HALRFADSVSLTLDWHR"
     CDS             complement(60591..61145)
                     /codon_start=1
                     /gene="folE2_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q884Q3"
                     /locus_tag="PA25_00520"
                     /product="GTP cyclohydrolase 1 2"
                     /protein_id="BBN80067.1"
                     /transl_table=11
                     /translation="MHDNLKNSYKQIIAAVGEDENREGLLETPKRAAKAMEYLTKGYR
                     ETLEEITNNAVFTSDADDMVLIQDIELYSMCEHHLLPFVGRCHIAYIPNGKVLGLSKF
                     ARIVDMYARRFQIQEQLTHQIAQAVEQVTGAKGVGVIVEAKHMCMMMRGVEKQNSKMR
                     TSVMLGNFREDPKTRNEFLQLVKN"
     CDS             complement(61158..61865)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000520812.1"
                     /locus_tag="PA25_00530"
                     /product="dihydrofolate reductase FolM"
                     /protein_id="BBN80068.1"
                     /transl_table=11
                     /translation="MTAPILITGAGQRIGLAMAQHFVAAKQPVVVTYRTRHNVIDELE
                     QSGVHCINIDFSDAHAIEQLETTLRSHYSALRAVIHNASSWDCEANNPDFDSLFDSMM
                     RIHAKVPYQLNLALADLLLAYSAVSDIIHLTDYVVETGSPKHIAYAASKAALDNLTRS
                     FASKFAPDIKVNSIAPSLIIFNQHDTPEYKAKTLKKSLMGIEPGCKEIINSVELLMSS
                     DYITGRTIPVDGGRHLK"
     CDS             complement(62264..63100)
                     /codon_start=1
                     /gene="nadE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KMW1"
                     /locus_tag="PA25_00540"
                     /product="NH(3)-dependent NAD(+) synthetase"
                     /protein_id="BBN80069.1"
                     /transl_table=11
                     /translation="MRQAILAEMQVQPQIDVAYEITRRINFIKQRLVSAHCQTLVLGI
                     SGGVDSSTCGRLCQLAVDELNAEHDTDRYQFIAMRLPYGVQADEEEAQLALDFIKPSQ
                     RITVNIKPAVDAMHEQAMHAMHSSQLSIPAPTSVDFVKGNVKARQRMVAQYEIAGLTH
                     GLVVGTDHSAENITGFYTKFGDGACDLAPLFGLSKRQVRSLAAHLNAPVELVTKAPTA
                     DLECDRPGLTDEEALGLSYDQIDDFLEGRDVAPSVEEKLIAIYERTQHKRQAIPTVYD
                     AL"
     CDS             complement(63159..63794)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87GU2"
                     /locus_tag="PA25_00550"
                     /product="UPF0502 protein"
                     /protein_id="BBN80070.1"
                     /transl_table=11
                     /translation="MSIDMELSEVEQRIVGCLLEKQTTTAEHYPLSLNALTNACNQKS
                     NRDPVMSLTESQVIDAVETLKSKHIVTIDEGLSGRVDKYAHRFCNTEFSRMQFSEQQR
                     AIVCLLLLRGAQTPGELRTRSARLANFTHVSEVEQALEKLQTEGFVKKLAREPGKRES
                     RYVHLFQNTEHLATNTAPPHKELETPELDALLLEIELLKKELADIKQHLGL"
     CDS             complement(63807..67145)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00560"
                     /product="hypothetical protein"
                     /protein_id="BBN80071.1"
                     /transl_table=11
                     /translation="MFANLSNAPRKTQSIKISFWLLLGAIVAFGWYVDTVNYNKLVQE
                     EKSRTYETVNVYRTQIEGILATNIQLVRGLAIAVAQEEQLTQATFERIADPLFRSSGV
                     LRNIGAAPDMLLQFIYPLKGNEKALGLNYLTHPTQSIEAIEARDSGEIILAGPLELLQ
                     GGKALIARVPVTDKNANFWGLLSVVIDIKALFAKARLEDLKNHYDVAVQGRNSKNKQG
                     EFFYGDSSIVLEDPLTFNIAVAAGQWKLYVYPRGGWQPKSATIWPFRLALATIILLFI
                     TAFIFFNRLLEQLQDNAHSLSSMGALAEVGAWTINLKTRNISWSEVTKEIFEVPTNYK
                     PSWIATTEFFVAGAQRRLMQDTFDSAIKKGIDFEQEMLIKTAQGNERWLLVKGRAVRH
                     GKYTSQLYGSVQNIHDRKCLEIEHNKVAKNNELLARLSSHEAVLNLKLEPAQRIAIKI
                     VCEGLAAQRASIWLLNADGSLLIPTAFSNTREEDLQYFPPWRKKQLPELFAAIFKQQI
                     ISANFAHTHPCTQELRDTYLSPYEVNAIFGCSIAYKGHAIGFLCAEYRHPHVAWDNTD
                     EKLIRAVAATLGSLFASREQQQARQQAVMEKQLAQQSAKMKSEFLASMSHEIRTPLNG
                     VLGMLEVVTHSQLSPSQTHHLQLAKNSAESLLTIINDILDFSKIEAGKLQVDIIECDL
                     VQVISDSISNFAPKAQEQQTRLILDTHNLKVECAKTDPHRLKQVLNNLLSNAIKFTEN
                     GTVTLTCYTEEQAQHTRLWCNIEDTGVGISKSQLSKIFDSFTQADISTTRKFGGTGLG
                     LTIARQLCELLGGNLNAYSKVDVGSTFSFYIELHEPQPVSPKTFNCDALIIVDPLLMT
                     ESKKHYLFDIWGMSLLHTESIANTLEYIDNNQLTHPALIIAAEQLATASHAQREKLHH
                     LQQSSKANFAVLSNRLITDTEFLPLQPSLTLLRPLTPTDMLKLCQIETYEHPSDDDIT
                     SDISNLDVLLVEDNKVNQTVALKLLSRFGINAQCKEDGLQATEHLKERKRPYDVILMD
                     CLMPELDGYQATHLIRSGGVGEQHKHTPIIALTANAMQGDRQKCLAAGMDDYVSKPIK
                     VNELEEKLRHWQNEAKQNSTNSVQ"
     CDS             67370..69667
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011205051.1"
                     /locus_tag="PA25_00570"
                     /product="penicillin amidase"
                     /protein_id="BBN80072.1"
                     /transl_table=11
                     /translation="MLKLLKWILAVTIVIVVALTATLYGVLSLSLPQLDGKQVSKGVA
                     SEVAINRDELGQAVIHADNRQDAAYGLGYAHGQDRFFQMDLLRRSAAGELSELFGDAA
                     VQLDERMRFHQFRKRSELIVKALPERHRLVLQAYALGVNEGRLQAGFDSFEYLLTGAP
                     QLAWRSEDSILVIFAMYLDLQAATFQRDQALIQLESLFTEKMRRFLTQPSQYQAALDG
                     SKLPPSPILPPELNETGQHAQVTDIISLPHFGSNNWAVTGQLTQTGKGMLSDDMHLGL
                     NVPAIWYRAQLNYKENGKAVQVTGVSLPGAPSIVVGSNDNIAWGFTNGYLDTADWIEL
                     DEQAKTWVVTEQIALPKGAMHQYQLTMSEFGPVKYFNGKNYALSWVAHQPYAVNLNLL
                     ALEQADSVADAMRLAPAVGIPVQNLMVVDAQGSAGWQPIGALPARTNPSEVAIKKKEY
                     SPLWQQNEVSRPRVLNPEKHRLWSANARVVSAVEHQRFGDGGYALGARAQQIRDRLHE
                     KSQFSEPDFNQLQQDNEARFLAPWHTHLTQLLSATTQLQARYNNDLKHLENWQGCACA
                     SSVGYTLVQRFREALINEVFAPIEDEMLLHDSSLKYIKNYLEPGLWQLLNSQPESWLN
                     GHKDWRSLQLSAYEQAKQRLSQQHGTDLAAWRWGEVNALYVQHPFSQQLPILGGMLDM
                     PKVSGFGDTFMPAVQQPDFGASQRFIAQPGALDNAIMTVAGGQSGHPLSPFYRAGFEA
                     YAQGEATPLLPGAIMHQIRILPEPD"
     CDS             complement(69671..70717)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_007243946.1"
                     /locus_tag="PA25_00580"
                     /product="GGDEF domain-containing protein"
                     /protein_id="BBN80073.1"
                     /transl_table=11
                     /translation="MQHPHQQPNKIEQLKSRLLTQVAWYCMALHACLIYAFWYIEVPL
                     LGAFNVLSVATWWFGIKLLERNQQSLALRVFSLEVTIHSVLVCAVIGTDYGFQFYLWT
                     ASCLLLLDTQLKLKQAIIWCTAIIVIFAYTYIGFNLPLQPIDYQKMAPYLHFANVIIC
                     GIPMIYTIGLIREITVNQQHELEVLAAHDSLTHLFNRRYAQGLIQQAYKSCINHQHPI
                     CVVMADIDHFKQVNDVYGHEQGDEVIERVALCLSQHINSADIAVRWGGEEFLLVFPNC
                     SQSQAQKHLEIIRQAIEAMTFAQGSLQVTMSFGLALWQAQSDFEEVLKQADIALYKSK
                     HKGRNTISVAPLVH"
     CDS             71033..72562
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005464264.1"
                     /locus_tag="PA25_00590"
                     /product="hydrolase"
                     /protein_id="BBN80074.1"
                     /transl_table=11
                     /translation="MSIEKARITLCNINKKDYPQIKTLMDEAYPDLGGAWPSHTIFRL
                     IDQFPEGQIGILDEGRLVGLALSVQVDYQRFSNPHTYDEIVDAHNRVFSDSNGDALYG
                     LDVVIAKSHRGMRLGRRLYDARKELCRQYNLRAILAGGRIPRYSNHCDEMTPMEYIDK
                     VDHKEIYDPILSFQLANDFQVKRLLKQYLPEDEDSEGYATLLEWNNILFEPTDTVIEA
                     KKTIVRVGAVQWQMREVESVEELMRQVEYFVDTVSEYQSDFIIFPEFFNAPLMGLQEH
                     RNQTEAIRYLAEYTEQFRDAMSTMAIEYNANIVTGSMPLMEDEKIYNVSYLCHRSGKI
                     DEQRKVHITPHEAYDWVIEGGDEIGVFETDAGRVGIQICYDVEFPELSRIMAQRGLDI
                     LFVPFWTDTKNSYLRVRHCAQARAVENECYVVIAGSVGNLPQVDSLDVQYAQSAVLTP
                     SDFAFPHDAALNEATPNTEMLLFSDLDLDKLKLLHSEGTVRNLKDRRTDLYQVTLKTK
                     N"
     CDS             complement(72559..73431)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000219805.1"
                     /locus_tag="PA25_00600"
                     /product="multidrug transporter"
                     /protein_id="BBN80075.1"
                     /transl_table=11
                     /translation="MGWITFTVLAAFSQAWRNALQSQLSQSASVAGVTLARFLLAVPL
                     AAIYLLCLYQYQTVPTLTLNGSLMAYVLSASMMQIVATGLMVVLFKQNNYAIGAGLAK
                     SEALMAAILGMALFGSSLSVTGWFGVAIGAIAVLMLSGFSVKRFAPKTALLGIACGSA
                     FALTSLWVREASLATGLPFLHSAAWVLLLVLFTQTVILSLYLTIKERQTWQALWQKRS
                     LTGAISFTSFVGSVGWFSAMSLQHVAYVKTLGQIEVFFTMLIAVLWLKQPIKASDNIG
                     LLLIGVAAALVMLS"
     CDS             73675..74058
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010947947.1"
                     /locus_tag="PA25_00610"
                     /product="membrane protein"
                     /protein_id="BBN80076.1"
                     /transl_table=11
                     /translation="MTTILICALIAVILPYLAKAPVAIAMNRLGGYDNQHPRAQQAQL
                     TGLGARALAAHQNSFESLAVFAVAVAVVLGTNTIGSTVQYLAIAHIVARVLYCVFYYL
                     NLHLLRSLVWAVGLGCAIAMIAVSL"
     CDS             complement(74126..75343)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8P5X8"
                     /locus_tag="PA25_00620"
                     /product="protein TonB"
                     /protein_id="BBN80077.1"
                     /transl_table=11
                     /translation="MLYPYLEWLLNPNMQMVLSAIMIILVLLQKHATAQLGARLIYSL
                     WWIIPLSIIALNLPSELKPITNDAISYFLVTPQLQQHTAVWQFSATALYSAIVMLLLL
                     MLWWQHYKFSRDLNIKAVKNTFFDQPLFVSSQLSTPMVIGLWKPIVVLPNDYDKQFDH
                     ETFKLLLEHENTHIRRFDNVANMALILLCIACWFNPIMWLGYQSFRRAQELACDEKVL
                     QEKSTHQQLMYAKALISCAQNARNSALAYSYYGDKSTMKQRLLHLQKLSGASMGAKCL
                     VVALACGSLSAMALAKPNEVQAHKHEGKPHPVMRIEPKYPAEAANAGISGYVTLQFTI
                     DGRGHTNNIEVIDAQPQAVFEQSAITALRQWQYTSASDTSQRHVVQLDYALGEYSEAT
                     KKKVKHERIKVAH"
     CDS             complement(75345..75722)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012640294.1"
                     /locus_tag="PA25_00630"
                     /product="transcriptional regulator"
                     /protein_id="BBN80078.1"
                     /transl_table=11
                     /translation="MIELSKAEFAVMEALWQGHPAKASDIIQRLSSDTQWHEKTIKTL
                     VSRLVKKQAVSFEKQGREYIYSPTIGREAYTLKESQSFIERFFRGRIAPLVSGFAKTE
                     QLSQQDIDELKQIIKQWEQKQGK"
     CDS             complement(75792..76469)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:K4PTX7"
                     /locus_tag="PA25_00640"
                     /product="pseudouridine synthase"
                     /protein_id="BBN80079.1"
                     /transl_table=11
                     /translation="MRLAKYLSHAGVCSRRQASRLIDSGDVIVNGRPANHIDHVSEQD
                     EILVLGKKVCGPAAKVLYAYHKPVGIDCKLKPDDPSSLLHHLPTSQRVYPIGRLDKDS
                     RGLLLLTNDGELCQRLIHPDHHVEKEYWVKVDRPLDAEFCQKMASGVPVDGQITLPCQ
                     VSLLDATRFKIVLKQGLNRQIRKMAKYCGYKVIDLYRVRIAHFTLPNTLPEDEYQPIN
                     VTSLKLD"
     CDS             76621..77460
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00650"
                     /product="hypothetical protein"
                     /protein_id="BBN80080.1"
                     /transl_table=11
                     /translation="MKKAIFTLAIGDNPMYQAAILSFQHYAKRVDADLIVSETLHYPI
                     KISEPKYGANPAWAEKLRIGELLKEYDRVLYLDADILVSPDAEDIFKKYQDLDTLYML
                     NEGAVCDRTQERTLIEDLCGKVAWPSEKEASIYYNVGVILASKPCRLFEYADLDELQS
                     VCNEIRFYEQTLFNYQLFKHQLKHEALPSRFNRMDMFGKEGYLDADFIHYAGRGYAKN
                     NRRRDVQFLRDFAKLYQGIVPRQDIERLQGVAWNNFLEVVYKKYPLPNWLVKLCSQRF
                     VPH"
     CDS             complement(77507..78376)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073864.1"
                     /locus_tag="PA25_00660"
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="BBN80081.1"
                     /transl_table=11
                     /translation="MQKIMLTGATGLLGRTLYSTLVNDFEVVGTGFSRATAPLYQLDL
                     GNQNAVIDFLELHQPDALIHAAAERKPDVCENAPEQTIALNVAASEFLAKQCALRDIA
                     LIFISTDYVFDGKAPPYLESAQTNPLNLYGQSKQQAEQAVLAHSSRHSVVRVPVLYGD
                     VSELAESAVSVIATQISATETTKHDNWAVRYPTHVEDIAFTLRDLLKCPENLGGIFHI
                     SDNQAMSKYDMACIMADILGYPKSLLEPFDEPSQSAARPHDCALADSRLKPQGIAHGR
                     DFKQAIQSVLTAI"
     CDS             complement(78662..79360)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015368862.1"
                     /locus_tag="PA25_00670"
                     /product="flavin mononucleotide phosphatase"
                     /protein_id="BBN80082.1"
                     /transl_table=11
                     /translation="MKFNRAIGKIKVLSFDLDDTLYNNHPIIASALRAQADYLKNLPG
                     WPHQDNHFWMACRNKALKDNPELQHDVTLWRQRALYLGFLECGLNHDDALEHTHNAYA
                     AFANARSQISVCPSVIELLTDLKRRYTLIAITNGNVDVEQFNLAGIFSLVLQAGKDGR
                     SKPYGDLFHNAVNQLNIRHDQLLHIGDSLDTDVQGANNAGCHSVWLNNQSCAYRYQGL
                     ADIEISDIKQLQCF"
     CDS             complement(79405..80337)
                     /codon_start=1
                     /gene="xerC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KFI3"
                     /locus_tag="PA25_00680"
                     /product="tyrosine recombinase XerC"
                     /protein_id="BBN80083.1"
                     /transl_table=11
                     /translation="MADDNALNAQWLQPIDTFMAYLRHEKQYSAHTLSQYRTQLLQAA
                     HYFAPNATDWLAVSSEQIRRYSMHLRGKQYNPRSINLKLSCIRSLYKYLKAKHSPNSA
                     FTNPGDTIRGPKFDKPLPKNLDVDQMAQLLSINDDDILAIRDKAMMELMYSSGLRISE
                     LVNVNIGDIRDGEIRVLGKGNKERIIPVGGKALQALERWLLLRSQFSSEGEMAVFLSK
                     RKQRISIRHVRERMKEWGIKQGISTPIHPHKLRHSFASHMLESSGDLRAIQEMLGHTS
                     LSATQVYTHLDFQHLAKVYDQAHPRAKKRPSKED"
     CDS             complement(80341..80964)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073966.1"
                     /locus_tag="PA25_00690"
                     /product="DUF484 domain-containing protein"
                     /protein_id="BBN80084.1"
                     /transl_table=11
                     /translation="MSNINNIDEQLICDYLSHHPDFLLKHPYVLLDLDLHGQSVGLPN
                     LALQQQRLLREHNTQLKQQIAAMTRSATENEQIFRLLSECQRQLWCCNSIDELAQKLA
                     QTLCQQPNIVSCKLLPYENKFAELKQARLQNGVYLGRLSQQEQRIIWSQEESIQSVAL
                     YLLGDNAAPDAILAFASNHAEHFAPTNDTLFMQEFVTTLQVRLSALA"
     CDS             complement(80983..81813)
                     /codon_start=1
                     /gene="dapF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KFI1"
                     /locus_tag="PA25_00700"
                     /product="diaminopimelate epimerase"
                     /protein_id="BBN80085.1"
                     /transl_table=11
                     /translation="MFVNFSKMHGLGNDFMVVDNVTQNVFLSRDQIKKLADRNFGVGF
                     DQLLMVEAPYSPDLDFHYRIFNADGTEVEQCGNGARCFARFVRMKGLTNRHKVCVSTK
                     SGNITLYSEKDGQVTVNMGHPHFAPSSIPFKASKPELTYIMRAQEHTVFCGVVSMGNP
                     HCVIEVDDINTAEVETLGPILENHERFPERANVGFMQIINEEHIKLRVWERGAQETLA
                     CGSGACAAVAIGIAQKKLANTVRVDLPGGSLQVRWQGEGHSVKMTGPAEHVFDGQISL
                     "
     CDS             complement(81882..83135)
                     /codon_start=1
                     /gene="lysA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8E9H4"
                     /locus_tag="PA25_00710"
                     /product="diaminopimelate decarboxylase"
                     /protein_id="BBN80086.1"
                     /transl_table=11
                     /translation="MDFFQYQHNQLFAEQVSVADIAKQHGTPCYIYSRKTLERHYHAF
                     TDAAQGHPHLVCYAVKANSNIAVLNVLARLGAGFDIVSKGELARVIEAGGDTSKVVFS
                     GVAKTADEIAFALTHNIKCFNVESTAELKRISEVASNMGEIARVSIRVNPDIDAKTHP
                     YISTGLKENKFGINIKHAFDVYQLAYALPGIEVVGVDFHIGSQLTEVEPFLAALDKVI
                     DLVEQLKTAGIELQHLDIGGGLGVPYDSEKPPHPSAYAAQVKARLTNYPHLELVFEPG
                     RAIAANAGILVTKVEYLKSSDDKHFAIVDAGMNDMLRPSLYQAWQNIIPVNPRDDNTP
                     THAYDVVGPVCETGDFLGKNRPLAIQEGDLLVQRSAGAYGFTMSSNYNSRPRVAELMV
                     DGDTCYVVRQRETLSSLWQGEHLLP"
     CDS             complement(83136..83333)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00720"
                     /product="hypothetical protein"
                     /protein_id="BBN80087.1"
                     /transl_table=11
                     /translation="MKATLSQSSLFFLVIFTTLILAGCGQSGPLYLPEKPNSKQTNQE
                     LDKSQTKPQQQPQAQTNQQDG"
     CDS             83457..83777
                     /codon_start=1
                     /gene="cyaY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P27838"
                     /locus_tag="PA25_00730"
                     /product="protein CyaY"
                     /protein_id="BBN80088.1"
                     /transl_table=11
                     /translation="MTDSEYHELADALMLTIEEQIDDCDADLDYESAAGILEIIFADK
                     SKIVINKQAPLHQVWVATKFNGHHFELHGDKWIDNRSGAEFWQFMCDAATRQAGTAIE
                     WQHS"
     CDS             83777..84430
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072086.1"
                     /locus_tag="PA25_00740"
                     /product="carboxylesterase"
                     /protein_id="BBN80089.1"
                     /transl_table=11
                     /translation="MLPFVEYAAKGEHKASIIWLHGLGDSGEGFLPIAPELKLPDELG
                     VRFVFPHAPEQPVTINGGMVMRAWYDIKSLDLENRADEDGVRASAKAVEALIQAELDK
                     GIAPERIILAGFSQGGVIALHLAPRLAYKIGGVMALSTYMCAPQKLADEAKQATLNIF
                     MAHGSHDPVVAMSAGKLAYETLREQGYQVSWQDYPMEHQVCYEELVAIRTWLIATLS"
     CDS             84447..85307
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00750"
                     /product="hypothetical protein"
                     /protein_id="BBN80090.1"
                     /transl_table=11
                     /translation="MTQRIVIKTSVNKAPTAHAPVSYQWHWRRIFMAFSVVLLFTTAL
                     IYGLMNSVNADEIQATDSGSIQSGSIQSKAVAVAHNETEHQHEQAVTPKESAPEEPAI
                     NVAEASADNLAPVTLNEEARLPSSVQNQVDMQSDMPPEVVEQVDDQQSELASENTFAE
                     HAAITNVALGAQIDSNLVSRAVLTTGVVDREPVDVLKENLELSQFTDKLFFFTEINNL
                     QGQTVQHLWFHQDQLMAEIPLTISAVRFRTYSSKNIMPSQTGPWRVEVVTEEGQLLAQ
                     KSFRIISEAE"
     CDS             85328..86266
                     /codon_start=1
                     /gene="hemC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KFH6"
                     /locus_tag="PA25_00760"
                     /product="porphobilinogen deaminase"
                     /protein_id="BBN80091.1"
                     /transl_table=11
                     /translation="MTQQHTLRIATRKSALALWQAEFVKAQLEHFHPELNVELVPMST
                     QGDIILDTPLAKIGGKGLFVKELEQAMLDGRADIAVHSMKDVPVEFPQGLELYTICER
                     EDPRDAFVSNSYKALDELPQGAVVGTSSLRRQCQIKALRPDLDIRDLRGNVNTRLAKL
                     DNGDYDAIILAAAGLIRLEMPERIASFISPEQSLPANGQGAVGIECRSDDELTKRLLA
                     PLEHQQTRIRVLAERAMNRRLEGGCQVPIGAYAEVEAEQVNLRGLVGALDGSQILHAQ
                     VTGPSEQAEQLGIELAEQLLAQGADTILAEVYKSSK"
     CDS             86266..88074
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00770"
                     /product="hypothetical protein"
                     /protein_id="BBN80092.1"
                     /transl_table=11
                     /translation="MRIAITRPEGKGLELANLLDQQGIFNVHTPVLRIEPCPLSASQL
                     APIQDADIIVFISQDSVKQLAEQVSLLPASAQLFAVGEQTANAVQRYYSRKAVAPNQQ
                     DSEGLLALSQLQQLDSKQVVLVKGHGGRTLLAKTFKQRGAILNVCAVYKRVAQQDTSD
                     KWLDHWRSKEIDGIVVTSNATLDAIFNTQQEELLNWLKSKSRHFFLVSERSARYLHNT
                     YEVGQQRISIANGPDDLAIFNSIVPNQQQQGSQMSEQETQSESVTSNPEAPVTQPVFK
                     QKISKLAVLALLVSVTGGVATAGLIIHGKQISDKTYAALAQLRQDNAQLSEQLKQAKS
                     QLALLQGNLQQQNSELEERLTLQTQAVDAQLNAALSQAKQQISGALSSEVTYLQRMAE
                     FKANAEQDYQGAIAVLKRLYDVVQSENNNTALLSAIATDIATLQAQPTPAVEALYLQV
                     HGMLQQVDSLALKTLQLPEPKAHHDEPLSSEISDFQSNLQKTWHKLVDDFIKVRTREV
                     AVIDPLLDAEQQQLLRAQLRSHLSQAQSALMDKQASIFFNALGSAQLTVEQFYDLQDR
                     AVQVMQDQLIELQKVPLKFNAQVELKTTAAVKEWLK"
     CDS             88071..89180
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00780"
                     /product="hypothetical protein"
                     /protein_id="BBN80093.1"
                     /transl_table=11
                     /translation="MIKALLVLAVVAAAMAAGHLLIDEKGYVLIAFNETTIEGTIVAF
                     VIMLLLTVLAGWIVLKLLSVVWHFYRSTTGHFSNKRRIKSELALNDAVWGMLNDDAHM
                     IKSAFAKNDAPAQWQDHQQAMLAKAALQSGEQAQALQYLQAMSDDAQAQVPKLWLNAN
                     QSEQALALLSQPMQQKKPTPAAVSSYLDGLLHEQQLAEIVATLSSKYKQLDLATKQWH
                     DFFKRFFDSAKQQASDYFSQLPKTVQAHAQLAYLQSMAGQSRLENVHDALIKLLKKGQ
                     FSQLSQVLAHAKGVDVKLTQAIQMRLKKQPEHSELLFCLACMANAEGDFELAAKIFAS
                     LPEQDWQRYWIEPALYSFEQTGQFQRAYQLARHKW"
     CDS             89317..90309
                     /codon_start=1
                     /gene="add"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87TF3"
                     /locus_tag="PA25_00790"
                     /product="adenosine deaminase"
                     /protein_id="BBN80094.1"
                     /transl_table=11
                     /translation="MINKTLPLLDLHRHLDGNVRASTILELGQQFNLALPAQDLEGLR
                     EHVQVIDNAPDLMAFLAKLDWGVKVLGDYDACRRIAMENVADAVAQNIDYTELRFSPY
                     YMAQSHYLHPQGVTEAVIDGVKAATQGRDIQVNLIGIMSRTFGVDKCQYELEALLACK
                     DGLVAVDLAGDEIGYPGELFVEHFKQVRDAYLGVTIHAGEARGSQSIWQAINELGATR
                     IGHGVKAIEDPKLMDYLRDNRIGIESCLTSNILTSTISDIETHPLKQFLTHGILACIN
                     TDDPAVQGIELDYEYQVAAPKAGLTKADMELAQRNALEIAFLSDSDKQALRAKY"
     CDS             complement(90375..91088)
                     /codon_start=1
                     /gene="fre"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000586597.1"
                     /locus_tag="PA25_00800"
                     /product="NAD(P)H-flavin reductase"
                     /protein_id="BBN80095.1"
                     /transl_table=11
                     /translation="MQLVNAEVVNISPLTEFVHKVTLKPDAAVSFEAGQYLQLVLGEK
                     DKRAFSIASRPSMQNELELHIGASGADSYAMQALEHLKQAHLNKQSVLIEAGLGISQL
                     RVDSQRPIILLAGGTGFSYVKSMADHLAEIGFTQPVLLYWGVKEESALYAKQEMEAWA
                     AGHKNFQFIPVVENASATWSGHTGYVHKAVMKDIVSLEPYSIYMAGRFDMIGIVRDDF
                     INHGAEREHMYADAFAFIK"
     CDS             complement(91169..92659)
                     /codon_start=1
                     /gene="ubiD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3CR58"
                     /locus_tag="PA25_00810"
                     /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
                     /protein_id="BBN80096.1"
                     /transl_table=11
                     /translation="MPSNQMKYKDLRDFITRLEAQGELVRISQPISTKLEMTEIADRT
                     LRAGGPALLFENPVGFTIPVLANLFGTPKRVAMGMGQDDVSALREVGKLLAFLKEPEP
                     PKGIKEALGQLPAYKQVLNMPAKEVRKAPCQQVILSGDEVDLTQLPIQHCWPGDAAPL
                     ITWGLTVTRGPYKKRQNLGIYRQQLLGKNKIIMRWLSHRGGALDFQEWCKEHPGEPYP
                     VSVALGADPATILGAVTPVPDTLSEYAFAGLLRGAKTEVVKSISNDLQVPANAEIVLE
                     GHIMPDELAPEGPYGDHTGYYNEVDDFPVMTVTHITHRKDPIYHSTYTGRPPDEPAIL
                     GVALNEVFVPILQKQFPEIVDFYLPPEGCSYRMAVVTMKKQYPGHAKRVMMGVWSFLR
                     QFMYTKFVIVCDDDVNARDWNDVIWAITTRMDPSRDTTLIDNTPIDYLDFASPVSGLG
                     SKMGLDATNKWPGETDREWGEPIVMDEATKQRVDEIWDSLGIGAKQ"
     CDS             92844..95414
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011103180.1"
                     /locus_tag="PA25_00820"
                     /product="GGDEF domain-containing protein"
                     /protein_id="BBN80097.1"
                     /transl_table=11
                     /translation="MSFLCGNSAALTTQDSVFLQHSAAMMVINPESGNIIAANDAAAE
                     FYGYTVDVLQSMRIQDINQLNAEQVAQEREQALAEGRNYFIFRHQLADGSLRTVSVYS
                     SPFIDQNGQSQLLSVIHDISAQRELQDALWYYQNNLEEQVAEQTKEIQQMSSMRMLLL
                     AVIIVILLSSMMVLVVLLLRLRRAKRRSEAQGARLEAIFDSIVDLLVFTDKDGIILST
                     NQRVQDVFGVAHCMLNQPIEEVLDEGICTKQSTCHQMQCEVHIANHSTTFSVTKNPVL
                     DLHKQLVGYIYVLQDITERLAQEKDQRLARTVFDTTSEGVLVSDKNNRIQMVNRAFTE
                     ITGFSADEVMGQSPAMFNSGHHGNAYFNKLYQTLNERGHWEGEIWNRRKSGDVYPSWL
                     QVSAVFDKQGDIEMYVALFNDITSRKHHEQMMWQQANFDTLTGLANRHHYHEKFDQAL
                     ANAKEQQTRLAICFIDLDRFKAINDTLGHHIGDLLLIEAAQRIQDCTRSSDTVARLGG
                     DEFAILLTDIKSIRDVEGIANKILHQLSSQFVLEGHEAFVSGSMGITFYPDDGDDRKV
                     LLRNADSAMYKAKEHGRNCFQFYTSVMHENAKARSQLEGALHKSLINKELSVVYQPIH
                     DAKGQRLGCEALLRWHSEALGQVPPDEFIPVSEELGLILAMGEWVLYQACSQAKSWCD
                     RLDGAFFVTVNVSSTQFKRQDVSMLVAKVLRETGLLAHCLTLEITENVLADNSEHILR
                     QLSALRDMGVELAIDDFGTGYSSLSYLKRFPLSKLKIDKEFICDLPDDAEDRALVSAI
                     ISMASNLNLKVVAEGVETVEQLGLLKQLNCDFTQGYYHSKPLSAVDFEDYLLSFNDAH
                     "
     CDS             complement(95398..96219)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00830"
                     /product="hypothetical protein"
                     /protein_id="BBN80098.1"
                     /transl_table=11
                     /translation="MYLKSLSVLQKLTFFIHGRLEHSIVKYKAHLICVITVIAIAHQV
                     VSYQQSQRLQHTLLAEPQKDDVWVINMGHFQTQRRYQAQYRVAQVLNVTDEHVELQQG
                     SFTYRKKRGAERAISLDSLMLDSYFRNQTLTLERDQLQSYFDAQAIDTVYRPEDIYVL
                     GGIVKRRAMPSAINGNIRVKTKLNPHNNDGIMLYQQGDYQAARERFLQASEQGDSWGQ
                     YNLADMVEQGQGGKQDLAAAIFWLEQATAQGNTKAQQRLKALCTKHRALCPSERR"
     CDS             complement(96362..97756)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073369.1"
                     /locus_tag="PA25_00840"
                     /product="peptidase M28"
                     /protein_id="BBN80099.1"
                     /transl_table=11
                     /translation="MKKLLTTICALVPLIGTVKAQEFTPTQIQQVKQVTELALDSDLS
                     WQLLESLTSEVGPRLPGSENDKKAVEWAKQQFEQLGFDKVWLEPATFPNWRRYRESGT
                     IITPSKQPLHLTALGNSIGTPKEGLTAPVVMFETLDELIAAPKGSLENKIAFVNYRMN
                     RHIDGNGYGPAVRARNTGAIEAAKKGAIAYMMRSVSTSHHRFAHTGNSRYKDGVSKIP
                     NTAIANPDADQIERLLNAGHAVSVNINLQTEDLGEGTSYNVIAEITGSDAPQQYVLIG
                     GHLDSWDLGTGALDDGAGVALTMAAATHIKQIARPKRSIRVVLFAAEELGLWGAKAYF
                     KQHADKLDNIVAAAESDFGADVVYGFESSVSANSLPVVRAIAEQLAPLDIKYVRANNA
                     HGGPDLIPLRQATNAPIFALHQDGTDYFDYHHTADDTLDKVDPDKLKQNTAAYAVFAM
                     MAANAKTTLTGKNP"
     CDS             97913..99298
                     /codon_start=1
                     /gene="dbpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071179.1"
                     /locus_tag="PA25_00850"
                     /product="ATP-dependent RNA helicase"
                     /protein_id="BBN80100.1"
                     /transl_table=11
                     /translation="MNTAAFNTLPLATEFLNTLADLGFKSMTPVQAQSLPVVLSGKDV
                     IAQAKTGSGKTVAFSLGVLSRLNVNRYRVQGLVLCPTRELAEQVAAEMRKLARGIHNI
                     KILTLCGGVPIGPQIGSLEHGAHIIVGTPGRVEDHLFKGTLNLTEVSSLVLDEADQML
                     DMGFADVLDNIVSYLPQQRQTLLFSATYQKRIEEIAERVMQNPQMVKVEEQVVNTSIK
                     QLFFKLDNNKLRFNTLRLLLLQHKPQSCVVFCNTKVETQKVCDELKASGFNVVALHGD
                     LEQREREQTLIRFANKSASVLVATDVAARGLDIDDMDMVINYHLAHDSQTHVHRVGRT
                     GRGGKKGLACSIYGESEAFKVAQIGDVYDRDFEPSPMPSLNLLDKPPYKPDMITLQID
                     GGKKQKIRPGDIVGSLTGEQGIAFAQIGKINVLDNSAYVAVAREAAKPAFRKLSEGKL
                     KGRKFRVRRIN"
     CDS             complement(99291..99875)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011263300.1"
                     /locus_tag="PA25_00860"
                     /product="molecular chaperone DnaJ"
                     /protein_id="BBN80101.1"
                     /transl_table=11
                     /translation="MLNPLIDAIFIAISDQQIHKVHTIGHAINVNEILPKLDEEPYKD
                     LFKKNFLIMNALFQLQQELINEGFYLHVSSMHIQLSEHKKNTPIGKDTLRDYYLNWAN
                     YETSKQEIVELLDSFWQRLNTLKPMTHTPIDKIKALCSKWQLSYPYDVRQLKTCWRQY
                     AVTHHPDKASGCAEHFKQLKNEYELLKAHIMTLS"
     CDS             99968..102790
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00870"
                     /product="hypothetical protein"
                     /protein_id="BBN80102.1"
                     /transl_table=11
                     /translation="MVIYATLLFNSLVTPLSHASSELSTPQSLAAQIEQLADLDDWQD
                     ISIKGHQLLSHPNITDKQHFDVLKVLAKAAFNRDDFATTERYLKEIEAQYKQMPLSEG
                     YYFATKLLAINTFHQGKYNTAVELYKKALSIATKRKQPLEQAHMHNNLGLVYVETNEL
                     SRAITHYGEAQKLYQQQGNLQDEADIMLNLSALYIRQYQFDTAQEMIGTVIKYFEELN
                     DNYGIALANSYLGELYSKKGLNLSARHYYQAAIDYYEAENNTDLLMVQYTYLANVSIA
                     QGNFELAEKEANFALYYAEKINSKSGRMRALFPLAKSLFAKGEVNMALKMVEESFELA
                     KQLGARYLEREELATLALLQASVGQHKQALESFTQYKTEQSEYLNENVLAKMVDYQNR
                     IEAAELNREIMELKQNQALQALQIDKREQVIWLSAMVVLSLFIAVVSLYYKQAEKNAK
                     VELREKVAERTAELQRVADELRKANQVKNQFLANISHEIRTPLTSIIGQAEAMLNDHA
                     SNPDLQVSLGVIQRQGEHLKGLVSDVLDLSRIEAQRLELEYTEFTAKSLLNDISDMFH
                     NACKVKGLEFSVKGDFDDSVIVKLDYMRVKQILINLLGNAVKFTEQGKVGLHVSCHPS
                     GLVFKVFDTGIGMSPEQLGRVFESFQQGDNSITRRFGGSGLGLCLSQQLTEIMDGSIS
                     VNSQLDKGSEFIVFIPCSPEHSELPNHEEQPQTIIWEHGKVLVAEDHDDNRALFKRIL
                     EQLGLEVLAAKNGEEAVEICLREYPDIVFMDIQMPKMDGVEALNLLHLSGFDQPVYAL
                     TANVMEHEIKSYLKVGFTGHLGKPLDRKMLLKVLQRHISVTSVAPLSQLDMSDLASSF
                     VATLASERASIIEFWQTQQWFNLQRACHRLSGAASTFNFGSLANIARQLESVLKNEEY
                     KQAENLYLILCDELEFLSLSEQLDVG"
     CDS             complement(102767..104029)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00880"
                     /product="hypothetical protein"
                     /protein_id="BBN80103.1"
                     /transl_table=11
                     /translation="MKNAPFILLFLSSHALLIIGVSLFFSLQFVIILTLLGVTLGCTL
                     CFFYYQSCKRPRTEYLEQLLHALVKESNVDLTFRFDETNRNLPKVCFALNASLATIEH
                     MIGEIHASSARLYPMADNLRDTYASMTQKASIQHAHGQDLAASINRILAVSRELDENL
                     DKIYHSVEDATIAVKQTRKDTDKSQQSLLGLVDNIEQTSKQISTLKTDSDAISSVIEV
                     INAIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLAARTSQSTQQVRDMVTKIQ
                     LGTDSAHKLMQEALAQTEQTVSLSEASTKEVDQIEQAMISVNDMSQNIHTQVEQQKAV
                     YDEAQTSIESMVELNSDALSSSKIQAVSSSDLLNLAVTIRDKLSLFNVDFASVDTSQR
                     EAKVAEQKQETQSSSTSKKDDSANVELF"
     CDS             complement(104154..105413)
                     /codon_start=1
                     /gene="rho"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87KH7"
                     /locus_tag="PA25_00890"
                     /product="transcription termination factor Rho"
                     /protein_id="BBN80104.1"
                     /transl_table=11
                     /translation="MHLRELKDKSINELVKLAESMGLENVARLRKQDIIFAILKAHAK
                     SGENIYGGGVLEILQDGFGFLRSSEASYLAGPDDIYVSPSQIRRFSMRTGDTISGLIR
                     PPKDGERYFALLKVNEVNFDKPENSRTKILFENLTPIHANERFVMERGNGSTEDITAR
                     VLDLASPIGRGQRALIVAPPKAGKTMLLQNIAQSITYNNPDATLMVLLIDERPEEVTE
                     MQRLVKGEVIASTFDEPANRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNT
                     VIPSSGKVLTGGVDANALHKPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEE
                     FKGTGNMELHLNRKIAEKRVFPAIDFNRSGTRREELLTKADELQKMWILRKIVHEMSE
                     IDAMEFLIDKLSMSKTNDEFFDLMRRK"
     CDS             complement(105621..105947)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KV51"
                     /locus_tag="PA25_00900"
                     /product="thioredoxin"
                     /protein_id="BBN80105.1"
                     /transl_table=11
                     /translation="MSDKIIQLTDDSFEADVLKSDKPVLVDFWAEWCGPCKMIAPILN
                     EVAEEYADKVTIGKLNIDQNAGTPPKFGIRGIPTLLLFKDGAVVATKVGALSKTQLIE
                     FLDSNA"
     CDS             106039..107310
                     /codon_start=1
                     /gene="rhlB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87KH5"
                     /locus_tag="PA25_00910"
                     /product="ATP-dependent RNA helicase RhlB"
                     /protein_id="BBN80106.1"
                     /transl_table=11
                     /translation="MTKTHLTNKKFSDFALAPEVVAGLTENGFEYCTPIQAKCLPFII
                     AGRDIAGQAQTGTGKTLAFLTATCHRLLQKEGASRKHPRALIMAPTRELAIQIHKDAK
                     VIAPQCNLKLGLIYGGEDYEKQRTQLENGVDILIGTTGRLIDFYKQGAYSLNEIEVVV
                     LDEADRMFDLGFIKDIRYLFNRMPDTSSRLNLLFSATLSYRVQELAFEHMTNPEHVQI
                     EPDVKTGKRIQEELFHPSHDDKIPLLLTLIEEEWPEKAIVFANTKQSCENVYAWLKAD
                     GHRVGLLTGDVNQKKRQSILAQFSKGEVDFLVATDVAARGLHIPEVSHVFNFDLPDDC
                     EDYVHRIGRTGRAGASGHAISFACEQYAYNLHEIEAYIEHSIPLSHYDKTALLDDITK
                     PNIQRKRNYPSGPRNRNNGRRQGSYQKQRSN"
     CDS             107357..108859
                     /codon_start=1
                     /gene="gppA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E8U7"
                     /locus_tag="PA25_00920"
                     /product="guanosine-5'-triphosphate,3'-diphosphate
                     pyrophosphatase"
                     /protein_id="BBN80107.1"
                     /transl_table=11
                     /translation="MVQKIPQSDVFAVIDLGSNSFHMLIARHAAGGVHTIGRVKRKVR
                     LAAGLDKHNILSNEAMERGWECLALFAERLQDIPKQNISIVATATLRLAKNAEEFKAR
                     AEQILQNKVNVISGELEAKTIYKGVAHTSACQGRQLVIDIGGASTEVVIGKGFDALLY
                     KSLNMGCVTYLEQFFSDGTLSSKNFSNAILAAQKVVKPIQQDFIATGWELAIGASGTV
                     QAIQEILAANGLSDMLTLQKLEEIQSQAMSCKTIKQLDLPGLSEERRLVFVSGLAILI
                     ALFRSLKINQMGLAGGALREGVLYSMIPELHNSDICKRTLNNFMVRYHVDKQQASYVA
                     ELSVSLAKQLSTAWQLDIGNVQKVLSAVACVHEVGLIVDYKLYHKHSAYILSHTDMPG
                     FSKIEKQIIVGLTASHRGDLDVKLFQTLGAQELYTQRLTRIIRLAVILSMRRRDDIVP
                     PVLIDVSDDEVLSLSFEADWLAQHPLMQSELEQEAQYQSRVGWDIQIKRN"
     CDS             complement(110728..110919)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00930"
                     /product="hypothetical protein"
                     /protein_id="BBN80108.1"
                     /transl_table=11
                     /translation="MIQPQVPLGLPCYDFTPVMNHSVVNVLPKVRLSTSGATHSHGVT
                     GGVYKARERIHRGILIRDY"
     CDS             complement(114501..115286)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001881385.1"
                     /locus_tag="PA25_00940"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BBN80109.1"
                     /transl_table=11
                     /translation="MVLRQLLYLSLLVNAGVCTALSPPKTIYISTGQWPPYMDQGRRD
                     QGCVAKLIRDAFALSNLKVRFVFMPWDRAYQEGQKKAFSGSAYWYFSEQRAQDYIYTK
                     TPVTTEVSRFYHLTSLNLNYQTYKDLAPYRLVLNQGLTYPDELLEAIERHDISIVNAT
                     YTTKNLSFLLRERADVVILTEQTKTEYAKTLTQEQNKLITFQDKPAFVTQGYLLINKH
                     SAQYVSIFDVGVKTLWQDRAYFDNYIKSCLRLKSDVNITPQGE"
     CDS             115360..116058
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011263026.1"
                     /locus_tag="PA25_00950"
                     /product="DNA-3-methyladenine glycosylase"
                     /protein_id="BBN80110.1"
                     /transl_table=11
                     /translation="MDTFKTILASASERKGGKRNVLSLLTEPSTQQQLEKLTDSDWLE
                     EFTRKVFQSGFYWNVIDAKWHGFREVFWDFDVDKLLMMSPDMLEQRASDERIVRNYKK
                     VMTIAHNCMMIYEVAQEHGSFSQFIAQWPTDDITGLWLYLKKHGARLGGNTGPFALRV
                     LGKDTFILSRDVESYLRAHGIIDGGLHSKKSLVATQNFFNTLVSQSGWSLQSLSQLIA
                     LSVGDNIVHSVEAS"
     CDS             116055..117506
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q6HFT0"
                     /locus_tag="PA25_00960"
                     /product="UPF0061 protein"
                     /protein_id="BBN80111.1"
                     /transl_table=11
                     /translation="MSFFDRYTQLGSQFAVMHSPRLANSVNPEKLNLLLWNEDVANKY
                     AIAIDKGQAHLYLSGHTPLKNSTASALAYSGHQFGHFNPTLGDGRAHIIGSFNDNSGN
                     TYDLQLKGSGATPFSRGGDGLCALGPAVREFVMSQAIDALGVPTTECLSVVATGDDVY
                     RESLLPGAIVCRVASSHIRVGSFQYLALQQDKKGLQQLLDMAIERYYPEITAQGDDRL
                     VEFLRAVCKKQVALIIHWMRVGFVHGVMNTDNTLVGGETIDYGPCAMLEGFSFEQVFS
                     SIDRHGRYAFGQQPNIASWNCARLAESLLMLFAANEKHAVERMSDVLAEYASDFNNQY
                     QLMWANKLGLLEWREDDASLLSELLGILKTEGLDYTNSFAALTNLTFENPLSCFEVPK
                     ELSPWLPKWRARINEYNRSQVCALMRSVNPAIIPRNALLEQVIQDYYEQGQSKLLEHW
                     LPLLKAPYQYQEYEQCYLEFTSKSASYKTFCGT"
     CDS             117522..119297
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261885.1"
                     /locus_tag="PA25_00970"
                     /product="transporter"
                     /protein_id="BBN80112.1"
                     /transl_table=11
                     /translation="MTQTLTWQSIKRQVLAHKRPLLIAHVIAFFAALVSVPIPLMMPL
                     LVDEVLLEKPGPAIDFLNGLLPVDWQQSAVYIVIVLLSVMCMRLAALVLGVIQSRQFT
                     IIGKDISLNIRERLLIHLPKVKLKEYETQGAAAISSRCITDVETLDQFISQTLSRFLI
                     GLLTIIGTAIVLLWIDLTLGLVILLLNPAVIYFSRQFGKRVKHLKKDENAAFEAFQAA
                     LVETLDAIAQLKAVRRETSYFEHVRSTAADLKYFAVQSQWKTDAVNRLSFTVFLLGFE
                     VFRAIAMLMVVFADLTVGQIFAVFGYLWFMMGPVQELLGIQYAYYGASAALQRLNQVF
                     AFKTEAAAPKQNSFVFEQSKIGISFQHVSFAYQPELPVLQDVSLEIPAGKKVAVVAVS
                     GGGKSTLVQLLLGLYEKHSGSIEIAGTPVEQIGYQNIRENIATVLQQPILFNSTIRDN
                     LSLGREHSDEQLWHALKVAELDSTVRSIDGGLDALVGRNGIRLSGGQKQRLAIARMVL
                     CDPKVVILDEATSALDIETESKIHNNLKAFLHNRTTLIIAHRLSAIRQADLIYVLDDG
                     RISQAGDHHSLLSEEGLYQTLFGHR"
     CDS             119414..120457
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_00980"
                     /product="hypothetical protein"
                     /protein_id="BBN80113.1"
                     /transl_table=11
                     /translation="MKFKSISLAIATLLAASAVNANEHKEGVHFGVFGDYYKADWNDV
                     RDAASVDVDDSTGWGAEIGYRFNNNWSARLEYADMDFDLSGASTGSMDADRFGVDALY
                     HFDDSPFYGLVGLKAVDVYKSLTFANVGAGYRHYFNNNFFVNAEAAVYQGLDRGYTDV
                     GAKLGINYFFGSSAPAKKVEPAPAPVQQPVAKDSDKDGVMDSDDRCANTPMSDAVDSS
                     GCTKYEERQVSVKLLVRFPHDASKVNQQYFDDINEVVAFMKEYESATVVLEGHASVVG
                     DAKYNQALSERRAQAVAKQMMSDGIAAERISTIGYGEERLKNTANTKEAHAQNRRVEA
                     TVTSTDRVKVKRQ"
     CDS             complement(120504..121235)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010973830.1"
                     /locus_tag="PA25_00990"
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="BBN80114.1"
                     /transl_table=11
                     /translation="MLNYSSTNNNTKSFMHYLPAHPFKPLLNFPYHCCTFDVDQFEQT
                     DFPKNNVVMPAKLANAVPKRRAEYLAGRICAHTALAQMGIEHVCVETAEDRAPIWPQN
                     IIGSISHTQGIALAMTALEHQLQGLGIDIEKHMSRSQETKLKGQILHPLETGIHTTLE
                     QYVPCPLTVIFSAKESIYKALYPSVKRFFGFEAAQLIDFDSQKLLFVITESLSPSVQK
                     GMQVEVCYQLNEQLVLTECAFKSAQ"
     CDS             complement(121268..121657)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01000"
                     /product="hypothetical protein"
                     /protein_id="BBN80115.1"
                     /transl_table=11
                     /translation="MISRASYLLLGCIFTLVGCKHSQPTMTYKAHLANTSPAVKKQLQ
                     DAIVQLKGGVAPQLADNVFMRSSTLILEQGMNQHGYEPILGQHDISVTRFELLMKDGL
                     CVLYYPKKDKYLNLTDLQCNVQPSTEK"
     CDS             complement(121658..123031)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005480646.1"
                     /locus_tag="PA25_01010"
                     /product="peptidase S41"
                     /protein_id="BBN80116.1"
                     /transl_table=11
                     /translation="MLEKLWLRSFSHETYLWYDEIPDQNPSTFDSIKAYFNSLKTSAT
                     TASGKQKDQFHFSESYEDYKKESQSGVSASYGVRWAFVNRTPPRVIRVAYIQENSPAA
                     QAGLERGDTIAAIDGIDISATSSNELAAINNALIPQAGDSHTFTLLKNNGSINEVSLI
                     AGDIASTPVRQHQVTTINDRRVGYLQFDQFISVGQRPLIEAFEVFAQKNVSELVLDLR
                     YNGGGLINMASQLAYMIAGPTNTGAGPNNSGRVFSNTVYNDKRTAENRAMGFEYRVID
                     WEEQVYTDETLPSINLDRVYILTTNSTCSASELVINALRGIDVDVVMIGAPTCGKPYG
                     FFPTANCGQVYYTVQFRSENAKGFGDYADGFLPVPSGQNNVELGLSNRVSGCTVGDDF
                     SRALGSPDEALFAAALNYMNTGQCPQKTANRAIQGASMNAYGPAIDIPMHPLRNGAVT
                     LPIKESH"
     CDS             123517..123894
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01020"
                     /product="hypothetical protein"
                     /protein_id="BBN80117.1"
                     /transl_table=11
                     /translation="MSEIQFLNVDLELESKHDISALVSDLKQNAIVLHYDKDEYRQLA
                     RIEADADVLSPDKAINHLCELIESCSKAALKQWLSCTKRTFDIGFNSGTSPKCYSQAL
                     HADTLLRISAIGAGLEITLYPTE"
     CDS             124144..125304
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001881437.1"
                     /locus_tag="PA25_01030"
                     /product="hypothetical protein"
                     /protein_id="BBN80118.1"
                     /transl_table=11
                     /translation="MKKLTQLALPALLVAMSLHGQAAASTLQVQQVFPALDVYNPASD
                     QIAGMKQQLAHQLAKQLPSISTHLQAQMSQYRLQVPLSENVVSGTLAKQLQSATDYTR
                     VLKGLPSSADSLYQLRLADVAMLERWQQGEEVLIAFAPKGDDKTWLHVEAYDQQGNTH
                     LLDAHTLPKQPVLVLEIDGRQSMKEGLAVMQSVFDNRLGKTEPLSTEIQSDAQPISTS
                     VLKRIRLNDDEEPWILGAAEVYGVVTGVDPSRDEPVLDIVDMPYLDHDGRDYTPNQIV
                     IHWERYRWQAADMLLMEQDDNTNYQTLATTFLDIVTQVMRTIPDPNVQGYAIIPQLTN
                     QLIKAMPSSWFTNDDDYVDVFYTLFEGQQYTDHMGASGNAKVSLSPLTINPR"
     CDS             complement(125404..127044)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005458327.1"
                     /locus_tag="PA25_01040"
                     /product="endonuclease I"
                     /protein_id="BBN80119.1"
                     /transl_table=11
                     /translation="MKHGKLSFKHKLALVIGLTSLSQSSLAQVINGDFEVWQQNQPSG
                     WTTVDSGVALSATSDQIKSGQTAARVTVNTSTQSNTDLLQQVSVQAGQSYTFSTWVYH
                     TEGGVKARLIVDGYHGYSDPFTLNQWQQISHTYTATANATINVGLRFYDGTGFDGSEI
                     VYIDNFQPTEATPPPPTNTCQATSLNLSLTTDNYGSETSWTLTNSSNTQVASGSGYAS
                     NKSYSETLCVNDDSYTFTILDSYGDGMCCSYGNGAYSLTGPSGTLAQGSSFTTQQQHT
                     FTIGNGGGNGGGTPTDPSEYYASTTGLTGYALKSQLHSIISTHQSQGYSAIWQFIDQS
                     ERDNYFEKDNSVLDRYSEQPNGADSITYVAVTNQCGSYSSEGDCYNREHSFPKSWFGG
                     KIEPMNSDIHHIFATDGFVNSKRSNFPFGEVASATYVSSNGSKLGNASSTLNYTGTVF
                     EPIDQFKGDFARAYFYMATRYENVISNWQNNTTYSDAVLNGTSTQVFEPWVVAMLLRW
                     HQADPVDDLERARNQAAHEFQGNRNPFVDHPEFVQQIW"
     CDS             127346..129154
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KNK9"
                     /locus_tag="PA25_01050"
                     /product="sulfite reductase [NADPH] flavoprotein
                     alpha-component"
                     /protein_id="BBN80120.1"
                     /transl_table=11
                     /translation="MLLGQLSAAASPLTQEQVQKLQGLVAELNPIQQAWVSGYLAANA
                     NTASLAGNVGAAGSAVEAAPLTILYGSQTGNAKAVASQLKSQAEARGLSVKLVNMADY
                     KTSALKKEKFLAIAVSTYGEGEPPEDAEALHAFLASKKAPKLDGVKVAVIGLGDTSYE
                     FFCQTAKDFEQRLTKLGADVAYQRADLDVDYEEQATQWIAGALDVFEPDLKAQQQSQN
                     NVVSMGLSAPVAQSQYTKQNPFAAELSVVQKITGRDSTKDVRHVEISLEGSDITYLPG
                     DSLGVYFLNDEVLVDKVLAALEIAPETSVTIGSEALSVRTALIEKLELTQSYPGFVEK
                     YAQATNNAQLLALVEDKAALREYIEARQIFDVILQNPAKIAAQTLVECARKLQARLYS
                     IASSQAEVEDEVHLTVGLVEFDAFGEKHFGGCSGYLANRAEEGVKVKVFSEHNDNFRL
                     PANDETPVIMVGPGTGIAPFRAFLQEREVREANGDNWLFFGNPHFTQDFLYQVEIQGY
                     VKSGLLNKVDLAFSRDQAQKIYVQDRLREKGEEVFAWLEKGAHFYVCGDANRMAKDVH
                     QALIDIVKAHGGKDDEQAEQYLKELRSQNRYQKDVY"
     CDS             129204..130922
                     /codon_start=1
                     /gene="cysI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E840"
                     /locus_tag="PA25_01060"
                     /product="sulfite reductase [NADPH] hemoprotein
                     beta-component"
                     /protein_id="BBN80121.1"
                     /transl_table=11
                     /translation="MSTDYKPNSKLDPNAKFADNERLKTQSNFLRGTIEADLKDQLTG
                     GFTADNFQLIRFHGMYQQDDRDIRPERTKQKLEPLHNVMLRARMPGGIIKPQQWLAID
                     KFAQEKSMYGSIRLTTRQTFQFHGVLKPNIKEMHQMLNSVGIDSIATAGDVNRNVLCT
                     TNPVESELHQEAYEWATKISEHLLPHTKAYAEIWLNGEKTETTEEPILGSTYLPRKFK
                     TTVTIPPNNEVDVHANDLNFVAIADNGKLVGFNVLVGGGLAMTHGDVNTYPRKADDFG
                     FIALEHTLKIAEHVVSVQRDWGNRVNRKNAKTKYTLDTFGADAFKAEVEKRAGVTFEE
                     SRPYEFTHRGDRIGWVEGIDGKHHLTLFIENGRILDYPDKPLKTGCRKIAEIHQGDFR
                     MTANQNLIIAGVPSEQKALIEQIAREHGLINDAHTNQRKNSMACVALPTCPLAMAEAE
                     RYLPDLVTQVEGLLEKHGVADDNIILRVVGCPNGCGRAMLAEVGLVGKGLGKYNVYLG
                     GNRQGTRVPKLYLENVGEEVYLPALDELIGQWVSERQEDECFGDFVIRKGIVAEVKVS
                     KTDFHA"
     CDS             130969..131709
                     /codon_start=1
                     /gene="cysH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A1JJS4"
                     /locus_tag="PA25_01070"
                     /product="phosphoadenosine phosphosulfate reductase"
                     /protein_id="BBN80122.1"
                     /transl_table=11
                     /translation="MSDYKTLLQLDGEEQAALLAQANELLKPMTPQQRVAWALEHLPD
                     TAFLSSSFGIQAAVMLHLVTSERADIPVVLTDTGYLFPETYQFVDHLTERLNLNLKVY
                     RAALSPAWQEAKFGKLWEQGQDGIKQYNTLNKVEPMTRALQELSAGTWFSGLRRDQAS
                     SRADKQTLEISRGTVKVYPIIEWSNRDVYQYLTKHDLPYHPLWEQGYVSMGDVHTTRK
                     LEPGMSEEETRFFGLNRECGLHIDGDGI"
     CDS             131824..132342
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01080"
                     /product="hypothetical protein"
                     /protein_id="BBN80123.1"
                     /transl_table=11
                     /translation="MKYFSYLMIMVMLVGVGSLFILKKPDGTPWLSFGDVTWQAQQKA
                     STLLNEAKSNFNQVVNESNVDSSNSSSNSGAIYKWQDANGNWVYSDTPNTQGNSQTHT
                     LDASRITVMAAEDTSILKELAAQKAQIDTQLSNPSALNPNDVKKLMQDAKNIQKLMDE
                     RTQRLDQAIEGN"
     CDS             complement(132471..133577)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003112621.1"
                     /locus_tag="PA25_01090"
                     /product="hypothetical protein"
                     /protein_id="BBN80124.1"
                     /transl_table=11
                     /translation="MEHIQTLVIGAGAVGLAIAAELSEHHDVVVIEQNTHFGEHTSSR
                     NSEVVHAGIYYPSNSLKAQLCIEGKALLYQHCQSYHVPYKKVGKVLVAHGEREIAKLH
                     ALVQQAEDNNVQDLAFLSQAELAKKAPQVKASLGVWSPSTGIVDSHQLMLSYLNKLSA
                     HAGQYVNNTRFVRAQFDGQHFIVTLNCDGELFNLKCTTLINAAGLFAQSCAKQIDALD
                     ARFIPELYYCKGQYFSYQGSHPFQHLIYPMPEQQGLGIHATIDMAGQLRFGPDTTFID
                     TLDYTPNAQAKAHFVKEIIKYWPNLDSSRLHVSYSGIRPKLFRNGAQDFVIQDHTVHG
                     IQGLINLFGIESPGLTASLAIAQHVVNKVTRPLG"
     CDS             133731..134474
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010939681.1"
                     /locus_tag="PA25_01100"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BBN80125.1"
                     /transl_table=11
                     /translation="MSKQLKVVLIALTFFVSISHAQVSKVIGGHNPWPPYIESDGSGL
                     VRDILLAAFGSQGMELEIQIAPFSRMIVLLEKREVDFIAALWWTEKRHKTILFSQPYF
                     HNELAVVSKKNKLINFRGAKSLQYKSVAAIRGYAYHDLLQSIEQLKVIDVHSLHACLE
                     LVHKERADFAIADQLAFKHELRLDPSLNDLVAHSPVLLSWPLHIGVNRAHPNAKEIIR
                     RFNQGLMQIKREGRYQQIIAKYFGEHAQR"
     CDS             complement(134443..134895)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071322.1"
                     /locus_tag="PA25_01110"
                     /product="esterase"
                     /protein_id="BBN80126.1"
                     /transl_table=11
                     /translation="MAIWYKPITLELCQQLDEGMHGKGSLMKTLGIQISEIGDDYLVA
                     TMPATTAHHNPIGMVHGGANVALAETVASYAANFAVDFEQYYCVGQEINANHLKASRN
                     GMLTATAKPLHLGKRTSVWEVKITNAKGELCCVSRMTAAIVARARQNT"
     CDS             complement(135011..137749)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9WHM1"
                     /locus_tag="PA25_01120"
                     /product="aconitate hydratase"
                     /protein_id="BBN80127.1"
                     /transl_table=11
                     /translation="MQNSYSTLTQLTVNQQQVHLHSLDKLGAKARRLPFSLKILLENL
                     LRHEDGRAVTKEDIDHLLNWQPDATPNKEIAFTPARVVMQDFTGVPAIVDLAAMRDAM
                     ARLGGDPKKINPLSPAELVIDHSVQVDEYGHSGAFDLNAKLEYQRNKERYEFLRWGQS
                     AFNNLTVVPPATGIVHQVNLEYLARVVFQSEVDGETFAYPDTLVGTDSHTTMINGLGV
                     LGWGVGGIEAEAAMLGQPISLLIPQVVGFKLEGELPEGTTATDLVLTITQILREHGVV
                     GKFVEFYGNGLSQLPLADRATIANMAPEYGATCGIFPIDEETLTYLRLTNRDEQQLAL
                     IEAYAKHQGMWRYDGDEPEYSDTFTLDLSTVVPSIAGPSRPQDRINLDAAGTLINEQL
                     KAMQDKRSEQSTSLPEAQIVDEGGQPADASTESEVLGFAQVTYQGETFSLKDGACVIA
                     AITSCTNTSNPSVILAAALVAKKANELGVKPKPWVKTSLAPGSKVVTDYLKQANLMTH
                     LEALGFDLVGYGCTTCIGNSGPLPEEISQAINKHKLVVSSVLSGNRNFEGRIHQDVKM
                     NFLASPPLVVAYALAGRTNIDVYNEPLCQNEAGKDIYLKDIWPSVSEVKQLVNKTVTQ
                     TMFASNYSNVYQGDENWQNISTESSELYPWQSDSTYIRHAPFFENMTTEVPKLPHIAG
                     AKCLAKLADSVTTDHISPAGNIKKDAPAGLYLEQQGIKESNFNSYGSRRGNHEVMMRG
                     TFANIRLRNQLAPGTEGGITRLLPDDEIMSIYDAAMEYQKRDTPLIILAGKEYGTGSS
                     RDWAAKGSLLLGVKAVIAQSYERIHRSNLIGMGVLPLQFKAGDSHESLELTGEEDFEV
                     MGLCDNCDEVKIIATHEQNNSKEFLVDVRIDTPKEWDYYRHGGILQYVLRNMLSEN"
     CDS             complement(137877..138254)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01130"
                     /product="hypothetical protein"
                     /protein_id="BBN80128.1"
                     /transl_table=11
                     /translation="MLEQPLEYIEIELEEEPIELCNLLKVLDLAETGGQAKMLISEGY
                     VAVNHELCTVKRKKLYAGDTLEFDGEHYQLTLAQGVKPAERPVHENPTNAVQDAPSQR
                     KKRNRSRKDKKDSNTGRKPISFG"
     CDS             138425..138709
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01140"
                     /product="hypothetical protein"
                     /protein_id="BBN80129.1"
                     /transl_table=11
                     /translation="MGIRSALKKELMNLDSLDLMTADDVRGYLQTHIEQVEGKSAQHF
                     NLIARFNAQHNQIQSGLPAQKSMFTHQRHRLFKEVLYSKTEVQKWVSQHV"
     CDS             138854..139597
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01150"
                     /product="hypothetical protein"
                     /protein_id="BBN80130.1"
                     /transl_table=11
                     /translation="MIKYLCLAFSLFLSCALIAQSFVINVSEDVAYQMGKDKVRKSLE
                     IIYAPLAIKPTLVFIPSRRGLSLLNRGEIDADAGRIDSAMISYENVLQVPYPLSTIRL
                     FIYCIRPDDCMLSEGAEHLIVKGTVISELYCKKRRLKCNIVANDVSAFSALAKGFAPT
                     LIANDRFSVGTLCASKIEEIYAKPLTGVLKAYHYVHKKHADLVPKLTESITALMSRNI
                     LQNSFQSLTDTASACGVKLTIMENMTLSE"
     CDS             complement(139611..140351)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01160"
                     /product="hypothetical protein"
                     /protein_id="BBN80131.1"
                     /transl_table=11
                     /translation="MSKYITLLISLFVYSHVYARPYTINASEGLAYELGQEKVIDAMN
                     AIYAPLSITPEVIFLPSRRGLQLVDNGQLDAEAGRIEGAVHNYQNLIKISYPLSQTRL
                     SIYCIQAQNCSATANSSAVTIQGGLIAQQFCKKQHLNCTQVMNDISAFKALEKHHAPA
                     IIANDRFALATICESGLRKLYTRPLTKELPIHHYVHNKHAALVPKITKSIEQLVQSSA
                     LPNTFQSLSDAANECGVILTEIENNNIE"
     CDS             140483..141148
                     /codon_start=1
                     /gene="fabG_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011124862.1"
                     /locus_tag="PA25_01170"
                     /product="short-chain dehydrogenase"
                     /protein_id="BBN80132.1"
                     /transl_table=11
                     /translation="MRQHILVTGANRGIGLEFCRQLSEQGNEVTAVVRKPSAALEALD
                     VEIISGVDVSNAQQVTQLASQLSGKAIDILINNAGIFESETLANMDFDAIEKQLQVNA
                     LAPLRVVHALLPNLKENSKIAMITSRMGSIADNSSGGYIGYRMSKAALNAASVSLAHE
                     LKGKGIAVGLFHPGFVQTQMVNFAGDISPEVAAERLCKRIDSLTLENTGGFWHSNGET
                     LPW"
     CDS             141272..141637
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01180"
                     /product="hypothetical protein"
                     /protein_id="BBN80133.1"
                     /transl_table=11
                     /translation="MDLSENTPLVLPLFLLNDTIEQRDIEHPDLTLEVTLDETLLANL
                     CQNPSIEENISINLAQYSLSAHETEYETAISSAHQAQLILNHGPVLSAVVSLESELVF
                     ISPPMEMMPTFDLGEEEDN"
     CDS             141637..143982
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011106322.1"
                     /locus_tag="PA25_01190"
                     /product="9-hexadecenoic acid cis-trans isomerase"
                     /protein_id="BBN80134.1"
                     /transl_table=11
                     /translation="MMVRAWWMLGVAVILCGCVTLGMSHYDDMYGHPSVQVRNVEHTQ
                     GQGSEYLQLVKPIIDQRCVVCHGCYDAPCQLKLSSPEGIDRGLSKERVYHGTRLLAQD
                     PSRLLFDATSTQQWRDKSFAPVLNERAQSEQANLAGSVLYNSLLLKLSHPFAQEGLLG
                     EEFDFSLDREQSCPSMDEFDSFAKKQPHGGMPYGLPAISQGEFKQLERWLKTGAKMAQ
                     IAPPLEAELRQVSRWEQFLNQSGLKHQLAARYIYEHWYLAHIYFPEQNSSTSPSFFKL
                     VRSKTPPGEPIELIATRRPYDDPQVTRVYYRLMHERSSILSKTHMPLALSDKKMARLY
                     EQFIAPDFKVTQLPSYEPEVASNPFKAFSAIPVKSKYQFMLDEAELIIKGYIKGPVCR
                     GQVALNVINDHFWVAFIDPQKNSVPAVSELLMRHEDDLALPAQEQSNALPISSWVKYA
                     NRQHEYIRAKTQLANELLADGQLLTTDLIWQGDGNNGNAALTVFRHFDSATVVKGFVG
                     QAPKTMWLLDYALFERIHYLLVAGFDVFGNIGHQLHTRLYMDFLRLEGEQNFINLLPQ
                     NVRQKVKNHWYRRSSVSLSEFINRKTLLATPSGIEYTTDNPKEELYAKIAAALQPVLS
                     ERYSYKAVAEPLAKLNDLPYKAINFLPQVSFILQRQPNGEHKAFTLIHHNAHYNVSSL
                     LNEEAQRAFEEDTATLVPGFIGDYPEAIWYLADEANTQAFVSQLQKVTSERQYRALTQ
                     AYAIRRTHPQFWQYSDLLHDVAKQYRGVEYGLFDYNRLENR"
     CDS             144075..144695
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01200"
                     /product="hypothetical protein"
                     /protein_id="BBN80135.1"
                     /transl_table=11
                     /translation="MSANITKLAVMLEMQNAMNTKVHEQWFNQGFEWYRAIWVECAEM
                     LDHYGWKWWKKQTPDTEQVILELVDIFHFGLSLRIDGKTSYQALAEQLEGELSQPLAG
                     DNFKQTLETLAASAVADKQFNAQAFAGCMQQIGMDIDDLYRGYVGKNTLNFFRQDHGY
                     KEGTYIKVWNGQEDNEHLVEVVKSLDTEHPDFAKNVYAGLQARYPS"
     CDS             complement(144700..145362)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003114065.1"
                     /locus_tag="PA25_01210"
                     /product="hydrolase"
                     /protein_id="BBN80136.1"
                     /transl_table=11
                     /translation="MPMLNWSEIDTVLFDMDGTLLDLHFDSHFWLHVIPTEHAKKQNI
                     SFEAAKADILKRYEAVHGQIQWYCLDYWQEQLGLPIMALKREIQDLISVREDVPEFLT
                     ALKDAGKELILLTNAHPDSLSLKIELADFAHYLDALISTHHYGVSKESQSLWQQVQAD
                     LGFDKQRTLFVDDSLSVLNAAKEFGIGHLLAVANPDSKQPVNVITDYLSITDYRTLLP
                     IK"
     CDS             145417..145980
                     /codon_start=1
                     /gene="nudE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070586.1"
                     /locus_tag="PA25_01220"
                     /product="ADP compounds hydrolase NudE"
                     /protein_id="BBN80137.1"
                     /transl_table=11
                     /translation="MSQKKHPIPPEILHCEVTAKSRLFTVEALQLQFSNGEQRHYERI
                     RGGGRGAVMIVPITADNELLLVREYCAGTHNYQLGFPKGLIDLGETAIEAGNRELKEE
                     VGFGAKQFSDLKTLSLAPSYFNAQMHILVAKDLYPQKLEGDEPEPLVTVTWPVDKWQS
                     LLSQSDFTEARSVAALLLLQQYLATEV"
     CDS             145982..146776
                     /codon_start=1
                     /gene="cysQ_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070587.1"
                     /locus_tag="PA25_01230"
                     /product="3'(2'),5'-bisphosphate nucleotidase CysQ"
                     /protein_id="BBN80138.1"
                     /transl_table=11
                     /translation="MQKLLEPCIALAIKAGDAIMDIYQNEDVGAREKSDHTPVTEADL
                     AANEVLMAGLKALAPDIPIMSEETPIPALSLRETWQRYWLLDPMDGTGEFILQSGDFA
                     VNIALVENNQPVLGVIYWPSKQTTYYATKGHGAFKRTEQTQKQIFVAPPDSLTLAVSR
                     RQKLEAVSQYLNSHFDTVALGSCSLKACMIAEGKADCFLRVGPTGEWDTGASQVIVEE
                     AGGCITDAEFNPLTYNQREHTENPDFIVMGHPDWQWQKLITPHHRS"
     tRNA            146937..147013
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="PA25_t00030"
                     /product="tRNA-Met"
     tRNA            147081..147157
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="PA25_t00040"
                     /product="tRNA-Met"
     tRNA            147225..147301
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="PA25_t00050"
                     /product="tRNA-Met"
     CDS             complement(147651..148799)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011403681.1"
                     /locus_tag="PA25_01240"
                     /product="dipeptidase"
                     /protein_id="BBN80139.1"
                     /transl_table=11
                     /translation="MTLRFTLCALALSALSAQAQDYQASERAQRIAQKSILIDTHIDV
                     PYRIKDKWDDVSKATEGGDFDYPRAVKGGLNAPFMSIYIPANLEFEGKGKSYQLANQL
                     IDGMEALAFRAPDKFAIATSSKDIYTHFKQGKISIAMGMENGSPIEGELKNLKHFFDR
                     GVRYITLAHSQSNHISDSSYDIRRKWKGLSPFGKELVVEMNKIGMLIDVSHISDAAFY
                     QVMELSKVPVIASHSSLRKYTPGFERNMDDDMLKALKKNGGVIQINFGSSFVTSSARN
                     WYDQRNKADQREKYIKENPFPYATLEQVLDHIDHVVKLIGIDHVGIGSDYDGVGDSLP
                     VGLKDVSSYPNLVQGLLDRGYSEGQIKKILSGNTLRVWRQAEEYATQF"
     CDS             complement(148876..149124)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KGZ0"
                     /locus_tag="PA25_01250"
                     /product="UPF0270 protein"
                     /protein_id="BBN80140.1"
                     /transl_table=11
                     /translation="MIIPYQQIDKDTLNNLIEHYVLREGTDYGDQEFSTDAKVEHVKS
                     QLKTGEAIIVFSQLHESVNIVSKAQFQAMQSEEYAQYE"
     CDS             complement(149121..150101)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010947351.1"
                     /locus_tag="PA25_01260"
                     /product="alpha/beta hydrolase"
                     /protein_id="BBN80141.1"
                     /transl_table=11
                     /translation="MDYSFNSAWWMRNRHAQTILPRFFRPLQKVPVKFEELTTPDGDF
                     LELAWAHEKRPNAPLAIVLHGLEGNINSFYAKGMLKALTHKGFDAVLMHFRNCSRHAN
                     RLPRAYHSGETSDLGFLIKTLKQRFVDRPLYAVGFSLGGNVLAKYLGEQQALSGLQGA
                     AVISAPHHLSSSCQVIRKSCFGLYQKYLLDRMKRSFSRKLDTITDVLPVDEQKLRAID
                     DLWQFDNLITAPLHGFDDAEDYYAKASAQNYLKDITTPTLLIHAKDDPMLSSQAVPKA
                     EQVSAQVTLAVSETGGHVGFISGANPFKPQFWLEKVVPNYFNELDQRKLK"
     CDS             complement(150314..150454)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01270"
                     /product="hypothetical protein"
                     /protein_id="BBN80142.1"
                     /transl_table=11
                     /translation="MNVFFRDFFSDPVLFLSFGILGVVIGLCIFYVYYFIKKVQEAEV
                     PN"
     CDS             complement(150574..151038)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01280"
                     /product="hypothetical protein"
                     /protein_id="BBN80143.1"
                     /transl_table=11
                     /translation="MSTLDEQAFWQFSCAVYQQGSVQHTLLTLQNEQHKNINLCLLLY
                     YLDTLNLQLSHTTFVHLDALCQSLDAHLLAPHRKIRRSLKAQFITHSEYSEIRQQLLQ
                     SELQLEKLQQSELIRALNQGATTLKNPSNNLALYLNESQLQQLKMSFTTAKS"
     CDS             complement(151035..152954)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707314.1"
                     /locus_tag="PA25_01290"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBN80144.1"
                     /transl_table=11
                     /translation="MIQLSDIELLRGTKSLLKNASATLFPEHKVGLVGANGSGKSSLF
                     ALLKGELTLDAGELQIPKDWSIASVKQETPALEISALDYVLQGHPEYYQCRVALQEAE
                     QAQDGAKQAKVHQQLELMKGYSIEAKAGELLHGLGFSNEQITHSVSAFSGGWRMRLNL
                     AQALIRDADLLLLDEPTNHLDLDAVYWLERFLRAYTGTLVLISHDREFLDAVVDQIWH
                     IDQQKINVYKGHYSQFERQKAERMAQHQALFAKQQEQIAHLEKFITRFKAKASKAKQA
                     QSRVKALERMEKLAPAHADSPFDFEFAEPTTLPNPLMTLDGAQAGYGDVTILHKIKLN
                     LVPGSRIALLGRNGAGKSTLIKLLAGELKPQSGEVFMHQGLKVGYFAQHQLESLDLSA
                     SAVTHIQRLDPKASEQSLRDFLGGFAFHGDKALEPVAPFSGGEKARLVLAMLVYQKPN
                     LLLLDEPTNHLDLEMRHALVMALQGFEGAMVTVSHDRHMLKNTADEYYLVDNGEVTQF
                     GYDLDAYYQWLLNANKEASKKPQDQHKAHSSVNRKEQKRLEAEFRKSVQPLKKNIEKL
                     EKSLDKYSEQLAKIEQQLADNDIYQEENKTKLTELLAEQAKVTPLLNEVEESLLFALE
                     ELEEKQAEFEQSIDA"
     CDS             153126..153326
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704934.1"
                     /locus_tag="PA25_01300"
                     /product="DNA-binding protein"
                     /protein_id="BBN80145.1"
                     /transl_table=11
                     /translation="MRQKKRFIAGASCPECKELDVMMLFKEHDVEKVECVKCGHVMTQ
                     PKEAVQASTRQFEQVIGVFKPE"
     CDS             complement(153344..153556)
                     /codon_start=1
                     /gene="slyX"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3CUB6"
                     /locus_tag="PA25_01310"
                     /product="protein SlyX"
                     /protein_id="BBN80146.1"
                     /transl_table=11
                     /translation="MTELENRVMELEAKIAFQDDTIETLNDELKMHQQRLAKMQRQIE
                     LLGEKIKEGREEGLMPQNQEPPPPHY"
     CDS             complement(153553..154542)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704937.1"
                     /locus_tag="PA25_01320"
                     /product="hypothetical protein"
                     /protein_id="BBN80147.1"
                     /transl_table=11
                     /translation="MPKLDRLLLLIALFLLSSCTPADKKADLTVEHAARGAFAAAISH
                     DGRYSLVSSVEHGVSLWDNQVHGLKYQWQQSKPDGNLVHSLAIAYDNSVAVTAENETF
                     AIWDITTGKNLGYYRIQTGTIRDIAVSNQGRFVLYGRSDNVAVHLDLESGRRIEFLGH
                     QEKINSIALSPNGAFALTGANDYSAYFWDTRTGQVIHRFNHPSRVTKVALDASGQYAF
                     TADSLKKASIWQLTSGDLVSQLQYIARQKIFSAVRFNQSGTLLATGSPNRELTLWRVK
                     DGEKLGLWKVQPREGSRPKSAVVFDVTFIEQDNALMTESSSGLLERFNQLESQ"
     CDS             154796..155548
                     /codon_start=1
                     /gene="fklB_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EHY9"
                     /locus_tag="PA25_01330"
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="BBN80148.1"
                     /transl_table=11
                     /translation="MKQTIKLSLVAASVLALTACNQKAEEKPAELKLETEAQQQAYGI
                     GASVGNFLQKDLEDKKSFGIELDQALLMRGFEDALAGNAQLDEAKIREVLTSLDTSVR
                     EKQAEKVKLEAEQNKADGEKYLAENAQKEGVVVTDSGLQYEVISEGEGKKPLDTDVVK
                     VHYKGTLLDGTEFDSSYARNQPATFGLRQVIKGWTEGLQLMPVGSKYKFTIPADLGYG
                     ERNLGKIPANSTLIFEVELLEIQEEEKKAEAE"
     CDS             complement(155624..156094)
                     /codon_start=1
                     /gene="rsd"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070791.1"
                     /locus_tag="PA25_01340"
                     /product="sigma D regulator"
                     /protein_id="BBN80149.1"
                     /transl_table=11
                     /translation="MLSRLEQAQEKWGGSHSVIDAWLAERQELLLQYYKIAGFSPYDK
                     KDHALPDQMQIQSFCQILMDYLSAGHFEIYDNLVEACEEKGPDSAKLAKALYPRIADT
                     TDVALDFNDKYAENAQEQVLEDFDKDLSRLGEVLESRFELEDELIDNLYANHSD"
     CDS             156540..157604
                     /codon_start=1
                     /gene="hemE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KGD0"
                     /locus_tag="PA25_01350"
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="BBN80150.1"
                     /transl_table=11
                     /translation="MSELKNDRYLRALMKQPVDVTPVWMMRQAGRYLPEYRATRAQAG
                     DFMSLCKNAELACEVTLQPLRRYPLDAAILFSDILTIPDAMGLGLYFETGEGPKFERP
                     ISSLQDVKNIPNIDPNDELGYVMNAVSTIRRELKGEVPLIGFSGSPWTLATYMVEGGS
                     SKTFGKIKKMAFAEPQTLHLLLDKLADSVIDYLNAQVKAGAQSLMVFDSWGGVLSPRD
                     YKEFSLQYMHKIVDGLIREYDGRKVPVTLFTKSGGQWIEAIAATGCDAIGLDWTIDIA
                     DAKRRVGDKVALQGNMDPSMLHGTPERIREEVQSILAGFGEGSGHVFNLGHGITPDVD
                     PENAGVFINAVHEFSAKYHK"
     CDS             complement(157682..158596)
                     /codon_start=1
                     /gene="speE_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8P447"
                     /locus_tag="PA25_01360"
                     /product="polyamine aminopropyltransferase"
                     /protein_id="BBN80151.1"
                     /transl_table=11
                     /translation="MGKHWQNCQLFFSKCEIDMSNLEANRWFTEVSDRDGSAFSLRIN
                     KKLDEIQSPFQNVEMYETTNYGNLMIIDGCTMVSSRENFFYHEMMSHPALFSHPAPKN
                     VVIIGGGDCGTLREVLKHPDVETVTQIDIDEVVTQMSLKYFPELCESNKDPRATVMFD
                     DGIKYMREAAPESIDVVIVDGTDPVGPGEGLFNHAFYTSCLNALRPGGIMVQQSESPL
                     THMPLLLEMRDAMLDVGFVDLQTLPFPQPIYPSGLWSATLARKSETFNGFREADADSA
                     IFSTEYYNTGIHKGALATPNFMKRAFTK"
     CDS             158826..159086
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01370"
                     /product="hypothetical protein"
                     /protein_id="BBN80152.1"
                     /transl_table=11
                     /translation="MDMSKAIKVIGVIGFGVAIAGCSSTQDTQSGSAASWKDPDMVCE
                     SIAQTGSNLRKKRCMSKELADEIRANTKEGMRKLENNSRTVK"
     CDS             159240..159506
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01380"
                     /product="hypothetical protein"
                     /protein_id="BBN80153.1"
                     /transl_table=11
                     /translation="MKLKLHFSAVVAGSILLLSGCNSTSESSGDRVAKVDNDLVCESR
                     PTTGSNLRKRRCMSRELADEMQKETKASMRKVEVKGRAQSHTKL"
     CDS             159717..161597
                     /codon_start=1
                     /gene="speA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KIP8"
                     /locus_tag="PA25_01390"
                     /product="biosynthetic arginine decarboxylase"
                     /protein_id="BBN80154.1"
                     /transl_table=11
                     /translation="MNWGLDTAREIYNVAHWSEGYFDINSHGELVAYPDGDHNKSPIS
                     LNQLTEEFKVQGLTLPVLVRFTDILKHRVDTMTEAFSLACEQRGYQGQYNCVYPIKVN
                     QQRSVVTKLLAHPSGQVGLEAGSKPELMAILGVATTPITIVCNGYKDSEFLRLACIGQ
                     AMGHKVNIVVEKLSELTTLIKEIDDLNIEPAIGIRIRLNSVGKGKWQNTGGEKGKFGL
                     TAGQVLEAVEMLKAANKLHLMNLVHFHIGSQIANIRDIHRALKECARHFAELSQLGVP
                     LKTVDVGGGLGVDYEGSGSRSACSMNYTVAEYARNVVSAFAEVCELHDLTHPAIITES
                     GRALTAHHAVLITDVIDVEKAPNQRIPNAPSPDAHAILQELWQAYSRITVRLALETYH
                     DAMHLFSEAHAQYVHGLVSMTQWAQIEQLYFTILHRVRELLNENARTHREVLDDLNEK
                     LADKLFVNFSLFQSLPDVWGIQQLFPVMPIESLDQPLTQRAILQDITCDSDGQIRDYV
                     EGSGIESSLPIPTYIPGEQYHIAMFMVGAYQEILGDLHNLFGDTDSVHVELSEDGYKL
                     TNAIKGDSVQEVLKFVHYDHTQLAQNFVTTIEHNVTDEQLRAQYIEELNAGLAGYTYF
                     ED"
     CDS             161720..162595
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707863.1"
                     /locus_tag="PA25_01400"
                     /product="acyltransferase"
                     /protein_id="BBN80155.1"
                     /transl_table=11
                     /translation="MSLLRCILSLLLYALNTLFWFVPIFLFGLIKLIPITALQKACSR
                     LAKAFAGFWVAGNTWNQKLLSPFALNVVGLDSLKQKDWYLVIANHQSWVDILVMQRML
                     HGKIPFLNFFLKKELLYVPFLGLAWWALDFPFMTRTSKSQLKKNPKLKGKDVETTRKA
                     CEKFKTMPVSIVNFVEGTRYTDAKHRRQKSPFQHLLKPKAGGIAFVMQAMGEQISKVV
                     NITIHYPDGIPTFIDFVSGRVTRVDVHVEILPVSENLIGDYSNDSDFRVRFQSELNHL
                     WQQKDEQLQQLSGSE"
     CDS             162615..163535
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000196902.1"
                     /locus_tag="PA25_01410"
                     /product="acyltransferase"
                     /protein_id="BBN80156.1"
                     /transl_table=11
                     /translation="MLRNVLPKWFFGLSATVILLANTIVCGIVVFVLGLVKLCLPFRA
                     ISHILHAAYGMWCKGNRLGLQVGCGQIDVNVPAQVKQQGWYLLVSNHISWLDIVVLSA
                     VDALPAPKFFLKDELKYIPFIGTGAWAMGMPFMKRATKAQVAKDPKLKGLDVARTKRS
                     CHNFRRHPTTVINFAEGTRFTPSKKQQQNSDYQHLLKPKAGGTAFALEVLAEQLDGLL
                     NCTLVYQAQGQHICRSFILGQLQSVHVEIDISDISAIPQGSYQFDKEYRVAFQNYLNA
                     LWYDKDEQITRHILEYDNLSTQTSKETAPL"
     CDS             163532..164713
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000894643.1"
                     /locus_tag="PA25_01420"
                     /product="miniconductance mechanosensitive channel"
                     /protein_id="BBN80157.1"
                     /transl_table=11
                     /translation="MTLVHLTDLFDTWFANVPQGAFLSALTANSVGFIGLILLYLFTR
                     RLVFPTIQKGLVRVSPTRVGHLAPELNKVTGRLAAVICSVAFLALNDKVLVAPTWVMD
                     VLHSLGQVVLVILAGFLFSGMVNLAHAIYNQLRFAQDVPIQGIVQVTKLMTFIISGIF
                     VISLVLDKSPTYILSGFGAIAAITLLVFKDTILGLVASIQIAANRLVKTGDWIQVDAF
                     GADGEVIDLGLNTVRVRNWDNTVTTIPTYMLISDSFKNWRAMQESAGRRIKRAILVDM
                     HSIKVLAEHEVAHLQAQFSELTHLEHWPDKTTNLGLFRRYAEKYLQEHPAISKECVLM
                     VRELAPANNGLPVEFYCFSADKRWVAYEHLQADIFDHMLAVMGEFELRPYQNFSGHMW
                     Q"
     CDS             complement(164693..165826)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261328.1"
                     /locus_tag="PA25_01430"
                     /product="chorismate-binding protein"
                     /protein_id="BBN80158.1"
                     /transl_table=11
                     /translation="MALSIFYQFFLLGCTSFGGPAAHLGIFKKHFVDNLGWIGHERYG
                     AMISLSQILPGPGSSQVGFAIGLERAGIIGGIAAFIGFTLPSFLIMLMLAMTATQMHG
                     VFDNVISGLKLFAVVIVADAILNMAKSFCKTTALKIVTFVSTLILLLFPNLHAQLWLL
                     LGVAFVASLYSFSAIPDTKKRAKLMLNWPVLAVFFGLFALTFADLPNVLFSQFYQAGA
                     LVFGGGHVVLPLLQNSVPELSQESFLTAYAAAQAVPGPMFSIATYLGAEVGSANAVLS
                     AMLATIAIFLPGLLLMWACHHNWQSLSALPRFASITAALNAAVVGLLAAAFYNPIWLS
                     SVQSIWHIAFAVGGFALLKYFKPPIWMMLLLFASIGILLPHMP"
     CDS             165957..166733
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01440"
                     /product="hypothetical protein"
                     /protein_id="BBN80159.1"
                     /transl_table=11
                     /translation="MQQLALSLLFFALYASFNVCAAHRAIQVAIDHAPPYSSVSNDGE
                     SSGLILDIISATAGTKYPIRPVPCPVSRCLRMLEQGEVDVMGGLLKTPQRQESMVFVE
                     PPYMALSSSYVFYAKKGSNLSVMRFEDLYGKRIAVMRGAAYFERFDKDTKLNKVDVTS
                     EQIALDLVLKERVDLAIGIEDTAEVAMKVLKQPISQLEKMHYRQTNVIYGYMAFSQDF
                     AQTDAAHYIAEKMQEIARSKLLDKLIAPYSLPPIPNELMQ"
     CDS             166923..167549
                     /codon_start=1
                     /gene="ompA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006310900.1"
                     /locus_tag="PA25_01450"
                     /product="porin"
                     /protein_id="BBN80160.1"
                     /transl_table=11
                     /translation="MNKKGFIAITLGVALVSGCEMTNTGKGASIGAATGAVLGKATGN
                     HKDKRIFIGAAIGAIAGAAIGDYMDKQEAAFKKELAGSGVEVIREGDNMRLVMPSNIT
                     FASGQANISVDFYRTLDGITKVMNKYEKTFLNIVGHTDSTGSAQLNQQLSEQRANSVK
                     NYLLGQQVLAARLHTQGMGESAPVASNTTEQGRAKNRRVEIQIVPNKA"
     CDS             complement(167613..170198)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01460"
                     /product="hypothetical protein"
                     /protein_id="BBN80161.1"
                     /transl_table=11
                     /translation="MKPKSSVLTLAIAASLLLSGCNDNKDKNPHSLLIKEHSQLNKAQ
                     GIWDKKAYGEVLSIVDGRIKYYEYNSQACTQISDKSYQEFMQDHASTLHITNSQILDI
                     IEKDTTQSETLFKVDELPVSCKTPIQLTQSSTATQVFEYFWHSFNDYYAFFELRDVDW
                     QAQYTAYAPQVHDSMTDDALFNVLAQMIAPLQDAHVSINDGSKSFSNTKPAPLLRSAH
                     GKAKSYLRFGAHVDTIDVINDLWDDYYDTTASYIDAESLKSFPQETDAKTLIWGITPD
                     NVGILVINNMAQYHSDPDATEQQQLTAAKTLIDSVMSDLKDTDGLILDIRNNLGGDDV
                     IATIIANRFTEKRQMAYKKQAVNRSGRGIPKIFSIGGKGEAYTKPVYMLTSQVTVSAG
                     EVFAMTMKQLPHVTQVGEETAGAFSDILNFTLPNGWEIGLSNEVYSNPKGERFERIGL
                     QPDVHISAYSSLETDLQRFSTYDYALDMMGKQTSAKLSISEFEQQVRAQMAQGAIPGL
                     AVAVINQGQIKYANGFGIANEQNAPVTADTPFYVASVSKALVGATIAHAASAQTISID
                     ENIAHLLPFAIDVTPAQQTPVTLRHLITHTSGIVDASPAFLCAYYIHATKQNISDAML
                     GTNTCDSQINPDLQVYLTDYLNRDGRYYQQENFTSQYGLNTGEVYIYSNIATALAAYT
                     LEQKRNIPFVELAQEYIFTPLNMSNSTWGVGEPADNVATRFVHNPQTGERVAMPNYGA
                     ITYADGSAISTVNDLARFLIASMNNGQIEQQQALSKAAVEAMLTPQTTTPVPSRDIGY
                     FWELDGEYIHHDGSDPGVISQMIGNLTTQNGVILLSNGDDNHQSNNQAFNTILHLALQ
                     LANSN"
     CDS             complement(170401..172494)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01470"
                     /product="hypothetical protein"
                     /protein_id="BBN80162.1"
                     /transl_table=11
                     /translation="MNKMRLYCHITIALSGSVLGSTVAQEQTSIEHIEVGASRYALMK
                     NNGSALHQLSKEAIAQTPHIADDVFRLMPALPGVSAGDYSANFYVRGGQKNEVLVLLD
                     GQELYRPFHMKSFNSAFSIIDTENAEQINLYTGGFSARYGNRLSGVLDIQSVQPQAQT
                     KYSVGASFINARAAAQGSFESQKGHWLVSARRGYLDMILKAMDDETSKFEPIYADLYA
                     KLSYELNDSHTLSTNLLYAYDDEILDDNFDEWNGFEKYYVKEKITGNYASQYLWSRLT
                     SHWHDALSSQTMLSVGKVEEQRKGGQSDPYEIDLSVKDDKSFSFYGIKQDWRWLRSHD
                     FMLEFGFHSKHVDINYDYAMALFRHRLFADKPQSQRTAALVNAKGLQAGAYLSGKYKL
                     HPDWVTELGLRYDKQNYQGFSDSQISPRAALSYQLSSDESLNFSWGHFYQAQDMLDLQ
                     VGDGIVNYAPAQKSEHYIAGYSGAFNTLTYRVEAYYKRLSDIPKRYENALDPLNFFPE
                     GQADRQLIIATKGEVTGIELSIAQTINNQWRWHANYSWSDAQETIDSKQVQRSWNQTH
                     TLNAGINYLFNNGWNVNLTSQYHSGWPTTGEYGTLQKSINGEQKIIRHLAARNQQNLA
                     DYLRFDLRLSKQYQLTQSQLQVFFEISNLLNRKNQCCVEASKYRLNENSKIIVEQEYG
                     HWLPMIPSFGVRWDF"
     CDS             complement(172491..174005)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01480"
                     /product="hypothetical protein"
                     /protein_id="BBN80163.1"
                     /transl_table=11
                     /translation="MSRRLFIHYSFISVLAFTLMLIAACGKEFNNKVEQTTNSVSSPK
                     KIQTGLAPPQHPKRLIIDNVNVITMDGSQPDVLTNQRVVVIADKIIKIDEASNIAFAT
                     DDKVIDAKGGYLAPGLIDSHVHLRHEPGASSNIVEIHTSPAQMSIFLQQGITTIRSYS
                     GTPNELEWRDKVNTKQWLGTRIISSGPIISLYETESPFLGVPHEQFSQEFLGKLSLTW
                     PKTPEEAKREVAKHREIGYDFIKVYSGVTEQIYTQISEAAKANKLFLAGHIPDAPMAL
                     VLENHNEIAHLSEIIEGRAIAPEEMDDETYIDWVATTMSKNNISLVFNWSTDEVVTRW
                     DLGEDIYSSDSYNIIPQPILDAWQQEERDPNIDPTLHNIALMIVKTLVEEGVAVQVGS
                     DTGDAGSIPELVHRDMELMVEAGLTPKQALAAATSVPASVIANITHRPQDRGIIKENY
                     LADLVLFKQNPLDDIHNIKQRIGVVIGGHWLSQQQLNEMANEFAKLPVHYLELP"
     CDS             complement(174118..175332)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01490"
                     /product="hypothetical protein"
                     /protein_id="BBN80164.1"
                     /transl_table=11
                     /translation="MAVFLEQTVLLLGSLHALILSIFLFKQSAKNPANRYIGLFTNTF
                     ALVLLSIFIDTAGLLYVYPHLIGVHEWLIPALGPLLYLYALKLTAQEASQKYWLHFLP
                     SAVIALLSIEFLLQSSAMKIQFISPHTELGAINEQFEFLVDTVIPAFSLLQITCYLLL
                     IFRILKRHTINIESQFSYLEKVNLSWLMWLSKFISVLLVLWLIDELIELNIRLCFDSG
                     DGVMCHLSWFAQERHFYPSEMGVILCVYAITYYALKQPAIFYPQQPNPAPPLHLGAQI
                     PSNTRYANSNLSEQLAKQLFQELDKQVRQQQLYINPTLTLDELAQATGWSRHQLSQAI
                     NQVSGKNFFDYINMLRINDAKHLLLQQPQKTVLDIALETGFNSRSAFYNAFKKYAQQT
                     PSEYRKAPPIAS"
     CDS             complement(175448..175792)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011338309.1"
                     /locus_tag="PA25_01500"
                     /product="rhodanese-like domain-containing protein"
                     /protein_id="BBN80165.1"
                     /transl_table=11
                     /translation="MLTTAQDLLKIVRPNQRCITAQQAKAEIDQNQGLLIDVREPAEF
                     EAKSAPTAVNIPRGLLEFKLPDLEKDPQRPIYVHCAAGGRAVFSAEQLTRLGYQNVSV
                     ITCKADEVCQVF"
     CDS             complement(175795..175983)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010941064.1"
                     /locus_tag="PA25_01510"
                     /product="sulfurtransferase"
                     /protein_id="BBN80166.1"
                     /transl_table=11
                     /translation="MKLNAMLRLIAGMMLLLSLALTEFVHAHWIWLSVFIAVNLMQSA
                     FTNWCPMITLLKKLGVKE"
     CDS             176081..176377
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704640.1"
                     /locus_tag="PA25_01520"
                     /product="transcriptional regulator"
                     /protein_id="BBN80167.1"
                     /transl_table=11
                     /translation="MDFEAMAHNAEQAEALLKMMANKNRLMILCSLLEQEMSVSALND
                     AVPLAQSALSQHLASLRKANIVTTRRDGQTIYYRVIDKKVQAILQQLYQLFCAQ"
     CDS             176389..179679
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005479332.1"
                     /locus_tag="PA25_01530"
                     /product="acriflavine resistance protein B"
                     /protein_id="BBN80168.1"
                     /transl_table=11
                     /translation="MTLFNKVLASSLSGRLPVFVLFVALIMGMFALQFTPREEEPQIV
                     VPMLDIKVSSPNLSAPEVARLVTEPLEKLLQQIPGVEHIYSTTNAGGTVVTLRFHVGE
                     NREQAILNTYTKLYANQHNMAQVVANWQIQPIEVDDVPILMLGLYSKNAEQYSDYELT
                     RFAQEISTQLQKVPNTSEVKVISGRKRQLSVHLDATALAAHQTTPLDVLMAIQASNQL
                     QGVGNILAQGQEIVLESGDVLRDAQQIALLTVNVLDAQQVLLKDVATVVDGPAEPESY
                     QWLAINEQQQSVPLVTVSVAKQRGSNAVDVAQQSLILMNELKQRILPDDIEVKVLRNY
                     GQTADAKVNDLTASLSFAVLTVVIFVGVFLGWRPAIVVGLAVPICYGITLGLDFAFGY
                     TINRVTLFALILSLGLLVDDPITGVENISRFLAARKSNDKAHTRQQVVSAMSEIKVAL
                     LMSTLTISVAFLPLAYITGMMGPYMAPMAFNVPVSVMASTLVAFMVTPWLAKMLLHNH
                     PINLQNQHQGSSLYSRILTPLLSNAKRTKVLLWATFALFVVSVSLPIFRAVPLKLLPF
                     DNKNEVQVLIDLPEGSTLEQTAQLTRQVQQQVWQLNEVTAIAAYVGKPSSMDFNAMVR
                     GYYRREAAHLADLRVLLLDKTQRAHQSHAVVLRLRKALAQFNHSGVKVKVVEVPPGPP
                     VLSTLVAQVYAEPFVSSETHRQAANVLMARLSSEPHVVEVDSTLAASTHIARFVVDKG
                     KAALSGISTEDINQSLRIASGGVDSGLLYLANESEPVTINLRLPYAVRHQQQNLDALQ
                     VRGQMALSKVGNEYGLDSATRPLVALSELGQWQTIPAPQPIIRKDLQNVIYVTAELNG
                     RTPAEVIADIVADENAESFKPVSWQQRSFIENGGTQAWQLPEGTSYTFSGEGEWRITV
                     DVFRDMGIAFAFALLAIFGILRIQTASSALSLIIMSAIPLTMIGIMPGFGLLNQFGER
                     AIAGAPEPILFTATAMIGMIALAGIVVRNSLILVEFINQARSEGVELKQALIQAGEVR
                     MRPVLLTAGTTLLGNLVIILDPVFSGLALAIIFGIIASTIFSLLVVPLVYFLVFRHTE
                     DSRDVINS"
     CDS             179663..180733
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003112437.1"
                     /locus_tag="PA25_01540"
                     /product="resistance-nodulation-cell division (RND)
                     efflux membrane fusion protein"
                     /protein_id="BBN80169.1"
                     /transl_table=11
                     /translation="MLLTHNLVKKMALPSLALVLLLIVVAYLAGVFNDVEPEGVKSQP
                     VEYQGELYRVGEKQVSHHEIVNANVIAKENTLVSSRLLAQLKTLQVRAGQSVKAGQLL
                     ATIDDADLQARVSQAKAQQDAIAVQLQQAKKQLARNESLQAQGLVAVNMVDEWRTKVD
                     ELVAQELALSEQLEGAKVALSDSKILSPINGTVVQRLQEPGAMLTPGTAIVSLYNPAQ
                     LQVSAPVREQQASQLMLEDDLKIHIPASGVTQYAKVSEIVPVVDSNARRFMVKLDIEL
                     AQNVKPGMYAQLYLPPIEHKLVVIPNQYVKRYGQLTMVEVVENGHVQRRFVRLGALLD
                     NALEGEVVVLSGLSAGEMLAVH"
     CDS             complement(180759..181436)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013226198.1"
                     /locus_tag="PA25_01550"
                     /product="oxidoreductase"
                     /protein_id="BBN80170.1"
                     /transl_table=11
                     /translation="MQNHNNVPLNDFIEYPQADMLQRAQENLKEYQRRHTIRSFSSRP
                     VPKEIIEACIKAAASAPSGANHQPWHFVAIHSADVKKKIREAAEDLERSFYQGRAGDE
                     WLDALKPLGTDANKPYLEHAPWLIAIFSQKKGGIHTEDKNTNYYVHESVGIATGFLIQ
                     ALHHAGLATLTHTPKPMSFLTDICGRDKDNERPYMLLIAGYPSDDATVPEHALVKKPF
                     DDIASFL"
     CDS             181974..182681
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01560"
                     /product="hypothetical protein"
                     /protein_id="BBN80171.1"
                     /transl_table=11
                     /translation="MDIFSELQDACSAKEVIELIAMSDGYSCAQDQNRLVLKDTIAHR
                     LVLYKGANCFGATLCNSAPHSVCVLQGTLRLKTIPIMQVHLKSGGPSNFIASGAMRLS
                     SLSAGDAQQLNTLEVFDFQASHDAHWLVLYDKSVSHYQSAKLCAVTFRPVSSSLLDSG
                     NLKIVKSIQHLSSATCEESFQALLKLCESDIEAIAWQAIEGVYLRDRYKAAQLVSEYQ
                     LSHSCELIRHRVASIPF"
     CDS             182829..183491
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003110705.1"
                     /locus_tag="PA25_01570"
                     /product="hypothetical protein"
                     /protein_id="BBN80172.1"
                     /transl_table=11
                     /translation="MYQHHWVGTEQEKLPVGKIVCVGRNYVEHAQELNNPIPCEPLIF
                     MKPSTCYQHFEGRIELDRSLGEHHYEAELALLVGEQIDKHHLQPLSAIKGIGLALDLT
                     LRDEQTKLKNQGHPWERAKAYDGSCPITPFTAVSAVAELENLEFQFWQNDQLVQYGQT
                     NLMIFSFEKLVKSITQFCTLLPGDVILTGTPKGVGKLEDNAYLSLQLNDAPKFDAHLT
                     LR"
     CDS             183520..184707
                     /codon_start=1
                     /gene="purT"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HXP3"
                     /locus_tag="PA25_01580"
                     /product="phosphoribosylglycinamide formyltransferase 2"
                     /protein_id="BBN80173.1"
                     /transl_table=11
                     /translation="MKIKPLGTPFSKATCKILLCGGGELGKEVVIEFKRLGCEVVVLD
                     RYEHAPAMQVADKSYVLSMLDGERLAQIIKQEQPDYIVPEIEAIATDTLVELEQQGYT
                     VVPSAKAAQLTMNREGIRCLAAEELGLATSPYQFVDTLEDFKQAVTEIGMPCVVKPIM
                     SSSGKGQSVVKSPQDIASAWQYAQEGGRAGQGRVIVEGFVDFDYEITLLTIRHINGTS
                     FCEPIGHVQENGDYQQSWQPQQMSELALARSKEIASKVTEALGGRGLFGVELFIKGDE
                     VYFSEVSPRPHDTGMVTLTSQDLSEFALHVRAILGLPIPNIHFHGPSASSVVLVSGAS
                     QQLLFNGVQEALAMPDTDLRLFGKPEVSGTRRMGVALARAPSVEQAVSKAKQVASSVK
                     VVL"
     CDS             184704..185600
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000250661.1"
                     /locus_tag="PA25_01590"
                     /product="oxidoreductase"
                     /protein_id="BBN80174.1"
                     /transl_table=11
                     /translation="MMQNPNRVIAPLVMGFWRLMDWQWSKQQCLAYLQHCIELGVTDT
                     DHADIYGEYECEAAFGEALKLAPQVREQIKIITKCGIRPAFAKKGLVGKANHYDSSKA
                     HIIASAQQSLRNFNTDRLDVLLIHRPDYLMDADEVAQAFTQLKQQGDVLHFGVSNFTP
                     SQVQLLQSRLDFELVTNQIECSVYQMKALDDGTLDQCQQLSMPPMLWSPLAGGKLFSG
                     QDDKAKRLFATLTQVAEELAVDAIDQVAYAWLNMLPSQPSIVLGTSNIKRVESAIAAS
                     KLSLTREQWYRIWQASTGHSVP"
     CDS             complement(185672..186340)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070887.1"
                     /locus_tag="PA25_01600"
                     /product="hypothetical protein"
                     /protein_id="BBN80175.1"
                     /transl_table=11
                     /translation="MKKTASLLALACLTATSFNTFAEVSANVAASSNYFWRGVTQTDD
                     GAALSGGIDYSSDNGFYAGTWVSNVDFGDQTSYEMDFYAGFSGETQGLGYDVGYIYYA
                     YPDAPGSSDFGELYGSVSWEWLSAKASYLTHAQNDSSSEEDMLYLELNASFTILNDSE
                     LALHIGRSSGDTIKEWTGEDDSYMDYGVSIAKDGFTLGLVKTDLDANDDVKAFVSYSV
                     DFAL"
     CDS             complement(186571..187707)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01610"
                     /product="hypothetical protein"
                     /protein_id="BBN80176.1"
                     /transl_table=11
                     /translation="MALGEQESQIYQNILKQATEISLNLMAVKVENHPEDFLLWCYEL
                     LDVAKNRLNFDLLDNHQLPTVKKLQDQLISAISFLQLKTLRITPWPVLVAFVEQHRDA
                     LAIDEQLKLITYLADKRATPLKEMIVEDRLAFSGKHGASLDTSVYNFDVEWFSSTKNA
                     KGFHQLLADLPGAFDEALAHIPVEGEVSEQNYQQFVVAYLLAFNGSDEKPTLAPATRL
                     LAMRRPDVFTPISGSKLDALCSAFGITKLNNRDFERYWQDIVLTVHAMPWFKMPTPAN
                     EFEQQLADIKALLPCWFYYADKDTAEGSNYLKLLNKPKRTTSSGGKKTVRRGKESAEV
                     LVDRALSDESIPEHIRAKRDSIVAEVEKGRSVDETISLMRTIFG"
     CDS             187999..189933
                     /codon_start=1
                     /gene="asmA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072519.1"
                     /locus_tag="PA25_01620"
                     /product="cell envelope biogenesis protein AsmA"
                     /protein_id="BBN80177.1"
                     /transl_table=11
                     /translation="MKTAIKVLGATILVLLGVVVAAPFLIPTERIVSELSEQVELNTG
                     RKFQVLGHSELSVLPSLKIELNDVHFANMSSGSRDNMVSMQALEVHIPWLSILGGEAK
                     LEKFVIRQPDILLETDQQGVPNWQILPTANNTDKQSTSSEGSTSLPENFDVKLGEVAI
                     YGGTFTYKDGQTKAQHQLSDIEVTVQLPSLRETLAIAGSITYQQQVFELSTTLATPAK
                     LIGGDTFSVTQALNSALVNMNFTGKVAQGGKDIQGELTLKGDSVKAIAQWQDVDLKAK
                     DNAFNQFEVSGAMHMSGQTFTLKTLTAKLDELAIKGQSTLELGKRLNVQANVDLGMLD
                     LNPYLPEPVKQAEAPKEQQETQPIVWDDTAIDLSALNSLDANVVVRSTGLKAREIKLG
                     ENQLSFKLNKGVANIGLDKFNAYEGSGKGAVKVDASRTPYKINTQFALDSINAEPLLT
                     DAVGFDKVLGKGSINWDLTTQGQSQKSFVSALGGKLAFNLKDGGVKGANIAEMTRKAK
                     EMLKGDFSSLKEGLNADYNPEQKTDFSSLTGSFVFTNGVGRNTDLYLASPLIRITGEG
                     DVDLPQTNVNYRLVTGIVDTIEGQASTDDSTGFKVPLRIKGPFHKVDVNIDVSGAAKD
                     KAKDKLKDKLKDKLKGLFGG"
     CDS             complement(189994..190161)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01630"
                     /product="hypothetical protein"
                     /protein_id="BBN80178.1"
                     /transl_table=11
                     /translation="MKNKTSNPQTIPTHLLDTVKGGVSMNLNLVKRRGGSRDDLVDIC
                     PQVVIGSTQPG"
     CDS             190349..190558
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01640"
                     /product="hypothetical protein"
                     /protein_id="BBN80179.1"
                     /transl_table=11
                     /translation="MIKRIKSPPLSGEHVRHVLLSAKQLHHVTGGVSVKQRGPIEDIC
                     PKLGTVRPPNIEDICPRLGTVPPPT"
     CDS             190670..191167
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01650"
                     /product="hypothetical protein"
                     /protein_id="BBN80180.1"
                     /transl_table=11
                     /translation="MSQIDTYNFTVQPSATGEDWQITQNTNSNDETLNIQLNNGDKAV
                     LIYTLAADSQQAWQFTENGTLFTEAQDNLNYNLSSHVSADGVAVTVSIEAVNLDHTLT
                     EDDINKLMSESQAMSCILEPLGEATIDFRLVAEQKTDSNNPLEPVKRYFSQDPKVVIG
                     GIQPK"
     CDS             complement(191180..193690)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01660"
                     /product="hypothetical protein"
                     /protein_id="BBN80181.1"
                     /transl_table=11
                     /translation="MSTVFLATDAKLGRKVALKVLNNGKTHSQTLMEEARLLARLNHP
                     NIVQVYNVQEIDDCLVLEMEYVQGTTLANHVKEAHLSLEQKLSILIDIAQGLTAAHQQ
                     DILHLDLKAANVLINKQGQAKIADFGISQLKGEQELSALSSFGSLVSMSPEQLREEPL
                     DQRSDLFSFGLLAYQLLTGNHPYRGQAKSNNEQAIAEQIKFSPLQHAARGLIELPSAL
                     ITLIERLLQFDKDLRPHSAEEVVMHLKQVLMGVTYDNSDPTVELSELNLSNPNSKRNK
                     LLTLFAFAFAFLFIGLLGSGIWYWQINKPKTYIAALPIKYDENSSLTDTQQRIVKLGL
                     DDAISNFILQDSSTLQVSNSEVESAIKLMGEQTSLASLGKALGANILLEPELSCRGPI
                     CEVVLNAIDGSNATMIKSTRYSVDADLFSETYRNSLSHISGLFSKKHDLNEMDDAFFD
                     KYVELVNAYNTGSQDLLTTLRKVQLLLKQSPSFTPLYSFYRRVVIETDRAHSDKSVLW
                     DFLSDLENAPKNYKGSQNYTLDHILVYQSLNNWKEADNLIKGLENSSFIDAYELYSIK
                     ASYHRERAQYKEALLNMVEAHRLRPTLYTTRNLAITHLLNGDYPSALTFLDLVINSAP
                     NDYWALQAYADISLLNDSPVKAIKAYRQLLKKTPNDSKTLTNLSIALALIGDYEQSSK
                     NAYKAYTLSSNNVSYILNYADSLIYKGEETQAKHLYQKIINLTNDSDNSDILLVRAQA
                     LLHSGQQVVALRLINELELEHPSNYDLKFVKAMVLTILGESQSALLAIEASINEGWSK
                     SFFALPWFKKLCSHKPTLIQLIGLDNVNILCKPAPAFT"
     CDS             193915..194775
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011123674.1"
                     /locus_tag="PA25_01670"
                     /product="chitooligosaccharide deacetylase"
                     /protein_id="BBN80182.1"
                     /transl_table=11
                     /translation="MRKIAIIAWVIYSILHTTGCNSVEAQSNAAEQNPAPAQTMGWQY
                     PNGARNAISITFDDARESQVDVGVPILDKYNVKATFYVMPEPVQGRLTQWQTVAGNGH
                     EIGNHTASHLCTGNFQWLRAMNKGLEQVDLQWLRDDITKTNNYIENNLGVTPRSFAYP
                     CGNTFVGRGLEVQSYVPLIADMFTTGRTWLDETANDANYTDFAQLTGIRIDGMTYEQI
                     KATLDALRFSKSWIILAGHEVGQKGMYTIDSQALESLIIYLKDPANGYWLDTVDNVAN
                     YLKQHRDAPK"
     CDS             195042..195410
                     /codon_start=1
                     /gene="rplN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KF31"
                     /locus_tag="PA25_01680"
                     /product="50S ribosomal protein L14"
                     /protein_id="BBN80183.1"
                     /transl_table=11
                     /translation="MIQMQTQLDVADNSGARKVQCIKVLGGSHRRYAAVGDIIKVSVK
                     EAIPRGKVKKGDVKNAVVVRTKKGVRRPDGSLIRFDSNAAVILNDNLQPIGTRIFGPV
                     TRELRTEKFMKIVSLAPEVL"
     CDS             195421..195735
                     /codon_start=1
                     /gene="rplX"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KF32"
                     /locus_tag="PA25_01690"
                     /product="50S ribosomal protein L24"
                     /protein_id="BBN80184.1"
                     /transl_table=11
                     /translation="MAAKIRRDDEVIVLAGKDKGKRGKVLSVVSETGRVFVEGINLIK
                     KHQKPVPQLQQAGGIVEKEASIDVSNVAIFNQETGKADRVGFKIEDGKKLRIFKSTGK
                     TI"
     CDS             195752..196291
                     /codon_start=1
                     /gene="rplE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P44346"
                     /locus_tag="PA25_01700"
                     /product="50S ribosomal protein L5"
                     /protein_id="BBN80185.1"
                     /transl_table=11
                     /translation="MAKLHEVYKDKVVAELQEKFGFSSVMQVPQIEKITLNMGVGEAL
                     ADKKILENAVADLEAISGQKALITKARKSVAGFKIREGYPIGCKVTLRGERMWDFLER
                     LVSIAMPRIRDFRGVSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGMDITITTSA
                     KTDEEGRALLEAFNFPFKK"
     CDS             196302..196607
                     /codon_start=1
                     /gene="rpsN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KNZ7"
                     /locus_tag="PA25_01710"
                     /product="30S ribosomal protein S14"
                     /protein_id="BBN80186.1"
                     /transl_table=11
                     /translation="MAKNSMKAREAKRTKLVAQYAEKRAALKAIISDVNASEDDRWDA
                     VLKLQSLPRDSSPARQRNRCNITGRPHGFLRKFGMSRIKVREAAMRGEIPGLKKASW"
     CDS             196628..197020
                     /codon_start=1
                     /gene="rpsH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3CQH1"
                     /locus_tag="PA25_01720"
                     /product="30S ribosomal protein S8"
                     /protein_id="BBN80187.1"
                     /transl_table=11
                     /translation="MSLQDPIADLFTRIRNGQTAKKVAVSMPTSKLKVAVAKVLKDEG
                     YITDFAVSGDAKPELTIELKYFEGKAVIENIQRVSRPGLRIYKKRDALPKVMGGLGIA
                     IVSTSQGLMTDRAARSAGVGGEIIGFVA"
     CDS             197034..197564
                     /codon_start=1
                     /gene="rplF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P0AG58"
                     /locus_tag="PA25_01730"
                     /product="50S ribosomal protein L6"
                     /protein_id="BBN80188.1"
                     /transl_table=11
                     /translation="MSRIAKAPITVPAGVEVTIKGQDITVKGKNGELSRTINDAVEVT
                     LAENVITTTPRDVANAWAQAGTARALINNMIVGTNEGYEKKLQLVGVGYRAAVKGKVL
                     DLTLGFSHPVNFDIPEGITIEAPSQTELVVKGADKQLVGQTAANIRAYREPEPYKGKG
                     VRYADEHVRRKEAKKK"
     CDS             197574..197924
                     /codon_start=1
                     /gene="rplR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EK53"
                     /locus_tag="PA25_01740"
                     /product="50S ribosomal protein L18"
                     /protein_id="BBN80189.1"
                     /transl_table=11
                     /translation="MDKKTARLRRAKRTRRNFIEQGTTRLVIHRTPRHIYAQVVNAEG
                     GVLAAASTVEKAISETVSGTSNIAAAQAVGKAVAERAADKGIEKIAFDRSGFKYHGRV
                     KALADAAREAGLQF"
     CDS             197934..198440
                     /codon_start=1
                     /gene="rpsE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P59124"
                     /locus_tag="PA25_01750"
                     /product="30S ribosomal protein S5"
                     /protein_id="BBN80190.1"
                     /transl_table=11
                     /translation="MANVEAKQQQPDLAEKLIAVNRVSKVVKGGRIFSFTALTVVGDG
                     AGKVGFGYGKAREVPAAIQKAMEKARRNMINVELNGNTLQHPIKGRHAGSKVYMQPAS
                     EGTGIIAGGAMRAVLEVTGVQNVLSKAYGSTNPINIVRATISALENMNSPEGIAAKRG
                     LTVEQIQG"
     CDS             198447..198629
                     /codon_start=1
                     /gene="rpmD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KF39"
                     /locus_tag="PA25_01760"
                     /product="50S ribosomal protein L30"
                     /protein_id="BBN80191.1"
                     /transl_table=11
                     /translation="MANKTVKVTQVKSSIGRLPKHKATLRGLGLRRINHTVELEDTAC
                     VRGMINQVSYMVKVEG"
     CDS             198635..199069
                     /codon_start=1
                     /gene="rplO"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87SZ4"
                     /locus_tag="PA25_01770"
                     /product="50S ribosomal protein L15"
                     /protein_id="BBN80192.1"
                     /transl_table=11
                     /translation="MHLNTLSPAAGAKTEKKRLGRGIGSGLGKTGGRGHKGQKSRSGG
                     KVRVGFEGGQMPMQRRLPKFGFTSRKSLVSTEVNLYEIAKVEGDVVDLNALQAAGLVK
                     KNVLFVKVVKSGEVSRAVTVKGIKVSKGAREAIEAAGGKVED"
     CDS             199081..200409
                     /codon_start=1
                     /gene="secY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KF41"
                     /locus_tag="PA25_01780"
                     /product="protein translocase subunit SecY"
                     /protein_id="BBN80193.1"
                     /transl_table=11
                     /translation="MAKPGQDMQSAQSGLAELKRRLLFVLGAIIIYRLGSFVPIPGID
                     AAVLAEFFEQQKGTIVEMFNMFSGGALERASVLALGIMPYISASIIMQLLTHIHPAMI
                     ELKKEGEQGRKKISQYTRYGTLVLATFQSIGIATGLPNMMNGLVVNPGFGFYFTAVVS
                     LVTGTMFLMWLGEQITERGIGNGISVLIFVGIVANLPSAIGSTAEMARQGDLNVLVLL
                     LIAVIVFAVTYLVVFFERGQRRIVVNYAKRQQGRQVFAAQSTHLPLKVNMAGVIPPIF
                     ASSIILFPGTIASWFGQGEGPVADVLQAISAVLTPGQPLYAMVLAAAIIFFCFFYTAL
                     VFNPRETADNLKKSGAFIPGIRPGEQTSKYIDKVMTRLTLAGALYITFICLVPEFMTM
                     AWQTPFYFGGTSILIIVVVIMDFMAQVQTHMMSHQYDSVLKKANLKGYGR"
     CDS             200675..201031
                     /codon_start=1
                     /gene="rpsM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E892"
                     /locus_tag="PA25_01790"
                     /product="30S ribosomal protein S13"
                     /protein_id="BBN80194.1"
                     /transl_table=11
                     /translation="MARIAGINVPDHKHAVIGLTSIYGVGKTRAKAILAATGIAETTK
                     IGELSDETLDVLREEVGKYTVEGDLRREVTLNIKRLMDLGCFRGLRHRRSLPLRGQRT
                     KTNARTRKGPRKPIKK"
     CDS             201045..201431
                     /codon_start=1
                     /gene="rpsK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P59375"
                     /locus_tag="PA25_01800"
                     /product="30S ribosomal protein S11"
                     /protein_id="BBN80195.1"
                     /transl_table=11
                     /translation="MAKAPIRRKKVKKQVVDGMAHVHASFNNTIVTITDRQGNALSWA
                     TAGGSGFRGSRKSTPFAAQVAAERAGTAAQEYGLKNLEVFIKGPGPGRESAVRALNAA
                     GYRITNITDVTPIPHNGCRPPKKRRV"
     CDS             201453..202073
                     /codon_start=1
                     /gene="rpsD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KF44"
                     /locus_tag="PA25_01810"
                     /product="30S ribosomal protein S4"
                     /protein_id="BBN80196.1"
                     /transl_table=11
                     /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKLETAPGQHGAR
                     KGRLSDYGLQLREKQKVRRIYGVLEKQFRNYYKEAARLKGNTGENLLQLLEQRLDNVV
                     YRMGFASTRAEARQLVSHKAVMVNGRVVNIPSFVVTPEDVVVIREKSKKQARIIAALE
                     LAEQREKPTWIEVDGKKMEGSFKRLPERSDLSADINEQLIVELYSK"
     CDS             202098..203084
                     /codon_start=1
                     /gene="rpoA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EK47"
                     /locus_tag="PA25_01820"
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="BBN80197.1"
                     /transl_table=11
                     /translation="MQGSVTEFLKPRLVDIDAINPTRSKVVLEPLERGFGHTLGNALR
                     RILLSSMPGCAVTEVEIDGVLHEYSAKEGVQEDIIEILLNLKGLAVSLEGKDEVFLTL
                     TKSGVGPVTAADIQHDGDVTIANPDHVICHLTADNSEISMRIRVERGRGYVPASSRLS
                     SDDDERPIGRLLLDASFSPVERIAYSVESARVEQRTDLDKLIIDMETNGTLDPEEAIR
                     RASTILAEQLEAFVDLRDVSEPEEKEEKPEFDPILLRPVDDLELTVRSANCLKAEQIQ
                     YIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASLAE"
     CDS             203121..203519
                     /codon_start=1
                     /gene="rplQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87SY9"
                     /locus_tag="PA25_01830"
                     /product="50S ribosomal protein L17"
                     /protein_id="BBN80198.1"
                     /transl_table=11
                     /translation="MRHRKSGRQLNRNSSHRKAMFSNMAGSLVKHEIIKTTLPKAKEL
                     RRVIEPLITLAKTDSVANRRLAFARTRDKEVVGKLFSELGPRFEGRPGGYTRILKCGF
                     RAGDNAPMAYVELLDRPVAEETQEDAQSAE"
     tRNA            205894..205970
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="PA25_t00060"
                     /product="tRNA-Ile"
     tRNA            206085..206160
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="PA25_t00070"
                     /product="tRNA-Ala"
     CDS             complement(209966..210610)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011074052.1"
                     /locus_tag="PA25_01840"
                     /product="DUF2959 domain-containing protein"
                     /protein_id="BBN80199.1"
                     /transl_table=11
                     /translation="MKHFTLVTTFVCMLSGCQTAYYSAMEKVGIHKREILVDRVEATK
                     ESQQESQQEFQSALERLSTLINFDGGELQSAYEQLNDDYEASLASAEEVSVNINKVED
                     VAQALFDEWQDELTQYSSDKLKRESEKKLKQTQRQFDRLLRSMRSSESKMQPVLASLK
                     DNVLYLKHNLNAQAIAAIRGEFKNLQTDIKTLIDDMNRSIADSNKFIEQMNSNK"
     CDS             210696..211592
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEZ1"
                     /locus_tag="PA25_01850"
                     /product="UPF0761 membrane protein"
                     /protein_id="BBN80200.1"
                     /transl_table=11
                     /translation="MNFQFEVWPDKIKQIIVMQPRWWRCYFSRCIEDQITINAGYLAY
                     VTLLSLVPLIAVGVAIFSAFPGFEDTRLAIENFIFNNFVPTSTDSIKSHISAFTGNAN
                     QMTAVGIGFLASIALLLIRNVDAALNRIWRVEKKRPLMISFAIYWMVLTLGPVLLGAS
                     IGVTSYIVSLVSFADQGIPGFSGFLLKLLPYAISMAGFIMLYTLVPNTRVSFRAAVPG
                     ALFAAMLFELSKKGFAAYISHFPSYEVIYGALATVPILFVWVYLSWVVVLLGAEFTVC
                     LSEHDSWFNELDEQSEEQNISS"
     CDS             211602..212546
                     /codon_start=1
                     /gene="pip"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:F9Y661"
                     /locus_tag="PA25_01860"
                     /product="proline iminopeptidase"
                     /protein_id="BBN80201.1"
                     /transl_table=11
                     /translation="MMAQGYRVGEVSRQFHFAVGDGHQIYVEEYGKADGLPVIVNHGG
                     PGCGLSRDSAQYFNPQRYRIILFSQRGCGGSTPLELDNNTPKHLVSDIVSLLDHLEIK
                     QSVLAGGSWGATLSLLFAHLYPERVRGLILWASFLATDDDLRWLYSTQGAGAQFYPES
                     YSAFSQGLSCEHDILAYYRDALFSQDELLQHKAAQHWHDWDRQVTMAASLSRYHLEQP
                     SCITQQAKLMCHYFSPEIFSQLKGLDIAPDALRGIPSWFIHGRHDLVCRFAPVQRLAE
                     ELNAQLYILDGLGHSGANDAYFEAIRRAADLLACKLHT"
     CDS             212623..213060
                     /codon_start=1
                     /gene="dtd"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KEZ2"
                     /locus_tag="PA25_01870"
                     /product="D-aminoacyl-tRNA deacylase"
                     /protein_id="BBN80202.1"
                     /transl_table=11
                     /translation="MQGLIQRVSQAKVEVDGRIVGEIGTGILVLLGVEKNDDVGHVTK
                     LLHKISNYRIFTDTEGKMNLSLRDISGQMLVVSQFTLAADTRKGMRPSFSSAATPEQA
                     RHLYELFVAQAKESGLPVATGEFAADMQVTLCNDGPVTFNLTV"
     CDS             complement(213057..213746)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01880"
                     /product="hypothetical protein"
                     /protein_id="BBN80203.1"
                     /transl_table=11
                     /translation="MHNFVTASGTIANQFVQQSHQLGHLLYWHKHGDVSIQVRQDKTL
                     RWLLINNTLQSVVERNHPEHLLFPHLQVLEKIWRDLPSPKNVLELGLGGGAIRDYLHV
                     TYPDCKVLSVDNNPDIVHCYKKYFSTEQGCNVACMNADTALSGKKSYDWIILDLFSEL
                     DAPLFLYQHPFYQLLRAALNANGWLFINFLCEHASQKQHLEHLLITNFGKKPHIETVT
                     DYANHIIAIKR"
     CDS             213905..214798
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005456791.1"
                     /locus_tag="PA25_01890"
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="BBN80204.1"
                     /transl_table=11
                     /translation="MFKVSSPQSSEDWQAYYQLRWQVLRAPWGQPRGSEQDDLEQESE
                     HLYIKNNEGEVLAVARLHFNNQQQAQVRYMAVSEQHRGQHLGSRLLHELEKSAWRQNA
                     EELVLFARERALAFYERHGYQMVEKAHLAYNDIQHWKMVKQKPTEPGWFRHPDWTQVL
                     QNTWRESIPISDAMGIKVESYTDWQFSTRADLKANLNLHNSMFAGSIYSMATLTGWGA
                     TYLALKERNLEGNIVLADANIKYLKPLTTAPSATVSIADCKGVLDEVTSQGKAKYYVP
                     VKVYDGDVLVATFDGTFVVVK"
     CDS             complement(214869..215591)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000978021.1"
                     /locus_tag="PA25_01900"
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="BBN80205.1"
                     /transl_table=11
                     /translation="MFLIFNTSVFAKTIKVAAIDWCPQICPKQTEKGYVIDLVEEIYR
                     NSDYQLKIDYFPWSRAIKYVLAGKYHALLAPAKAEAPQLRYPNTAVGQQEMCFFTTAD
                     NQWQYRGVDSLNKMQIGIAIDTSIEELNQYVSNHTEQFVFQPYHERYIKQSAQMLSKK
                     RIDAFLFTKNSTRYELKQANMWHDYKLAGCVSRTEIFMAFTPATKNQHSIDAMMQTFD
                     TRAAQLNSQRLIQQLLTKYNLQ"
     CDS             complement(215719..216420)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003097919.1"
                     /locus_tag="PA25_01910"
                     /product="AraC family transcriptional regulator"
                     /protein_id="BBN80206.1"
                     /transl_table=11
                     /translation="MPPWQHVQTHQHTWGQLAYTSNGVMSISTPAGNFVIPPNQALWL
                     PPHLPHETFCRYGGHFRSVYIDDEYVDVLGHKAKLLHVDELLKAIILEICQWDPNYTP
                     DEKKRRFIDVFIDRLESAPTSAFFMPTAQDSRLLPIISELYANPGCNKTLQQWGEEVG
                     ASTRTLNRLFNKSFTMNFSQWKQKLRGLRAVEMIEAGYSQQIIAEQLGFESSSAFNTA
                     FKKVFNCTPGQYLRK"
     CDS             216602..217795
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005423059.1"
                     /locus_tag="PA25_01920"
                     /product="MFS transporter"
                     /protein_id="BBN80207.1"
                     /transl_table=11
                     /translation="MEEIPNQKWKTPFGFLTLATIVMAVTFAAWTALLNNFAIEAAQF
                     TGANMGMLQSLREIPGFLAFTAVFILLVLKEQTFALVSLCLLSVGVAITGFFPTIYGL
                     YATTVLMSIGFHYFETLNQSLSLQWFNKEEAAHKLGQLLSIKSMASLVTFALIWLCVT
                     FLTKSYEWLYLVLGGVGLLLTLFMISAFPHFEAKSTQHKKLILRKEYSLYYLLLFFSG
                     ARRQIFMVFAGFLMVEKFGFDVAQITLLYMLNHVINIFAAPAIGKMIGRIGEQKALTI
                     EYTGLILVFTGYALVESADLAAVLYVVDHLFFAMAIALKTYFQKIARPEDIASTAGVS
                     FTINHIAAVIIPASFGIVWLYDNSLVFYFGAGLAACSLILSQFIGWHLQRRQAQLPIA
                     EQHIS"
     CDS             complement(217812..218702)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000383981.1"
                     /locus_tag="PA25_01930"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBN80208.1"
                     /transl_table=11
                     /translation="MDWLTAAKSFVLIAEQASFTQAAQQLGISSSAVSKRIDWLERQL
                     GTSLLIRTTRQVTLSESGQVFLPKARALLAQFESVMTHTQEMNQIPTGTLKIAATLAV
                     GNSILMPSIQSFLATYPEISIQLNVLAPGAPPDLHHDLVITRHYDEFDSIAHKGCSLL
                     TYQMSLFASPSYLLQHPNIDKLEDLAGHNMLLSSYYQQKGHIVLNDGSKFDFTHYNFV
                     SDHLDVMLEAAEQGMGLIFISPSYLTKQLDAGTLVPVLPAIQSAKKQLWAYYPKSAFT
                     PLKTRMFIDHLKQRLSSMQT"
     CDS             218919..220013
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011263597.1"
                     /locus_tag="PA25_01940"
                     /product="Bcr/CflA family drug resistance efflux
                     transporter"
                     /protein_id="BBN80209.1"
                     /transl_table=11
                     /translation="MMITGYFLCLGISQLVVGPLRDKYGDRQVFIIGQSLFVLGCVLC
                     AMANNVAWFALGRVLQGLGAAAPLLISRTLLGVVYQGKYLQSAINSLAMAASGIAILS
                     PYLGGALGQWSSWQAVAWSLAGYVFLVALIGLKLLPRSKLYQAPISLHPRQLLERYSL
                     LLFAPQFIAVALFKWGPTFIYLTIQLYYPFVLQSQFAMTQSDFGQFMMLPMVGLLVGA
                     MLTKYFQSRCGVGKTLALFWPLLLISGSCFLILPFTLVTALFGYALVMIVFGGYFSLY
                     MRLVSRLFPSQAGTANALIGAIELLLFTLLAVALNTYFINVPSDIAWLIWAVAALLIW
                     AWGTLFIEQEQASVYCQHLKQTVKIKKRSR"
     CDS             220013..220534
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013228061.1"
                     /locus_tag="PA25_01950"
                     /product="N-acetyltransferase"
                     /protein_id="BBN80210.1"
                     /transl_table=11
                     /translation="MQFSTARLAIRLVTPDDLQASYEHRSCAQTSRYIGDPVTFEQAK
                     TRLLEGCKPWLAHEHQRLALAITLQEGGKLIGELMFKYVNKESLIGEIGYRLHKDYIG
                     QGYAFEAVDAFVKTLFEQLPVMKVTALCATENTASWKLMEKLGMQREGHLRSHIKLGN
                     ARADAYYYGLCRN"
     CDS             complement(220568..221239)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003899514.1"
                     /locus_tag="PA25_01960"
                     /product="hypothetical protein"
                     /protein_id="BBN80211.1"
                     /transl_table=11
                     /translation="MPVPTKDRPVDAVREEVIDQLILNYSHGEISADAFERRLDKAYS
                     IDDAEQLQALAADLPLQSDPRYHSEKQARMQPKFTASTDHPDTLSITSILSADQRSGE
                     WVVPKHIKLNNYLGSIELDFRNAVFTHPEVTIEINCISGSDEIIVPDNIDVITSTTNI
                     LGHVSNNRVGLSSNTHTAQRPKLYIQGKVILGSVDISVKQTMQEKVKQFAHSLKSLFD
                     EGKHS"
     CDS             complement(221486..223528)
                     /codon_start=1
                     /gene="susB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072426.1"
                     /locus_tag="PA25_01970"
                     /product="alpha-glucosidase"
                     /protein_id="BBN80212.1"
                     /transl_table=11
                     /translation="MRLISTLTLCGSLFCAATQAASYSVSSPDGNIKFTVDDNHAQPQ
                     YQVTFNNKPLLNGSKLGFEFQRAAPMKDNIEISTSTTSKHHSTWQQPWGETRIIEDSH
                     NELEVKLRDKNNKESAYILRVRVFNDGLGFRYEVNKNNALYITKELTEFNFATSESST
                     AWWIPARGWNRYEYTYNTTSLHDAAHVHTPFTLKNADGVHISVHEAALVDYAAMTLNQ
                     RRPGTFIADLTPWSDGIKVKTNGQFKTPWRTLQIGDKATDLLNSHLILNLNEPNKLAD
                     TSWIEPGKYLGIWWGMHIGKNTWGSGEKHGATTERTKEYLSFAAKHGFDGVLVEGWNT
                     GWDGDWFYNGDVFSFTQTYPDFDIAAISEHGKKVGARLIGHHETSGNVSNYRNQMDDA
                     FKLYQQVGVRQVKTGYVADGGNIKRIDERGIPRFEWHDGQFMVNEYLDNVKRASKYQI
                     SINSHEPIKDTGLRRTYPNWLSREGARGQEFNAWGTPPNPPEHTPMLAFTRMLAGPMD
                     FTPGIFDMGFNGLGDKTNRPQTTLAKQLALYVVLYSPIQMAADLPNNYLAKADAFQFI
                     KDVPTDWEHSLALLGEVGDYVVFARKERQRGKYPGNDWYLGAITDEQARTITVPLSFL
                     EENKKFEAQIYQDGKNAEWKNNPYDIQISKRIVTAKDTLTLKLATSGGTAIRFKAL"
     CDS             223716..224354
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01980"
                     /product="hypothetical protein"
                     /protein_id="BBN80213.1"
                     /transl_table=11
                     /translation="MKKILLLLGLLSSATQALEITITDAQGEPVAGAAVWLTGKNWQA
                     SPSQKQRLYSMGQKNRAFTPHILIVPNDSQVDFPNLDSILHHVYSFSQAKSFELKLYR
                     DKPLAPVQFEQTGVIELGCNIHDWMLGYIIVVDSGVYGLTNNNGKVSFAIDSSQVGNA
                     QLNVWHERFENLNMPESEPLTIVQVSQVMQYQIKQPLLEKLEFLSDETDDYE"
     CDS             224329..225579
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_01990"
                     /product="hypothetical protein"
                     /protein_id="BBN80214.1"
                     /transl_table=11
                     /translation="MMKRMITSKYIRLFVSALMISPCVAAQGVSAQFKGALDVSLTNT
                     NDMPAWHQQGWGVVRFSDDHQRLNISRFALSTRLDLSSAWSAHAVAQYVPDPNDKIGL
                     TEAYVQYQPLAQGYQLSARFGGFYPRMSLENPALGWSSPYTYHYSGLNAWLGEEVRAF
                     GAEFELKRAARRFRSKHDLSVIGALFKGNDPAGTLVAWRGFVPHDRQSVFNERIGFAP
                     LKSLTWPQLRRQGQYVEPFTEVDGRFGYYLGAHWSYLKRHSVRFYWYDNNGDPAAINY
                     VTKQYAWDTKFWSLAWRTKFNTQTQLIMQAMLGNTAMGPTRGVDNDFYSWFAMVSHTF
                     DDYRFSLRAEQSKVIDKDAWQFDENASFSKGLTMNIQKSLSDKWQLGAELQLIDYEAD
                     ARLAVGRALGLDEQVWRITAQYKF"
     CDS             complement(225638..227080)
                     /codon_start=1
                     /gene="sthA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q83MI1"
                     /locus_tag="PA25_02000"
                     /product="soluble pyridine nucleotide transhydrogenase"
                     /protein_id="BBN80215.1"
                     /transl_table=11
                     /translation="MAKPKSKPAATTEAADTYQYDAIIIGTGPGGEGAAMNLSKSQKK
                     VAVIERQQAVGGGCVHWGTIPSKALRHSVSRLIEYKANPLYRFTEKPQRHTFQDILNH
                     ASTVISKQSNLRSSFYERNRIHLYQGNASFVDQHTIKVEHIDGSQELITAHTIVIATG
                     SRPYRPPEVDFAHPRIYDSDTILSLKHNPQRVLIYGAGVIGCEYASIFKGLGAKVDLV
                     NTRDRLLAFMDAEISDALSYHFWNSGIVIRHNEDFARVETRDDCVILHLKSGKRVKAD
                     CILFANGRTGNTDDLNLAAIGLQADGRGQLKVNENYQTDVKNVYAVGDVIGYPSLASA
                     AFDQGRIAADAIAHGECADKLIIDIPAGIYTIPEMSSVGKTEQQLTAAKIPYEVGRAQ
                     FKHLARAQITGTEVGSLKLLFHAETKELLGVHCFGERASEIVHIGQAIMEQKGPGNNV
                     EYFVNTTFNYPTMAEAYRVAALNGLNRLCD"
     CDS             complement(227118..228128)
                     /codon_start=1
                     /gene="oel1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070593.1"
                     /locus_tag="PA25_02010"
                     /product="acyl-CoA desaturase"
                     /protein_id="BBN80216.1"
                     /transl_table=11
                     /translation="MFFAGLSITAGYHRLWAHKAYDAHPAVQWVFAIGGAFALQNSAL
                     HWSSDHRVHHGQVDDPVKDPYAATNGFWYSHIGWMLRDYQGESYSNYNNARDLQRNKI
                     VMFQHRHYLKLVLLTNIGIPLMLGLLFSNSVSEIIGMLLLAGVLRLVLSQHFTFFINS
                     LAHIWGSRPYTEKNTARDNGFLALFTYGEGYHNFHHIFASDYRNGIRWYHYDPTKWII
                     RAMAAVGLASKLKRTPIERIEKAKAETLLLKTKVRLAKLPLAQDKLTLLHQEYELLLK
                     KLQTFCGVQKQLIEARKDSMLEHCEKSALMKQYQELEAAWQTQKQAWLALNARLLKPS
                     FS"
     CDS             228371..228979
                     /codon_start=1
                     /gene="fabR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3FM60"
                     /locus_tag="PA25_02020"
                     /product="HTH-type transcriptional repressor FabR"
                     /protein_id="BBN80217.1"
                     /transl_table=11
                     /translation="MSGVRAQQKQKTRQALIEAAFNQLSAEHSFSNLSLREVAREAGI
                     APTSFYRHFKDMNELGLTMVDEAGLTLRQLMRQARRRIASGGSVIITSVETFMEFIDT
                     SSNQFRLLLRERSGTSKAFRAAVAREIKHFILELAHYLESETPCDKNHAYMQAEAMVT
                     LVFNAGAEALDQDAQQRAELTERLIWQLRYIARGANHYGAQS"
     CDS             229348..232611
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02030"
                     /product="hypothetical protein"
                     /protein_id="BBN80218.1"
                     /transl_table=11
                     /translation="MNKFSVFIASGLLSITTTAQAVQSHTLLNQAHVWQVLEQSIAKQ
                     GLGLTKHSNVRNATDGYDAAFSYQLIKQTGKQKEYRHYQTYLGQWPVLGGRFVLVSND
                     HGQVKQGLGKAILAKGTVRYATPKRFLQSDEQVLADIAKQQNVIAPGAKLTRAYEISN
                     GQLNPVIVLKARAYRYIFDARTLQILSRKPDLDALTSDLVAGGGIGGNEKLGAICYSP
                     QPQSMSKCLDYQFDSSTPKGQELLFQVQESAIFQAFSGYPFIVSKRSGTCTLENPYVK
                     TIDYMNDKSVAASYQCDSTNEHFDKQRIDDQFYDYYSYLAVNEAHFNAGVVMQYYHTL
                     LKQMYPQQTSDCDYNGFCLKQLKQNVGNNTYGNTQANWDDSHVNYGTGNYGGTHYFHT
                     TLDVVAHEASHAVTFWNSQLGAADQDGAINEAFSDIASVAILDHLQANVSGAYSQSVA
                     YLNQISDSAQNHQKNRKWWYGWDVMYEDKGARFFEMPSWDGRSIDHFKDYQTGLSTYH
                     IGGVLRKAFYELVKTQHWSIEDAFKLFLRANIECFFPGASIEDAGQCLLSQAGNFTYL
                     GAESKLKADIDETLHSVGVIARSSDISTLDFTSSINYNTVIYRVASVPVNDIARIDIA
                     WGDGTEERWQEGDLSNIYDYLERSRQVNVDDLVRFKLTVTLKNGQQKEGYRHFYSRAV
                     GASCEPYFNQGQVHTTDVSVNGTPLTLSSERYQSLLANAVSFNRHNEQALTLPSSLSD
                     KRVTLLVDSNRNGLFSADEMVLNNQLIGSGTVNFTLPETLSAGVTMLRIAIGSEYNFY
                     DTCGHTKLAQVIDLKADIDVPELPIKASFDYQVLADNRVEFTNTSQANMLRQPKYQWQ
                     FGFDGRTSSAQNPGVIDYPKVAGNYTATLSVSYQDGSGETDTASKNISLSEPQQCVVA
                     ISDQNNANAFYIDQIMMWTSINDRLSVTGAQGTNSAGYVLHKPNFSFTRSQELTVDIV
                     SNEISESTAERLLNNRENELRFTIWLDKDEDKKFELGEENFSDMNSNYLKECSNGRCR
                     IKASQSLFLPYVRWWEGKDYVIRARLEELPQASKGQDGCHNFHYGEVSDIKFSVTGW"
     CDS             232717..234699
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02040"
                     /product="hypothetical protein"
                     /protein_id="BBN80219.1"
                     /transl_table=11
                     /translation="MKLLSLSVALALGAATSIAQAQSDVVQVNASSPVLEIKQGFVKS
                     DLTSKQNIQALKQRLNKYGLNKQNRPHLFNVIDKQYARSLAAPSLAIPSVSMANDCNA
                     HNSSLCSFFKHMGIEVATLPGTNEEYLVVSALNSEKKPTNYTFIDITLVNEKGESITL
                     PRYAEFFGDGEQEKKRKSIYSSARLSDALAKLQSAEQIYADAWVTVVYTDANGNEVVE
                     DRNSKVEYSKDTILGELGLITPEVQSGAPMVSVQNAGTLTTDFGSTLSHPKDLRSKEA
                     GQLDNKIIVCLNRNYGDCDYENIYPAGTPNDQLKLKIPFVGEYIMMGKVTRIYRPDWS
                     VIDVVDNGDGSTTLKSGPQVQKPDVIDFGSNIFIQTKEGGGATSISGDQYNDIQNFFA
                     DNIQVEYIPFGRRTKTKLSWNITRNQGVFGDATLYGRYQDANWIMNIAVDNEPRPGQT
                     ARAETVVIGSAGLGSWEDIDYPQMQIVYSCLAQGSLITLPDGSQMPIEKLAVGDLVMG
                     ASQYNPANRLALEIKDISVGVEAIPMIEIKTKSGKKLLLTESHPVIMQSGESIWANEV
                     QLGDRIHTQDGIEFVSKIKEVKFKDKVYNLRLSRSKDDPNYLEGETFSMFANGLQVGD
                     LAMQSNNEFKEKVETQQDVLNRLPEPWHKDYLNSIK"
     CDS             234738..235973
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02050"
                     /product="hypothetical protein"
                     /protein_id="BBN80220.1"
                     /transl_table=11
                     /translation="MNKFININILVAALCSTSAFALDESQETKKSLIKPSTIDAVPLG
                     TAYHSKGENYLGLQSVKGVQAEHLGNTKIDFRVGVDLGYEQALKLIDGKVDAGFKFPA
                     VRVDAGANYAKDISADKYTGTYTVYSSMKPKSRMLMPNGMVGYEPTQAALDLAQAQPG
                     NREKNLGDGFVHGFAYGSNVVINMKIDYRNEEDKRSIGGYLSVDWIGKVKVDGQLQKL
                     DDSKRQSVKITISGYQSGGDPNRLLNIIPNGIMRCTLLNPEPCFELFESAINYLKNDY
                     INQFDSLDSYNVTEAYIAEYQDSGPALQALVPAQGYEGANYLTKLVVKELTARWIEER
                     LTYRRAKNLQRYYASQFNNEQLAQLSNIESASRNNANLFADMVDYCEQNPEGNYCTEY
                     EAANLVYYTDYSSYSDVLK"
     CDS             235984..236829
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02060"
                     /product="hypothetical protein"
                     /protein_id="BBN80221.1"
                     /transl_table=11
                     /translation="MMKPLFIATSVMCAATQVQAATALEQQASYNEVGEFLTVAQAQG
                     RFAWLEKCYDGLLVEIWEQSHDTTQIVSKEEKLKQLRALWLSADKIAQGRVNYLTFAN
                     SDFSNPYQWRAGNSVNDACGTMPPEYVPVALHTTLLKNQYCENQSYDNEWEWIEKITI
                     EGFSHESQSHGYSAITGKVVTLPAGRAVKMSVTPGNKEPQYPSYVAMRVWIDWDQDGV
                     MSESEMVHKSASDGPFQFTFEVPTEVPDGVTLMRIASDAGGGSDNACKRIQYGEVEDY
                     LVTIR"
     CDS             236840..238321
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02070"
                     /product="hypothetical protein"
                     /protein_id="BBN80222.1"
                     /transl_table=11
                     /translation="MKPIYSTMLLLGLCTNSAMAKYNDVIAKETINSGSSISGLINDH
                     IAIGTAYDSQTKRFLNVQPVAGRIDETYGNSEVTFKTGIDMSYDDLLSTLNGSVDLDV
                     NFPVVRVSAGASLAKEMASSTYSSSYTFSARSTPKKRLFLPQDSNIGYTLSQAGEEIA
                     NKHQAKLQQLAGDEFVSAIEYGANIMVNLKIDYGSNKDKSEIGGYLDVDLYGGVFNVG
                     GQLKYLQDDTKSSVKITVRAIQNGGDPKQLLSIIPNNIITCSLDNPKPCFDMFYEAVQ
                     YAKTGFGSQLNSLSDYNVVRYYTTRYDSASLALRPLVADYQTIRNATKWLISELEDDF
                     KQAVLDEQRASNLLTSYYAYLPETQRSAVETIRNLAYDNAWFLFNAAQFCRDNPFGTA
                     CEDEVQKMKDDCARRGKVCPASYDVTQLQLPQSDRLDWKQCELARQEAVRAGIVSEND
                     SVKYRNMRWAPTFININAPALGILNWRLCEGALSTYGNAFNAG"
     CDS             238384..239433
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02080"
                     /product="hypothetical protein"
                     /protein_id="BBN80223.1"
                     /transl_table=11
                     /translation="MKLIAVLMLVLTFNVSAKRYYSEQFNEQDLGKAFDTQLHQPSTH
                     CLTGTVKFHQESAGQLDYLQHLNETQIRRRTFGEVHGGVNLFIVAGSVSTSITHRNAT
                     DNLTLTSQLHLNMSQGHSTLENRHVLKGAAHCGDQFIYQVNFGRDLFINTRLHFRSEA
                     DYKKYVTKIKIRLLFFKKTKTKVKEIEKFAQNAVLTIDANSSGTLPPSLQQILNTNPI
                     HCRGANISPCLNTLQMLADYTFGGQLSNDLQALPKLPRSIVTKSYEESGHFEVNNDIS
                     VDTQQYEQIWHDIEQRYGAAVRRQQRAEAFLAVATEQEQQNAQAEYEAAWQQVTQLQA
                     LRNVCLAQPWLGQCL"
     CDS             239836..241383
                     /codon_start=1
                     /gene="leuA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KGM9"
                     /locus_tag="PA25_02090"
                     /product="2-isopropylmalate synthase"
                     /protein_id="BBN80224.1"
                     /transl_table=11
                     /translation="MQDKVWIFDTTLRDGEQALKASLTENDKIQLAHAISRLNVDVME
                     VGFPVSSPADFRAVQRIATEVRNPIICGLARAVSKDIEACGEALKPAQRSRIHTFIAT
                     SPLHLEHKLRMSLDDATAMAVKSIKLARNYTDDVEFSCEDAGRTPHADLCRIVEAAIN
                     AGASTINLPDTVGYVTPDEYAAMIHHLMNNVPNIDKARLSVHCHNDLGLAVANSIAAV
                     QAGARQIECTVNGIGERAGNCSLEEVAMIMKMRQDHLKVHTDIHSEEIYRASRQVAKI
                     CNMAVQPNKAIVGENAFAHSSGIHQDGVLKAQNTYEIMSPESVGVPNNQLNMTSRSGR
                     HVIEHRLTELGYQKSDYDMDKLYESFLALADQKGTVYDYDLEAMIYFNQINDDDDHYQ
                     LEFVNSTSNSQSVASSTIGMTVGEQSKQEAATGNGPVEASFLAIERITGMAVEVIEYN
                     LDATGQGASSLGQVDIIAKYNGRQYHGAGLAADIVEASVRAMIRVYNLIDRAQKVSSL
                     KQQRKAG"
     CDS             241380..242456
                     /codon_start=1
                     /gene="leuB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KGM8"
                     /locus_tag="PA25_02100"
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="BBN80225.1"
                     /transl_table=11
                     /translation="MSQASYQVAVLPGDGIGPEVMAAALKVLDAVSDKFNFKITRAEY
                     AIGGAAIDAHGQALPASTLAACEAADAILFGSVGGPKWEHLPPEQQPERASLLPLRKH
                     FGLFCNLRPAQLLPALSAASPLRADISEQGFDILCVRELTGGIYFGEKGREGAGQEES
                     AFDTQRYSRHEIERIARFAFEAAKLRHNHVTSVDKANVLASSVLWREVVTEVSQDYPE
                     VKLDYIYVDNAAMQLVKQPQQFDVLLCDNLFGDILSDECAMITGSMGLLPSASLNQSG
                     FGLYEPAGGSAPDIAGKGIANPIAQILSAALMLRYSLSQDEAARSIEKAVAEAVAAGV
                     GTPDIFPQAGYTTQDVAQAIVARI"
     CDS             242512..243912
                     /codon_start=1
                     /gene="leuC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8Z9I2"
                     /locus_tag="PA25_02110"
                     /product="3-isopropylmalate dehydratase large subunit"
                     /protein_id="BBN80226.1"
                     /transl_table=11
                     /translation="MAQTLYDKIWQSHVVAKINEQTDLLYIDRHLVHEVTSPQAFSGL
                     REKNRAVRCPEKTFATMDHNVSTKSRSLDAASEVSKNQLMALAKNCEEFGIVLYDLNS
                     INQGIVHVMGPEQGITLPGTTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLQQ
                     KKAKSLKIQVNGLLRPTVTAKDLIMAVIGKLGTAGGTGYVAEFCGSAIEALSMEARMT
                     LCNMSIEMGAKAGLIAPDETTYEYIKGRPFAPKGDDFEAAVAYWRTLCTDEGAQFDYV
                     VELDAEDIQPQVTWGTSPEQVIGIDELVPDPDQEPNLIKAQAIRSALQYMGLQAGQKL
                     SDAKVDTVFIGSCTNSRIEDLRAAADIVKGKQVAKGVEALIVPGSGLVKQQAEQEGLA
                     DIFKAAGFEWREPGCSMCLAMNDDRLGAGKRCASTSNRNFEGRQGRGGRTHLVSPAMA
                     AAAAIAGHFTDIRGEA"
     CDS             243912..244511
                     /codon_start=1
                     /gene="leuD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:F0KM02"
                     /locus_tag="PA25_02120"
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="BBN80227.1"
                     /transl_table=11
                     /translation="MSCYHQGLLAPLDKNNVDTDQIIPKQFLTSTSRDGFDKALFYDW
                     RYLEDGSQNPDFVLNDACYQGASILLTRDNFGCGSSREHAPWALKQYGFSVILAQSFA
                     DIFFNNCGNNQMLCIALSAEVLEQLFQLTQQHNDIQIEVDLANQQLKSQYFDAIDFDV
                     RADIKARLLSGLDFIGETEQLNDKINAFEQQLASQRPWQ"
     CDS             244638..245231
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070688.1"
                     /locus_tag="PA25_02130"
                     /product="hypothetical protein"
                     /protein_id="BBN80228.1"
                     /transl_table=11
                     /translation="MKFTALSVLALSSSLALARPAPLVSIPTHDAFFKHIAAHCGKAF
                     EGEVVVDNAQGPSSFAGKKLIMHVRRCDERQLQVPFHVGDDASRTWIITKTGSGLSLK
                     HDHRHEDGTDDASTMYGGHTVDAGFDNVQSFPADQYSKELFVRQGIPQSMGNTWQMFI
                     YDESFSYRMVREGREFRVDFDLTQPIKPPAAPWGYKD"
     CDS             245346..245762
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011085591.1"
                     /locus_tag="PA25_02140"
                     /product="hemoglobin"
                     /protein_id="BBN80229.1"
                     /transl_table=11
                     /translation="MAITARQKKLVQQSFAKVEPIAEQAAEIFYTTLFEYDPSLKPLF
                     KNSIKSQGQKLMATLKLAVAGLDDLDKLVPVLQNLAERHVGYGVKAKDFTPVGNALLH
                     TLKVGLGEQWNAELRQAWVDTIHIVADVMKAHAFSK"
     CDS             complement(245788..246168)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02150"
                     /product="hypothetical protein"
                     /protein_id="BBN80230.1"
                     /transl_table=11
                     /translation="MHRVYQDKLAAFTMTLKQFLMIITLTAGTSALAKDITPEKLYDF
                     DHKVHYEQTKYNNGHYLLQVKSDSYEHFLQQSVFLLRHSAKLCQGRNPQLTILKGIQH
                     FDRLPSTPRPYQSDLHVEVKCVNK"
     CDS             246232..246684
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013528912.1"
                     /locus_tag="PA25_02160"
                     /product="hypothetical protein"
                     /protein_id="BBN80231.1"
                     /transl_table=11
                     /translation="MLNHLKKLLQNNTPRAVGHEGLDFNTALAALLVEVMRADGKLLE
                     SEFDKIAQILTQRCQLTTEQTSALINKAQKQVEQAIDLFAFVKQINRHTSDIERIEII
                     ELLWHVAFADGHLDSHEDHIIRKISGLLYVAHPDFISAKLAAQERASG"
     CDS             complement(246771..248150)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P0A1E2"
                     /locus_tag="PA25_02170"
                     /product="oxygen-independent coproporphyrinogen III
                     oxidase"
                     /protein_id="BBN80232.1"
                     /transl_table=11
                     /translation="MRIVINLPTWDESLIKKYNVSGPRYTSYPTALSLAPGYDDNTLR
                     SAISASNSHVLSLYVHIPFCHQLCYYCGCNKIVTRHQHKADTYLDNLEREIQAQAPLF
                     KHYTVEQLHLGGGTPTFLTTEQMTRLITMLERYFKFNHQAQRSIEVDPRSLASNMLAH
                     LKVLGFNRVSFGIQDFNDQVQEAVNRPQHMSDVIALLQHARDLGFKSINADMIYGLPH
                     QTPDSFAQSIDQLIALSPDRVSVFNYAHLPDKFAAQRKLKEADMPSPQQKLTMFKNTL
                     QQMSQAGYQFIGMDHFAKKQEELAIAQQHGQLHRNFQGYTTHGDCDLLGLGVSSISQI
                     GNAILQNEKDLRSYYDAINQTGFAISKGMQLTDEDQLRADIIKQLICHFELDMTAFER
                     RYQIEFKTHFVQALEALSPLVQDGLVEISDHKIAVTSRGNLFIRIICMCFDEYLQQQL
                     KTSRFSRVI"
     CDS             complement(248261..250291)
                     /codon_start=1
                     /gene="pctC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HW93"
                     /locus_tag="PA25_02180"
                     /product="methyl-accepting chemotaxis protein PctC"
                     /protein_id="BBN80233.1"
                     /transl_table=11
                     /translation="MLENLSLRKKILLLIGGTISVLLIIASSYFVNHIATLSRQGVER
                     EAQSYILSEKLSMESFFAQYGKLVKSFITSPHMIEFFERYDTRESNLSALDGYDNINK
                     DFIRISSNDENVLSAFFGSAKTGEYFKENERTSKFADGNPYYAYKRSWWQNALSKNGL
                     YVGTPTVDINTGAVSAVVQQPVRNSRGELVGIGGVDLQINRISAMVEDIRFNGQGYGF
                     LLDSDLKVVHLSKQTGHDLSITDEGPNGKEGLEALESRFANTQGFSALNKKIKSNQSG
                     TAKVTLKGRDYYVVFNSVKLDTPILDWHVGILIPVSLIEEPVEQAVMTTITSVIVILA
                     IVVAMIWWATHMIAKPITKLTYIMRDIASGDGDLTQRIDIKSQDEVGQLAHHMNTFID
                     KLRAMMLDTAAQASQLGNASAQLSEVSANTNHEIQQEKEQVDSVSAAVTEMAATVTEI
                     SRNAQETNQAAETVQRMTQDGAARSNQAQQVMVELSAHIGEAAKVVSGLEQETSNIGA
                     VIDVINGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLASRTQESTDDIRNMI
                     SRLQQIAQQASTMMQQGQDQAQSTVEQTQGVLDSLKEIAESVVTVQDQSHQIATSTEE
                     QTVVAEDINNSLNTINDLVNSTAHHAQTLASEARDLNDLAKALNGTVNQFKL"
     CDS             complement(250544..252082)
                     /codon_start=1
                     /gene="pckA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EKD3"
                     /locus_tag="PA25_02190"
                     /product="phosphoenolpyruvate carboxykinase [ATP]"
                     /protein_id="BBN80234.1"
                     /transl_table=11
                     /translation="MTSSATRFVDLTAAELVEHAISRGEGTLAANGAFVAKTGRRTGR
                     SPSDRFIVKEPSTENDIQWGNVNRPFDAEKFDALWARVEAHVQSKDHFVSHLEVGADP
                     EHYLPVVVTTETAWHHIFAKNMFIEPVRYNASDLPQWQVMNVPSFVCDPERDGTNSDG
                     TVIINFAERKVLLAGMHYAGEMKKSMFSVQNFLLPAKGVLPMHCSANVGEAGDTALFF
                     GLSGTGKTTLSADPTRFLIGDDEHGWAPGSVFNIEGGCYAKCIDLSQKNEPVIWNAIK
                     FGTILENVVLDENRVPDFKDTSLTQNTRAAYPLEHVEKRKVENRAGEPKAVVFLTCDV
                     SGVLPPVSVLSEEAAAYHFLSGYTAKVGSTEIGSTSDIESTFSTCFGAPFFPRPAGVY
                     AELLMKRVREFGAKVYLVNTGWTGGPYGIGKRFDIPTTRAVIDAIVSGKLADVETTHI
                     ESLNLNVPVAVPGVNSELLNPINTWEDKAKYAEYAAKLAADFQENFAKYDVSDAIKQA
                     GPRG"
     CDS             complement(252344..253189)
                     /codon_start=1
                     /gene="hslO"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87TE0"
                     /locus_tag="PA25_02200"
                     /product="33 kDa chaperonin"
                     /protein_id="BBN80235.1"
                     /transl_table=11
                     /translation="MQSDLLHRYIFEKLDVRGELVQIDQTFNEIIAGHDYPQAVQALI
                     GELLVATSLLTATLKFEGDIAVQLQGDGPVKYAVINGDHEQNMRGVARLQGEITGDSI
                     PELMGKGYMVITITPIKGERYQGIVPLTSDSLAACLEDYFTQSEQLKTRLWFATRTTG
                     ERVKASGLFLQVLPVDKEKSIEDFRHLEALSNTIKDEELLDLDAQTVLTRLYHEDNPQ
                     LFEPQQINFVCGCSREKTINALVNVGQEALLEDIKQQGEINISCHYCLKNYTFNEDEV
                     KAIFN"
     CDS             complement(253200..253505)
                     /codon_start=1
                     /gene="hslR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P44754"
                     /locus_tag="PA25_02210"
                     /product="heat shock protein 15"
                     /protein_id="BBN80236.1"
                     /transl_table=11
                     /translation="MIQGGKVHYNGQRCKPSKCVEVGAKVKLAQGFDEKEVTILVLLD
                     KRQSAVIAQQAYLESEQSIEKREQNAIARKNNSFFAPHPVNKPDKKQRRELLKLKSS"
     CDS             253820..254707
                     /codon_start=1
                     /gene="gspC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070562.1"
                     /locus_tag="PA25_02220"
                     /product="type II secretion system protein GspC"
                     /protein_id="BBN80237.1"
                     /transl_table=11
                     /translation="MELQLQQLQKALLSLPHAKLSRLVVYLSVVYIAYLLSQLFWLLW
                     PQPVTQPLPSMSSVYASSSSAVSSQAIIQQHLFGNAQSKPVEQPQTIVSDAPQTALNV
                     RLTGIVAVSLNDRAGLAIIESQGRQVTYEVQQAIEGTRAKLAQVLPDRVILDVGGRFE
                     TLMLDGLEYSKNVAMPVAAKAPEKRPALVRTTVPSELIENKDALLKDPGKLLDYIRIT
                     PYRSSGELMGYRLSPGKDPALFNKMGLKNNDLAVAINGYQLTDMKQAMAAMSELKNST
                     EATITVERDGQVMSVQFSL"
     CDS             254735..256804
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005478663.1"
                     /locus_tag="PA25_02230"
                     /product="type II secretion system protein GspD"
                     /protein_id="BBN80238.1"
                     /transl_table=11
                     /translation="MGKKLHLTKIKKGLARYAALMLAAGLSLSVSAVEYAANFKGTDI
                     NEFINIVGKNLNKTIIIDPNVRGNINVRSYELMDESLYYQFFLNVLEVYGYSVTEMDS
                     GVLKVVRSSDGKKGNVPLVEGEEAGNGDVMITRVVRVKNVSVQELGPLIRQFSDQKDG
                     GHVTNLNSANVMMLTGHAASVNRLVDIIKSVDQAGDKRVDIVKLNHATADDVVSVVES
                     IYKDSGKGAIPDFLIPKVVADSRTNSVIVSGESQARSRATDLIKRLDNELENQGNTKV
                     FYLNYAKAEDLVKVLQGVSKTLQEDAQGGGNKTRSSSNKNETSIEAHPDSNSLVITAQ
                     PDTMRSLSQVIEKLDIRRAQVLVEAIVVEVFESDGINFGLQWISEQGGMLQFNNGSTV
                     PIGSLAVAAEQARDKEIKKNIIGSDTGNATPYTETVEGDLGPLGQLLGGVNGLAMGII
                     KNDWGAIVQAISTDTKSNILATPSVTTMDNEEASMIVGQEVPIITGSTSGDNNSNPFQ
                     TVDRQEVGIKLKVTPQINDGSAVQLTIEQEVSSVSGATAVDISVNKRAINTTVIADDG
                     GMVILGGLIDEDVQESVSKVPLLGDIPVLGHLFKSTGTTKRKRNLLVFIRPTIIRDSR
                     SMNELSHSKYNFIRSEQQIQQDDGIDLMPFEETPVLPEWNDALVLPPTYEEFLNKQNI
                     KERNNDD"
     CDS             256794..258368
                     /codon_start=1
                     /gene="gspE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070564.1"
                     /locus_tag="PA25_02240"
                     /product="type II secretion system protein GspE"
                     /protein_id="BBN80239.1"
                     /transl_table=11
                     /translation="MMTESKVEAVTEMSVNELSADLPAEVLEQSEHVAQSPLRLPFGY
                     ARRAGMLLSQQPDGLVVYYRGELEIETLLEVRRIAGEAFKLEHLDDDKFELLLEASYQ
                     RDSSETQQMMEDIGNEVDLFSLAEELPQTEDLLAADDDAPIIKLINAMLSEAIKEGAS
                     DIHIETFEQDLVIRFRVDGVLKEVLKPNRKLASLLVSRIKVMAKLDIAEKRIPQDGRI
                     SLRIAGRAVDVRVSTMPSSFGERVVLRLLDKNNARLNLEDLGMTERNRELFADIINKP
                     HGIILVTGPTGSGKSTTLYAGMSQINSKDRNILTVEDPIEYEIPGIGQTQVNTKVDMT
                     FARGLRAILRQDPDVVMVGEIRDLETGQIAVQASLTGHLVMSTLHTNTAAGAITRMED
                     MGVEPFLLSSSLLGVLSQRLVRTLCPNCKEAHQADERECELLGQSFTSAPTIYRAIGC
                     EECNFNGYKGRTGIHELLVVDETIRELIHNGKGEQAVEKYIRKNSPSIRQDGLARVLK
                     GQTTLEEVLRVTREEG"
     CDS             258371..259597
                     /codon_start=1
                     /gene="gspF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070565.1"
                     /locus_tag="PA25_02250"
                     /product="type II secretion system protein GspF"
                     /protein_id="BBN80240.1"
                     /transl_table=11
                     /translation="MAAFEYRALDKKGKEKSGILEADTAKQVRQMLREKAMMPLEVSP
                     AAERDKQHSGGGFKLFQGYKPSVADLALITRQLATLIQSSLPVEAAVMAVAEQCEKPR
                     LKRMLMSVRSKVVEGYTLADGMSEFPHVFDNLYRSMVAAGEKSGHLDQVLNRLADYTE
                     QRQHMRSQITQAMVYPTILVIFAIAIVSVLLGTVVPKILKTFEKSNQVLPWTTEWVMA
                     ASNFVQDYWLASLVVITGSIIMMKRALQQPKVRFWFDSKLLVMPGIGKVSRGINTARF
                     ARTLSILSSSSVPLLEGMKISGQVLENEKIKAAVAEAATRVSEGASLRAALQQTKLFP
                     PMMLHMIASGEKSGELEQMLERAANNQDREFESMVSVSLKLLEPAMIASMAVIVLFIV
                     MAILQPIMAMNKAVGL"
     CDS             259700..260083
                     /codon_start=1
                     /gene="gspG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005308483.1"
                     /locus_tag="PA25_02260"
                     /product="type II secretion system protein GspG"
                     /protein_id="BBN80241.1"
                     /transl_table=11
                     /translation="MVVLVIIGMIMSIVAPNIMGSQEEAAIDKAHLDIQQLEDAMNMY
                     KLKNKAFPTTEQGLEALVTQTTIDPVPKRFPDGGFISKLPEDPWGNPYQLVSPGEMGK
                     IDIFSMGPDGEVGTEDDIGNWDEEK"
     CDS             260106..260693
                     /codon_start=1
                     /gene="gspH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011262829.1"
                     /locus_tag="PA25_02270"
                     /product="type II secretion system protein GspH"
                     /protein_id="BBN80242.1"
                     /transl_table=11
                     /translation="MSPELSTVKTQHGFSLIEILVVIVIIAFATKMVTYSFGGDMEEE
                     LEKKALRTHSVLNMASEFAVLNQVELGLHLDKNTLELLVFDGDKWTTLESEELYKPIE
                     FSEHYRVELKIEDLAWAQDNLLEQANWRELMGTSDDESLLELKKLKVPQVLILSSGEV
                     SAFQLTIELAEQSEPVYFIEGEFMAPVNLRMEPEA"
     CDS             260690..261067
                     /codon_start=1
                     /gene="gspI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704544.1"
                     /locus_tag="PA25_02280"
                     /product="type II secretion system protein GspI"
                     /protein_id="BBN80243.1"
                     /transl_table=11
                     /translation="MMRTSRGFTLLEVMVAMSICAMAGIAAMQATGEHITHISTLEDQ
                     TYASWVAENRLVEMRASGDKWSGTNGQKGEEELAERTWYWQQKVTATADPSFVKVTVE
                     VFSDEALKHSVYDLTTFMLKDKS"
     CDS             261067..261771
                     /codon_start=1
                     /gene="gspJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011262827.1"
                     /locus_tag="PA25_02290"
                     /product="type II secretion system protein GspJ"
                     /protein_id="BBN80244.1"
                     /transl_table=11
                     /translation="MRQRGFTLLEVMVALGILAFVVMSTHQILDSTLKAKEASESTIA
                     ELEALQTTFRLMDQDFSQMTKREVRNEAGDVNPTYVLHGRYELQSQFDGIAFVRDGWT
                     NPISLLPRSELQAVGYRVVDDNLERIYRIYVDELDGAEPKAQVVIEDIEELKFEFMDD
                     KQQWQEDWKKKALPVAVAVTLQVKGAAPIRRLFLTPGDGKEQQAQSGDGQSRNGNANS
                     RSGDTQNGRSDFRGRQ"
     CDS             261768..262751
                     /codon_start=1
                     /gene="gspK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EKC2"
                     /locus_tag="PA25_02300"
                     /product="type II secretion system protein K"
                     /protein_id="BBN80245.1"
                     /transl_table=11
                     /translation="MRKAQRGAALIIVLFIVALAATIAAEMAANLMVQVQRAQNIQTH
                     QQAKWYSYGAEELVKKVLLESKKDEPEKVHLGQPWALSDVPYPVDHGTLSGEVTDLQA
                     CLNLNALRAPKKQGSSVSDTNPAHKALLSLLNNIEDLPVEESEEALADSVYDWLDEDS
                     ITFRSGAEEDEYMSRTMPYLSANNLMASESELRVIKGFNPLVMEKLLPYVCVIPGNTE
                     LKVNVNTIKSEQALLLSGLLDGLSASGAEAVIASRPEKGFDSVEDFFVEARDQGAKVD
                     KQSNELFTVDSNYFKLRAKALFDDRRFSMTSIIQINQGQATILARKFGGVQ"
     CDS             262748..263956
                     /codon_start=1
                     /gene="gspL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EKC1"
                     /locus_tag="PA25_02310"
                     /product="type II secretion system protein L"
                     /protein_id="BBN80246.1"
                     /transl_table=11
                     /translation="MTEKLVIRVGQSHQNPIHWLIYSSSDEQIIASGELDNAEQLAQL
                     SDKAVSRDVSLLLSASQVQLKRVPLPTKWNRKLEQALPFMLEEQIACDVDELFIAIGQ
                     PTLDGEQHCIDVAICNKQWLKDWLSVFNELDIELTRVVPDALLLPEQQDNGLSMIELG
                     QQWLCRLGQWHISAIEKSWGADYLYALQPSKIVHYSPAEGIPDVAPKEAKESEYELPL
                     ALFAKHLNSTSFNLRQGVFAAKKKQPQWWRDWRSGLLAASITIGCFVIVKGAQLVMLQ
                     TQADELKAQAVATYQQAFPGKVVRPHLLKKQIEGELAGLGNTEHGGFLELTNHLVAVY
                     GEVEDFTPETLRYDRRRNELRIRARASGFQVFGQVKAVLEQRGLTVQQGSLNNDGDVV
                     IGEIRLRGDS"
     CDS             263953..264429
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02320"
                     /product="hypothetical protein"
                     /protein_id="BBN80247.1"
                     /transl_table=11
                     /translation="MKEQAIKYWQSLKEQEQKLLIVAAIVFVIFSLVMGVFKPLNAAV
                     EKAQKDKQRNQELVAWVNNSVTKLKSGASTRQTTTTSNLSVLVNRTRGQYQVNISKMQ
                     PSDNALRLTIDSVEFNKLVAWLDELTNKHGVKIDSLDLAQDSMPGYVRVSRLLLEN"
     CDS             264431..265189
                     /codon_start=1
                     /gene="epsN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P45784"
                     /locus_tag="PA25_02330"
                     /product="type II secretion system protein N"
                     /protein_id="BBN80248.1"
                     /transl_table=11
                     /translation="MKKTISLVVIFVVAFGLFTAYNMPASVALQLVGKQLPPSLQIGA
                     VSGTLWQGQVSEVRVSNVQLNNVRWSIEAPALLLGDMHGHVRFGNVRDKSDISGRGEF
                     TVGLMNQSVSLSDASVRFSVEQAMSQVTLPLPVKAKGRVLLDIDDYQSGAPYCEGLKG
                     EIRSPGITVEGLTGWFDIGQLGGELSCKSGDIAVLVDPDNRLGLQADAILADNFQFRV
                     AGNIKPEASLPKEVHDAVKFLGRPDSDGRYPVNL"
     CDS             265197..265784
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02340"
                     /product="hypothetical protein"
                     /protein_id="BBN80249.1"
                     /transl_table=11
                     /translation="MFEFNFTPEHRQLLADYVAHRQGAMPLSMVQGYLFAAICGPDAV
                     EVEPWLADVSCNDQAIDESVVFAYMALHHQITEQVFSGTYQLPWLNETDYGARHLWSK
                     GFLTGVETYFESFQSSSRVTGELKEALQMATEQLAFFSLEHSQIVQFCTHQQCNERDF
                     INQQTQLAQEFAQGYAQLIETVALQSGLYDDEQGF"
     CDS             complement(265781..265984)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02350"
                     /product="hypothetical protein"
                     /protein_id="BBN80250.1"
                     /transl_table=11
                     /translation="MDFSQFNKQRAASFNQQKQLLKKLSAGQTILCETCQQPLKLNLA
                     VDAAQKGQVCCERGCTQIELEIA"
     CDS             complement(265984..266343)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02360"
                     /product="hypothetical protein"
                     /protein_id="BBN80251.1"
                     /transl_table=11
                     /translation="MKKFLIFALLIVALFTTDIEMIKQPRQQLLETSIAILSESTKVQ
                     RPSAATRARTSIEQQIPLTDKQAAHLDEELANDFVMKKFYQQYCVEREMSLYFFTDKL
                     ENICDILERAMQRTGTL"
     CDS             266585..268012
                     /codon_start=1
                     /gene="ccoG_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011074321.1"
                     /locus_tag="PA25_02370"
                     /product="cytochrome c oxidase accessory protein CcoG"
                     /protein_id="BBN80252.1"
                     /transl_table=11
                     /translation="MDKQIKVKNIPSEVKIQKPDNLQPDRFNPRNRIYVRAVQGLHQL
                     LRKRIGFVGMLAFMLLPWLSFNGQQAVLFDLFEQKFNIFGLTLLPQDLTILAFILMIA
                     AFALFLVTTFYGRVWCGYTCPQTVWTFIFIWFEEKFEGTANQRKKLDQRNMDFDKFWR
                     KTAKHGSWMMFSLYTAFTFVGYFTPIRELLPDVLTFSASGYATISILVFAICTYGNAG
                     WMREIMCLHICPYSRFQSAMFDKDTFTVSYDAARGESRGPRSRKQDPKELGLGDCIDC
                     NLCVQVCPTGIDIRNGLQYECINCGACIDACDGVMDKMNYPRGLISYTTERNLEASAE
                     KTKPVRGKLVGYVCILLVLSGALVANIVMRKPMELDIIRDRNQLYRVNFEGLVENTYT
                     LKVINKAQATRSYNIDVVGLNNFKFLGKQQITVEAGRSLDVPLSIVIDPYDLKKPVTE
                     FEFVIYPVDKPDSRVAQQTNFFKGK"
     CDS             268077..269051
                     /codon_start=1
                     /gene="srkA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87KC4"
                     /locus_tag="PA25_02380"
                     /product="stress response kinase A"
                     /protein_id="BBN80253.1"
                     /transl_table=11
                     /translation="MSEFSFANLTPDFILDAIESVGVYPESGLLALNSYENRVYQFKA
                     DDNRRYVAKFYRPHRWSDEQILEEHQFAFSLQDAEVPVVAPIVRDGDSLFHYQGYRFA
                     LFPSVGGRQFEMDNLDSLEILGRYIGRMHSVAGTQQFQHRPSINCQDYLYNARDALLN
                     SQLLPMHLETSFVTILDHLIDKTQQQYHQVEQIRLHGDCHAGNILWAGDSLMLVDLDD
                     CRQGPMIQDLWMMLNGDQQEQIIQLDTLLSGYEEFNAFDQRQLSLIEPLRAMRMVHYM
                     GWIATRWQDPAFPRNFSWFATDKYWEQQILALKEQFATLHEPALRLIP"
     CDS             269068..269700
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87GP4"
                     /locus_tag="PA25_02390"
                     /product="thiol:disulfide interchange protein"
                     /protein_id="BBN80254.1"
                     /transl_table=11
                     /translation="MFKTIKQSLLLLFIPMLAFAVNAADFADGKHYQTIDNKKSDTPK
                     VTEFFSFYCPHCYQFEPVALALEQNLPKGATFEKSHVNFLGGLPAQVQSNLSYAYIIA
                     QQFGKEKQVAAQIFESIHQKKVNFSDIKDVKKLLELNGISEKEFDQSMSSMLVIAAEK
                     KMQDQQELFGKLGALSGVPTFIVSDKYKINMKELKSQAELESLVKYLLEK"
     CDS             269716..270345
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87KC3"
                     /locus_tag="PA25_02400"
                     /product="thiol:disulfide interchange protein"
                     /protein_id="BBN80255.1"
                     /transl_table=11
                     /translation="MLKFIKAAAVAMMLPMLANAAQFEEGVHYEVVAERGTKKPEVTE
                     YFSFYCPACNAFEPLIAEFKPKLDKDVKFKKSHVNFVGPRDPEIQELMANALATAAVL
                     PQKDAVVSALFSHIHAKRGKINELADIKDIFVSQGVDATKFDKLYKSFAVRTKASRMT
                     RMQEQLQEKGALTGVPMFIVNGKYKLLLRESKTTTPEQISALINYLAAK"
     CDS             complement(270398..271507)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02410"
                     /product="hypothetical protein"
                     /protein_id="BBN80256.1"
                     /transl_table=11
                     /translation="MNISSFEQQLENNVLKARQGDINAFNKLVAVTTSTVDSIALAIT
                     KDRDATQDVSQQVFLKAWQDLAKLKNNHSFLPWIRQITRHTAINFLRDNKSHIVFNEE
                     RLQACLETLSTQQHIQEINLLKSEQRDIVHALISNLPDESREIVILFYREAQDSKAVA
                     TLLGLSDSNVRKRLQRARELLKEQVLARYGQILLSSAPVSIISLTSLTTSTTASAASA
                     ASAAGSKLLSGSVGKVSLIFSGAFIGGLAALLANIMNTHCVASLCRDNKTKNSIKQSG
                     KLNSLGIIICTLVMAIGYTYTEGWFMPAIAYLLLAIFLSLGQYNVHQALFSKNAKFGV
                     KSHVIGLAGLVLGLLSGAAGLYYGLENSGRLVRLF"
     CDS             complement(271746..272843)
                     /codon_start=1
                     /gene="trmA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87KN8"
                     /locus_tag="PA25_02420"
                     /product="tRNA/tmRNA (uracil-C(5))-methyltransferase"
                     /protein_id="BBN80257.1"
                     /transl_table=11
                     /translation="MAVILIDTSVYEQQLAEKQQRISEQFAKFNAPELEVYDSPKTQY
                     RQRAEFRVWHEGDDLFHIMFDQQTKQKIRVDQFDPAAPLIQEMMQVMMDKLRHNEVLR
                     RKLFQIDYLSTLSGEILVSLLYHKPLDEHWQSAMQQLRQELQKTYKIDFIGRARKQKV
                     VFGDDFVTEKLNVNDQTLIYQQVENSFTQPNAKVNEKMLAWAQSICAPLKNDLLELYC
                     GNGNFSIALADSFNKVLATEISKSSVHSAQYNIAANKVENLDIIRMSSEEFTQAMKGE
                     RSFSRLNGINLQDYHCQTILVDPPRAGMDELTCRLVANYDNIIYISCNPDTLERDLEL
                     LCETHTVSRIAIFDQFPYTHHVESGVFLQRK"
     CDS             273027..274127
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02430"
                     /product="hypothetical protein"
                     /protein_id="BBN80258.1"
                     /transl_table=11
                     /translation="MKIGQLHQLLNPAMTNKANKPHTFVPSIKLNSDSYFGDKNKLAA
                     MVLDDKLAQALGIEKKAEKEKPLFDFDAITKNVLDFVTAAVKRAKADGKDDDVLKDML
                     GAARKGVQMGIDEATEELKGVNAFNEEIEQGIEKAKEGIFNGLDDFEESLFSPKSQSM
                     QISQAQYASLSNQAEYSFTTAEGDEVKISFSDVRSESQAAAYSQKGNDYGLAVGQQSN
                     HEVSFSISVNGELNLQEQQAINEMMKDVRNVSDSFFSGAYDDALDKAKSLNIDSDQIT
                     NFTMDLRQSKTTAAISQYQQSNPLKDIEKELQPLDKQLENVHDQGKKLGIEQQLPDIL
                     AWLNEGQARLNEFLDYAKGFFEQLNAREQQKK"
     CDS             274190..274969
                     /codon_start=1
                     /gene="murI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E218"
                     /locus_tag="PA25_02440"
                     /product="glutamate racemase"
                     /protein_id="BBN80259.1"
                     /transl_table=11
                     /translation="MPHILVFDSGVGGTSVLEHIKLLVPTAEYSYVMDNALLPYGLQS
                     EQTIQARLACLVKRANQLSVPVDLIVIACNTASTHALATTRELTDIPIVGVVPAIKPA
                     VLSSQKKHIALLATPATSSNAYTQSLIREYAKDCQVDLHQSTKLVSLAEQLYWQGSFD
                     VGQLHDELALIDISEKVDRIVLGCTHFPILKAQLSQYYGHSVELIDSGAAIAKRVKFL
                     LSNKLEVLEGTNKKPLQFYATAPDNLVFNSQIELQAMSLNC"
     CDS             complement(274959..275360)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02450"
                     /product="hypothetical protein"
                     /protein_id="BBN80260.1"
                     /transl_table=11
                     /translation="MQLLFSSIQVSTPIVFAIGIIIGGFAVSFTTSKPSSSDENEVAT
                     KTLYVGNLPYKANEGVVRELFAQQGQVFSVRLLKDKNTGKRRGFGFVEMAEKDADNAI
                     SQLNDKEFQQRTLKVRAAKQKQFDNEEEANS"
     tRNA            277661..277737
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="PA25_t00080"
                     /product="tRNA-Ile"
     tRNA            277852..277927
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="PA25_t00090"
                     /product="tRNA-Ala"
     CDS             281715..282329
                     /codon_start=1
                     /gene="yadS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005420789.1"
                     /locus_tag="PA25_02460"
                     /product="membrane protein"
                     /protein_id="BBN80261.1"
                     /transl_table=11
                     /translation="MFELMHWFDLLGVMVFAISGTLIAHSKHMDGFGVVVLATVTGIG
                     GGTLRDIILDVPVFWLHDTSYFVAIFGAIFICILLLNSHRVIPQQMLQIADALGLAFF
                     AVMGTQKALDIGMPDTTAIIMGVLTACFGGLIRDVVAREVPLLLKGELYAITCILGGL
                     VYTQMLKSSLSIEIAMVSAMSVTLLIRLLAMRYNLILHVFRYTN"
     CDS             282515..284026
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707862.1"
                     /locus_tag="PA25_02470"
                     /product="ATP-dependent protease"
                     /protein_id="BBN80262.1"
                     /transl_table=11
                     /translation="MSLAKIYTRAQVGIDAPQVTVEVHLSNGLPAFHIVGLPETSVKE
                     AKERVRSALTNSRFLFPDQRITVNLSPADLPKEGGRYDLAIAVGILVASGQLVSQELT
                     SYEFYGELALSGEVLEIHAILPSVLAAEKAQRCCYLPTANDELASLAPNVHRKAVCSL
                     EALWLDIQGQQALPLNMTYDTRVVDPIEHVDMNEVKGQESAKRVLEIAAAGGHNLMFI
                     GPPGTGKSMLAQRMPTIMPKLSANAALETASVYSLIGQRIDTQNWRRRPFRSPHHTCS
                     AVALVGGSSKPKPGEISLAHNGVLFLDELPEFERKVLDSLREPMETGQVTISRAARQV
                     DFPARFQLIAALNPSPTGNYDDKRASAEQVLKYLSKISGPFIDRIDLQIELPRLSTTQ
                     LQSDNPQESSAQIRERVEKAYMLAVKRQSKSNALLSNRELNEFCALALPEKQYLAKAV
                     DKLQLSPRSYHRILKVARTVSDLNAEPNITLNALKEALSYRAFERLIGKLAKY"
     CDS             complement(284023..284727)
                     /codon_start=1
                     /gene="aruR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9HUI2"
                     /locus_tag="PA25_02480"
                     /product="transcriptional regulatory protein AruR"
                     /protein_id="BBN80263.1"
                     /transl_table=11
                     /translation="MSIQVLLVEDDDLLAKRIQSHFAQTEFEIQVDNTGANALTLIQQ
                     TGNTDMPISLAIIDIVLPATDGLELAKEINTLTDIGVIMLSSRDSQADRIAGLAQGAD
                     DYVCKPVDLLELELRMRALYKRISQSNDEDESEEFIEYADFKLHPDNRTLLNQHGEES
                     RLTEAEHKVLICLIANAGKATSREKISEDIGQPDWSPNDRTVDVLVGRLRKKLGDEKD
                     QKRIVTVRGKGYMLST"
     CDS             complement(284958..287411)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005789772.1"
                     /locus_tag="PA25_02490"
                     /product="peptidase S9"
                     /protein_id="BBN80264.1"
                     /transl_table=11
                     /translation="MILRTVATLLASALTLQLNAAPLNEKQIQFLGPIPTHSNIKPNN
                     TAHQNKIIQTLLPSLKSSSDSLSIFGNSIDWQNLADINALTLPGIQVLKFSFATTRFT
                     QGKINLSGVKKAHVFLNGEQLTGEKSYDLHAVTGDHQVIIITEQVDNWNEVSIDYVPQ
                     SEHDQITLHNNEQVSLSAKQLFDSPTISALSQSPNGRFYITTQRHYSDLNGNTPITET
                     LIKKQDGSTIYRLDGVSANNVAWRSDSKQLAYVQANQLKTLDLKTMTSRVIADKLDGA
                     SNFEYFDDSSLIFSWSNTPKDSHTLVKHYRGLEDRWSYARINNQVYLLDINSGLISAL
                     TEGTLSHSLEDHDAQRNTILVSRNPQNYQAPPHMLTELIEINLSDNQQTMIGAYRTFK
                     QAKYANRGIYIVAGPDFANGIGKALPDGMLANNYDGQLFWLNNNGEQPKPLSKSFDPA
                     VANIQVLSNDDVVMLVTNEDKRQLYLYDKSKSHFKHIKTGFDVVDQFDVTHGQKADVL
                     VAGTQASVPQQLKRVSLSSNKAKRLWDSQQIAYKNSHIAQLEEFNFTNKLGTEIKGRV
                     YLPHNLDKTKRYPALVYYYGGTSPVSRAFTGRYPFNLWAAHGYVVYVLQPTGATGFGQ
                     QFSAQHVNAWGENTAQDIIDGTKAFTDAYSFVDPKRIGNLGASYGGFMTMLLATKTDM
                     FSASIAHAGISNITSYWGQGWWGYLYSGEASKNSFPWNNPTLYSQHSPVFHADKVKTP
                     LLLIHGDADTNVPPGESHNMYTALKILGKDVELIEYKGANHQILARDRRFQWWDTMLA
                     YFDMHLKQQPQWWQHIYKK"
     CDS             287519..288583
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011403685.1"
                     /locus_tag="PA25_02500"
                     /product="hypothetical protein"
                     /protein_id="BBN80265.1"
                     /transl_table=11
                     /translation="MFLLVTYMVLAIGISFLCSVMEAVLLSITPSYIAVLKKDKPKLA
                     DRVQQLKDSIDKPLAAILTLNTVAHTAGAAGVGAQAAVVFSDAAVGIASAIMTLLVLV
                     LSEIIPKTLGATYWRALTPVVSAALVWLVRVLKPFVWLSDMLTRLMGKKESEAHYIRQ
                     EIEAMAEIGSEAGALQEEETQTIRSLLRFRHAKLEHVMTPRTVLFKIHKDMTVNEYLS
                     EHGSVAFSRILVFDKSGDDIVGFVHKNDIMLAYHRLGEEYKIGKLVKPLYTVPETLDA
                     PSLFQTLLEKRIHIALVIDEYGDIQGIVTLEDMLESLMGMDIIDEREQSTNMQQAAKR
                     KWRERVDGHSHLIETDSEKH"
     CDS             complement(288580..289788)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011706358.1"
                     /locus_tag="PA25_02510"
                     /product="transcriptional regulator"
                     /protein_id="BBN80266.1"
                     /transl_table=11
                     /translation="MNATTRHVMVVDDSQAILMVMQAMLTELGVDEITTCTSATVALE
                     KIAQAPSRYDAIFTDLNMPEMDGMELIRQLGDIKYPGGVIIISDMDIKIIDLAANLAR
                     QSNAHLIGNISKPVQLKEVDRLLKKLESFIAPEKRHVESITQAELLHAISHRQITPYY
                     QPKVNRATKSIESIEVLARIITPEHTHTILPEQFITLAEDLDLINLVTFQLFEKATEE
                     FKEIRTELPHKVTLAFNLSPVQLDDINCPNKLALILELSRLKPEDVILEITEHVPLNS
                     TVQLETINRLRMRGFAISLDDFGTGFTNITQLKTLPFTEIKIDRSLITHIDSDRFSQV
                     IVDSLIDIAQSEQISIVAEGIERIEELQYLDRYKHNLLMQGFLISRPKAKSEFIRWIH
                     SWLRMMNSNS"
     CDS             289923..290936
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02520"
                     /product="hypothetical protein"
                     /protein_id="BBN80267.1"
                     /transl_table=11
                     /translation="MTRIEFTVLGNHFFALVDNGQLVQVFCEQQALPIESHSPGILRS
                     RFAQGVVQFDTAQLAQQQLGVSVNEGQWQWIELPAERIAAKRNYIGLAALGFKLVKSA
                     NVVKAALAGASVAGYAWLFSWQFALMFVACLVVHEYGHVRAMQYFKIKTKGIYLIPFV
                     GGLAVSDDKITTRWQDVVISLMGPAFGLFTSVLGVVIYYITDLEIFAAVAVLSALLNL
                     FNLLPILPLDGGHVLKSISFSMRSWVGLLVCMAGVLFGLWLSYIFGLMLLVFFLFVGS
                     LEIVFEWRARHTSHLLPLDRYGQVFSAVMYMLVVAGHVAVMMHFADSESVILSLPMKV
                     LSS"
     CDS             complement(290949..292268)
                     /codon_start=1
                     /gene="atoE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071598.1"
                     /locus_tag="PA25_02530"
                     /product="short-chain fatty acid transporter"
                     /protein_id="BBN80268.1"
                     /transl_table=11
                     /translation="MLYRVTRPISNLVERYLPDPYIFVLLLTLIVLALASLVTPFSAV
                     EAITTWGNGFWKLLTFAMQMLLILLAGYMLASTPVCIAALDKLAKQAKSPTLAIIMVT
                     LVAMLASWINWGFGLVIGALFAKALAKHVAVDYRILVASAYSGFIVWHGGLSGSVPLT
                     IASEGHFSQTSIGIITTQETLFSHFNLLILILLIIALPILNALLLPPKEQQVLIDKRK
                     LVDTVEQAPEDNGLLTPAQKLEHSKILGILIGLLGCGYLVHYFLFAAGTLNLNSVIAI
                     FLFLAILLHQTPARLLMSLHQAITGGAGIVIQFPFYAGIMAVMVDSGLAQQISSAFVS
                     ISSADTLPFWSFLSAGLVNIFVPSGGGQWAVQAPIVLPAAHMLEADIARVAMAVAWGD
                     AWTNLIQPFWALPVLAIAGLKAKDIMGFCLIQLIVSGVIIAAMLTWA"
     CDS             292464..292703
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011074051.1"
                     /locus_tag="PA25_02540"
                     /product="hypothetical protein"
                     /protein_id="BBN80269.1"
                     /transl_table=11
                     /translation="MAGQGSGGNVIAAICNIFFPGLGQLVQGRILAALIFAIVVVGGY
                     ALWFLVVPPVIGAVVHLWSIIDAAKYTNYSSYERR"
     CDS             complement(292683..293594)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011338408.1"
                     /locus_tag="PA25_02550"
                     /product="malonate transporter"
                     /protein_id="BBN80270.1"
                     /transl_table=11
                     /translation="MTAFSILFPIIFVVLVGYSCAKLNILSTSALDGLRQFIFNLAIP
                     VFLFISMYQADLSQALSSSVMLSFYVPVLAAYFFSFAALKFIVKQSNADSATLALAGT
                     YSNTVLVGLPIIIASLGADYGAMVFVIITFHSALLFGCTFLLASNFHGRVLLAFKPLL
                     FNPIVLSISTGLICNYAGIALPLAFQEGLHLLAEPAIAGALFALGASLNNYALKGAWR
                     GALGISVIKLMVLPSAVFALASWGMQLPSKQVAVLTLMSASPLGVNAYLVARQLQCQQ
                     SVLASSVVLSTLLSVLTLAFWLTALVT"
     CDS             293702..294070
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87LW4"
                     /locus_tag="PA25_02560"
                     /product="UPF0231 protein"
                     /protein_id="BBN80271.1"
                     /transl_table=11
                     /translation="MEYQFIKDPVTGFRVKISDEHMLVGRWLNEELPFEQVNSLLNSA
                     KNLSKAKPALVIEGKETRLTLSHEEALFESHALFHQSDELIRYADDALELDEHGLVSG
                     CGYEDFLELLQAWHQFINRN"
     CDS             complement(294087..294791)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072041.1"
                     /locus_tag="PA25_02570"
                     /product="prolyl 4-hydroxylase subunit alpha"
                     /protein_id="BBN80272.1"
                     /transl_table=11
                     /translation="MTDFIRVYDNALSAEFCDQFIDLFEKSPHLKQGITSGGVDLSKK
                     VSQDLYLNSHPEYAQPLQHIQQVTAQHVFKYVEEHLFMIIGAFGLKVYHPKTGKPVDV
                     TFENFEEVGKPQLPLLTQQLFRLGNIQAQKYEVNKGGYPYWHSEVYPQQGHNEALHRV
                     LLFMFYLNDVSEGGETEFYYQQKKIAPKKGSMVIAPGYFTHTHRGNKPISNDKYILTS
                     WILFNRAEQIYGAPTS"
     CDS             294820..295209
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704482.1"
                     /locus_tag="PA25_02580"
                     /product="thioesterase"
                     /protein_id="BBN80273.1"
                     /transl_table=11
                     /translation="MLSEKLMPRFSETDVLGHINNTVLPVWFEAARVPIFKIFTPDLN
                     PHQWKLIVAKVEVVFKGELFYGQEVEVKTAIEHIGNSSFVILQQAWQHGECCAEGKTV
                     MVRYDFSAKRAQSLSEDERTQLTPFMV"
     CDS             complement(295199..296056)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02590"
                     /product="hypothetical protein"
                     /protein_id="BBN80274.1"
                     /transl_table=11
                     /translation="MILITALALIAMLSEFWPKFIKIWDSLPGRAMILLFYAFVANYA
                     LVQSSGQVNDITGVSADYLPYTHNFAVLLSIPVWFFITSLVVLLIIQFTIPLYLFVLL
                     LLRPFGLHALWHPPGYRFPFMTGLVRFGAGLYLLAQLALLATYTGALNGVSTTAANII
                     NGLESDLIVNVAANPQEKITSAMKNDPELARSMAELDKATEQFSQQSSAYEHKVKRIL
                     ANFIFDNEADSKSRCEHTTGSRVIELNDYEILEVSKQGSAEDFYYTYQVKPCISAAIG
                     HQFKSNTTP"
     CDS             complement(296276..299095)
                     /codon_start=1
                     /gene="uvrA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87LA0"
                     /locus_tag="PA25_02600"
                     /product="UvrABC system protein A"
                     /protein_id="BBN80275.1"
                     /transl_table=11
                     /translation="MDKIEVRGARTHNLKDISLSIPRDKLIVITGLSGSGKSSLAFDT
                     LYAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTIT
                     EIYDYLRLLFARVGEPRCPTHDLPLAAQTISQMVDSVLEQPEGSKLMLLAPVVKNRKG
                     EHVKLLEQLSSQGYIRARIDGEVCDLSDPPTLELHKKHTIEVVVDRFKVKEGLQQRLA
                     ESFETALELSSGIAVIANMDDPHAEELIFSANFACPTCGYAMTELEPRLFSFNNPAGA
                     CQSCDGLGVRQYFDPNRVVQNPELSLSGGAIKGWDKRSFYYFQMLQAVAEHYQFDLEV
                     PFQKLPDEAKKVTLEGSGRTKIAFNYRNDRGDLITRNHEFEGVLNNMNRRYRETESSS
                     VREELSKYQTSQSCPSCHGSRLREEARNVFIGQTTLPDVTTMSIGEAMHFFDGLTLQG
                     QKAQIAEKILKEIRDRLSFLINVGLNYLSLERSADTLSGGEAQRIRLASQIGAGLVGV
                     MYVLDEPSIGLHQRDNDRLLSTLTHLRDLGNTVIVVEHDEDAIRAADHIIDIGPGAGV
                     HGGHVVAQGSRDDIINNPDSLTGQYLSGAKAIEVPKQRHECNDKWLELFGASGNNLKD
                     VDLRIPFGLMTCITGVSGSGKSTLINDTLFKLAHTELNGATTAEAAPYKEIKGLDHFD
                     KVIDIDQSPIGRTPRSNPATYTGIFTAIRELFAGTQEARSRGYKVGRFSFNVKGGRCE
                     ACQGDGVIKVEMHFLPDVYVPCDICTGKRYNRETLEVLYKGKNIHEVLEMTVEDAQQF
                     FDKIPAINRKLTTLMDVGLSYIRLGQAATTLSGGEAQRVKLARELSKRDTGKTLYILD
                     EPTTGLHFHDIQQLLVVLHRLRDHGNTVVVIEHNLDVIKTADWIVDLGPEGGAGGGQI
                     LIAGTPEEVAQYSESHTGTYLKPLL"
     CDS             299284..299997
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011706549.1"
                     /locus_tag="PA25_02610"
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BBN80276.1"
                     /transl_table=11
                     /translation="MAKTLPCELIVRFENYSAQSLQDEQMRWHGLDVDFAKALLDEAG
                     CGYRFISIPWGRALKMLEMGEIDLMLSVSKTAQRMRFAYFIGPQREENIVFAFNAQRP
                     FYVQSLEELFSLPRPVAIQRGAYYGEAFEARMKQESDSEDKFIYVPDNQLKLNLLRHG
                     RISGFLEEKYNIVYQREYNPDFVEIDIAPFVVNVEPVYIALSKQSVSKSVIDKLTRAF
                     KRLNESGKFEQILKKYKLD"
     CDS             300048..301415
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073745.1"
                     /locus_tag="PA25_02620"
                     /product="MFS transporter"
                     /protein_id="BBN80277.1"
                     /transl_table=11
                     /translation="MSNQSLNLLEKRAALSLASVFAFRMLGLFMLMPVLAIYGQSLEH
                     VSPMWIGLAIGAYGLTQALLQIPMGWLSDKFGRKPIIIVGLVIFAIGSVIAALADSIY
                     WVTVGRALQGMGAIASALLALAADLSRDEQRPKVMAVIGMCIGLSFAFAMLLGPMVAA
                     AFGISGVFWLTAILALCGIVIILFVVPSAVNKAPKGDTIATLSDIRKLSRHPQLLRLD
                     IGVMLLHLSLTTLFVVLPGQLIADGLVAEAHWKLYIPVLLLAFVLMAPLMIVAIRKQK
                     ERETFLAAIGLLVISTASLMMWANSVIGIAVCMLLYFIAFNFLEATMPALVSRIAPAS
                     QKGSAMGIFSSGQFFGAFLGGILGGYIAQYGEANSVFAAVACVGVIWLFIAWRMQIPP
                     KSKIISLITELSEPQQAEVLANKLVALPGVLEAIVVSEENRSYLKIDDKKFDLNQAKQ
                     ILGLH"
     CDS             301436..302107
                     /codon_start=1
                     /gene="ssb"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EA81"
                     /locus_tag="PA25_02630"
                     /product="single-stranded DNA-binding protein"
                     /protein_id="BBN80278.1"
                     /transl_table=11
                     /translation="MARGVNKVILVGNLGQDPEVRYMPNGNGVANISIATTDSWKDKN
                     TGQLQERTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGRLQTRKWTDQSGQEKYTTEIV
                     VDMGGQMQMLGGRNEQQGSAPYQGGQQQSNYTQQQYNQAPQQQQQQYAPQAQSNQSHS
                     QQQSSGYAPAQQSNQGQSGGFAPQQPQQSAPQQQGGFAPKPAQSGGASNPMEPPIDFD
                     DDIPF"
     CDS             302380..303342
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02640"
                     /product="hypothetical protein"
                     /protein_id="BBN80279.1"
                     /transl_table=11
                     /translation="MLKSVILRCGSYIFILLASIITQATEVSKVVQLEHVTIHYHFMD
                     NVSVKKELEINGLTNQAFAAYTKLFGGLPRDLKGKEYSDITIHVNKGKYLGGEADPKL
                     IMLSWNEGKAFGFATWQTILLHELFHLWSGESIRYQDGQEHWFNEGFAEFYAYKSAVE
                     LDLISSNEMLAMVSSVIGYYFSASRLGDISMREAGRTNNTKFDNYFLVYSGGWLVAMA
                     LDHDIRKRTNNNKSIDNLMQWLYSNFPRDKRRYTQKDIIEGIRLTTGLNYTKFIDSYV
                     DGHAILPVSEYLPISDALWALTLNKKNKSDFSVLYETLGITEYE"
     CDS             303563..305179
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02650"
                     /product="hypothetical protein"
                     /protein_id="BBN80280.1"
                     /transl_table=11
                     /translation="MQLFFKSLNWRMVAVGLAVIVALNILLLHLLHLQIHQRAEAVVQ
                     RVAKLPTELRTETNIAAIAQQFKFEYVPDDAPLPEEASQFSAAGISLNLVHPAPYQKH
                     AYIILFFNILFFGLLVFVYRWWQVYRVRPRRFLSDNKLDSHDNSILSTVDPKAADSSL
                     FKVFLLIRWTIKLEPGLDEKSHFSVAIHKHLPSSMKCSVKYLNSGALAVTFENIAWGD
                     VIELGKKLHEVMFRTLRSLRGDLSRKQIKVGGCFYQNEAEQANVYQLARAALEIANNN
                     VWQHVHMMPLDKTHENAMQNSEDDFVRCIKNGQFVLFFQPLFGFEQQDIIQSEVLLRV
                     RHAQLGLIAAKQFIPQLHSKDNLETLDKTILSKAISILSKEPHKSDVSINLHIENWVD
                     IDFIHWLIAQIRDTNQIKKLTFEVCADDYYKYHQQINVQQLFFTGVNVALIIDHVESP
                     LIVNILRENQLISAVKLGFGLVHKVHLSTQQQKTIKQIVYQAKRLKVAVYAVGVESQA
                     ELDCLKSLGVDGAQGYYFAELLQQLELVRY"
     CDS             complement(305165..306079)
                     /codon_start=1
                     /gene="acdS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011963338.1"
                     /locus_tag="PA25_02660"
                     /product="1-aminocyclopropane-1-carboxylate deaminase"
                     /protein_id="BBN80281.1"
                     /transl_table=11
                     /translation="MSFNQFDFPESPLQVISHPLLKQKNITLTVKRDDLHHPHIAGNK
                     WRKLKYNLIKMQQERKAAFLTFSGPFSNHLYAVSMACKLFSLEGNVIIRGPHLDENNP
                     TIRMARACGVKLHTVDRATYRLRYQESYLNELQQQFAHCHLIPEGGSNQFAMLGLKEL
                     AQSLPKSDYIMCATGSGGTLAGLINASSCKTSIIGIAVLKQAEYLNSDILRLAPKAAN
                     QSNWQLMCDFHDGGYGKFSAELWQFCQTMRKNYNLPLEPIYSGKLFYALWHLLEQDFF
                     APGSHITAIHTGGLQGLDGLRYRKLISH"
     CDS             306294..308333
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011263653.1"
                     /locus_tag="PA25_02670"
                     /product="NirV precursor"
                     /protein_id="BBN80282.1"
                     /transl_table=11
                     /translation="MRIAPLSFFVSATLMAACATFNVTAQDTATVNAIESELSVKQAE
                     LDNYTQILDKHLGEETRLQSQLDLLRKRSTDLDKEKNQALDAMNDLYRRLIDDPTIDI
                     SKAQARYKEAVSEHKKNKDDITMQLAAIASHRKDIEQIRVTKHTLINTLESLKDQLST
                     ARVERLRNEFTREGTLEVDHTINCKRTETLAACEQRGQQMALQKATKRFVDQLFANLT
                     EQRLVEPKRNLAGAQVQVLNSHVVSSAFSGQGNYSVNLSVSMRGDVNNSRLCSLISID
                     NRFCAEYGTPMAGSVGTYQANYPAVYNDSQLNFSEQTTTVPSRVQVSRLNVEPTIEVT
                     QSSAQAMPEKKTPAMIPVTLRSNVYDDEVFINGVSYGSTKLSVKLPAGTYDVEIRKLG
                     YKPYKKRMTIRKAQTINAKLVKKPESIAVPTPKSEQGSTETTPKVISQTPKNEVVIVP
                     AGSFKMGDLVGNGLANERPVLEKVLSNSYGMQSTEVTVGEFRMFIESTGYVTAAQKSR
                     GCAYYKDGEPVWELDYNWQAPGYEQAENFPVVCVSYEDAKAYANWLSAEQGEQFRLPN
                     EVEWEYAARAGTKSEYPWGNEIGKSLANCGWCGSEWSNKSAAPVGEFPPNYYGLYDTV
                     GNVWEWTQKRASQSGVTVRGGAWNFAPSLARVSTRLELATDFRANYIGFRLVRER"
     CDS             308404..309447
                     /codon_start=1
                     /gene="mreB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_007651015.1"
                     /locus_tag="PA25_02680"
                     /product="rod shape-determining protein"
                     /protein_id="BBN80283.1"
                     /transl_table=11
                     /translation="MFKKLRGLFSNDLSIDLGTANTLIYVKEEGIVLNEPSVVAIRQE
                     RAGGPKSVASVGTAAKQMLGRTPGNIKAIRPMKDGVIADFYVTEKMLQHFIKQVHNNN
                     FMRPSPRVLICVPCGATQVEKRAIRESAMGAGAREVYLIEEPMAAAIGAGLPVSEATG
                     SMVVDIGGGTTEVAIISLNGVVYSSSVRIGGDKFDEAIINYVRRNFGSLIGEATAEHI
                     KHEIGSAFRSDEPISIEVRGRNLAEGVPRSFTLNSHEILEALQEPLMGIVSAVMVALE
                     QSPPELASDISAHGMVLTGGGALLKDLDRLLMEETGIPVVVADDPLTCVARGGGKALE
                     MIDMHGGDVFSYD"
     CDS             309447..310289
                     /codon_start=1
                     /gene="mreC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KFA8"
                     /locus_tag="PA25_02690"
                     /product="cell shape-determining protein MreC"
                     /protein_id="BBN80284.1"
                     /transl_table=11
                     /translation="MNLLFGRTVSLQLRLTVAVMLSIILIVGDRFTQGGDMIRTSLHT
                     AVSPLLYLASMPYEVFNSGAKSLQTREQLNEENSTLKHKQLLQSEQLQQLQFLQQENK
                     KLRALLNASAREKNTRQIAQVISVHSNPYSHQVVVNRGTIDGVTESQPVIDEMGLVGQ
                     LTQVGTTTSRVLLMTDITHATPVRILRNDVRTVVEGIGKINKLKLSHVPHSLDVRIGD
                     VLVTSGLGGTFPEGYPVAVVTELNRDEGLPFAQVYAEPIAQLDRVRLLLILGRTSQES
                     LDND"
     CDS             310282..310761
                     /codon_start=1
                     /gene="mreD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KFA9"
                     /locus_tag="PA25_02700"
                     /product="rod shape-determining protein MreD"
                     /protein_id="BBN80285.1"
                     /transl_table=11
                     /translation="MIKRYYFLIAFSVFLALVMALMPLPISAEPFRPDWVLLVLMYWS
                     LAVPHRVNIGWAWVAGLLMDLAIGAPLGVNSLTYSICIYITVSNFQKIRNFSIWQQAM
                     LVGLFLTLYHLLLFWLNHFLLDVYFSPHYLWPAFTGMLCWPWIFLLLRKYRRQFRIR"
     CDS             310761..311339
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E7X6"
                     /locus_tag="PA25_02710"
                     /product="Maf-like protein"
                     /protein_id="BBN80286.1"
                     /transl_table=11
                     /translation="MPLSLYLASASPRRKQLLAQLEYEFVQFSVDADETQLSNESPLE
                     YVERLARLKAELGVQKGYNDRPVLGSDTVVVIDDIALGKPKDKSDFLSTMERLSGRTH
                     QVYTAVALADSTHTLSCVVATDVTFKMLSEREIDQYWLSGEPLDKAGGYGIQGIGGKF
                     VTKMSGSYFAVMGLPLYETEQLIKEFTEGYYE"
     CDS             311332..312804
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704378.1"
                     /locus_tag="PA25_02720"
                     /product="ribonuclease G"
                     /protein_id="BBN80287.1"
                     /transl_table=11
                     /translation="MSSELLINVTPSESRVALIENGVLQEVQVERIGNLGIVGNIYLG
                     KVSRVLPGMQAAFVDIGLEKAAFLHASDIVNSASFEEGVDEQPVKKVQDIRELVKQGQ
                     YIMVQVVKDPLGTKGARLTTDITIPSRYLVFMPDATHVGVSQRIETEEERARLKEIVS
                     EYNDENGGFIVRTAAEGASEAELKHDAEFLKKLWRKIVSRRKKTSKAAILHEDLTLAF
                     RTLRDYVGEDMERIRVDSKLTYQELKAFTEEFVPLLGKALEYYPGERPIFDLFDVENE
                     IQKALHRKVELKSGGYLIIDQTEAMTTVDVNTGAFVGHRNLEETIFNTNVEATSAIAR
                     QLRLRNLGGIIIIDFIDMVSDEHKRRVLHSLETALAKDRAKANINGLSALGLVEMTRK
                     RTRESLEHILCDVCPACAGRGSLKTVETVCYEILREIVRVNRAYDADKFMVYASPAVS
                     EALINDEYHNLAELELFIGKQVSIQTESLYSQEQFDVVMM"
     CDS             312821..316678
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073797.1"
                     /locus_tag="PA25_02730"
                     /product="DUF3971 domain-containing protein"
                     /protein_id="BBN80288.1"
                     /transl_table=11
                     /translation="MQVKTFCFFCIRKIWQVFAITLVTLAVLVSVIKYSLPYANDYRE
                     RIEDIIHQQFGVNLSLGSISASWESNGPALVLENLTFVDNESSPIALSIQKTSLQLNV
                     LESLKNWQIRSNYFVIDGFSAQVNLAELAQANDNEQSQEFEQQSLIESLFLGETGHFS
                     IQSSQLNLRTKNGFIHTLLLNDLTWQNSPENHKGEGEVAIPGLQQGRFSARIALTGNT
                     LRNLAGQVYLQAQNVDVAEWLTEQLSTQQKHISTELNGELWLALSDGQVRDVTINALP
                     SKVQWIDAQSPHEFTLSRGQVQLVPNEGVWKLRSSELLLNLDNTNYTPVKFEGQFGEQ
                     GRYFWFEDVNVGLVKELSQLLQLNEVDTLANVNVQGQLQGRIAWSPATSYQVWLNVEN
                     LGWSPFSGVPGLSKARVELLWQSTGAAINVFSEHSALLSEGMFKKPLEYEQLNAQLQL
                     YQQNDVWHITSDSLWFNNQELTVAGEMHLALNENPKLDLYAEVLGGNAKTASNYYPRT
                     VMSENLVEYLERGVLAGQHRKSQVLLSGVLDAFPFDNGKGQFEVLSHISQADFLFAPD
                     WPAVKNADVTLHFANERMDIYANEGELINQQLSSPVVVTLPNLNQADNLYVTIDHETN
                     AQTLLPFFNATPLKEPLVNVLEVVKGEGRVSGQVSLDIDLNSLDVHASGKIDLNSADI
                     FLAQPGMQLSNVDGILHFEDDRIELKQSTATWLGMPLSIDVFGDGDSDQYEVNVDTVL
                     SAQASKLIPHTQGLLDGLVEGESQLRTQVKLQFMEQGFNYNAQLHANLKGVTSHFPIP
                     YQKPSEEEWVLSAQIQGDDISNLITANLAERLFFNGILDNQTGKLSQAQLIVGQDNKG
                     LVVGSGFHVAISQPNMEVEPWLTFIDRLISLPNSEDTLLPELEMITAQFANIHVADIP
                     FTDLEMRLFPSSDGMTMRLNAKELRATILLPRRGSSRPILVDTDYLRVNFKEQAEQTE
                     KAKVAELDWLTRIPAIEFNCGDCKLGRYQLDKVTASLFGDAKQLTVSELVVDKGDHVL
                     RGQGRWVDGQSYFDGILNSKDIGELFDEFDLTSTIKDSRANVGYQLNWQGAPYDFDIA
                     TLGGEINWELGEGHLTEVSDQGARVFSLLSLDSLIRKLKLDFRDVFSKGFFYNQMKGS
                     IQLDKGIAYTKDTKLDGVPADLSIQGYANLNTLEINYDLAVAPQVTSSIPVIVAWMVN
                     PVSGLAALALDKVIHSARVISEIKFKVTGTMSEPVVQEVDRKSREVEIPQAAQNEPPN
                     PEVESAPFKQISSSNEGAIPVSG"
     CDS             316714..317538
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073796.1"
                     /locus_tag="PA25_02740"
                     /product="amidohydrolase"
                     /protein_id="BBN80289.1"
                     /transl_table=11
                     /translation="MPTSRVIAVQMCSVMKPEDNFLQLKHWLSQCEFNFPTLVCLPET
                     WLAFMKTAGQSFELSKHYEYWLTKLGQLCREYNIWLAAGTMPVSNGLDKYYAASFLLN
                     EQGEVVARYNKIHLFDADVADGSGGYRESKSTVPGSDVVVVDSPFGRIGLSVCYDLRF
                     AGLYQVMRQLGAEIFLVPSAFTTVTGQAHWTPLLQARAIENQCYIVAAAQFGEHENGR
                     KTYGHSLILSPWGEIMADAQQALGSISAELDLTQLHKLRADMPVQVHNRFKSEFYE"
     CDS             317531..318970
                     /codon_start=1
                     /gene="tldD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261176.1"
                     /locus_tag="PA25_02750"
                     /product="peptidase"
                     /protein_id="BBN80290.1"
                     /transl_table=11
                     /translation="MNNVEQRLLTDSQLNREQLEKTLSYIHQHKVDYADLYFQSSHHE
                     TWVLEDGSVKEGSYNIERGVGVRAVAGEKTGFSYSDAINLEALNKAALAARSIAQAGE
                     SKKVQVLSEAAITTQFAPAHPIQSMTDADKVALLREVESAIRDLAPDAQQVVSSIAAV
                     YEEVLIAASDGTFATDIRPLIRLNCSVLLEKNGRRERGSAGGGARLDYGYFKELVNGK
                     PRWLEYAQEAVRQAKVNLQAVDAPAGTMPVVLGAGWPGVLLHEAVGHGLEGDFNRKGA
                     SAFSGKVGEKVASSLCTVVDDGTMLNRRGSLNIDDEGTPAKRNVLIENGILKGYMQDK
                     LNARLMGVQPTGNGRRESYAHLPMPRMTNTYMLPGSDSKADIITSVKKGIYAPNFGGG
                     QVDITSGKFVFSASEAYLIENGKITQPIKGATLIGNGPDVMNKISMVGNDLELDRGVG
                     VCGKDGQSVPVGVGQPSLKIDEITVGGTS"
     CDS             319206..319631
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02760"
                     /product="hypothetical protein"
                     /protein_id="BBN80291.1"
                     /transl_table=11
                     /translation="MDMFLTRLIYASTIGEHFSQHTIEDILETARHNNVKHNITGVLC
                     FNCSYFLQCLEGPRADVNETYKRILNDDRHHNIVMLDYREIDSREFSDWTMGYIPSST
                     ISIPINLKFSEASEFNPYAMSGASAYMMLLELKHSVPTL"
     CDS             complement(319685..320206)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EA30"
                     /locus_tag="PA25_02770"
                     /product="UPF0307 protein"
                     /protein_id="BBN80292.1"
                     /transl_table=11
                     /translation="MAKQNKPDIEEEIIYVSKSELKRDAQQYQQLAQDLASMPKKQRD
                     KLPLTDDLLEAMVVADKIRQKSEAYRRHINYITKTLRLTENVEDIEAAIAVMLNKNNQ
                     ADVLLNKVELIRNELIEQGDSKINELLEQYPTLERQKMRQLVRQASKEFKTQKPAKGY
                     KELFQYIKEAIMP"
     CDS             320337..321686
                     /codon_start=1
                     /gene="pmbA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000852994.1"
                     /locus_tag="PA25_02780"
                     /product="metalloprotease PmbA"
                     /protein_id="BBN80293.1"
                     /transl_table=11
                     /translation="MVQSQQHPIYNQIDDVKQAVSEALSHAKKLGATAAEAAMSSTSG
                     LSVSTRMGEVDTIEFNQDGGLGISVYVGNHKGNASTADLSPAAIKTVVEKAIDIAKFT
                     SDDPCNGVADKELLEMSPPDLDLFHPWEVTPQEGIALCLEAEKAALDSDKRIVNSDGA
                     SFSSHQGLRVYGNSHGLIAGFPRTRHTLSTVVIGKDGEQMQRDSAYTISREKKGLKAA
                     REIGLEAAEATLARLNSQKLSTMKTPVVFRADIANSLFGHLVSAIGGGALYRKSSFLL
                     DHLGKQVFNSCVNVVERPHLLKGLASSPFDSEGVKTVDRDIIHGGELRTYLLASYAAR
                     RLGMSATGHAGGIHNWLVQQTHDDLSELLNEMGTGLLVTELMGQGVSTVTGDYSRGAG
                     GFWVENGQIQYPVSEITIAGNLKDMFQNIQGIGGDIEYRGSVQTGSVLIESMQVAGA"
     CDS             complement(321718..323076)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EAE0"
                     /locus_tag="PA25_02790"
                     /product="magnesium transporter MgtE"
                     /protein_id="BBN80294.1"
                     /transl_table=11
                     /translation="MPEALEQDYTLQQLQQVTQALNSGQFVQVRRILAETAPCDTALL
                     LESSPHKVRRQLWQLVDPDIQGDVLEELSEDVRLSIIVQMEPELIAAATEDMDDDDLG
                     EVLRSLPETVYQDVVGAMDSQDRERATQALSYQERSAGALMNTDTVTIRPDVSLDVVL
                     RYLRLRGALPDGTDDLYVVDKDNCFIGALSLNSLLTNSPDKLVSELMDTDKESIPITM
                     DETEVAQLFERHNWISAAVVDDNAHLLGRITIDDIVDVIREDAEHSLMSMAGLDDEED
                     TFAPVFKSSKKRSIWLGINLLTALLAAFVASFFESTLDILPFLAVLNGIVPSMGGVAG
                     SQTLTLVIRGIALGHINQTNQRFILGKELAIGALNGILWSILIAGVVALWQWDFVLGA
                     VIAFAMFMNLLAAGIAGASIPIILKRMNIDPALAGSVVLTTVTDIVGIFAFLGTATWF
                     LV"
     CDS             complement(323252..323524)
                     /codon_start=1
                     /gene="npr"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KP46"
                     /locus_tag="PA25_02800"
                     /product="phosphocarrier protein NPr"
                     /protein_id="BBN80295.1"
                     /transl_table=11
                     /translation="MRCEDTFLIQNKCGLHARAASVLAQLAVKFDAQITLYQDEKSAA
                     GNSVLALLLLESSQGKEVKVVCDGPDAQGALQAVGELIAQKFYEQE"
     CDS             complement(323528..324373)
                     /codon_start=1
                     /gene="rapZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8Z3G1"
                     /locus_tag="PA25_02810"
                     /product="RNase adapter protein RapZ"
                     /protein_id="BBN80296.1"
                     /transl_table=11
                     /translation="MELIIISGRSGSGKSVALRVLEDLGYYCVDNIPVNLLPSLVRSV
                     SDNYDKIAVSIDVRNLPKEQQDFNDILEYLPGFANPMLFYLDSDDNTLIRRFSETRRL
                     HPLSMHDLPLDLAIREEKKLLDVLTTRADVLIDTSELSVHQLAETIRERILGKKDKQL
                     IVTFQSFGFKHGIPKEADYVFDARFLPNPHWEPELKPLTGLDQPVKDYLASHSIVQKF
                     TWQIQTFVQTWLPHLERNNRSYLTIAIGCTGGQHRSVYLAQTIGESFARTHSNIKIRH
                     REQDT"
     CDS             complement(324392..324844)
                     /codon_start=1
                     /gene="ptsN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261179.1"
                     /locus_tag="PA25_02820"
                     /product="PTS IIA-like nitrogen-regulatory protein PtsN"
                     /protein_id="BBN80297.1"
                     /transl_table=11
                     /translation="MKLSSIVNKDCTKAAVLFNSKKRVLEYISELAHEQLPHLNPHDI
                     LNALMSREKLGSTGIGKGIAIPHGRIDGIEQVTAMLLVNQQGIPFDAIDNRPVDIFLA
                     LIVPDGDNEQHLKTLAAIAEKLNNKEFCKQLRNAGNDEELYAIIASAD"
     CDS             complement(324847..325140)
                     /codon_start=1
                     /gene="yfiA-2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005305957.1"
                     /locus_tag="PA25_02830"
                     /product="ribosomal subunit interface protein"
                     /protein_id="BBN80298.1"
                     /transl_table=11
                     /translation="MLMQLNLTGRHVEITDSLRDYVNNKFAKLERHFDHINNVHVILD
                     VEKLVQKAEATLHVNGGELFASTEHQDMYAAIDGLIDKLDRQVIKHKEKLIRH"
     CDS             complement(325162..326670)
                     /codon_start=1
                     /gene="rpoN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EAE5"
                     /locus_tag="PA25_02840"
                     /product="RNA polymerase sigma-54 factor"
                     /protein_id="BBN80299.1"
                     /transl_table=11
                     /translation="MRQSLQLRMGQQLTMTPQLQQAIRLLQLSTLDLQQEIQEALDSN
                     PLLEVDESDSDPETHSSDQEKNGKDDSRDDTQTDNQEVEAISDYEMDSDSALTKETLS
                     DELAMDVTWDEYMSAAPAASSGPMPEDETIYQGETTETLHEYLMWQLELTPFSPTDRG
                     IAVAIVEAIDDNGTLTLSTEDILESLNDGNSGEPIELDEVEAVLKRIQLFDPIGIGAR
                     TLQECLCIQLNQFDPNTPWLNETKMILNEHIDLLASRDYRTLMKKTKLKENDLKEVMT
                     LIHTLNPKPASSIIREESEYVIPDVSVKKVKGRWVVELNPDCMPKIRVNDHYAAMSRS
                     VKSSTDSQFIRSHLQEAKWFIKSLESRNETLMKVTNCIVQQQQAFFEHGPEAMRPMVL
                     NDVAEMVEMHESTISRVTTQKYMHTPRGIFELKYFFSSHVSTENGGECSSTAIRALIK
                     KLIAAENTAKPLSDSKIADILAEQGIKVARRTIAKYRESLAIPPSNQRKSLI"
     CDS             complement(326727..327452)
                     /codon_start=1
                     /gene="lptB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005417497.1"
                     /locus_tag="PA25_02850"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBN80300.1"
                     /transl_table=11
                     /translation="MSVLTATALAKSYKGRQVVKNVSLSVEAGSIVGLLGPNGAGKTT
                     SFYMIVGLVPSDHGSVCINDHDITLLPMHNRARLGIGYLPQESSIFRKLTVYQNLMAI
                     LETRNSLNKVAREQVLNELLDEFNIQHIRDSLGMALSGGERRRVEIARALAANPKFIL
                     LDEPFAGVDPISVLDIKKIIEHLKNRGIGVLITDHNVRETLDVCEKAYIVSHGELIAS
                     GTPEHVLADQTVRDVYLGEQFKL"
     CDS             complement(327455..327904)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02860"
                     /product="hypothetical protein"
                     /protein_id="BBN80301.1"
                     /transl_table=11
                     /translation="MANEVSIKAGKQQAQLKTNIGIFEQNVEIIHGNRTINADRLEVH
                     RREELGDNKQLLVATGSPARFSEKQPDGTTLSASAMEIRYDVANRTLEIKGNATINQA
                     GQIIQAQAITYDMDKQLISAERGEQDSARVHTILVPEKKAKQAGQGN"
     CDS             complement(327972..328526)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02870"
                     /product="hypothetical protein"
                     /protein_id="BBN80302.1"
                     /transl_table=11
                     /translation="MSSNRVALFVVFIAAMLWLWYPYLTQTTPKVRNQSDVIAKPDYI
                     ATQLEQTSYNEAGIRSYTVTADKMELYQELGFSHFTMPVFTLYNGPQNWLISSTEATL
                     YENNTLMLEGNVEAKNLTSGAMITLIKADNIRVEIDERLMQSERPVEITGPSLKITGK
                     GLNADLNTDIIELINHTRTIYYDQ"
     CDS             complement(328627..329598)
                     /codon_start=1
                     /gene="kdsD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EAF0"
                     /locus_tag="PA25_02880"
                     /product="arabinose 5-phosphate isomerase"
                     /protein_id="BBN80303.1"
                     /transl_table=11
                     /translation="MLSKQFTDTALRVIAIEQQAIAEIGQHIDQYFAQACQAIYDCQG
                     RTIVVGMGKSGHIGNKIAATFASTGTPAFFVHPGEASHGDLGMITKHDVVLLISNSGE
                     TSEVLNIIPVIKRIGAKTIAMTGNPQSSMAKLSDIHLCVAVSQEACPLGLAPTASTTA
                     TLVMGDALAVALLEAKGFTADDFALSHPGGALGKRLLLTLSEIMHKADQVPVVSHLST
                     IKDALFEMSAKGLGMTTVVDEQERLVGIFTDGDLRRIIEQRIDLHTTPIHKAMTINCT
                     TAREDMLAAEALNIMETKRINGLVVIDDNKRPIGALNTQDLLRAGVL"
     CDS             complement(329609..330565)
                     /codon_start=1
                     /gene="yrbG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261186.1"
                     /locus_tag="PA25_02890"
                     /product="sodium:calcium antiporter"
                     /protein_id="BBN80304.1"
                     /transl_table=11
                     /translation="MLLSFVVLVLGFAALVWSADRFVFGAAALARNFGVPTLIVGLTI
                     VAMGSSAPEMMVAAQAALADKTDTAVGNAVGSNIANILLVLGITALLRPLSVSSGILK
                     REMPLLIMVSLAAWFIVSDNHFSLLEGAALLAGFICFLLILIVITKKGGADADPLISE
                     ACDEVPDNIPTSKALFWLIVGMIVLPVSSSYLIDAAVDIAKYFGMSDLLIGLTIIAIG
                     TSLPELAACIAGVLKQEDDLALGNIIGSNIFNILAVLSIAGIINPSDIDIDIAGRDIY
                     IMLGATFALVLMSLSFTGSRRINRIEGGLLLTAFIGYMFYII"
     CDS             330746..331588
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707618.1"
                     /locus_tag="PA25_02900"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BBN80305.1"
                     /transl_table=11
                     /translation="MSQLVNVDLESDLSQAIVEVKDVTFTRGDRVIYKNMSFSVPKGK
                     ITAIMGPSGIGKTTMLRLIGGQLKPDNGDILFEGQSIPSMSRKALYDVRTKMSMLFQS
                     GALFTDMSVFDNVAFPLREHTQLSEDLIRLVVLMKLQAVGLRGAKDLMPSELSGGMAR
                     RAALARAIALDPELIMYDEPFAGQDPISMGVLVKLIKSLNEVLGLSSLIVTHDVNEVL
                     SIADHVVIIAEQGVIGSGTPQQMQQHESDLVQQFLKGLSDGPVPFHYQAQDYQDELLS
                     GSQR"
     CDS             331585..332364
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005455118.1"
                     /locus_tag="PA25_02910"
                     /product="ABC transporter permease"
                     /protein_id="BBN80306.1"
                     /transl_table=11
                     /translation="MIDFFQSIGHKTLSRFASVGRATRMLIGALVSVPDFRKGPALLI
                     RQLYMVGHQSLLIIMVSGLFIGMVLALQGYTVLVGYGAEDSLGPLVALSLLRELGPVV
                     TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAIDPLRRVISPRFWAGFISMPLLALI
                     FSAVAILGAHLVGVDWLGVDSGSFWSIMQSQVSFEKDILNGMIKSFVFALIVTWIALY
                     KGYDCIPTSEGISKATTETVVHSSLAVLGFDFLLTAVMFSG"
     CDS             332381..332923
                     /codon_start=1
                     /gene="mlaD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073691.1"
                     /locus_tag="PA25_02920"
                     /product="outer membrane lipid asymmetry maintenance
                     protein MlaD"
                     /protein_id="BBN80307.1"
                     /transl_table=11
                     /translation="MNTRKIEILVGLFVALGVAAFAVLALKVANSGISGSGETYTLNA
                     KFENIGSLKTRAPIKVGGVVIGRVEGISIHPQEFVPVVAMSIDSSYECQFSDTSSVSI
                     LTSGILGEQYLGISPVIASDSAKQTCLGNEVTNASSELDDLFGVQSKALKDGDLVTDT
                     KSALVLEELIGQFLFNQGSE"
     CDS             332929..333606
                     /codon_start=1
                     /gene="mlaC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073690.1"
                     /locus_tag="PA25_02930"
                     /product="toluene tolerance protein"
                     /protein_id="BBN80308.1"
                     /transl_table=11
                     /translation="MLGRVLIAIAALWFSSISSANEPVDLNDPYKMVQQVADNTFKRI
                     TRDQEAITESKEHLRVIVEQELLPYIDYKYAAYRVLGSYIQKVRNISNKEEKAQAIEH
                     IKQFIEVFKNYLVATYAGVFTQYTNQHVEFSPAKDFAGDQVAIVKTTIVEPGKPDIKI
                     DFKVRRDSNNEWRAYDMMAEGISLLDAKQSELHGILRQQGIEHVIELLDKKSRLPVQF
                     RGDDGSK"
     CDS             333593..333892
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_02940"
                     /product="hypothetical protein"
                     /protein_id="BBN80309.1"
                     /transl_table=11
                     /translation="MAASKVQFKQLENDLVQVSGELTRNSLNDERLLNQQIENVQSVR
                     YFDLSEVSRVDTAGLAWLIHSLGKLQQQGKRLELKNIPTQLHNLMALGQVSNLFE"
     CDS             333898..334155
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005306001.1"
                     /locus_tag="PA25_02950"
                     /product="hypothetical protein"
                     /protein_id="BBN80310.1"
                     /transl_table=11
                     /translation="METNQVETLLKETLSLEEVIVKANGSHYEVIAVGECFDGLSRVK
                     KQQLVYGPLMASISDGTIHAVSIKAFTPTEWQRERKFILPQ"
     CDS             334166..335425
                     /codon_start=1
                     /gene="murA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KQ23"
                     /locus_tag="PA25_02960"
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="BBN80311.1"
                     /transl_table=11
                     /translation="MDQFVIQGGTTLAGEVTISGAKNAALPILFAALLADGVSHFSNV
                     PQLRDIGTTEALLKTLGAGIKWQGDVLQVDGSTVDKVLAPYELVKQMRASVLALGPLL
                     ARFGEAQVSLPGGCAIGARPVDIHIRGLEKMGATISVDNGYINAQVNGRLKGAEIYME
                     MVSVGATENLLMAATLADGITVLENAAREPEIVNLADCLTAMGAKITGAGTSRIEIQG
                     VEKLNGCEHKILPDRIETGTFLVAAAMAKGEVLCKNTDHVSLEPVLDKLRAANALVEV
                     NGDSIYLDMRERNLAAVNIKTMPHPGFPTDMQAQFTALNVVAQGSATITETIFENRFM
                     HVPELQRMGANIRLEGNTAICGDTDKLSGAQVMATDLRASASLILTGIVASGETIVDR
                     IYHVDRGYQRIENKLSQLGAKIKRRHN"
     CDS             complement(335487..336572)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000911599.1"
                     /locus_tag="PA25_02970"
                     /product="outer membrane-stress sensor serine
                     endopeptidase DegS"
                     /protein_id="BBN80312.1"
                     /transl_table=11
                     /translation="MLKLIRFLLPPLIAGLCIAFFIIWFSPNLKNAVLPKFDMTRHYT
                     SNHMSFADAVEKAAPAVVTIFSESISSVPRYMRTNTTQELGSGVLMSHDGYILTNYHV
                     VNDADQIMVILTDGRRFNDVQVIGFDTITDLALLKIDAQHLPVIPIDDNFSPRVGDVV
                     LAIGNPLNLGQTITQGVVSATGKQTLTDSPYNNLLQMDAAVNVGNSGGALVNSNGVLV
                     GITSAQFRTRYNIDIQGISFAVPYKLAKEVMQKLIVDGRVVRGYLGFRGAAVDSTGKE
                     VTDLYTRIVGLRVSDLDPLGPAWQAGMQENDIIVKVAGEPVTNPQRTLKFIGNTRPGT
                     RLEFEVYRGDELRTFTLVVAELETRAN"
     CDS             complement(336669..338021)
                     /codon_start=1
                     /gene="degQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073684.1"
                     /locus_tag="PA25_02980"
                     /product="serine endoprotease DegQ"
                     /protein_id="BBN80313.1"
                     /transl_table=11
                     /translation="MKLKHSLLTAAILSTALLINPHAAYAKLPMAVDGQTMPTLAPML
                     ERVTPGVVSIQVSGAKEVRRRVDPFDYFFGNPQPRSQKRPFSGLGSGVIINADEGYVV
                     TNNHVIADAEKIIVTLEDGREFEAKLVGTDKESDIALLEIDGEKLTEVKLADSDKLRV
                     GDFAVAIGNPFGLSHTVTSGIISALGRSGLNIEGYEDFIQTDAAINQGNSGGALVNLR
                     GELIGINTAILGASGGNVGIGFAIPSNMMKNLVDQIVEFGQVRRGSLGIEGRTLDAGI
                     AKAQGFDVKQGAYVARVIKDSAAAEAGILANDVITSVNGDDIQSFAELASKIATIGEG
                     RTVELGIYRDGRKRTIEVTLKGQGEAQAPADKVHPMLRGAVLESGERNGNKGVVVTSV
                     EPRSPAARVGLEEGDVIMQVNRKRVDTIRDMSSLIEDIQGNIVLGIKRGRDSVFLLIQ
                     "
     CDS             complement(338147..338605)
                     /codon_start=1
                     /gene="yhcB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011262645.1"
                     /locus_tag="PA25_02990"
                     /product="cytochrome D ubiquinol oxidase subunit III"
                     /protein_id="BBN80314.1"
                     /transl_table=11
                     /translation="MTSFAWIGLIIIVAIAAFFVGSVWTKKQFKHSDLEQQAQQAKHE
                     LEQYRQEVADHLASTKKLMGKMQDSYSQLLSHVEETNQVLLSEKPSHPSEPFFSKETT
                     EQLHASLKSRPERRRSDRANEGFAQPTDYVDGESGLFSGERLEVEQTKAS"
     CDS             338761..339849
                     /codon_start=1
                     /gene="yhcM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E2M8"
                     /locus_tag="PA25_03000"
                     /product="cell division protein ZapE"
                     /protein_id="BBN80315.1"
                     /transl_table=11
                     /translation="MTPWEKYQQDLQREDFQYDNAQENAVKHLQRLYDDLTAKPAPRK
                     GLLSKLFGKSEAQKITGLYFWGGVGRGKTYLVDTFYEALPTQRKMRVHFHRFMHRVHD
                     ELKLLKDVKNPLETVADKFKAETDIICFDEFFVQDITDAMLLGGLMQALFARDIVLVA
                     TSNIVPDELYRNGLQRARFLPAIELVKANTEVVNVDSGIDYRLRTLEQAEIFHSPLDE
                     QADKNLFEYFDKLSPEPGRLDEKIEIEGRLIHTRKVSDCIVMFDFTALCETARSQVDY
                     MEISRLYNTVILSNVKQLGQHNDDAARRFIALVDEFYERNVTLIISAAAPITELYTQG
                     TLNFEFKRCISRLQEMQSLEYLAREHLA"
     CDS             340108..340536
                     /codon_start=1
                     /gene="rplM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EAG2"
                     /locus_tag="PA25_03010"
                     /product="50S ribosomal protein L13"
                     /protein_id="BBN80316.1"
                     /transl_table=11
                     /translation="MKTFVAKPETVKRDWYVVDAEGKTLGRIATEIARRLRGKHKAEY
                     TPHVDTGDYIIVINAEKVTVTGNKTQDKMYYAHTGFPGGLKSVNFEKLQAKKPEMIIE
                     KAVKGMLPRGPLGREMYRKLKVYAGNEHNHAAQQPQVLDI"
     CDS             340548..340937
                     /codon_start=1
                     /gene="rpsI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q32BA9"
                     /locus_tag="PA25_03020"
                     /product="30S ribosomal protein S9"
                     /protein_id="BBN80317.1"
                     /transl_table=11
                     /translation="MANQYYGTGRRKSSSARVFLRPGTGSIVINQRSIEEYFGRETSR
                     MVVRQPLELVEMTEKFDLYITVEGGGMTGQAGAIRHGITRALMEFDESLRPTLRKAGF
                     VTRDARKVERKKVGLKKARKKTQFSKR"
     CDS             341454..342044
                     /codon_start=1
                     /gene="petA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPZ1"
                     /locus_tag="PA25_03030"
                     /product="ubiquinol-cytochrome c reductase iron-sulfur
                     subunit"
                     /protein_id="BBN80318.1"
                     /transl_table=11
                     /translation="MSNAPVDNGRRRFLTIATSVVGGVGAAGAAVPFIASWNPSERAK
                     SAGAPVEVDISKLEPGQLIRVEWRGKPVWVISRTPKMLEQMKGHEDMLRDPESEEPQQ
                     LDSAKNPYRSKRPEIFVAVGICTHLGCSPSFLQGGFGEKVEGTEDGFFCPCHGSKFDM
                     AGRVFQSVPAPLNLEVPPYTFIDDTTILVGEEEGVA"
     CDS             342044..343309
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KUE7"
                     /locus_tag="PA25_03040"
                     /product="cytochrome b"
                     /protein_id="BBN80319.1"
                     /transl_table=11
                     /translation="MFGNIINWIDERIPMTRVWNMHIAQYPAPKNFNFWYLFGSLAIL
                     VLVNQIVTGIWLTMNFVPSAEGAFASVEYIMRDVEYGWLLRYLHSTGASAFFIVVYLH
                     MFRGMIYGSYQKPRELLWLFGMFIFLALMAEAFMGYLLPWGQMSFWGAQVIISLFGAI
                     PVIGDDLTLWIRGDYVISGATLNRFFALHVIALPLVLVILVFLHIVALHEVGSNNPDG
                     VEIKRKKGTVAEEDKPKFKFHEYYTSKKDIVDAIPFHPYYTVKDVLGVAGFLILFCWV
                     VFFMPEMNGFFLEAPNFEAANPLKTPEHIFPVWYFTPFYAILRAIPNKLLGVVAMGAS
                     IVVLALLPWIDRGKVKSIRYRCGLHKLNIAQFVVTFVILGWIGATPQTDFKTLLSQIT
                     TVTYFMFFVLLFVYSKNEKTKPLPTRLTK"
     CDS             343306..344043
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005479715.1"
                     /locus_tag="PA25_03050"
                     /product="cytochrome c"
                     /protein_id="BBN80320.1"
                     /transl_table=11
                     /translation="MMKKLIIGLFALLPTFVMAAGPSVPLMEAGHDLTDKASLQRGAK
                     LFMNYCLGCHQMQYQRYERTFRDIGIPTDIGQEQLIFDGSKVGSHILNSIEKDDAAKW
                     FGAAPPDLTLVARVRGADWIYTYLKSFYKDESRPFGVNNTIFPSVGMPHVLQELQGLP
                     TPITEQVTENGKTVTKIVGTETDGSGEMSTDEYDQAVRDLTNFMAYVGEPSRLESEAL
                     GYKVLGFLVILFILAFFLKKEYWRDVH"
     CDS             344141..344767
                     /codon_start=1
                     /gene="sspA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005162411.1"
                     /locus_tag="PA25_03060"
                     /product="stringent starvation protein A"
                     /protein_id="BBN80321.1"
                     /transl_table=11
                     /translation="MAVAANKRPVMTLFSGANCMYSHQVRIVLAEKGVSVDIHLAEKD
                     NLPEALHEINPYGTVPTLIDRELGLYQADIINEYLDERFPHPPLMPVYPVMRGRSRLM
                     MHRIDTDWYSLAAKITEGGAEEAQARKELTEALLAVAPIFNEAPYFMSEEFSLVDCYL
                     APLLWRLPQLGIELNGAGAKELKDYMLRLFERDSFQASLTEAEREIRA"
     CDS             344767..345198
                     /codon_start=1
                     /gene="sspB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707593.1"
                     /locus_tag="PA25_03070"
                     /product="stringent starvation protein B"
                     /protein_id="BBN80322.1"
                     /transl_table=11
                     /translation="MTPNRPYLLRAFFDWIVDNECTPHLVVNAEYPAVQVPTQFVQDG
                     QIVLNISPSAVTQFAMDNHQLSFNARFGGQPMQVYVPIAAVLAIYARENGEGTVFTQE
                     EFPEDDAVETQEVQETQEVQTTESDKPEPEKRKGSHLRVIK"
     CDS             complement(345466..346032)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707592.1"
                     /locus_tag="PA25_03080"
                     /product="BON domain-containing protein"
                     /protein_id="BBN80323.1"
                     /transl_table=11
                     /translation="MLVKPIAILLSLALLQGCAAAVVAGTAGAISAADDRRTIGSQLD
                     DNNIEIKGMLAIRNIERLKEHANISLISVNGVVLMVGQVANIEMKQQAQKALQDIPAI
                     RQVHNQLRISSNIGVTTQTHDVWLTSKVKTKLLAADDVSGNNIKVVTENSEVFLMGLV
                     SQDEANRAVDIARHVNGVTRVIKAFEYL"
     CDS             complement(346036..346623)
                     /codon_start=1
                     /gene="diaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P66817"
                     /locus_tag="PA25_03090"
                     /product="DnaA initiator-associating protein DiaA"
                     /protein_id="BBN80324.1"
                     /transl_table=11
                     /translation="MQESIKSIFTESIQAQIAAGEVLPDALESAALTIVQGLINGNKL
                     LCCGADSCHMLAEHFAGLLVNFYETERPCLPAIALTQTSVHLGQSVATDDTERFSRQV
                     RAFAQQGDLLLVIAVNGNEKDIVSAAEAALTKDMKVIALVGDDGGELTGLLGPSDVEI
                     RVPSKRPSRIVESHLFITHCLSQLIDNTLFPQGEQ"
     CDS             complement(346625..346990)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5ZR89"
                     /locus_tag="PA25_03100"
                     /product="UPF0102 protein"
                     /protein_id="BBN80325.1"
                     /transl_table=11
                     /translation="MFEKLFKNSRDKGQHYEQLAKSYLLKQGLSFVQSNYNCRYGEID
                     LIMREGTCWVFVEVKFRQSQRFGGVLSTLTHTKQQKLKRSIYYYLGAQQLHNVPVRVD
                     FIAIEGKNPPNIQWIKSVF"
     CDS             complement(347003..348895)
                     /codon_start=1
                     /gene="lpoA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E2P0"
                     /locus_tag="PA25_03110"
                     /product="penicillin-binding protein activator LpoA"
                     /protein_id="BBN80326.1"
                     /transl_table=11
                     /translation="MRLKIISLVIAILSGLSACSTTEKVPTANTKSQNQQSKHTLDYS
                     DALALFEKAQSKEGADRIQLLYYARDAAISNKEWQLLEQICLALESKVSVDHVQNKLY
                     IALARKNQQRASDALAMLNSLEEQLSLPEHKAWHQYLTGSIYASEGLPNQALTYFFNA
                     ANITAQNNVAIANLNDDIWQALQQLSSYALEKLDTGSVTQQGWVKLAKYQLVYLGAGV
                     ELHQALNNWQRRFVNHPASYLLPEEVAKSVSLTPYNTKRLAILLPQSGNSERFGLALK
                     NGFLAALDKQKIEEVFFIDESQSIEKIEQSLVRHQVDFVVGPLLKNNIDKLADSSVLS
                     ALPTIFLNTSSELYSNSNPQHYYFALNPEHEVEQALIHFLTQEYQKPMLLAPDNNSGH
                     RLISHFQKQWQRYSETEPEVGFYTDSKNMAKVVANLLEVDESKQRIRTIKSLFNKEVE
                     SETRSRGDIDVVYILGDAIETRLLKPYLDVNVSTFAQKIPLYATSRSYSRRIDSTDKG
                     DLEGLYFTEQPWMLPGAVQQNGLREKYLTLWPEQADIEQRLFAMAYDSVNLITQIKQL
                     ARVPGKEFSGLTGQLSIKRDNTLARTLSWAQYRKKKIRLVKLNETPPKPLFMRQTQAT
                     EAQIMN"
     CDS             348958..349818
                     /codon_start=1
                     /gene="yraL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E2P1"
                     /locus_tag="PA25_03120"
                     /product="ribosomal RNA small subunit methyltransferase I"
                     /protein_id="BBN80327.1"
                     /transl_table=11
                     /translation="MIKAQNTDKIGTLYVVATPIGNLADISERALTTLSSVDLIAAED
                     TRHTGKLLSHFNIKAKTFALHDHNEKQKAQQVVDWLNEGLDIALVSDAGTPLISDPGY
                     AVVNLCREQGANVTPVPGACAAITALSCSGLPTDRFQFIGFTPAKSQARQQFFIDAYE
                     SGITSIMYESTHRIMASLNDLHSALGEEQQVVFAKELTKTYETFFSGSVAELIDYLTE
                     EPEKQRGELVLMLPGKPKQQAEIPADAKRMLSLLESEMPLKKACGIVADYFDLKKNAL
                     YKAAIAEKEA"
     CDS             complement(350828..351733)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011976359.1"
                     /locus_tag="PA25_03130"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BBN80328.1"
                     /transl_table=11
                     /translation="MIDLNDYYYFVHVVEKQGFTPAAAALNMPKSRLSRHVSKLEERL
                     DIKLIQRTSRQFNVTETGQIFYQHARALLNEMEAAEAAIESRKTSLSGRVTISCSLGV
                     AQFAVKDLLIKFLQEHPKVELVQQVTNQNIDLISSGVDLAIRGHIESLPDSTIIQRSL
                     ATVSWHLFASPDYLTKTGTPQSTYDLFKRQSLKVGWQPSDGHWTLENKEGLKTTVPYN
                     PQLCSDDMGTLKQAAIKGLGIVSLPSYVCRNEINDGTLLRVLPDWISGRAQLSLLTPS
                     RKAQSPSAKAVGEFLLKHLKERIGD"
     CDS             351871..352773
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011726658.1"
                     /locus_tag="PA25_03140"
                     /product="short-chain dehydrogenase"
                     /protein_id="BBN80329.1"
                     /transl_table=11
                     /translation="MNTLINSTIEHADNQIIAPTMTAAKSGEVLRIGSGFEALAFRDK
                     DFSGTMDPLVMVDHYIMTKPTFGAHPHAGLSAVSVIFEDSEGPFHNRDSLGNDFDIMP
                     GDLYWLKAGSGVIHDESPRTGSKIHGLQVFVNLPAALRKSSPESLHVKAQNMPHIEYE
                     GARVRVVLGQSNGVKGEQSPALPMTILDGQLHSNTTFSHALEMGENAWITVVSGELDV
                     AVDGNPIRLVSGQATSISNVSSDTEATISMVNPSLKSVHFALFSGKPINETYVQKGPF
                     IMGSEAEITQVEQDFSAGKLGKLV"
     CDS             352814..353344
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011263911.1"
                     /locus_tag="PA25_03150"
                     /product="FMN reductase"
                     /protein_id="BBN80330.1"
                     /transl_table=11
                     /translation="MNILAFAASNSRKSINKALVTYAASLLDQHRVDMLDINEYEMPI
                     YNSDLEEGYGIPDAANRFLDRITQADALLISFAEHNGNYTVAFKNLLDWMSRINTKVY
                     QGKPIVMLSTSPGPGGANSVLSLASDSAHYFGGNVVASLSIPSFFDNFDLENGQLANA
                     ELISKLHAVLKKIESA"
     CDS             353373..353600
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03160"
                     /product="hypothetical protein"
                     /protein_id="BBN80331.1"
                     /transl_table=11
                     /translation="MIPKKLTFHTFSFVMSFLMSGVMSLSMLVMESATINEVFAGWPS
                     AWAVAMLVAFPFSLLVVPLTQRLVSAIVSDE"
     CDS             353757..354374
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03170"
                     /product="hypothetical protein"
                     /protein_id="BBN80332.1"
                     /transl_table=11
                     /translation="MNHLYEFNRAWDTPEFTQIELDPVDINAVIKDHYSHPGQFSMTK
                     TQLWDMEVKKASRPDLFIPSVIKRGSAAAWGFKTQGNSETFTRVSEQRLWLDNTQYGV
                     VIEHVHIDHDTKLVTFIGELQVNSDEYGHFIVDGAQPIFHVQHGVVGDENSPINTWKI
                     VHLEATNEAKLKERFQKMNHCRWLPEYVEIYLRDILGVELQRGEF"
     CDS             complement(354704..354937)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03180"
                     /product="hypothetical protein"
                     /protein_id="BBN80333.1"
                     /transl_table=11
                     /translation="MMKFNVANMSCDHCTAAIAKSLFALDEDAKLTFDVAHSSVSIES
                     KLSVEEVTAAIKEAGYDASEAKVSCCSPSNSCH"
     CDS             355087..357453
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003093042.1"
                     /locus_tag="PA25_03190"
                     /product="copper-transporting ATPase"
                     /protein_id="BBN80334.1"
                     /transl_table=11
                     /translation="MTTTVDLPVKGMTCASCAKRVEKAVMAVSGIDSANVNLASDTVS
                     ISGDLNITAVSDAVNAAGYQLDFVTKQFKVKGMTCASCSGRVEKSLNALEGVLSATVN
                     LASEQVTVAVSPKVTDGDLQQVVKSAGYELVIKSNTEKSAEQANSTAFYHRDSWSVIG
                     AAVLTLPLALPMFAMLFGKDWMLAPVWQWILATPVQFYFGARFYKAGWHALKAFTGNM
                     DLLVSIGTSAAYGLSLYLWLTFDGEHGSPHLYFESSAAVLTLVLLGKFLEKRAKKKTT
                     SALQALENLKPTSATVKRNGQWQTLSASELQKGDVVKIRPGERVPSDGVVINGNSNVD
                     EALISGESIPLNKSKGDKVTGGSVNLDGVLEVEASAVGSESTLSKIIRLVEQAQGAKA
                     PVQALVDKISSFFVPAVLLFALLTVLVWGGIFNQWSQGIVYAVAVLVIACPCALGLAT
                     PAAIMAGTGTAARHGILVKDAVALESATHIDYVVFDKTGTLTEGKPVLIQSKAVKGSE
                     ADLLELAYALSEHSEHPLSQAIVNFAQENKVRLNDVVNFKVIAGSGVSGDLNGRTIIM
                     GSSKWMKQLDLELPTELIEVEGASISWLAEMKEEGAELLGLLCFSDKPKTNALRAVQS
                     LQRDGIKVAMITGDSHASAEYVAKQLGLDNYDAEVLPQGKAAAIEAYQAKGYKVAMVG
                     DGINDAPALAQSDLGIAMATGTEVAVNASAITLMRGNPALVSSSLKLANATYQNIKQN
                     LFWAFAFNTVGIPLAALGYLNPILAGAAMACSSVLVITNALRLQRMSL"
     CDS             357464..357871
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_009939394.1"
                     /locus_tag="PA25_03200"
                     /product="Cu(I)-responsive transcriptional regulator"
                     /protein_id="BBN80335.1"
                     /transl_table=11
                     /translation="MDTLLTIGEAAKLSGLTAKMIRNYEKSGLIRKSPRTASGYRLYN
                     SEQLNQLRFIKRARNLGFSLSDIQSLLELWQNPDRESRVVKQLAQSHLEEIENKITQL
                     QHMQQVLTELAQSCKGDTNPQCSILEQLAESHL"
     CDS             358111..359067
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529501.1"
                     /locus_tag="PA25_03210"
                     /product="cupin"
                     /protein_id="BBN80336.1"
                     /transl_table=11
                     /translation="MNFDYKKRTSTRIDDSPIGKLLHSLRMESAFFTNSTFTRPWAVG
                     MPCMPNCMMFHLIVEGCAHFEVGDSHFQLNEGDFVLFPKGEGHILSDGTCTLVKPLAE
                     LPIQNLTARYETLNFGGAGARSKLICGAMLFEHPLAIKLLGILPSFIRIDSNADESLN
                     MVKSISELLKTETQNISVGAEAVIARLADILVIAAMRQYLTELSDDKLGWLSALEDER
                     VGKALKLIHEKPDKHWSLEELACEVAMSRTSFAVQFKRLVGNTPMDYLTEWRMSLAYS
                     RLQMSKDTVLCIALDTGYQSEASFSRAFKKVTGKTPGEVRKA"
     CDS             359302..359976
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013228914.1"
                     /locus_tag="PA25_03220"
                     /product="NmrA family transcriptional regulator"
                     /protein_id="BBN80337.1"
                     /transl_table=11
                     /translation="MREVNNVVVIGATGGSGYNTVQALVKLGYTVTAMSRNASKTFKS
                     PIKAVDGSALDEAPLRVAIAGQDAVIITLGISQNPIGVRLFGAQKTPLNIRSQGTKKV
                     IQVMKSLGVKRLIVQTTYGSGPSKNKLRLLDKLFFDWILKPQVDDTELQDSYVRESQL
                     DWTIVQPVHLTDDDNYHERLFSSSNYEVGQWSVSRTLVGKFNALLVNDNATINETYTL
                     SALPET"
     CDS             360125..361528
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003113875.1"
                     /locus_tag="PA25_03230"
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="BBN80338.1"
                     /transl_table=11
                     /translation="MPTITFHGAAQEVTGSCHLVSSVSLGDVLLDCGMHQGMRAKRLI
                     SREQFSFNPLSIDMVILSHAHLDHCGRLPCLVHEGFSGPIYCTEATAQLLPIMLFDAL
                     SLYENDLRRENRKRARKGLADIDAQYSKADVLKVLDCLKPLPYKQHKSIGNGALVCFY
                     DAGHILGSAIVELILNDEAKQKKLVFSGDLGNTDTLLMNDPTLLEDADIVLMEGTYGD
                     REHKTLGDTQRQLQEILSNAFARGGNVMIPAFAVGRTQELLLYLGKLQQAGELDNWQV
                     FLDSPMAIEVTSVYDQWLPTLDCEGVKKLCTGEQTLLKNFLSTLHLMVDAEDSMAINK
                     ISKGALVIAGSGMCTGGRITHHFKHRIWDSRNTIIFVGYQANGTLGRILVDGAQHVKL
                     FGEDIIVKASIETLNGFSAHAGQAALIDWVSHFKTNPKVVLVHGEPDALEALADKLEQ
                     MHNIQAEIPVLGDTIEF"
     CDS             complement(362422..364968)
                     /codon_start=1
                     /gene="chiA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261385.1"
                     /locus_tag="PA25_03240"
                     /product="chitinase"
                     /protein_id="BBN80339.1"
                     /transl_table=11
                     /translation="MAFSKRIILPHALLGLSVLPLHALAYDCQGLATWSNTLVYTKGD
                     LVTQQNTAFEAQWWTLNQSPTNNSAPFYVWKNLGQCGGNQAPNVVLTSPVDGSVLPAN
                     DSAVFIAEASDPDGQVAQVEFFLDSQSIGIANQSPYQITWQTVVGQYVVSAVATDDKG
                     ATRTSKLAQLTIRDGMENLPPTVELLNPANDAQFKKGETIRISADAKDADGEIESVEF
                     WLNNTKLSTDTTAPYEHDWLATVGKQQLKAIATDDKGATASALVSVDVTAQSSGGCAN
                     VPAYQAGGNYNAGDLVSHHNNKYRCDIGPWCSSSALWAYEPGVGEHWQEAWTDQGICA
                     IAPQVSFISPTPNSSLLQGNHYEIAVQAQDADGQINQVSVYANDTLLASLSQAPYSVT
                     WQAQQLGAISLKATATDNEGNVASSAQMVTVTDKPLVASITSPSAGTQLTLGSSVQVK
                     ADAAALVGQVTQVSFAIDGVVVATDTTAPYSTTYTPASLGMKTLVATAKDNLGNEAQS
                     EGVSIKVIDKPLGKTHKLIGYWHNFVNPAGCPIPLNQISDAWDIIDIAFADNDRNSNG
                     TVHFNLFEKDIHSNCPPVDPVQFKQDMQNLQAQGKVFVLSLGGAEGTITLNTDSDEAN
                     FVASLTDIINEWGFDGLDIDLESGSNLVHGSQIQARLPRALKQIEQNVGGDMVLTMAP
                     EHPYVHGGMIAYSGIWGAYIPLINELRETLDLLHVQLYNNGGLPNPYEPGSAPEGSVN
                     MMVAHAKMLVEGFDLADGSRFMPLRDDQVAIGLPSGPQSANSGQAPIGNITAALDCLI
                     NATNCSSIVPNKRYPNFGGVMTWSINWDKYDGYNFSKPIGEKLTQLNQQN"
     CDS             365286..366665
                     /codon_start=1
                     /gene="rhlE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E175"
                     /locus_tag="PA25_03250"
                     /product="ATP-dependent RNA helicase RhlE"
                     /protein_id="BBN80340.1"
                     /transl_table=11
                     /translation="MTFSDLGLSPAIVQTINEKGYSEPTPIQAKGIPAVLSGRDVMAA
                     AQTGTGKTAAFTLPIIEQLLAHERPRANQALALVLAPTRELALQIAENVEAYSQGTRL
                     RSAVVYGGVKINPQMMQLRKGVDILIATPGRLLDLHNQNAVKFNQLTTLVLDEADRML
                     DMGFIHDIKKIIKALPKQRQNLLFSATFSEPIQELAKGLIVDPIEISVTPKNAASKTV
                     TQCVYGIDKAKKTKLLSHLIRSKKWQQVLVFCRTKHGANRLVTQLERDKIAGAAIHGN
                     KSQSARVKALNGFKSGEISVLVATDIVARGLDIAELPYVVNYDLPNVYEDYVHRIGRT
                     GRAGSDGFAVSFVTIDDADDLYGIERFIGALIPRAQEPGFEAQHPVPEKALDTRPIKQ
                     KKPKKPKVRKEHQAVDHGKLQQTSSAKKAKPNSANKVKQQRVKAAIDNPTNAKPKRRR
                     FKPKPANTP"
     CDS             366769..367974
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011705373.1"
                     /locus_tag="PA25_03260"
                     /product="sodium:proton antiporter"
                     /protein_id="BBN80341.1"
                     /transl_table=11
                     /translation="MTDYALACVGIAIFIYSISVRQIKRAELTGSIWFVSLGALLGWW
                     FKDEWQFQIQDSTFVLPIIELTLAIVLFSDAAKTRLRVLFHSYQLPLLMLLVALPITM
                     ILGTLLAHWLLTLSWLYAALLAVIISPTDAALCKGFITQKQAPANLREAVNIESGLND
                     GLCIPVFVFLLAIAGGQTQSSWFGLVGLFFKEVSIALLVAAILTAGSITAIKAAHKRH
                     MFALNSSPFLFIGIVIAIFSITESFDGSGFIAVFVSGLLFDRFYQHSFKEELIEDSEH
                     IADFASLLIWVLFGMVVSQTLSFSDNLYEWLYALLAASVIRIIPVLLSLIPSQLSIEG
                     KLTLAWFGPKGLASVILTLMLLQANIEGTQLIAHVAAYTILLSVFLHGVSTRSISLRF
                     FQKHRKAKQ"
     CDS             368197..369855
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005479531.1"
                     /locus_tag="PA25_03270"
                     /product="alkaline phosphatase"
                     /protein_id="BBN80342.1"
                     /transl_table=11
                     /translation="MNKKLLAVAVSAVLLSACNDNDTKTVEVIKEVEVIKEVPAKSVT
                     SVKNVILMIGDGMGPQQVGLLEEYATRAPNSTYNGRGNQTALSKLANGGHLGLSLNAP
                     HGASGKLVTDSACSATQLATGLAAGSEMIGLDEQGNIVETILEKAKKAGKATGLVSDT
                     RITHATPAAFAAHQPHRSYEPEIAEQLIESGMVDVLLSGGARVFMPSDIKTDEADRKV
                     MADLGAPESVYKKSKRSDDRNLVVEAKEQHGYSLAFDKAQLASNDSNKVLGLFANSGM
                     ADGIAYKACKADNSCTQPSLKEMTVKALDILSKDEDGFFLMIEGGQIDWAGHANDAGW
                     MLNELLKFDEAVEAVHEWVKDRNDTLVVVTADHETGSFGFSYSNHNTPEPVALPGDGM
                     RGKDYKPKFNFGGLEILDTLYSQAGTFYDVIGEVNGNYDYSNATDQQWKDAIEKYTPY
                     TVSYEQAAKVNAVEGFNSSGYPLPKFDDFSDFYVYDTEDFTAKVGRVLATQQNVVWGT
                     GTHTAAPVPVYAFGPEGVTKQFSTMQHHVDISKKMMKALGLIEE"
     CDS             complement(370202..373267)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03280"
                     /product="hypothetical protein"
                     /protein_id="BBN80343.1"
                     /transl_table=11
                     /translation="MPLGVIISNLSIPQRFYRLLFLICVPGLLVIFAQLLDERSEILE
                     QSEHHALLLAKHIVAVQNTEINDTKSLLTTLSEQPNIRSFEDGQCPELLSHAQLLSAD
                     IANIGIVAPSGEVICSLLTGTQAIDIHDRAYFQSALSSKQFAIGQFQQDRSVHRATVN
                     FATPIFDKNGTIKSVLVAVKPLDRWSQTLAKLPLPQGSQVMLSDAHDNIIALSPFNSA
                     ILGSARTEHWPTISANKAHILEDNNGHRRIYFTLPLKSNNTLNTLTVNVSLPFEQAIV
                     QANKEVAIILVLFVLAIALLIWQARWSLQRVILKPLDNLVNAIEDLSHGQPVRWSQKS
                     QTPEFNAIALRFEQMASIRLNVESALSHKHAELSALLASLPDSYLRLDKQGNILMRHG
                     QFAKRAALLSQIFPEHIYQRLLKQLGRLNANSHCQLEFSLIENTKRHVFECRLSPITD
                     HPQAILVIRDISQRKKQEEAINLAALVYNNSSEGMVITDANGYILDTNPAFSAVTGYK
                     RSEVIGKTTSILASGQHDQAFYTRMWEQLEKQGKWQGEIINRRKNGELFTEWLTINSV
                     YDSNGEPYRRVAIFTDITEKKQQDELIWRQAHYDQLTQLANRTQLKRHLKSHLVKGAQ
                     QLAILLLDLDHFKDINDTLGHFYGDQLLTEVAERLNQLSPMCSLVSRIGGDEFVLVTP
                     YFGDDNTLIELAEKVLSQLQPKINIGNESFHISASIGIARTPDDGISSEHLLKAADQA
                     MYQAKQQGRSGYAFFSNDMREQAENRMRLLKDLRVAQQEQQFCLYYQPIVELKTQKIA
                     KAEALIRWQHPEKGLIRPDEFIPLAEETQLIHKIGEFIFASACDTLRRVQDSGKHLQL
                     SINVSPVQFTSKHCHLNKWHKQLQTQGLSTQDIVIEITEGLMMNAQPRTQKRLNALTT
                     QGFALALDDFGTGYSSLAYLKQMDTDYIKIDKRFVDGIAESRDDLALCEAMIMMAHQL
                     GLQVIAEGIETYEQHALLLQAGCDFGQGYYYAKPMPQDALLTLLDTSGV"
     CDS             373653..374111
                     /codon_start=1
                     /gene="mraZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPY1"
                     /locus_tag="PA25_03290"
                     /product="transcriptional regulator MraZ"
                     /protein_id="BBN80344.1"
                     /transl_table=11
                     /translation="MFKGASSLSLDDKGRFAVPTKYRQQLLSEDQGELICTIAINEPC
                     LWLYPVSEWYEIEARLQKLSNMNPRARRLQRMLLGHATEYQLDKNGRILLAPSLRTHA
                     GLNKKIMLVGLLNKFEIWDEDRWHQQMQLDTELERGGEFEASPELDNFSL"
     CDS             374136..375071
                     /codon_start=1
                     /gene="rsmH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9AJH1"
                     /locus_tag="PA25_03300"
                     /product="ribosomal RNA small subunit methyltransferase H"
                     /protein_id="BBN80345.1"
                     /transl_table=11
                     /translation="MTAQFQHVSVLMAETLDALAINPQGIYIDGTFGRGGHSGQILSR
                     LAPEGRLQAIDQDPQAIDAAKRFADDARFSIAHTRFSNIKEVAQQADLLGKVDGILLD
                     IGVSSPQLDDAQRGFSFMHDGPLDMRMDPTTGRSAAQWLAEADLEDITFVIKKYGEEK
                     FGRRIAHKVLETREHTPITTTKQLADLVDEAVPVKDKHKHPATRTFQAIRIYINSELE
                     EIQTALQASLEVLKPGGRLVVISFHSLEDRIVKQFIKKQSKGEAMPRGLPLTDAQLKQ
                     NLTLKAVGKAIKPSAEEIAANPRARSSVLRVAQKL"
     CDS             375071..375394
                     /codon_start=1
                     /gene="ftsL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8E9P1"
                     /locus_tag="PA25_03310"
                     /product="cell division protein FtsL"
                     /protein_id="BBN80346.1"
                     /transl_table=11
                     /translation="MSKNTDRQPKLFLEIIQGLLANKLTVFLLLLIFATALAVVQVTH
                     LTRQQLIAQDELLQQRDELDLEWRYLLVEEEFYSQHARIEEIAKTQLNMKRPTSKDEQ
                     VVVIQ"
     CDS             375391..377202
                     /codon_start=1
                     /gene="ftsI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073906.1"
                     /locus_tag="PA25_03320"
                     /product="peptidoglycan glycosyltransferase FtsI"
                     /protein_id="BBN80347.1"
                     /transl_table=11
                     /translation="MNKPKVTTSLVTWRFALVCVLLVMVFLTLVARAAYLQVIEPDKA
                     REENAKRTVRVEKLKVQRGMIFDRNGKELAVSVPVVSVYADPKALDKSIAKKVLKAAR
                     KQGEDYKALATNEAEMTRRKQAWYANELRWRELADVLQIKNEEVDSRLRNDPSRRFVY
                     LKRQVTPAVANYIRQLRLPGIHLLDESKRFYPSGEVTAHVLGFTNIDGKGIEGIERLF
                     ETALTGAEGKRTVRKDARGREIQVLSEEQRVEPENIELSIDLRIQAIAYRALKSAVLS
                     YKATSGSAMVVDVRTGEVLAMVNSPSFNPNDMSDAAPYKRRNRAITDLFEPGSTLKPL
                     AVLAGLDYGAIEADEVIDTYPGWMRLGGSLVQDTINHGEMTLREILKISSNMGVAKIS
                     QMLPKDYMVGLYQKVGFGEDTGTMMVGESSGLFYPNRRWSDFEIATLAYGYAVSASTA
                     QIARLYSVFGSGGILRPLTILKQKTPPPGERIFKKEDVHAVVEMMESVFEKGGTAANV
                     KVDGYRAAGKTGTSEKAIAGGYGDEYVGYFAGVAPVSDPRLAVVVMVNEPGGDVYYGG
                     HTSGPAFAEIMSNALRILNVAPDKDRVAYISESGNES"
     CDS             377192..378658
                     /codon_start=1
                     /gene="murE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3FWB6"
                     /locus_tag="PA25_03330"
                     /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-
                     diaminopimelate ligase"
                     /protein_id="BBN80348.1"
                     /transl_table=11
                     /translation="MNRDIRVVLEQLGVHSASMMVAHLRLDSRQVEAEDAFIAIQGHQ
                     QNGEDFALSALEQGAACVLIDADSHLCTSHPDFIPVPNLINNAAKIAALFYDKPSQRM
                     CTIGVTGTNGKSTTTAMIASLAQHCDTPSAVVGTLGYGNPKKLTELANTTPSNVDLQR
                     ILAQLSECNKLVAMEVSSHGLVQGRLDETHFDVAVFTNLSRDHLDYHGDMAQYALAKL
                     SLFQNHNPQHSVLNIDDEHGQQWLTEHHFDNIVVYGKKRQHSAFKRYVWFDDVVCDHQ
                     GMTVTIDSSWGRGQLRTPLFGLFNVYNLAAALAALLTQGFAFSSLLKAAKYLEPVAGR
                     MQAFSAPNKPTCIVDYAHTPEALELALQALQHHVPGNVVCVFGCGGDRDKGKRPLMAQ
                     AAERNADKLVITSDNPRSEDPQNIINDVKAGLSNPEYAVCKVDRAQAIRYAIEHAPQN
                     AVVLIAGKGHEDYQIIGDKRLPFCDRRFVETVLQEVSA"
     CDS             378655..380046
                     /codon_start=1
                     /gene="murF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPX6"
                     /locus_tag="PA25_03340"
                     /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-
                     alanine ligase"
                     /protein_id="BBN80349.1"
                     /transl_table=11
                     /translation="MIKADLAWLAAVLDTPLNGENLAIANINTDTRTIKNDEVFLALR
                     GPNFDGHQFVEQAKQKGAIAAIVDTPVACDITQFVVKDTRIALGKVGKAVIDTVAPKT
                     IAITGSVGKTTVKEMCAAILQCKGKVLATKGNFNNDIGVPLTLLRLQEDDEFAVIELG
                     ANHIGEIAYTTALTSPDVAVVCNVAPAHIEGFGSIEGVGQAKGEIFSGLKSGGIAVLN
                     CDCEFVDMWQSSLHDVKVKRFSSTQKLDVWAENVSLSDTAHASFMLCTDDEQVPVQLA
                     LPGEHNVTNALIAAALTSELGASLSDIASGLERMTPVKGRVNLIKANARLNVIDDTYN
                     ANVRSVKAGIDILMNMPGYRILALGDMGELGEQAREYHQEVGEYAQQKGVDALFSLGV
                     LSRYSSDVFSQPERHFSTREHLLKALQHELKAHNGVCTVLVKGSRSSRMELLVEELVS
                     SSHMSGNDEAPKC"
     CDS             380040..381122
                     /codon_start=1
                     /gene="mraY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8E9P5"
                     /locus_tag="PA25_03350"
                     /product="phospho-N-acetylmuramoyl-pentapeptide-
                     transferase"
                     /protein_id="BBN80350.1"
                     /transl_table=11
                     /translation="MLVWLAEYLTQYYSGFNVFSYLTLRAILGILTALFISLYFGPKL
                     IRALQKMQIGQTVRDDGPESHLSKSGTPTMGGLLILASIFTSTLMWGDLDNKYVWVTL
                     FVIGSLGIVGFVDDYRKVIRKDSKGLIARWKYFWQSVIAISVASFMYFTSHSAAETTL
                     VVPFLKEVMPQLGLFYLVMCYFVIVGTSNAVNLTDGLDGLAIVPTILVASALAIIAYL
                     TGNVNFSSYLHIPHIPLASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGA
                     LGIIAILVRQELVLLIMGGVFVMEALSVILQVGSYKLRGQRIFRMAPIHHHYELKGWP
                     EPRVIVRFWIISIVLVLAGLATLKIR"
     CDS             381122..382450
                     /codon_start=1
                     /gene="murD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8E9P6"
                     /locus_tag="PA25_03360"
                     /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
                     /protein_id="BBN80351.1"
                     /transl_table=11
                     /translation="MQYLNALKNKKITVLGLGVTGLGIVRFLLSHDIMPRIVDSRPVP
                     PGAQWLADNKPECEAVFGSLAEASLSSADIIIISPGIALYEATVAKAIADGVEVIGDI
                     ELFARLNDKPVIAVTGSNGKSTVVTLAAKVLTEAGMKVGLGGNIGTAALDLLAEDHDV
                     YVLELSSFQLETTHSLYCTSAMILNITEDHMDRYPDFAAYCAAKQRIYKHTEHLVYNV
                     GDKNTFCSAQQGVSVGLSQADYQLIQHQGEQYFSAYGQPLLPISIMALEGKHNQFNAL
                     AVMALLAPISLPIKAFEKAFSQFKGLPHRCQLVADHHGIKYFNDSKATNVGATVAALE
                     SLATKQGKIILIVGGDAKDADLTPLAKPMAQYCRAIYGFGKDGSLFLSLHRNSHLVST
                     LEDAVKQAKAIANNGDCILLAPACASIDMYPNYMARGEEFCRLVDEVTQC"
     CDS             382444..383631
                     /codon_start=1
                     /gene="ftsW"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8E9P7"
                     /locus_tag="PA25_03370"
                     /product="putative lipid II flippase FtsW"
                     /protein_id="BBN80352.1"
                     /transl_table=11
                     /translation="MLALSQFRLNFNIKQSNALYDVPLLYAMLCLLGVGFVMVTSASM
                     PVAERLFNNPYHITIRHAAFLCMGFVLFWITTSSPMSWWKRCNPYLLLFGLALLVLVL
                     IVGREVNGSKRWIPVGPVGIQAAELAKLFFFSYIAGYLVRKREEVQENLKGFAKPIAV
                     FAVYAFLILMQPDLGTVVVMFVTTVGLLFLAGAKLWQFFALILTGILLVVLLIIFEPY
                     RMARVIGFLEPWDDPFGKGYQLVQSLMAYGQGGWFGQGLGNSVQKLQYLPEAHNDFIF
                     AVIAEELGFVGVVSIIVLLGTLVFRALLIGQRALKCAKEYEGYFALAIGIWFAFQTMV
                     NIGASAGILPTKGLTLPFVSYGGSSLLVMIVAAGVLQRVDFETKMATKQATSRSGSRG
                     GKR"
     CDS             383628..384698
                     /codon_start=1
                     /gene="murG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPX2"
                     /locus_tag="PA25_03380"
                     /product="UDP-N-acetylglucosamine--N-acetylmuramyl-
                     (pentapeptide) pyrophosphoryl-undecaprenol
                     N-acetylglucosamine transferase"
                     /protein_id="BBN80353.1"
                     /transl_table=11
                     /translation="MTKRLMVVAGGTGGHIFPGVAVANELKAKGWQVSWVGTADRMEA
                     QVVPKNGFEIDFIDVQGVRGNGLKRLVKAPFMVLKAIFAARALIKRRRPDVVLAMGGY
                     VTGPVGVAAKLAGIPLVIHEQNAVAGLSNKLLAKIANRVLAAFPNAFAGSKVQVVGNP
                     VRHSVAALLPRNASQHLNCLVVGGSLGAKALNDTLPGAFAKLIEHASLPLAIHHQSGK
                     GHKAALQARYADVGIDANVVEFIDDMDAAYDWADIVICRAGALTVSEIAAAGKMAVFV
                     PYPHAVDDHQTANAGYLVDEAAALLLPQNKLSEQAMCDLLLPFVQQPEQISQLAKRAK
                     QYAKLEATASVAKVCEQLSSPI"
     CDS             384721..386157
                     /codon_start=1
                     /gene="murC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPX1"
                     /locus_tag="PA25_03390"
                     /product="UDP-N-acetylmuramate--L-alanine ligase"
                     /protein_id="BBN80354.1"
                     /transl_table=11
                     /translation="MKETSNRRAMRRINTIHFIGIGGAGMGGIAEVLAYEGYRITGSD
                     IAQNAMTERLLKAGAEVFIGHHENNIKDANVVVVSSAIDELNPEIKAAKAARIPIVRR
                     AEMLAELMRFRHGIAIAGTHGKTTTTSLIASIFAQAQLDPTFVIGGLLNSAGTNAKLG
                     TGDVLIAEADESDASFLHLQPMVSVITNIEADHMDTYDGDFEKMKDTYVDFIHNLPFY
                     GLAVVCIDSQVAADLIPRFARPTITYGESQHADYRMQGFKQTVNSSEFTVVTKKGESI
                     DVKLNMPGKHNALNATAAIAVAKDHNIENTAILAALEQFEGIGRRFQHYGEFENERGK
                     VMLVDDYGHHPSEVAVTIQAARAGWPDKRLVMIYQPHRYSRTRDLYEDFVKILAEVDQ
                     LILLDVYSAGEAPIVGADSKSLCRSLRQRGIEPIHVADHSELSMVLAETIQDNDLVIT
                     QGAGNIGQIVKQLAASKLSIAALKQGEA"
     CDS             386154..387062
                     /codon_start=1
                     /gene="ddlB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:F0KHC6"
                     /locus_tag="PA25_03400"
                     /product="D-alanine--D-alanine ligase"
                     /protein_id="BBN80355.1"
                     /transl_table=11
                     /translation="MNQFGKVAVLLGGSSAEREVSLKSGEAVLNALQSVGVDAIGFDP
                     AQRNLWELKNLAVERVFIALHGRGGEDGTIQGALEYMGIPYTGSGVLGSALAMDKVRC
                     KHLFQSAKLSTAPYAVVDANIGFNAQAIISEFGKVMVKPSHEGSSIGMAQASSAQELT
                     DALNNAFKFDDQVLVEQWITGREFTVAMLAEDALPVIEMKTPRGFYDYEAKYQVNSTQ
                     YFCPADISDAYTSQLQVMAKHAFELVGAKGWGRVDAMQDENGQFYLLEVNTVPGMTEK
                     SLVPMAAKAKGISFEQLVVRILEQTL"
     CDS             387064..387843
                     /codon_start=1
                     /gene="ftsQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8E9P9"
                     /locus_tag="PA25_03410"
                     /product="cell division protein FtsQ"
                     /protein_id="BBN80356.1"
                     /transl_table=11
                     /translation="MRAFFEKAKQLNQHLNWSLILGVSFFVFVVIGVIRGTYWVSDWL
                     IEHKDAQIKQLIVLGKPYYTQEADIIRVIKEVDLSSYFELDVKSVHNKVQALPWVAHV
                     SVRKQWPDQLQVYVVEHKPVAVWNSDLLLNRHGDVFQAHSDLLDKELPQLYGPEGSEQ
                     EAWKTFLQFKDMLRVNDFKLVSLALSERFAWQLWLDKGIRLNLGREKIAKRVQRFIDV
                     YPKMQAPEGAMIDVIDLRYDTGLAIRWKYPQIQEQQSKSEA"
     CDS             387840..389072
                     /codon_start=1
                     /gene="ftsA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8E9Q0"
                     /locus_tag="PA25_03420"
                     /product="cell division protein FtsA"
                     /protein_id="BBN80357.1"
                     /transl_table=11
                     /translation="MTKSAERNLVIGLDVGTSKVVATVGEITADNQLSIVGVGNQVSH
                     GMDKGGVNDLNLVSESIRRAIDEAELMADCRISSVYLGISGKHIQCQNESGVVAINNA
                     EVSDDDIANVIHIARSVPISAERKMLHSLPQEYSIDMQEGIKNPLGMSGVRMEAKAHI
                     ITCSNDMAKNLEKCVERCGLQVDQLTFSALASCYSVLTDDEKELGVAVVDIGGGTMDI
                     AIYLNGALRHSAVIPVAGNQVTGDIAKIFRTPISHAESLKVQYACASSQMASSEDTIE
                     VPSVGGRPARLMSRHTLSEVVEPRFRELLELALEEIRRSGFEDQIAAGLVITGGSGKM
                     TGALEVAEDICQMPVRIGKPIGITGLTDYVDDPAYATAVGLLQYGRTLQSMNAQKSKA
                     ESEGSWWSRITKWFQGEF"
     CDS             389094..390338
                     /codon_start=1
                     /gene="ftsZ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8E9Q1"
                     /locus_tag="PA25_03430"
                     /product="cell division protein FtsZ"
                     /protein_id="BBN80358.1"
                     /transl_table=11
                     /translation="MFDIMEQHSEEAVIKVIGVGGGGGNAVEHMVKQEIEGVRFIAAN
                     TDAQALRKSSADVTVQLGTQITSGLGAGANPEVGRKSAEEDIETIKTALEGADMVFIA
                     AGMGGGTGTGAAPVVARVAKELGILTVAVVTRPFDLEGKKRMAAADQGIGELSEIVDS
                     LITIPNNKLLKVLGKGTTLLDAFAKANDVLYGAVQGIAELITRSGLINVDFADVRTVM
                     SAMGTAMMGTASASGPDRAQEAAEAAISSPLLEDVDLTGAKGILVNITAGMDITIEEF
                     EIVGNHVKALASENATVVVGAVIDPEMSDELRVTVVATGLGGERRPQFGIVDNGFKKV
                     VGSDAGSASTESSQSAGMFVPSFTQPQTDASQETVTNSGSTTSSSAQSTNNEAAKASS
                     KDADKDKDNYFDIPAFLRKQSD"
     CDS             390424..391335
                     /codon_start=1
                     /gene="lpxC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87SF9"
                     /locus_tag="PA25_03440"
                     /product="UDP-3-O-acyl-N-acetylglucosamine deacetylase"
                     /protein_id="BBN80359.1"
                     /transl_table=11
                     /translation="MIRQRTIAEVVKATGVGLHKGEKVTITLRPASENTGVVFRRVDL
                     DPVVDFETTPEAVGDTQLCTCLTNKDGIRLSTTEHLIAAVAAMGIDNLVVELDSAEVP
                     IMDGSALPFIYLLQKGGIKEQNVAKRFIRIKEKVRVEDGDKWAEITPYDGFHIDFEIA
                     FDHPAINDSRQRIALDITAQSFTEQISRARTFGFMKDIEYMHANNLALGGSMDNAVVL
                     DDYKVLNPNGLRYDDEFVKHKILDCVGDMFMAGHNILGKITCYKSGHGLNNILLRKIM
                     ATESAWEWATFDEPVVMPAPGLEVATA"
     CDS             complement(391365..391868)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005420907.1"
                     /locus_tag="PA25_03450"
                     /product="hypothetical protein"
                     /protein_id="BBN80360.1"
                     /transl_table=11
                     /translation="MAKNRYDPKQLNELMGKWSDKLLNYTDKSKKMAELQQCLEKAIG
                     PILSKKSRVANYRDGTLIIEAASATLATRLNYLKMEILSQFRQAGMIECSQVKITTNP
                     EAQQRLSPRDSYTNTKQNSQGKGRVMSEHTAEQLRELASGAPPSLQAKLLKLAAHAQK
                     ADKKNDA"
     CDS             392263..394971
                     /codon_start=1
                     /gene="secA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPW5"
                     /locus_tag="PA25_03460"
                     /product="protein translocase subunit SecA"
                     /protein_id="BBN80361.1"
                     /transl_table=11
                     /translation="MIANLFTKIFGSRNDRTIKNIRKTVALINALEEQYSALSDEELK
                     AKTAEFRQRFEQGTSLDDLLPEAFATVREASKRVFNMRHFDVQMIGGVVLHQGRISEM
                     RTGEGKTLTATLPAYLNGLTGKGVHVITVNDYLAKRDAETNRPLFEFLGLTVGCNVPG
                     MMPQQKKAAYAADITYGTNNEFGFDYLRDNMAFSIEERVQRPLYYAVVDEVDSILIDE
                     ARTPLIISGPAEDSSELYTKVNTLVPLLELQEKEDEEGVEGDGDFTLDEKSKQVHLTE
                     RGQLKVEELLIEHGLIEEGDSLYSAGNITLLSHVYAALRAHKLYQKDVDYVVKDNEVI
                     IVDEHTGRTMEGRRWSEGLHQAVEAKEGVRIQNENQTLASITFQNYFRIYEKLAGMTG
                     TADTEAFEFQSIYGLDTVVIPTNKPMIRDDRADLVYLTQEEKFEAILEDIRDCQKRGQ
                     PVLVGTISIESSEYLSHFLTKEKIEHNVLNAKFHAQEADIVADAGLPGKVTIATNMAG
                     RGTDIVLGGNWQSDVAKLENPSDEQVAEIKEKWKQTHDAVIAAGGLHIIGTERHESRR
                     IDNQLRGRSGRQGDAGSSRFYLSMDDALMRIFAGERMTNMMRKLGMQRGEAIEHPWVN
                     RAIENAQRKVEARNFDIRKQLLEYDDVANDQRRVVYEQRNELLEEGDISETITAIRGD
                     VLGNIIDQFIPPQSLAEMWDIPGLEERIKADFLLDLPIAKWLEEDAKLYEEKLRDRIT
                     EEVESAYKQKELMVGPDVLRQFEKAVMLQSLDQHWKDHLAAMDHLRQGIHLRGYAQKN
                     PKQEYKRESFELFSEMLENLKTDVVGILSKVQVRAEEDVEKVEQQHRRSEQAPRQYQH
                     AEAEHVGGEVPEGVAVAAKAEQKVGRNEPCPCQSGKKFKQCCGKLK"
     CDS             395037..395432
                     /codon_start=1
                     /gene="mutT"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070770.1"
                     /locus_tag="PA25_03470"
                     /product="7,8-dihydro-8-oxoguanine-triphosphatase"
                     /protein_id="BBN80362.1"
                     /transl_table=11
                     /translation="MTIKRVHVAVGVIIKNNKVFVTKRGEHQHQGGLWEFPGGKVEQG
                     ETVTDALKRELQEEINILTHKSQPFMVIEHDYIDKQVCLDIHLVMEFSGEPKGLEGQQ
                     CDWVALEKLHELAFPAANLEIVAKLQADL"
     CDS             395546..397615
                     /codon_start=1
                     /gene="pepO_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070787.1"
                     /locus_tag="PA25_03480"
                     /product="peptidase M13"
                     /protein_id="BBN80363.1"
                     /transl_table=11
                     /translation="MNNKITLTAASVALTLGLLGCSESTTDTKAKASQDAVQSALVSG
                     IDLNNIDRTVKAQDDFYYHVNGKWLEKTQIPADKSNYGSFTQLYDESQKALKKVLEGA
                     KANAQAQPQSDEYKLGAFYASYMDETAREELGLSPLKTYLAEINAVTSKSELPALMAN
                     ILTKGGKNPFAWYVNNDAKSSSEHALYLYQSGLGLPDRDYYLEDTEKYSKLRTDYIEY
                     IEQVFSRLGEKDAKQVANRIFAVEKALAEVMWTRVQSRDATKTYNKMTMAELNQLMPD
                     FDLSAYFQALGLDLKELVVSQPSYLEGLSAIYTETSLETWQQYLTFHFVNNHASLLHK
                     DMVELKFNFFGKRLRGLEEQAPTWKKAVDASNEVLGELLGKIYVKQYFPPEAKAKMEQ
                     LVANLIKGFDQAISELEWMTAETKVAAKEKLNKFTPKIGYPDKWKDYSALEINRDDLL
                     GNYVRYNQWAYQDMLDKIGKPVDRSEWFMTPQTVNAYYNPVNNEIVFPAAILQPPFFN
                     LAADDAVNYGAIGAVIGHELGHGFDDQGAKYDGDGNLRNWWSESDLAQFETRGKKLVE
                     QFDQFKPFEDANVNGEFTLGENIGDLGGLTVAYKAYQLSLGEEKAPVIDGYTGEQRFF
                     MGWAQIWRRKYREEELRNRLVTDSHAPSHYRVIGVLPNMPEFYEAFDVKESDKMYLAP
                     QQRVKIW"
     CDS             397824..400406
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000914817.1"
                     /locus_tag="PA25_03490"
                     /product="beta-N-acetylhexosaminidase"
                     /protein_id="BBN80364.1"
                     /transl_table=11
                     /translation="MNFKQTLLASTLLAMPLLANAALTEGELQRFTKGTEFMFAVEDN
                     FNEGAGKLLASITLNNNSGVDLPKGKSDWQVYFHSIRKIHTEQVAGLKIEHINGDLNR
                     LVPTDDFAGLASGKSLKVAFEASAWIAAYSDFMPRAFMVANGHTPAIFSNTDSEDFTQ
                     FVAPIERENQLKRYNQPKDHTKIANAALRFERNETVHSVAREAALKRIIPKPNHVDFN
                     RGTAVLNEQWQIRYAGRLKSEVAVFTEDLADFGLKLEAQPDHINVGKQPTITLKVDDT
                     VAAGKAESYQLEVDDEQIIIVGSDNAGVFYGMQSLLALFSPDARGSIEIPNVEIEDSP
                     RFSWRGMHYDNGRNFHGKDAMFKLVEQMGRYKMNVLHWHFSEDEGWRLEIPGLPELSE
                     IGGYRCFDLSEQRCLLTQLGTGPFKSGSGNGYLSRKDFVELLKFATARHIKIIPEIEG
                     PGHARASIKAMEARYNKLIKQGNKNAASAYLLSEPGDTSQYLTVQNYTDNSINVCLDS
                     TYAFIDKVTYELQSMYREAGTRLTNLHFGGDEVGSGSWTDSKACQTLFADPNNGVAGV
                     ADLKPYFTQRVASLLDKRGITPGAWEDGLMYDKVNPFNRASFVNKQVTVNVWDNIWEW
                     GVADRAHRLANDGYQVILSHGTHLYFDHPYEAHPEARGYYWATRYIDTKKTFGYMPDD
                     VYGNADFTSNREPIVNLEALVGRELPKLERPENILGMQGQVWSETIRTEEQVMSMIFP
                     RILSVAERAWHKAAWESTGLNSKSFSNDWQQFAAALSVKELAKLEKGGIKANLPVPGG
                     IIKDGKLYANSAFPFLTIEYSFDGGQSWQEYVAPVNVDGNQSISLRTRHGSNNTSRVT
                     GLSK"
     CDS             400640..401941
                     /codon_start=1
                     /gene="nagP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073342.1"
                     /locus_tag="PA25_03500"
                     /product="glucose/galactose MFS transporter"
                     /protein_id="BBN80365.1"
                     /transl_table=11
                     /translation="MEAIVDIESKDKQSIWLPMVLAGSMFFILGCITWLNGAITPFLQ
                     QMLELTPLQASFIISSFYIAVTVAGIPSAMLIKRVGYKNGMAIGCMIMAGSALMYIPA
                     AKMQMIEIFLFAQLMIGVGQTVLQTAVNPYVVKMGSEKSAAVRVCIMGLLNKSAGVIV
                     PIIFAAVVVSGLVEGGAKLSQEQKDMMANSLIAPYIGIAGLIFIFALFAKFSPLPDLV
                     FDEESKTSKGELKETLAHPHLVLGVIGIALYVAVEVIAADTIGSYALQLGIADYSVMT
                     SYTMACMLIGYAIGIALIPRFMSQQSALMMSGIAGIVTVLAVVFGSNNSFVLANMLLV
                     PFGGPQLPDPLLCIALLGFANAMVWPAIWPLALDGLGRLTGTASGLLIMGIAGGALGP
                     LLIGVGNAAGLGAQGAYSLMIPSYLFILFYAVKGHKMRSWK"
     tRNA            complement(402115..402190)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="PA25_t00100"
                     /product="tRNA-His"
     CDS             402371..403186
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005482477.1"
                     /locus_tag="PA25_03510"
                     /product="mechanosensitive ion channel protein"
                     /protein_id="BBN80366.1"
                     /transl_table=11
                     /translation="MDTAIKWLNDNSDMLLHFSIQAVIALLILFIGLKVAKACDKLTV
                     KAFEKRKIDKAVAGFVANIVYAAVFAATILMALSQVGVETTSFIAILGAAGLAIGLAL
                     QGSLSNFASGVLIIILRPFKAGDYIEAGGKAGSVQKIEIFSTELKTPDNKVIIMPNSS
                     IMSGAIVNFSREKTRRIDLVIGVGYDADLKQAKQVLKSVLDKEERILKEPAYNVAVLE
                     LADSSVNFVVRPWVNTSDYWPVYFELVENIKVSLDEAGITIPFPQMDVHLHKD"
     CDS             403208..403993
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071214.1"
                     /locus_tag="PA25_03520"
                     /product="hypothetical protein"
                     /protein_id="BBN80367.1"
                     /transl_table=11
                     /translation="MKLKLLSLCVFAATVNCAYAATADVKKTWDVSSEVGAIITSGNT
                     KTTTLKGGIKAKHNLENWHNEYKLSGIYKEDEIENDAGKRVTERTNEKYSLSTQGNYK
                     LREDHSHLFVYGSYVSDYFGAYRNEAVVSVGYGLRLLNRDDMYLNAEVGPGIKRFEHH
                     NSSTTVDENGNSLAGQSENEVIAVGKLDFNWQVSENARFTQLIAVEYGDSNTKTTAES
                     ALMTKINGSLQMKVAYNVIHNSDVAAEKDNTDTETSLTLVYSF"
     CDS             404102..406759
                     /codon_start=1
                     /gene="wza"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073080.1"
                     /locus_tag="PA25_03530"
                     /product="sugar transporter"
                     /protein_id="BBN80368.1"
                     /transl_table=11
                     /translation="MKLSKLTVFFVLFSLFVFNAGSVNAATPSQKQIEQFKKLPKAQQ
                     EILAKRYGIDLNSAASQSKSMGNVNQEEKSILPREEESESLDESENKYKPKQEELEPF
                     GYQIFAGEPMTFMPTELAAVPDSYQVGVGDSVKINLYGKTSGEYIVEIDREGRLAIPE
                     LTPIHVVGLTFKELKDLIGEKISQEMIGVKAFISMGQLSPMRVMIVGESYKPGSYTVS
                     PLATVTHALFVSGGVRENGSLRKIQVKRAGKLITTLDLYDLLLFGDSSKDIVLKPGDV
                     VFIPPATKKIKIKGAVNREAVFELKESDSKENIEAMFGGFQANANKEKVVVSRYNPDG
                     RRVTLNFNFEQPSSYYPLNGDEILVNAKSTRYQNTVTVVGAVTQPGHYEWKEGVRIGD
                     IFQSPREDFLSIADYSYSLIIREVGFSGDIDVLQFSLQDVLEGKANDIELQSNDAVVV
                     FSRYQFKEEENQLLDNFAYSKEQLKLRENIKLWEEYERQNFLLYIGVEEEEKEEEKKR
                     PSIYSEIEQSQDDVDSEDYAVFSREKLLAPILAKLKQQATPKSPVKLFSIEGQVKFPG
                     TYPLSQHAGLSEAILAGGGLLESALVSKVEVTRLVYEGEKQVEHVAINGENELQAPKL
                     ALQSKDTVNIFPKPNWQERVQVKILGEVKFPGTYTISRGETLESVIQRVGGFSEFAHK
                     EGSIFTRESVKRKEATHLQRLTEELRRNIITSSFQKNTTANNSLSYADMDKILKDLSN
                     VEALGRLIIDFNKESTMALQLEDGDALYIPALQESVSVIGEVNVAATHIYDSRKSIED
                     YIQASGGLKKKADDERIYVIKANGSVYVPNSGSWFAVNSGVNDLSPGDTIVVPLDAHY
                     LDNLTLWSTATQIVYQLGLAAASIASLSK"
     CDS             406774..407709
                     /codon_start=1
                     /gene="wzz"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073078.1"
                     /locus_tag="PA25_03540"
                     /product="LPS biosynthesis protein"
                     /protein_id="BBN80369.1"
                     /transl_table=11
                     /translation="MLSEVDIVKKNEVDLTEILAAIWRGKWLIMLIGGLFAVASVFYA
                     LSIPNTYRASVLLSPVDSSQGGMLSNLRSEFGGLAAVAGVNLGAGQADKSSLALQVLQ
                     SRAFLYQFVEKRDLKPALLATEGWDMANNKLLYNPNMYNVAESKWSRNVKAPFDPEPG
                     IQEVYDHIMSQNLVVSEEKKKGLVSISVTHYSPHLAKNIVEELVDEINNYMKAEDIEQ
                     ANVKVEYLKQALADTTVADMQRIFYQLIEQQEQTKMLAQTQSQYVFRTIDPAILPVQK
                     AGPKRALICVGITFFGIALGAMLVLFRHFVLQRKP"
     CDS             407801..408877
                     /codon_start=1
                     /gene="wecA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8ZAE1"
                     /locus_tag="PA25_03550"
                     /product="undecaprenyl-phosphate
                     alpha-N-acetylglucosaminyl 1-phosphate transferase"
                     /protein_id="BBN80370.1"
                     /transl_table=11
                     /translation="MVILFAFLASYCSIFAIKPLAEYVGLVDTPCSRKKHVGSIPLIG
                     GVSIFVAVLISSIVFLPLDKALVSFLFCSAAIVLLGVVDDYRQLSVKVRLFTQACIAL
                     LMMWGADAYIRNLGDLLGFGCIDMGYIGIPFTVIAIIAAINAFNMIDGIDGLAGAMSI
                     TTFTSILVLMGVKGGQLTMLPLIIIATILPYLAFNLGVIGHKNKKIFMGDAGSMFIGF
                     SVIWLLMMSTQSHASNAFSPVTALWIIAIPLMDMMAIIVRRVKKGQSPFRADRDHLHH
                     VFMRIGFSSRKALVTISLLAVSLALVGIIGELIGVPDWLMLVAFVAAFIAYSACIQHA
                     WKVARFLRARVFTNKSRKKAIKVQ"
     CDS             409201..410232
                     /codon_start=1
                     /gene="wecA_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8ZAE1"
                     /locus_tag="PA25_03560"
                     /product="undecaprenyl-phosphate
                     alpha-N-acetylglucosaminyl 1-phosphate transferase"
                     /protein_id="BBN80371.1"
                     /transl_table=11
                     /translation="MVKPLAERVGLVDVPCSRKKHVGSIPLIGGVSIFLAVLISILVF
                     LPLEKRLVVYLVCAAAIVLLGVVDDYKQLGVKIRLCVQAVVALLMMWGSDAYIHNLGN
                     LFGFGDIELGLWGIPFTVVAVIAAINAFNMIDGIDGLAGAMSITTFTAILFLMAVNGG
                     ELSVLPLIIIATIVPYLAFNLGVKGHRDKKIFMGDAGSMFIGLSVVWLLMISTQSHTN
                     NAFSPVTALWIIAIPLMDMMAIIIRRVKKGQSPFMADRDHLHHVFMRIGFSPRRALAS
                     ITFFAMCLAGVGVFGELIEVPEWGMLLVFLIVFICYSACIQHAWRVARFLRKYVFTKK
                     QAKNKNEIQ"
     CDS             410273..410644
                     /codon_start=1
                     /gene="xcpT"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q00514"
                     /locus_tag="PA25_03570"
                     /product="type II secretion system protein G"
                     /protein_id="BBN80372.1"
                     /transl_table=11
                     /translation="MMELLIVIVILGLLASLVAPKFFNKLGTAERGVAATQMSAFETA
                     LDTYRLDIGQYPQSLEELRKSDHPRWDGPYLPKDVPLDPWGNPYVYKIPGENGEPYAL
                     MSFGADGKQGGEDNNQDIMHK"
     CDS             410644..412296
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012869802.1"
                     /locus_tag="PA25_03580"
                     /product="type II secretion system protein E"
                     /protein_id="BBN80373.1"
                     /transl_table=11
                     /translation="MNAKSILQSQFGVSEQDVEKAANYQAKHGGRLENILVNMGSLSD
                     EEVPLFLSKTLELPLLDEELWEEVELPNCSQENVQFFKEQDWVPLSVDNNKWTFAALY
                     PLNLTMNEWIVQNGLEVSVFIATEMQLQALLARYENVEVDSFDNQYSDAEEEKLKELA
                     SEAPVVNLLNSLMARALRQGASDMHLEPYQGRYRVRYRIDGVLHEVERLAPKMQMPLV
                     TRLKILSGMDIAEKRRPQDGKIETKIANKEIDIRVSALPLNDGESIVMRFLRKDNVQY
                     DMSILGLSPDIESMIRNDIKSTAGVVLLTGPTGSGKTTTLYTFLNALNNEDVKIITLE
                     DPVEYQLPGINQVQVNSEIGFDFAAGLRSIVRQDPDVIMLGEIRDKETAQIALQSALT
                     GHLVFSTVHTNDAASAYTRLLDLGVEEFLLNAALVSVVAQRLARKICASCSQAHPEAQ
                     SLIEEYHLEQFVQRYHLSEINLRIGKGCDECSNTGYKGRMAVTEYLRCDNTIKSMPKD
                     ADFITQAKQHNSSLDRRTLFEDGLYKAVQGLTTLDEVLRVAG"
     CDS             412296..413495
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011228203.1"
                     /locus_tag="PA25_03590"
                     /product="phytochrome sensor protein"
                     /protein_id="BBN80374.1"
                     /transl_table=11
                     /translation="MELFDYKAFDSSGAKSDGQIEANDQKHALILLKNQGLLVTEIKS
                     FQSNKSISLFSSKVSLADLEFLTAELSLLLQSGVRIDKGIDIIRKTKAKPALATMLAE
                     LSSELKKGNSLSMAFRAQPKVFDPLYCNLIELGEESGNLVEIFSDLAKDLKFKRELRS
                     KIIGSLTYPLVIFAVCLLSIFFIFNVIIPKMSVMFTDAEGLPWYTQFMLSTSDWMIKN
                     QTYLLIFLLVSVIGLLYGSKQKAFVDWWQKASLKLPVIKGAVITIERIRFNAGLAMMI
                     KSGLPIDKALMLCSGNINNYILRREVEIARTKVKQGSALAFSLKQTSLYPDFFVSLLE
                     VGEESGNLEKVFEEIANRSRQDFEAWTTRMTTLIEPLMILFMGGFVGSVVVVMLLSMV
                     SLNDIGI"
     CDS             413499..413933
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03600"
                     /product="hypothetical protein"
                     /protein_id="BBN80375.1"
                     /transl_table=11
                     /translation="MIKQGGFTLIELMIVIMIVVILGSFVGPLAFESLTRVQSKAEIK
                     KVERLFLNASQQAFLKNQKVSIDMDNKKFSFWLANNVQNKTQVSFDFISFPKQRIIFN
                     TRGLTTKKTVIVNQNNRAIYVELLELITGNNQYISNARATNE"
     CDS             413926..414354
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03610"
                     /product="hypothetical protein"
                     /protein_id="BBN80376.1"
                     /transl_table=11
                     /translation="MNRKGAGFTLIEIMVASVILFMVLGTVSIVYRGALLSSSKASEH
                     LLINAQVAPLLSLAESHIRSESKTEKEQLKLEGSSNDVRYSITASLIDFRSPPQRFDV
                     DSGSYQTPPKKYKLWNVELMLTHNGITKNFVFKQLGWLDE"
     CDS             414347..415039
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03620"
                     /product="hypothetical protein"
                     /protein_id="BBN80377.1"
                     /transl_table=11
                     /translation="MNKRVKLLSLRGFSLVELLISLAILSMLITTATFSYQMLLERWS
                     KGLNHFDSNYQSFHRNLLLQSVIKGIFPYVVVNRDGSPSFFFIGDQDSLLAVTENGVF
                     DDSFPEVFRLILQKNGDETFRLIYQGRSMRDFLLLRADQEIEFDNTLVLFDDINAFDI
                     SYIGWQNLRERTTLPVPKASRYSIYSGINNQLMPMAVEVRLKSAIGEIFFSSQYNTES
                     FKELSPYFSEGM"
     CDS             415039..415902
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03630"
                     /product="hypothetical protein"
                     /protein_id="BBN80378.1"
                     /transl_table=11
                     /translation="MKSNGIALVQILLFSAILTIVALYFSGSAKEQIAASQLATDRVE
                     ALVQLHSSRQALFFNLLTKQKSIVSSSQEPYQWNFFGEPFELAPGVQAQLYDLSSKIN
                     IRYPQRERLISLLVYAGMAEQEASVWVENLLEYQDIDTIDTYGRQEVSLSGSGNRNGP
                     ISNKNEIRGLGLEPDILDVLMPNITLFKISSFNPMNASSELLQALYGHDVASKVTQLR
                     SVESTTKDSFKELTGIVEGDGIFIYPSNDTQVVISSSYGQVNLKHDWIVSFNPYASGQ
                     SLPYIPLYIKE"
     CDS             415908..417005
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03640"
                     /product="hypothetical protein"
                     /protein_id="BBN80379.1"
                     /transl_table=11
                     /translation="MLTVVSNKLSDLALQYIGYYNGSLLCFRKRSNTIVLEPADESFN
                     PTVVILSREYYQESLRTIPLEDVKQVRKLLKLEQESEQLVSTLRFSKSEGKTSYMHWK
                     SKKDFPNATFVLPESLILTENVSFNQTLIVQEDRPLFLVKTVSGIQSCRANNLILDES
                     RFLLSTGIQTSDSAHIISEQNFPSALIFGIKKLPIKTWLAFFKGVDGSIKSNSAKVTL
                     MPIMLVGFSYLIISSLFLFWENHSLEKRLQTRSLGVSEALNVQYRVEQLTKRYEALQL
                     LGKGEGQHNDFFKVLSNLLSDVSLTNIRLNKSNRYVLRGSTYKATDVLSKLLGHPLVH
                     DAQFDYPTRKSREREVFVISFSLKPIVGDEV"
     CDS             417002..417568
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03650"
                     /product="hypothetical protein"
                     /protein_id="BBN80380.1"
                     /transl_table=11
                     /translation="MSEKLILQFKKKPILLGFLILLLTVRFVIVPVYEWQKKLINENN
                     SLANRVEKTERVLSAKRYNDIRYEQLTARFESKDEFLFEFEDDVKFKLERQQELDSLL
                     PKYGVNLLSIGWQPIIEDSSAHTLNFVASTRIEGRTIEVISLINFIDNRTKIYIDSFN
                     FDIDSHGETLGNMRGTLNLSYYVDSIDE"
     CDS             417546..418067
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03660"
                     /product="hypothetical protein"
                     /protein_id="BBN80381.1"
                     /transl_table=11
                     /translation="MWTVSMNKLGIIVSVVSIYLCFNDFMSRGFIGNSSSSIEQKSNT
                     SEPVAPWGMVKEDQLDELTDLFNAYKEQHENEAGPKTIQLSEEVSGSYTKVISDNYQL
                     ELKAVISDKLSYALINQVELETGKSRLVKVKAKEIITGLKMEIISQTKVKLTNDKRAI
                     TLMMYQPNKKESV"
     CDS             418069..420099
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03670"
                     /product="hypothetical protein"
                     /protein_id="BBN80382.1"
                     /transl_table=11
                     /translation="MQFKPLCSKTIIISLLLSGCQTTKNELFLLESSYLEEKGAEYTA
                     PSVDDKRKVDEEKLQTSSFEYFPNQLSELNNSKQRSNLNKFSDDETLQISADSLAVKD
                     FLHHVFGELLGVSYILGDSATSDTQEMTLNIQKPISQRKLFSLSEELLNQKGYIVRYN
                     DDIYYIHKTEQGGKANVAYGYGNSVSSVPETASDIIQYVPFKYGTQYTLVPTLNQLFN
                     VQVGIASANNALSIKGKRAEVLKALDFIQMLDIPSLANKQIASYQPVYHSVKELTEDL
                     QQLLEEEGISATSTGESGKAVSFVMLERAGKLVTFANEIEALKRVEKWVNVLDKPSAG
                     NDRAYHIYQPQFARATDVGQSLQLLISGSPAVSNRTSAESENNNTNSQRQGALSASNK
                     DLKMVVDERSNSLIIESSGEKYRQILPLIKRLDVMPKQVMLEVVIAEVQLNGKFSQGV
                     NFTLRNDQSANIVGAGKFNVGGAGLNYILKGANGEIALNMLQTDTNLEILSRPSIVVR
                     DGVTASIVAGDDIPTVGKIVTDPVNGSQTSIEYRKTGVQLSVTPTINAQGVVIMEISQ
                     RISSTSPTSSELEGAPIVAERTIETEVVAESGQTVVLGGLMRENNSINDRRVPGFSSI
                     PILGKLFDSTETGNDKVELIVMVTPKIIESAETWKAVKKEFMGRFQYLKVND"
     CDS             420480..421925
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03680"
                     /product="hypothetical protein"
                     /protein_id="BBN80383.1"
                     /transl_table=11
                     /translation="MFKKSLLALALTGAAVSANAATVVTNTLTQTANTSITTPEVTAA
                     TKVSKEGLEGAANARILFDAIATANDQTAAAVQPAATELGLYVTTDIVIKENDTIIVT
                     LPGAVFDTTLTPTIKTVTFQDAAGDADVDVTASTASFVKYDGDKMIFAVTGGTFPIAT
                     YNIGGFGLKSTSAASITPSFKAVSTVTAIGDYATGTAKAAAYSVVSELGGVKVTKALN
                     GVIDVAADRKLFTAGNDTTTTDVLTVNTTTTTVDKLAITGPADFDITLTGDFSALDTD
                     GDKKIETGEGSVTLGATTPVWAADLSSVTFKDVAVNTAHNVSVNISATAANRLTLATQ
                     SFTTSVTSDYTATTAKTDVKVLTNTAAGSWTLNGSEIEVPYLPFGDNTAPILRLTNAS
                     TKSGDLTVRYMIEGTEASWKTLGVLTTIKPGITNIADLVINAVKADAGVTKGKVALEL
                     VTNVPDADVDVTAGFKVVSEQDRGIVTTVKK"
     CDS             421997..422716
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03690"
                     /product="hypothetical protein"
                     /protein_id="BBN80384.1"
                     /transl_table=11
                     /translation="MISTKDNCLFVHIPKVAGQSIELFFVERMGLSWQQRESLLLRAN
                     NDPELGPPRLAHLYADEYVKYDYVSQREFDSLFKFSFVRNPWSRLVSEFTYRKALGHK
                     QYQQGFKHFVLESFPTPNRDVHKTGVDHYRHVVPQSRFLYDAEGNCLVDFIGRFEALH
                     EDFEAICNRLNIENAILPHKNATTDLSRARTWLSKVLGKQSSKRISPHYSTYYCSETI
                     DFVRSYYHEDIERFGYQFEQM"
     CDS             422716..423960
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_001056745.1"
                     /locus_tag="PA25_03700"
                     /product="hypothetical protein"
                     /protein_id="BBN80385.1"
                     /transl_table=11
                     /translation="MNAKQLLSRAFGVFFVKVIFVGLGFLSTLILARLYTTKELGFYF
                     WLLSCITFLCVAMRFGQENTLIKQAANSSTCKQKSAVTSQALFIVCRVTLAVAVGMLL
                     VTFFFQETLSVNLVMLVNAFMFSIISIIGYCMQAAGQSVMQQLLLNTPRLLCAGLAIA
                     FFLVFKYLAPLQTMLTAAFFISFIFTLALFYFKGFVIKYAPFKLLTNPSETKHYLLIS
                     CSAVLMAEGAMVILGMLGSKFDTAHFGVATRLVSLVAFVLLAFNSIVTPQFAQLYKQN
                     KHKELVKRYQSARQQSIFISMSIALVFWWSADFLLGLFGTEYVQASGVMLVLLLTQLT
                     KVFVGSAGQLLMMSDLVHLQKRCIVAGVLVMILGCCIFIPQYGALGAAISTFIGVAIN
                     NFLALFYANRYLSIPLGLASPQ"
     CDS             423983..425245
                     /codon_start=1
                     /gene="wcaL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P71243"
                     /locus_tag="PA25_03710"
                     /product="putative colanic acid biosynthesis
                     glycosyltransferase WcaL"
                     /protein_id="BBN80386.1"
                     /transl_table=11
                     /translation="MNFPCCASVKIAIFVDVFPIASQTFVLNQITTLIDLGVDVEILA
                     LYPGDQIVLSQPSLAPYQLQRNVTYLLAPKRTVWQQLGHRLSKVGKGLILGKNRRTIL
                     AGLKPEFSAQARNLMLSTIAATHSAPLKFDWVIAHFGSSGVVANNLRQIGVLEANIAT
                     VFHGQDITAELKFKHTQQNYQRLFKETELLLPVSELWKTQLLSMGADESKTYVQRMGV
                     DLSLFMARRTDKSTKVLHILTVARFSQKKGLKYALQALAKLPSTMQFSYRLVGYGELE
                     EELKAQSSALGLNDKVHFLGAMNTQQVAEQMRWADVFLQPSITADNGDKEGVPVSIME
                     AMASGAVIVSTLHSGIPELVAHNVNGLLAPEKDADALAQHLNSLYLKPDLRLELADNA
                     RERVSALADVVKLNQQLLDLMSNYKRYH"
     CDS             425246..426214
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011403764.1"
                     /locus_tag="PA25_03720"
                     /product="sulfotransferase"
                     /protein_id="BBN80387.1"
                     /transl_table=11
                     /translation="MQQDVWAPKKAITIADFFIVGAMKSGTTTLHNMLHAHPDIFMAK
                     DELFYFDMDDIAQHPDFIFQNKSGLQTTDVKHDEEGYWHWYQSQFSKAREGQLKGEDS
                     TTYLCSELAIARIAKLKPDAKIVVMLRQPSLRAYSHYWHMVRAGRAGYSFEDTLRFQP
                     QLLLQRSDYSTQLNMLYRYFPRQQVKVILFEHFIVEPEQILTEICQFLDVDEQKLPAD
                     SLHIHANKGQTPKFLKLHLLKCRLFRGAVSNMYNSHFTEAPKNRPLNIFERIYRLCNP
                     MVNTPSKKITQSHKQLLDDYFSKVMPDINELTGLDAYQIWFGEREK"
     CDS             426211..427005
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011106510.1"
                     /locus_tag="PA25_03730"
                     /product="hypothetical protein"
                     /protein_id="BBN80388.1"
                     /transl_table=11
                     /translation="MIQRLRSMYALYKQYTHPDTVFIYQMGKVGSTALENSIEGAVHI
                     HNFYSANHPCRVRLAGLAGFGWRYYLKRLAQECEMLVKRIAFKRRKHSKIVTLVRAPL
                     ERNISMFFHDLDCYLFALYSNCDRTPYPPAATRTQDPTVLYEAFNKHFQHEYPLSWFD
                     RELKRMTGVDIYSHPFDKHSGFIKINEQGCEVLCLDIRVLKRSKAAICEFLEQDIEIS
                     FANQAEHKWYGDLYAHFKHTYKPTQELVSKLEGSKFYQHFYAQGPQ"
     CDS             427002..428210
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03740"
                     /product="hypothetical protein"
                     /protein_id="BBN80389.1"
                     /transl_table=11
                     /translation="MKDHIILISNAYFPNRGGIENSLYHLAKSYQALGYQIDILVGDV
                     NQATESHLPEYEVLDGIAVHRFGAYSKWRRFKLFRPFLRFKNMAAKLNSLSRPSTLGI
                     ISRYHNTTMIAKMVTKLPVLYLVPGVVRVQDKPKNTTEHSSVKTNALQYIRLLKHDLV
                     QQIAFRVADVLLVFSDNMKQQVESCFIFKKPHIGITKPGVDCDRFLPVSQTAKQTLRE
                     ELELPTSNEILLGVGRLVRAKGFHFLIESLAHTSNTMVVILGDGPEKLALEKLADELG
                     VRQRVIFKGVVQEPNYYYQAADMFVMTSTYEPLGQIVLEAIASGLPVVAFSKQAMPQT
                     ATEELLSNQSCVFVNEANAKALANGINQLIKNQELRLTLAATGRQLAQDSFDWTHLAN
                     VLIALIKSKR"
     CDS             complement(428344..429930)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03750"
                     /product="hypothetical protein"
                     /protein_id="BBN80390.1"
                     /transl_table=11
                     /translation="MYYKTTLTIAMLSLLSACSGSDSQPSVKTTTPDTSTGAQAQFQT
                     SALLQSTLNEDASVQIDISAQQVPTGTEALQLSIIEPTQLGTLTGQYPNLTYSPKPNM
                     HGNDRFVYQLKKGEHTSEEVTVKITITAVNDKPELSGSPAQNVIKLNDDFSFSPIVDD
                     VDTDTSGHIFNIINKPQWAQFDTSNGTLSGAPKVDDDLGVYKQIKISLTDGDFTTELT
                     AFDIEVVKSAWQPITQLPNNQGSHLKTTVLNNKLVTLSHLTSLSSAMSCSTAPQSAPT
                     FMQLDTNHLSWLVLPRPEESRYYYHAVSTGSKLYLFGGTQACPSTSSAKTTMEIFDSE
                     SLAWSSVSAPVFSPYENTVLASCANSQHVAAFTSNSDSLYLYLLDVSDNTWKSEALEL
                     PVTDIHNCAFVGEKLFMTTTSDSHTNVNLTQFDINTLQITINEHIPADLADLYHTLAS
                     DGGSLQVHSPKAVMQYQIDTQQWQALTVNPYASEVQGEQNYYLRDYSVEQLEGKYYQL
                     GGAFTTQSNNQVYLFNSTVD"
     CDS             complement(429971..431353)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014208049.1"
                     /locus_tag="PA25_03760"
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="BBN80391.1"
                     /transl_table=11
                     /translation="MSLKTFVSYAVGPIGASLLGLITLPVLTRLILPDTYAQIALAQT
                     TIQLLLFFALSGFDQAFMREYYEQDDKQKLFSHAYLSTTVLFCGAAAILLLFRHDISA
                     FLFNAYRPDALSLIAATLLFTVLLRYQQLVMRLENQAMSYSIALFSQALLNLLFIIIF
                     VEIFKLEGLIGVLFANCSSVFLVSFGCWIKTKNKIAILHRPAFDYELFTQLFRYAYPL
                     LFSTLLMWVLYSADQYMLRWLSAYEELGVYAAAYKLCAALTILQVIVSTYWVPLSLQW
                     HKENVSISQFNLAGKAAAAVLIVVFLLSIALREVVSLLLGADFALAVEIFPFLMLYPI
                     FYTLSEISGVGINLSRKTSHMIYITLIAALANISINFWLIPLHGAKGAAIATGATFII
                     YFYCRTILANQVWKKVTLSHYHLIVCLSIFVLFFIDAAWIEWFCALLAITLCVVLAVL
                     FKSSKVKLTP"
     CDS             complement(431360..432520)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014208048.1"
                     /locus_tag="PA25_03770"
                     /product="glycosyl transferase family 1"
                     /protein_id="BBN80392.1"
                     /transl_table=11
                     /translation="MHIVVLPSWYPSDSHDAAGSFFREQAIALKESGMNISVLAVCLH
                     GLRNYKAIFKQGIAESVDSQLPTHRLHLMRWLPRSDKFDAVIVTAGLHFLFKRYIKKY
                     GLPDVIHAQCALFGGVVAQQLSAKYGIPYIVTEHCSIYARGLVSTSDKARANTVFEHA
                     HKLIAVSKPFAEDLKKAFDAPHQTWGIIPNMVEQRFLDDFENTQPNTSFSFISIGSLN
                     KNKAIDTLIRAFHRAFKGNEQVTLTIAGDGVERMNLEALSSQLQLTKQIKFIGSISRQ
                     RALEEIKSANALVSASLYETFGVVLIEALALGKPVIATRCGGPETIVTDKVGLLADKN
                     SVDSLSIQLTTLYQNYNQYDPEAIHNYCQQNYSKQAYTNLMRQQFNNVIKKA"
     CDS             432897..433628
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000564500.1"
                     /locus_tag="PA25_03780"
                     /product="teichoic acid biosynthesis protein A"
                     /protein_id="BBN80393.1"
                     /transl_table=11
                     /translation="MRCLQVNKLLLKLKSAPEINQRFDACIQEDSKTTEVITFINPYS
                     YLQLRDKEQIIDGVDAIYTDAISSAKYLSRLLKRPIPRVSFDQSSFAKDFLQRANEEQ
                     FAVYFLGAKEHELDKAIGNFKTHYKNINIVGYHDGYFSDDEQMIAQILAAQPDFVVCG
                     MGTPRQDEFAVKLKQRAKGGIKQIYTCGGFLHQSAESLIYYPGWIDKLHLRWLYRVFE
                     NSYVIKRLLTSYPRFFYLVRKDFKS"
     CDS             433691..434782
                     /codon_start=1
                     /gene="wbmB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015064737.1"
                     /locus_tag="PA25_03790"
                     /product="hypothetical protein"
                     /protein_id="BBN80394.1"
                     /transl_table=11
                     /translation="MLDEESNLKVAYLLVLKNTQYHSVYDKVIAQLETWRALGVDAKL
                     FLVTPEANEHPHVEVIAPDSTIKLIRKLKHAVDCFNPDIVYHRMWVLSPLLVPLLLSD
                     YKMLAEINTDTDMEISLEKSRSIKGFATYIYNALTKAFYQRRLAGAVSVTKELSGSVS
                     TQQVAVIPNSIAVEGFNYRKSVDKLDSKLSVLFVGTPGLMWHGIDILNQLARETKGRL
                     EFHVVGMEQSVLSEPSENIHFYGYLPVEQYAAIAQSCSVGLGTLALHRKGMKEACPLK
                     VREYLAAGLPVILPYEETAFLEHKPDWVLEIDSSKDRLDKETVEKVVEFTNLMHNVII
                     DRQEAAQYIGNVQLESKRVEFMQALAGVK"
     CDS             434784..435800
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03800"
                     /product="hypothetical protein"
                     /protein_id="BBN80395.1"
                     /transl_table=11
                     /translation="MEDTSIEPLVSVLIPAYNCTKTIEEAINSVISQSYKNIEIVVID
                     DASKDNTYSVLNKLTSQYPNIRLYQNEKNLGYLRTFNKLLSLAKGEFITFLDSDDWIA
                     EDKISKQLTLLLKHDEYGFCGTGFSRTNSKGQVYQEIILPSEHSEITAHLDNEIEVCF
                     CGSSIMVRKSVVDDVGGYNEFFLGCPAEDYDWIRRMANKYKCTNIPECLYFYRFSLDS
                     LTRNVSYNIKAQSAAELAFFFDKQRQQYNGHDALSHSQYQPELDDFLAKKQAEFNRHP
                     EWLEQKVVINEAIHGNVKNVMKALGRLFKISPVWGIRSSIIAVAVLIIPNTLLLVVKS
                     RFKK"
     CDS             435849..437129
                     /codon_start=1
                     /gene="wbpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073077.1"
                     /locus_tag="PA25_03810"
                     /product="UDP-N-acetyl-d-glucosamine 6-dehydrogenase WbpA"
                     /protein_id="BBN80396.1"
                     /transl_table=11
                     /translation="MFNIPKTPKIAVIGLGYVGLPLAVEFGKLFDVVGFDINQGRINE
                     LRNGVDNTLEVSREQLCQATKLSYSNDENALEESNLYIVTVPTPIDDTHAPDLTPLRK
                     ASELVGRHIKDNDIVVFESTVYPGATEEVCIPIIEKISGLVFNQDFFAGYSPERINPG
                     DKVNTLTKIIKITSGSTSEVADYVDEIYRKIIVAGTHKASSIKVAEAAKVIENTQRDL
                     NIAVINEFAKIFNRLHIDTEEVLNAAGTKWNFLKFKPGLVGGHCISVDPYYLTYKAEE
                     VGYRPEVILAGRRINDGMGEYVATQLVKKLSSRKIHIDEAKVLILGFTFKGDCPDVRN
                     TKIIDIVRELQDFNMSVDVYDGWASAEEVKSEYGIELINDIEQGQYDGIVLAVDHNEF
                     KEWGVEKLRAFGKTEHVLYDVKHVLTPKDADIRL"
     CDS             437137..438093
                     /codon_start=1
                     /gene="wbpB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:G3XD23"
                     /locus_tag="PA25_03820"
                     /product="UDP-N-acetyl-2-amino-2-deoxy-D-glucuronate
                     oxidase"
                     /protein_id="BBN80397.1"
                     /transl_table=11
                     /translation="MDKVKNFALIGAAGYIAPRHMKAIKETGNLLSVGYDINDSVGII
                     DSISPQSEFFTQFERFYDYAHKLKRDKDTQLDYISVCSPNYLHHAHITAGLRLGCDVI
                     CEKPLVPTIEELEDLILVEQETGKKVFNILQLRHHQAILDLKDKVAKSGADEKHEVEL
                     TYITSRGNWYMESWKGDPRKSFGVATNIGVHFFDMLHFIFGKLQRNDLHFMNNDKAAG
                     YLEYENARVKWFLSIDANDLPDTVKGKQPTYRSITCDGEELEFSGGFTDLHTVSYQEI
                     LAGRGYGLEDARHCIETVNAIRLGKIHVENEQEVHPFAKDYQ"
     CDS             438093..438674
                     /codon_start=1
                     /gene="wbpD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014208045.1"
                     /locus_tag="PA25_03830"
                     /product="N-acetyltransferase"
                     /protein_id="BBN80398.1"
                     /transl_table=11
                     /translation="MTYQKHESAIVDDGALIGDGSRVWHFAHVCAGAQIGEGCSLGQN
                     VFVGNKVTIGNNVKIQNNVSVYDNVHLESDVFCGPSMVFTNVYNPRSFIERKSEYKNT
                     LVKKGATLGANCTIVCGVTIGEYALIGAGAVINKDVKAFALMVGVPAKQIGWISKYGE
                     QLDLPLTGTGTAICPHTNDRYQLEDEQLTLLSA"
     CDS             438685..439749
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010933143.1"
                     /locus_tag="PA25_03840"
                     /product="aminotransferase DegT"
                     /protein_id="BBN80399.1"
                     /transl_table=11
                     /translation="MQFIDLAAQYQHLKTRIDNRIQEVLDHGQYIMGPEVQELESQLA
                     DYVGVKHAITCANGTDALTLSLMVLDVKEGDAVFCPTFTFFATAETIAYEGATPVFVD
                     SNPDTFNICPIDLEKRIQAVIAQGKLTPKAIIAVDLFGLPADYPALEALAKKYDLKLI
                     EDAAQGFGGEISGQRAGSFGDIATTSFFPAKPLGCYGDGGAIFTNNDEYADLIRSYRV
                     HGKGKDKYDNVRIGMNSRLDTIQAAILLEKLAEFPIELKSRNEAALRYHQQLADKFKV
                     PSVPPGYVSSWAQYTLQSEQRDAAMQQYKSQGIPTVIYYGTCMHEQTAFAHLNYQVGD
                     FPIAEKLARSVFSLPMHGYL"
     CDS             439796..440728
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011058151.1"
                     /locus_tag="PA25_03850"
                     /product="fucosyltransferase"
                     /protein_id="BBN80400.1"
                     /transl_table=11
                     /translation="MNISVVIPLFNKAEHVVRAVESVLQQTVPVKEVIVVDDGSEDGG
                     ATKVESLKYQNVLIHRQANHGVSHARNVGISLASGDFVAFLDADDYWLPNFIALITEL
                     RQLYPAGKLLCTGYEFKTKLGTKRAINSKLLAPHGLIDDYFRACCNEDLPITASSVCI
                     EKNILEEVGGFPEDLKLGEDQVVWAMIACKWPIAYVQQSAVVYDLMASSSDQQRIDYV
                     DPSPHLAAFKQLEEQSLVPDRMLNSLHYLQHLTVMSSIRSNLIHGRKRQAIRLLLTHT
                     MLKWDFYRLSAFLLLLAPTSLNIWLLNKAKSLRV"
     CDS             440738..441880
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03860"
                     /product="hypothetical protein"
                     /protein_id="BBN80401.1"
                     /transl_table=11
                     /translation="MVRQQYFTFFVIVAVVGCLSYGSYNLLPANAIFELLVVGSLLFV
                     AKRMPVKSWYIFAFCTGYFVVCMALALSRGAHPVDFLLAYKTYFYLAILCFFSAKVLF
                     TSDMIKLLWRSMLLLFFVKYALSIVLNVGERPGIFTENNFEIMFLLLLGCAVWSLKSK
                     LSALDWAMLGVVIFLSGSRSGVICFLAMMVLLYIKEMNWKTILQLGLVGIAGLGVVAI
                     FVSRLSGGSVEDIDRVVFFQLFLTAIADWQWHEFLFGSPALTPLPAQACERLAFYKTL
                     FSAKDPTICYSVILHSYVTRAIFDHGFIGLLSTFWVINTLLKMSDVQRRVRLSVLAIL
                     FLNGVSVSSVNSVYAVLGLIIVMTGLYPHRFELEKRKLHLLDTKSN"
     CDS             441991..443157
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005467215.1"
                     /locus_tag="PA25_03870"
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="BBN80402.1"
                     /transl_table=11
                     /translation="MKIVVVGTGYVGLSNAVLLAQHNEVVALDIVQDRVNQINNRVSP
                     IEDTEITDFLSNKTLNLIATTDKSSAYVGAQFVVIATPTDYDPDTGYFNTQSVEAVIN
                     DVLQFSPKTTIVIKSTVPVGFTKQLSENLKVSNLLFSPEFLREGKALFDNLHPSRIIV
                     GERSERAKTFAELLQQGAIKKDIDVLFTDSTEAEAIKLFSNTYLAMRVAYFNELDSYA
                     ESHGLNSKQIIEGVCLDPRIGNHYNNPSFGYGGYCLPKDTRQLLANYQDVPNNIIQAI
                     VDANTTRKDFIAESIVNKQPKVVGIYRLIMKAGSDNFRASSIQGVMKRIKAKGIEVVV
                     YEPVLTDELFFNSRVISDLDVFKKMSDVIVSNRMVTQLSDVKEKVYTRDLFGCD"
     CDS             443298..443789
                     /codon_start=1
                     /gene="rfaH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3CS73"
                     /locus_tag="PA25_03880"
                     /product="transcription antitermination protein RfaH"
                     /protein_id="BBN80403.1"
                     /transl_table=11
                     /translation="MDCLMKQWYLVYCKPKQEARACENLLQQGIDVFYPVYTRRKTSG
                     AKQLIQPLFPRYLFVYIDLYSAHFCAIKYTRGISDFVRFGEHIQQVPEEVVNQLRTQQ
                     PSAEHYDFKAGDKVVLSNNCYQNIEAIFQQADGETRSVLLIELLNTSVEIIAKNTEFE
                     MQS"
     CDS             444300..445415
                     /codon_start=1
                     /gene="gfcE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261018.1"
                     /locus_tag="PA25_03890"
                     /product="polysaccharide export protein Wza"
                     /protein_id="BBN80404.1"
                     /transl_table=11
                     /translation="MALSCKTIIASSLVLAMSGCTLVPGGHFEGINSGQQTANLERDL
                     EKVNIHIIDSQLVQEHKIKSAKELERSALVGIDVSDYEYRLGVGDVITIGVWDHPELT
                     IPAAVQRTAEFDGFRVQADGTITYAYAPKVPAAGKTVTELRDELAKRLSRVIEDPQVD
                     VKVVGFKSQKAYVTGEVTKPGVYPITETPVTLIDAINQAGGLSESADWETVSFTRHGK
                     TDIIQLDDFYAQGDISQNRLLQHGDIIHVNRNDKKNVYVLGDVIKAGKVDVNRYGLSL
                     AEALTDAGGFNERTADANGVFVLRKRDLQKDGVLADVYQLHAKNVASLVLAEQFELQP
                     QDIVYVTSAPLARWNKVISLLLPSLSTVDAIQDIENQ"
     CDS             445427..445861
                     /codon_start=1
                     /gene="etp"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261020.1"
                     /locus_tag="PA25_03900"
                     /product="phosphotyrosine protein phosphatase"
                     /protein_id="BBN80405.1"
                     /transl_table=11
                     /translation="MFDSVLVVCAGNICRSPTAEYVLKSKLTGKDIKISSAGLTALEG
                     KSADAMAQELTKVCGIDMSGHQGRQLNGTLVAQNSLILVMEHRHLDDLCSRYPQARGK
                     TFLLGKWIGDKEIPDPYRQSKEAFEHVYELIDSACGAWQKYL"
     CDS             445876..448110
                     /codon_start=1
                     /gene="wzc"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261021.1"
                     /locus_tag="PA25_03910"
                     /product="tyrosine protein kinase"
                     /protein_id="BBN80406.1"
                     /transl_table=11
                     /translation="MNAQPNLITPQKSQKLDAQEIDLMALFGALFDAKWFIVGVTALF
                     MLLGIAYAIFSTPIYQATAMVQVEEKGGSVPGFDDMSGMFETTSAAVTEIELLKSRSV
                     IGEAVDTLNLDTVVEPKLFPLFGGRSYRKFVAQNKGDVAEPSFGASSYAWGGEQVEIY
                     RFRVPKSAEGIGFTLQAQADSGFTLLNGNDEVVLTGKVGEEVKSGQFELIIKTLVARP
                     GTEFSIVKRNRLQTILDLQAAISASEKGKDSGIINLALQDKSPNYAEKVLDKVAGIYV
                     RRNVERNSAEAQQSLEFLEVQLPEVKRSLERAEKAFNDYQIRQESIDISLETQGVLEQ
                     IVSLETKLQELELKRLELARKFKREHPSYRGVVEQIDTVKRQRNDLAGEVQGLPETQR
                     ELLRLRRDVEVNNEIYTLLLAKTQELDIVRAGTVGNVRIVDYAEVNTTQPVKPKKALI
                     VVMATMLGGMLAVAIVLIQKAMHKGIEDPSEIEALGMPVYASVPFSEYQVKLTGFAKA
                     RKGKTAKAKSILAIDNPADLSVEALRSLRTSLHFAMLEAKNNVIAISGPSPGVGKSFI
                     TVNLATVLAQSGKQVLVIDGDMRKGYLQTQFGMKWDNGLSDYLSGRLDLNQTIKHTQV
                     EGLDVMTRGQIPPNPSELLMHENFSKLIKEVSSKYDLVIVDTPPILAVTDPAIVSAHA
                     GTTLLVTRFGQNHAKELEITRNRFEQNGIDVKGVVFNGVVRKSSNAYGYYGYYNYEYK
                     SDKG"
     CDS             448445..449560
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000756756.1"
                     /locus_tag="PA25_03920"
                     /product="UDP-N-acetyl glucosamine 2-epimerase"
                     /protein_id="BBN80407.1"
                     /transl_table=11
                     /translation="MKVLTVFGTRPEAIKMAPLVHALEQDKRFDAKVCVTAQHREMLD
                     QVLELFKITPDYDLNLMKAGQTLPEVTSRVLLELTPILKEFKPDVLLVHGDTATTFAA
                     SLAAYYEQIAVGHVEAGLRTGDIYSPWPEEANRKLTGALTKYHFAPTATSKQNLLAEN
                     YQDDTIFVTGNTVIDALLIVKKQIETDSDLNNTLAAQFPMLDEKKKLILVTGHRRESF
                     GGGFERICEALAKTAKAHPNCQIIYPVHLNPNVQEPVKRILRDINNVYLIEPQQYLPF
                     VYLMNKAYVILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVAAGTVKLVGTNVEAITS
                     SLDELLINKRSYEQMSRAHNPYGDGKACTRICDILAQ"
     CDS             449602..450864
                     /codon_start=1
                     /gene="wecC_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8ZAE4"
                     /locus_tag="PA25_03930"
                     /product="UDP-N-acetyl-D-mannosamine dehydrogenase"
                     /protein_id="BBN80408.1"
                     /transl_table=11
                     /translation="MSFNTISVIGLGYIGLPTAAMFASRKKKVIGVDVNQHAVDTINR
                     GEIHIVEPELDMIVHAAVKEGYLKATLTPEQADVFLIAVPTPFKNNDSTIPEPDLSYI
                     QKASEAIAPLLKKGDLVILESTSPVGATEQMADWLAAARPDLSFPQNAGENADVNIAY
                     CPERVLPGHVVRELVENDRVIGGITAKCSVRAVELYKAFVKGECVITNARTAEMAKLT
                     ENSCRDVQIAFANELSIICDKLDIDVWELISLANRHPRINILQPGPGVGGHCIAVDPW
                     FIVSTAPEEAKLIHTARKINDAKPEWVIDKVKIVIAEFLQANPDKTAKDITIACYGLA
                     FKPDIDDLRESPALNITRRLAEFHTGAILAVEPNINSIEGISANIELASFEAAKAHAN
                     IHLVLVEHKEFKASKFHAQYIIDTKGIW"
     CDS             450865..452055
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005459669.1"
                     /locus_tag="PA25_03940"
                     /product="UDP-N-acetylglucosamine 4,6-dehydratase"
                     /protein_id="BBN80409.1"
                     /transl_table=11
                     /translation="MNNILSLIGREKELFTQDITKHRVELQRIVSKSRFLVLGGAGSI
                     GQAVTKEIFKRNPAKLHVIDISENNMVELVRDIRSSFGYIDGEFKTFALDIGSTEYDA
                     FIKADGQYDYVLNLSALKHVRSEKDPFTLMRMINVNVFNTDKTIQQSIDAGVKKYFCV
                     STDKAANPVNMMGASKRIMEMFLMRRSKEIDISTARFANVAFSDGSLLHGFNQRIEKQ
                     QPIVAPSDIKRYFVVPQESGELCIMSCIFGDNRDIFFPKLSESLHLITFADIAVKYLE
                     QRGYEPHLCDNEQEARELAKTLPAQGKWPCLFTESDTTGEKDFEEFFTDKEELDMTRF
                     ENLGIIKNEPEYDQELLSLFEAQIANMKTEQAWSKEQIVELFFTMIPDFGHKETGKYL
                     DSKM"
     CDS             452065..453210
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011105625.1"
                     /locus_tag="PA25_03950"
                     /product="aminotransferase"
                     /protein_id="BBN80410.1"
                     /transl_table=11
                     /translation="MNAQLLVEFVRDQYKTQNFIPLHAPTFAGNEKAYVSETIDSTFV
                     SSVGKFVGDFERKIEAFTGSPSAIATTNGTAALHTALYMADVQRGDLVITQALTFVAT
                     CNALFHMGAEPVFVDVSPISLGLCPKAVDNYLSEHAQLNEHGCVHKQTGQRIKAVVPM
                     HTFGHPVELDELVEVCCKWQLTLVEDAAESLGSFYKGKHTGTFGDFSAVSFNGNKIIT
                     TGGGGMVLCKTSELGKRTKHITTTAKVPHPYEFFHDEPGFNYRLPNLNAALGCAQMES
                     LNAYLSDKRALAERYSALFEGTEYNFVKEPKYAKSNYWLNAVICEDKAARDLLLKETN
                     EAGIMTRPVWQLMHRLPAFSECLKGDLSHSLWFEERLVNIPSSPVNI"
     CDS             453234..453884
                     /codon_start=1
                     /gene="neuD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261004.1"
                     /locus_tag="PA25_03960"
                     /product="sialic acid synthase"
                     /protein_id="BBN80411.1"
                     /transl_table=11
                     /translation="MNEVYIVGAGGLAAELTEYVKDNNLKMEEQVSIKGYFDVSSKAY
                     LENKFSSPYLGDERDYSFSKGSAVLIAIGDVKARNRCIEYFSNLDVLLPNFIHHSAFI
                     ASSVNMKGGNIICPNVIIGPNVILGQGNLINYSSAIPHDCHIGDVNVFSPNVQITGQT
                     GIGSSNFFGTSVTCLPRIKIGDSNKIQAGIVVKKDIGNGRIIYCGSKNNDIKSHNL"
     CDS             453925..454182
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_03970"
                     /product="hypothetical protein"
                     /protein_id="BBN80412.1"
                     /transl_table=11
                     /translation="MSIRNTIIETFHQVLNQTDSELLVPELHDDVQLLQSGLDSLGFA
                     ILVASLDEKLGFDPFTMMEEPLYPSTFSEFVGIYERMSPNK"
     CDS             454185..455516
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011090508.1"
                     /locus_tag="PA25_03980"
                     /product="hypothetical protein"
                     /protein_id="BBN80413.1"
                     /transl_table=11
                     /translation="MDSIQNASLSVPSGRVAFIGENTRVFYDDLNQMVKHNAEALDRL
                     RGATAVINGRARLELALLLFLLDGVAKRILFLPQDIEQAQRKEFFRLANVNFDVLIND
                     GCIEVKEITPYQAGDVSAVVQTEWVIPTSGTTSTPKLVSHTFASLTRTAKKDIELGCN
                     FVWGLVFDVYRFSGLQVLLQSLLSGSTLIVPEAESSMEEVVNLLCQHNCNTLSATPSF
                     WRKMLMTKESKSIKFKNITLGGEIADSNILNALKSRYPEAGIRHIYASTEAGVGFSVN
                     DGIAGFPCTYLDEDINGIKLKVDDRGILWLKPNTREQKYVNGAPMFDEDGFINTGDLV
                     ELKEERVYFLGRESGAINVGGNKVQPEEVERTILDSGLVSAAYVYAISNPMMGSLVCA
                     NIVAVEKGVKATELKKQVTIFCRERLENFKVPALLKMVEELEITNSGKLKR"
     CDS             455520..456242
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011090507.1"
                     /locus_tag="PA25_03990"
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="BBN80414.1"
                     /transl_table=11
                     /translation="MNLVIVTGASKGLGLAISSKLIEVGYKVVGISRTLSEEFKSLRE
                     QNSDSLFFESYDFNNVNDIQELVRRITKTYGPIYGLVNNAALGHDGVLGTMHESQIEE
                     LIKVNVQSPILLTKYACRSMLMKQQGRIINVSSIIASTGFNGLSVYGATKASLNGFTK
                     SLSREVGKANITVNAIAPGFMETAMTSGLQGEKLESIRRRSPMKEMARVEDVAEAVIY
                     LLSDGAKRVTGTTITVDAGSTA"
     CDS             456239..457054
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04000"
                     /product="hypothetical protein"
                     /protein_id="BBN80415.1"
                     /transl_table=11
                     /translation="MSSSEIQYETVLDAQRKQQIKNEFQDFFTIIYGRALNDSSWQHQ
                     FIHSPYNDSPLFLALDRGRIVGSALMIGQKVRHKGEILDYYLFTTSGVLKEYRNKGVY
                     AELLKLQKEHASTNGKKFIFAFPNDLAYPVLRLFGGFNDLVQTKLVTTTLNNIDFSDK
                     GNSLLLDQDFSNWRFEHKDYCFSIVEDMLVITKEFNRQLDILAIYDAEAAELIETPLT
                     PLNEELKVNTLIDWTIDHAPCEVISNVNAVYFPLDRSIAITEIKLNLLMSDLY"
     CDS             457054..457725
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011403380.1"
                     /locus_tag="PA25_04010"
                     /product="GlcNAc-PI de-N-acetylase"
                     /protein_id="BBN80416.1"
                     /transl_table=11
                     /translation="MKEKVLVVAVHPDDETLGAGGALLKHKSFGDEIHWMIVTDVKVE
                     EGFKKEAVEKRESEMEEVSTMYGFDSVHRLGLSTMRVDEYAMSELIGKVSQVVNAVKP
                     SVIYMPFKSDVHSDHRVIFDAVYSCTKSFRYPFIKRVLMMETLSETEFAPSVKEDSFI
                     PNVFIDITEFMARKQSIMKVFKSEMGPHPFPRSERNIEALATYRGATAGCEYAESFML
                     LKEIK"
     CDS             457753..458649
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04020"
                     /product="hypothetical protein"
                     /protein_id="BBN80417.1"
                     /transl_table=11
                     /translation="MVYSCSNFEFFINDYLESVFSQTVQSFDLLIVIDNADEEKVLSA
                     LSRYEKASINVHVVNTEGKFSPIQLRKEVILKAYGLQANTLIFSDFDETVAENRVEEI
                     INNITDFDFVFNDFYLTDSMLNRLSQESFFSKRPVPDIVDNFDSVKLCNFVGLGSVAL
                     NLSRYRFDELEFPETIVALDWFIVTKVLLDGGIGKKLTTTYANYRQHVDSLVGFDFRL
                     DKNKLKQGIRVKKSHYMAFRDECEIYNELYNELHSLEQYIAEKGEEQYIDNINKQFDA
                     SLFCWWENIKLLPEIKRDFKRT"
     CDS             458630..459688
                     /codon_start=1
                     /gene="neuB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010942614.1"
                     /locus_tag="PA25_04030"
                     /product="N-acetylneuraminate synthase"
                     /protein_id="BBN80418.1"
                     /transl_table=11
                     /translation="MILKELEKPYIIAEIGCNHNGDTELGLKMIKAAKDCGADAVKFQ
                     YFTKDNLVTDKYLDDLDSGNVKLENVAVWKSESLGLNTVREQVAAFTNDEKQLIEFRN
                     YCRQIGVDFGCTPVDDKGVEFLKQIESDFIKLASMDADNLEMIENCIKADLPIILSTG
                     MASLPEIDAIYNMFKKKGFCNFSMLHCVSIYPPRDEIINLNFIDTLKSLYDCEIGYSD
                     HSLGFSIPLAAIAKGVKIIEKHFTLDKNMVGWDHKVSADEADLKIICEEGNKVFRSLG
                     STYKVLAPEEIEKREKFRRSATAVQDLPKGHILTREDFIYKRPGTGISPKEIDYILGR
                     KLKEDIAADTTLTLSVFE"
     CDS             459685..460368
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011403384.1"
                     /locus_tag="PA25_04040"
                     /product="hypothetical protein"
                     /protein_id="BBN80419.1"
                     /transl_table=11
                     /translation="MIAIIPARGGSKGLPKKNIKDLLGKPMIAYTIEAAKASKHITDI
                     IISTDCEEIYRIAIEHGARETFLRPAELATDEAQAIDNYIYTIDRLEKDFSMSIESFV
                     VLQPTSPLRTTEDIDKSIEMYKNSNARSVISYTVEHHPLTWHKYIKEDGSLENIFEDK
                     LDNRQKFRMSHYPTGAVYVFNTQLIRSRNYFDESTKAYIMPRERSVDIDTEEDFRYAE
                     FLLGRNRDE"
     CDS             460361..461386
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011403383.1"
                     /locus_tag="PA25_04050"
                     /product="alcohol dehydrogenase"
                     /protein_id="BBN80420.1"
                     /transl_table=11
                     /translation="MSSVLKLSDNPSFELAIELLDSNGNGILPVIDKDGKFAGIITDG
                     DIRKAILYKNLDLESIINKEPYTLDPSSSEHQKVQFLKSIKRRQLPLVDHERNYVGMF
                     TLDEFDFSTRDNWVVIMAGGLGSRLGELTKELPKPMLQVRGKPIIERIIENFVKQGFT
                     KFYLAVNYKKEIIKDYFQDGKKFGIQVSYLEESKRLGTAGALALIEEQHSEPMLISNG
                     DVLADINYAELVDFHERSSSMATMCVKEYEHIVPYGVIETEGDKITGLKEKPRILFNI
                     NSGVYCIDPKVINRIPQDTFYDMPTLFSELMNEDLPVTAYSYNQYWIDIGRPDDFKKA
                     NDFNEIQ"
     CDS             461373..462596
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04060"
                     /product="hypothetical protein"
                     /protein_id="BBN80421.1"
                     /transl_table=11
                     /translation="MKFNNLNQSEALVCIGRCNNFNDITLRFSKEFLGLEKYTTISEY
                     PGADHFVDLQKQNISDLHSDGWLAVKNTISIEEVILKDRLLRNISYFEAKELVVKVAK
                     YFYELYSKNSFKVLVVHPVDNYVMDVMVQMAEKFNIAVYGVCAFFVGGYKRVSVFGEH
                     NAIREVSPEEVQMFKKKITDKYKSPMVSSFSKALKGSISYYFKYKLKYLYFYLLKHKL
                     LGRLEYDYISTPHAATVNKLTDLFPFKYFSTTLPEKVSDYDIYIPMHYHPEATIEYWV
                     NDTTFVDYLTSLIEVVRKLSDEGFNVYLKEHPAMCFRQDKSLYKKLLYIKNVKIISPY
                     VETGQVLDMFNNVAVWTGSTGIEALLNDKKVYFISSNYYFSKQSGSLYEIKQFKTEEE
                     KDDFVEHILSNTIVW"
     CDS             462656..463744
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04070"
                     /product="hypothetical protein"
                     /protein_id="BBN80422.1"
                     /transl_table=11
                     /translation="MVVPKILPGSDYSELEYYKFIIFMFPFLLVGAHSGYMYFRFTEK
                     EDRFNTLVIFGALQLGLFALAFGLMTQNIFYAIAGLFMGMMVVIEQRVQVEKLFTLAL
                     AGKPLISVFLVLVAYLSWGGFSPQLDPSQILSFSVILGFLAWTAIVVYFIKHTTSFQE
                     GFEFSKYIDLIKKGFSINVATILLMMTFFLDRYITKQYYPESLASYSFSYNIIQFVIL
                     ALTTIGYVNTVKVGEKFDELSFSVLINKLVYTYKVFVVILALFFVFLYVIKFFYTFEG
                     FLTLSVIMSIFFGNFFCVNSVASIALYKGFQNKAAFFLACIFAVNVLLSYLLAESNVA
                     HYWLVLKTGLLLNIYSVTFLIMAKNRLK"
     CDS             464344..464973
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04080"
                     /product="hypothetical protein"
                     /protein_id="BBN80423.1"
                     /transl_table=11
                     /translation="MPFFILFNRGVKFGTVASIGGGVSALMLLILLPLATYLEDNADK
                     FSAGRSVINKFALLNPMSDNFDLKYAAGERFEEVYNSIEAHHQNPYSFLIGSGNGFSY
                     KLEVSRKDMVEENRNGVHFAPVDFYTKYGFLFVLSMTIFIILYLMKVFPYLKCGVWYF
                     NVLVYYQVFVLFYSLLGSNFGLDSIFWMSIGFSLLLIDEIKEAQKNELV"
     CDS             465084..465224
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04090"
                     /note="frameshifted, insertion at around 465079"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="BBN80424.1"
                     /transl_table=11
                     /translation="MGDVGACWDNAVVERFFGSLKHDWLLKVAQPTREHMKSDVTEYM
                     KY"
     CDS             465663..467507
                     /codon_start=1
                     /gene="asnB_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011119978.1"
                     /locus_tag="PA25_04100"
                     /product="asparagine synthetase B"
                     /protein_id="BBN80425.1"
                     /transl_table=11
                     /translation="MCGIVGFNFKSESNDFLSLAPHRGPDSSDYTYIGGYTLGHNRLA
                     VVDHNEESNQPFYSECGKYVIVFNGEVYNHADLRKELVEKYSFKTKSDTEAMLYAYIE
                     YGDEFVHKLRGMFSFVIYNSVDDELFCARDRIGIKPLNYYFKDGKFIFASEINVIAKL
                     LEEKPSINQEAIRQYMKYLYVPCPDTIFTDIKKLPPGHIMKLKDGELTSKQYWEASQF
                     VGKNLGLSEGEILEELDYLFDDSVKTRMIADVELGSFLSGGIDSSLILYYMQKNSEKK
                     INTYTLGFENADSYDESSDAMLMAKHFNTNHQEILIKPDVVSLLPKMVKHFGEPFASP
                     TSLLIHELTKETKKFATVALAGDGGDEVFGGYPKYQGVQLAEKLNSVPKFVLNGIAKV
                     TDLIPENTSGNHLPRRIKAFASSLSKDAAQRYDDWSAYISDDDLSKLFKEEISFSSIV
                     YDSWNLLDTGDGIITSSLVDLRTYLPNDMLYYGDIMSMANAFEVRFPLIDHNIIEFMT
                     AIDSQWRIKNGQTKYLMKRLLQGKVPDQIITKKKLGLNPPMGIWLKRDLAPLLEEYLS
                     KSVIEKRGIFDYKYVQQIIDEFTTNRKDRSLNLWAMVVLEEWFRQYLD"
     CDS             467533..468672
                     /codon_start=1
                     /gene="wbpG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003119728.1"
                     /locus_tag="PA25_04110"
                     /product="LPS biosynthesis protein WbpG"
                     /protein_id="BBN80426.1"
                     /transl_table=11
                     /translation="MTTNNYQVCTNCVMDTTDSKITFDENGICDHCSTFYNDIKPNWH
                     TDEKGWAEITKIAADIKKEGEGKEFDCIIGMSGGIDSSYLVYLAKERLGLRPLVFHVD
                     AGWNSQQAVHNIEQIVDRLGLDLYTEVIDWEEMKDLQLSFFKAGVSHTDTPQDHAFFA
                     TMYKFASKHKIKHILTGGNYSTECIRNPLEWMYFQSDSRQIKDIQKKFGTKKLKNFPL
                     TNILWHKIYLPYIKGIKLYRPLDFMPYDKEEATQFLVDNYGYQRYAQKHFESRFTRFY
                     EAYWLYVKFGYDTRKVQYSSLIVTGQMTREDALEKLKNPPYDPETIDDDFSYIANKLG
                     ITVDELKGYLKAPNKTYKDYKNQQAIYDLGAKVMRKLGLEKGGKR"
     CDS             468669..469292
                     /codon_start=1
                     /gene="hisH2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P72138"
                     /locus_tag="PA25_04120"
                     /product="imidazole glycerol phosphate synthase subunit
                     HisH 2"
                     /protein_id="BBN80427.1"
                     /transl_table=11
                     /translation="MIAIIDYGSGNIQAIQNIFTKLKVDSFFASTPEALQAADKIILP
                     GVGAFDEAMTQLQESGMREALDHFALIDKKPVLGICVGLQIMATGSDEGKLSGLGWFD
                     ASVKKFDESKINFKPKLPHMGWNEIEPTEAHPLLSNIDCEKGFYFIHSYYFEAHDEKD
                     VFIKAHYGDDFCCAVSKDNIFGLQFHPEKSHTNGINLFKNFAELKLC"
     CDS             469286..470071
                     /codon_start=1
                     /gene="hisF2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P72139"
                     /locus_tag="PA25_04130"
                     /product="putative imidazole glycerol phosphate synthase
                     subunit hisF2"
                     /protein_id="BBN80428.1"
                     /transl_table=11
                     /translation="MLRSRVSPCLLVHKKGLVKTVKFKDAKYVGDPINAVKIFNEKEV
                     DELIVLDIDATVENKSPDYQMIKHLANESRMPLCYGGGIKTPQQAQEIIKLGVEKVAI
                     SSQALSNPSVLKEMAEIIGKQSVVVVLDVKKTLFGSYEIYTHNGKNKVKKKLEQVISE
                     LEEFGVGELVINSIDQDGMMKGYDMKLAEKVRELTSVPLTILGGAGSAEDILKLIDKF
                     KVIGASAGSLFVFKGVYKAVLINYMNQDALAKIRKIARSQLGK"
     CDS             470073..472211
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012546064.1"
                     /locus_tag="PA25_04140"
                     /product="oxidoreductase"
                     /protein_id="BBN80429.1"
                     /transl_table=11
                     /translation="MKQILQDMAKGGSSIVKAPAPTITKNHVLINTTTTLISIGTERM
                     LVDFGKANLIDKARSQPDKVKMVLEKVQTDGLMTTVDAVKSKLAQPLPLGYCNVGVVE
                     QIGNGVNAVRVGERVVSNGPHADVVRVSKNLVAKVPDNVSDEEAAFTVVASIGLQGIR
                     LANPTMGECFVVTGVGLIGLLTVQMLRAQGCRVLAIDYDQEKLKLARQFGAEICNPGA
                     GEDPVAAGISFSRGEGVDGVIITASTKSNDPVTQAARMSRKRGRIILVGVTGLELSRA
                     DFYEKELTFQVSCSYGPGRYDPSYEEQGNDYPFAFVRWTEQRNFEAILDMMAGGQLDV
                     KPLITHRFKFENASEAYELLTSDKSALGILLQFESEPQSRHVKTVPLNPTVNYEKDEP
                     VIGFIGAGNYASRVLIPAFKQAGAKLHSVATSGGINGVIHGEKSGFVEATTDTQAMIK
                     NDDINTVAIVTQHNSHAAFVKAALEAGKNVFVEKPLAINHEELNEVKVAYKEACKNAL
                     EPKLMVGFNRRFSPQIQKMKQLLEPIKEPKSFIMTMNAGAISAVHWTQDINIGGGRII
                     GEACHFVDLMRYLAGSEIVSVQARRMGDTDSVEVTEDKAAIILGFADGSFGTINYFAN
                     GAASFPKERVEVFTNGKVLQLDNFIKLKAYGFKGFKKMNLWKQDKGQNLCSKLFLDSI
                     RDGNPAPIAIDEIFEVAKVSIDIAEQLRSQ"
     CDS             472208..473851
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000039947.1"
                     /locus_tag="PA25_04150"
                     /product="hypothetical protein"
                     /protein_id="BBN80430.1"
                     /transl_table=11
                     /translation="MKKLIKKALKVFHTVKYLKFKQFYYRLLYKITTPTVYKAEPTSC
                     KCWVWCGPEVNPQSITSETTVKFLNQTGSIVTLEDWNCPSKTKLWLYNLHYFDDLSSF
                     DSFKRYDLQRGWIERWIADNPPCLGNGWEPYPISLRLVNWVKWCSKQKHVSPAYTKSM
                     LEQADALSKQLEYHILGNHLFANAKALTFVGAYLNGEQAERYLNKGIDILDKEISEQF
                     LDDGAHFELSPMYHEILLWDLLELIDLAHTSDNDLLKKYSHGWRAVAVKALTWLQVMI
                     HPDGEISFFNDAAIGIAKQPKDIFSYAKKLGILCEMDSKRLITNPTSGYSRVTFDEYT
                     LIFDHANVGPDYLPGHAHADTLSFELSIGEQRVFVNSGTSLYGISEERLRQRETAAHN
                     TVTVEGCSSSQVWSGFRVAKRAYAKLNQTSYSDGRTLLVASHDGYLKQSPKLIHTRKL
                     ECSGKSIKVHDDLSHAKAACLHLNIHPELDIVQTSARACEIFKQGTRLCVLESDSALQ
                     LKDSTWHPEFGKSVPNKKIEINFNSGSIRTEIRIIKGLE"
     CDS             473848..475011
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012048108.1"
                     /locus_tag="PA25_04160"
                     /product="glycosyltransferase WbuB"
                     /protein_id="BBN80431.1"
                     /transl_table=11
                     /translation="MKILFLSFYYQPDLCAGSFRASALVEQLRQQEEVEIDVITTMPN
                     RYASFNAGAKSEEVLDNVRVRRVELPSHKSGMLDQIKSFYAFYNQVNKAVKNEQYDLV
                     FATSSRLFTAFLGARIAKRKKLPLYLDIRDIFVDTIKDVLNPKLALLMKPILNMVESY
                     TFSNAQSINLVSKGFEEYFYLRYKKPKYTFFTNGIDKEFLSFEKQNVSSESTYGIKTV
                     LYAGNIGEGQGLNTIIPELAKICKQRYHFKIIGDGGRKDLLLSSCESIDNISFHPPVN
                     REQLLKEYTRADILFLHLNDYPAFEKVLPSKVFEYAATGKPVLAGVSGYAAEFIKEEV
                     SNAAVFYPGDAKAGHSALSSLNSEYSDRKGFIAKYTRSNIMKKMSLSILSCRS"
     CDS             475014..475943
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073060.1"
                     /locus_tag="PA25_04170"
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="BBN80432.1"
                     /transl_table=11
                     /translation="MNTLLITGYSGFVGSLLAKELQSNNALKLLGRKKSNLGKVYKHN
                     IDGSGDYSSTLNNVDCVIHCAARVHVMKDSSVDPLAEFRAVNTAGTVNLAKQAAKASV
                     KRFIFVSTIKVNGESTSGKPAFTPFDTPAPEDFYGVSKSEAEQLLLELGKQTGMEIVI
                     IRPPLVYGEGVKANFASLMKLVGKGLPLPFRLINTNKRSLVSVYNLVDLIKVCIEHPK
                     AVNQVFLVSDDNDLSTAEMVRLMARVQGKSNFSLPLPLWCFKLAGSLLGKLDVVDRLT
                     GSLQLDITHTKNTLDWSPPYPVELGFKLAAKNL"
     CDS             475944..476510
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261052.1"
                     /locus_tag="PA25_04180"
                     /product="undecaprenyl-phosphate
                     beta-N-acetyl-D-fucosaminephosphotransferase"
                     /protein_id="BBN80433.1"
                     /transl_table=11
                     /translation="MEYLMIRLLDFLFALFGLLFAFPFLVILYIIGLFDTGSPIFTQE
                     RVGRNKKPFTLVKFRTMKVDTASVASHLASSSSITPFGHFLRKTKLDELPQLWNVLKG
                     EMSLVGPRPGLYNQEELTYAREVKGIYSVRPGITGLAQVSEIDMSTPELLATTDRQMI
                     DTLTVANYFKYIVMTVTGSGSGDRVGKH"
     CDS             476645..478624
                     /codon_start=1
                     /gene="wbfY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073058.1"
                     /locus_tag="PA25_04190"
                     /product="nucleoside-diphosphate sugar epimerase"
                     /protein_id="BBN80434.1"
                     /transl_table=11
                     /translation="MDSWFRVLLSASRSQKRLITLVLDSIFIISAFWLALIVRLDSLA
                     PLMIAKNWLLLVILLPASLFIFVRLGLYRAVLRYVGASAVGAVVLGTVISTVVLVLSA
                     FFTQTVIPRTMPVIYGWLMILSLGGSRILVRALIWRLSAVTKTPVVIYGAGDAGRQLA
                     TALATGPDYYVTAYLDDDDNKHGAIIQGIPVIPFAEIYNLIDKKRVKKVLLALPSATR
                     SRRKEILTKLEKLPLEVMTVPGMADVIDGKAQLSEIKEVEIEDLLGRDPVAPRTELLA
                     ANITNKVVMVTGAGGSIGSELCRQIIKNRPLKLVLFEVSEFGLYNIEKELNQLALSKN
                     IALEIVPVMGSVQRINRIETCMKAFGVQTVYHAAAYKHVPLVEQNVVEGVRNNVFGTY
                     HTAKAAINAGVETFVLISTDKAVRPTNVMGATKRMAELALQALSESKVTSKNTRFCMV
                     RFGNVLGSSGSVVPLFRKQIREGGPITLTHNDITRFFMTIPEAAQLVIQAGAMGKGGD
                     VFVLDMGESVKIKDLATKMVHLSGLEVKSESNPHGDIEIKCTGLRPGEKLYEELLIGD
                     NVEDTPHPRIMTANEVKLPLGELDKLIEKLDAACHKFDHEAIRKLLLEAPTGFNPTDG
                     ICDLVWNEKRVALEREAKQVVKAADDVKVVNLRKA"
     CDS             478940..481051
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04200"
                     /product="hypothetical protein"
                     /protein_id="BBN80435.1"
                     /transl_table=11
                     /translation="MSKINIVLAGGVVLASMPALADSPAKSFSSFAGYTGLFNTPNAE
                     VLEKGSVDFGYNNQLDLRGTKYIDGHNFIFSAGIYDGLEVSGQIASSTIHDSMFENKG
                     QTRDLSFNLKYQIPYIPKNWFNLAIGGKDLGGAANNYETYYLAGSKEWNDFRFSAGIA
                     VSDRATGQMDGAFAGIEWQPLDWFALQLEHDADAVNAGIRLTVPREWIYDVGTLTFSG
                     KLYSNTDYADKNTYWGLNFSMPLFEQAVLNDPTEAAPAPILDNHKNREAAFKAHYQKQ
                     RELAQKPLEEAKQEVAQRDKFSKSLTLQTRELKNALIDDGFEAVSVGFNREPHIVLSF
                     ENFVFNRNDIDAIGLVLGRIAEHIDEPDAKYSIQLLNRGMPMLFVRGSVDNYRDFINS
                     SITPDMDIRRGEMEPLGSVSWVGMPNANSPYFTPRLTIGPALNQRTATELGVYDYSLA
                     VKADLDLPMWYGGGLSVSAQSELAKTSDYEQGRPFGRLAEKDGITQATLYQTLALPYG
                     IYNQTHIGFFREFNQDFTGIKNETVWLSGNGRHQFKADIGYLEYQDYNTERDYQALSY
                     RYNWIEKDVSFHATAGRFFYDDSGVKVETRFWFGDSYISVFAQDTDVQVAGVSFSIPL
                     TPRKDMPATSYGQIKGNEAWQHSVSTRIGESHNNVTIGRAKQIETPLSITKTLLNQGR
                     LSSSYIYANLARLREAYLTYR"
     CDS             481454..483061
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04210"
                     /product="hypothetical protein"
                     /protein_id="BBN80436.1"
                     /transl_table=11
                     /translation="MLANKKSLLAMSVAASLTLTGCFSDNDNNVKVDPPTPPTPTPTE
                     TVVPDTLVTEQPSKVFSVNVVNAANSDVLSGATVSFVVNGEPANVLTDVNGEDLSSVT
                     VDETGNFTFLNKEGETGSVTALVASEGYISKSFTVDLSAEVEGDANDIPLEFGLVSAA
                     ATEGVEVAEEKAAVTGGTTAEAVTAAASGEGANAELTVPANTEFQNAAGEAISGSEVT
                     MSVIAADSSNANTGAIIPAGLNDGSTTQVKKPVGVTSITMTDDTGAKIKKFSSPINVS
                     VAIPSGNDIKVGDQLDISSYDEDTGVWSEETNKATVVSNGGALSAQFATDHLTFFSMN
                     KSVPICTDGVTVRVVGGTLPARGLAVSMTSPDGSISSYLRSNSKQVISGASTARFGIS
                     SEAVAKVRLYDRAGNTWYEQENQGICGNVDVTLTNSVQTIEKEVTLSGVCAADETKTA
                     DLSGSIVTYAKDGKAASLAQALGNSTFKLSGIEVGGNYTVRATIRGAKVQGGGQSQVF
                     TFGNVQSADTLTGSVQLECNQVPVTGG"
     CDS             complement(483169..483846)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04220"
                     /product="hypothetical protein"
                     /protein_id="BBN80437.1"
                     /transl_table=11
                     /translation="MKSHLGRRAFSAMELHTLFNGYIYGDEKQPREQPKHWHFWLPLL
                     AYYAGAYSDEIGNLTLADVVTIDSIHGFNFTTHGKIQHRFVPIHTALWQAGLEQYIQF
                     VKRENQDRLLFDLPSKSGRYSEKVRIWFSGEGERLGYLQKCGLPNVDQQGHKTAISSL
                     RLNFEQQVRIAAIQRANKPAFHYLMGLKDEALIQPPKPNLLKQIVAPIRVINSNVHWQ
                     RFVSRHS"
     CDS             484464..484649
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04230"
                     /product="hypothetical protein"
                     /protein_id="BBN80438.1"
                     /transl_table=11
                     /translation="MSIMKRLKALRGRFFGTVGRLLGHPLVVQVFVSVLGRLLLWLAK
                     LSIIGLLSYVGITIPTF"
     CDS             484692..484988
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04240"
                     /product="hypothetical protein"
                     /protein_id="BBN80439.1"
                     /transl_table=11
                     /translation="MNYDCKLLVKFREYLQLSASCVAQELGISVDYLNDIESGRQPAP
                     KALIDFYAKSLRVRSSHLLAILSSEKRTASTRPVNKVLNKYFGLIQKMKENEEK"
     CDS             484975..485934
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011202243.1"
                     /locus_tag="PA25_04250"
                     /product="RNA-directed DNA polymerase"
                     /protein_id="BBN80440.1"
                     /transl_table=11
                     /translation="MKKNKSYKIHQSPLYKLRSHKKLASCLGLEKEQTLRRLIKQGDK
                     NYYVSKLPDGRVIEVPKPQLNRVHRRINKLLTRIEVPEYLNSGVKGRSNVKNAREHTG
                     ELSVLKLDIRKFYPSVTEQQIARCFVKSFGCTKDVAETLSKLCVVDGHLPTGSSISQS
                     LSFTVNRPVFDHLNTYAKARKIKFTCYVDDLTFSGQAIPKEFCKYVTAYLKRSRGFRC
                     HKIRVYKAITPKSITGAIVVGNVLKVKNYHRKRIQRLLHLYNFMVKRYQPDDEKLINY
                     FQRLQGHLYSAAQVNPRYRQMGDIIVQRRCNLGVPALNQNTKK"
     CDS             complement(486064..486678)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011262505.1"
                     /locus_tag="PA25_04260"
                     /product="Cro/Cl family transcriptional regulator"
                     /protein_id="BBN80441.1"
                     /transl_table=11
                     /translation="MDIANRVRERRKSLGLTQYQLAEMTNSAQASIQKIEKGTTKNPR
                     NIEAIAKALQCTPEYLRFGVGDFDNASIGPELKSKLPLISWVQAGAWADIQEISRIEA
                     EHFLCPINCSEKAFVLRVQGVSMEPKFQDGDLIFVDPEAACVHGSYVVARLDDDNQAT
                     FKQLIIEGGQKYLKALNPNWPDQLIPINGNCTLVGRVVFTGKSL"
     CDS             486858..487055
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04270"
                     /product="hypothetical protein"
                     /protein_id="BBN80442.1"
                     /transl_table=11
                     /translation="MSFIKKAVEIVGGQTEIARLLETKQAVVWHWVNRHGQAPAKYIN
                     KISQLTNGQVTVSELLSDHEK"
     CDS             487066..487320
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04280"
                     /product="hypothetical protein"
                     /protein_id="BBN80443.1"
                     /transl_table=11
                     /translation="MNMTFALLARFNNPVIPLRDVCKEFFGVNPKTAEQHAKAGKLPI
                     PTFKMRDSERAPTLVNVSDLADYIQTQYDSARAEWERVQS"
     CDS             487317..487562
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04290"
                     /product="hypothetical protein"
                     /protein_id="BBN80444.1"
                     /transl_table=11
                     /translation="MSHTVVEVEKLITDPSHWEVQVMKVRQLREQIRAHRVQREVEAK
                     RQEQENRAQRNGQRSNLLLKSALAMAARNRINQQVVL"
     CDS             487559..489520
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013097404.1"
                     /locus_tag="PA25_04300"
                     /product="replication protein A"
                     /protein_id="BBN80445.1"
                     /transl_table=11
                     /translation="MSNMPESRSLPICWELVGSNTEDPKMQPITITRAAPYCWGKFGF
                     DKTAEQVKERLAQIPTNRLRRIAAREYAKRFNSESAKTPERSANIYLRKTIERVNDIV
                     ERSPLTIRELNSKKARKDKAKQLATICQQMGIVDFDHSMTEEDLEQLVFACYIAMHDF
                     TLSQGIKPPYQATFNAAKSKLTEDGWQRCNTHLLADRLERGIRRMECDKWWLRKLERL
                     RDTTLEHLNITMGQVRKGISPYASKDAVQEFRHSKKSQAEWVESMQLESEDGDTIDLA
                     KVFEGSISNPEIRRIEMIVRVRGYKEWAEEKGMSCMFYTITAPSKYHANSAKYNNASP
                     RETQEYLVKQWAKVRAELSKAKIKIFGLRIVEPHADATPHWHMVLFMNPSDEPIVTKT
                     MRRYAMQHDGDEEGAAKNRFDATPEDKSKGDAVSYIIKYISKNINGAHMNDMYDDETG
                     QPIEPENGIVMNVAAWASRWRIRQFQFIGGAPVGLWREFRRVPKDSVEKLSEIAKEIF
                     EAADNSRFAEFIELLGGALGERECPVELAKELNGTNDYGEDKTRVVGIVSGGVTYVTR
                     ATQWLLKKRDSDSPWSTGNNCNTQAHDWQVGHGDKLNPIVLIPPEHREAVMRGATYQE
                     TDEINQTVTHYWVSGGQLMQESMSYAAHS"
     CDS             489504..489683
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04310"
                     /product="hypothetical protein"
                     /protein_id="BBN80446.1"
                     /transl_table=11
                     /translation="MQHIVRSIKDKIEQAKKLPAFKAGKKTEIAENALDETVSLLSEM
                     VSRIEILEAQYGEIE"
     CDS             489980..490510
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04320"
                     /product="hypothetical protein"
                     /protein_id="BBN80447.1"
                     /transl_table=11
                     /translation="MQEQANPLPNEMQKTPIATAMEDLTYGAGSPSGQSALQHSPQVE
                     EYSHLDKFTADASDEPEVGEVAESEEMTDKDISALAGFGVSSLADFIESTIEAPVTID
                     NDTREVITQKATPVVRKYCKGGMPPWLARWKEEIELGLVLGTAAISLFKQVKAYEKAN
                     ADNESNSEKQEVVSAH"
     CDS             490500..491288
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011105875.1"
                     /locus_tag="PA25_04330"
                     /product="hypothetical protein"
                     /protein_id="BBN80448.1"
                     /transl_table=11
                     /translation="MPINPNNALKAKHVCYLAGTGGGKTTAVKLFDLVGEQCAIFDLY
                     GDYKYDGRKRGHFNGLGGRAVYHFKTRKQFALAFVEAWRSGKKFVVAYSPEFPKSLKG
                     EQLKKAKQSELYWFGQLMWEAADGNRELHIVIEELAKLSDTVGKDDSIIGELATGGRK
                     FGVVLHTVFQRSQEVPKTIWNNSPRKVLGAQEAQADAKRVAVELDAELRDIYQLSKLN
                     AHYEDERLYYLMKYKGGIGNIEPKVIDLRTGKAKNLTFEQLRAA"
     CDS             491530..492339
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04340"
                     /product="hypothetical protein"
                     /protein_id="BBN80449.1"
                     /transl_table=11
                     /translation="MLEVSPLNNLTGVAAGGSVSLTLPVGRTYEKIHFEYSGVTPAQI
                     KNLRVELQGRTLTEYGTLQDLLDENAYFKREQAAGYATLHFARPEIQGVLNPSLVEQR
                     FFSLGTMGLSIAQIKFDIAQDAAAPVIKAFAEKSSPSAPGWLFKRRTFRYNFAVGINE
                     IENLPRPLGAKIALIEIKKAGVDSAEFLVNNVKWRDHIPAPLHKHHLKQRGRSPRANT
                     HAIDLFLSGDVFSALALDNSINDMRLRVEASEAGSAEVVVHYFDDYAKSTF"
     CDS             492352..492678
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04350"
                     /product="hypothetical protein"
                     /protein_id="BBN80450.1"
                     /transl_table=11
                     /translation="MQPEGAPTMAATNTGGGFWDGANSFLGNALKIWGDYEKVKAVKS
                     SNGVTQKEHMNTAELDNGAAVLVDAPKTQTAQPKEPMVFGLPQKTLLYGFGGLLAVAL
                     VMKAIK"
     CDS             492788..493000
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04360"
                     /product="hypothetical protein"
                     /protein_id="BBN80451.1"
                     /transl_table=11
                     /translation="MFGAMLGATGAMPSLTNGAGSPISSGATSGTGDQTQSIGFTGGN
                     INFGGDNNQLLIIGAVAFAALYLLKK"
     CDS             493009..493362
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04370"
                     /product="hypothetical protein"
                     /protein_id="BBN80452.1"
                     /transl_table=11
                     /translation="MRIVHISEIDHIQSAAANDFEVIKAEVVQGLAVLVEFDSCYCVL
                     RHDRDGLCVVCAQGKNLLSIAPYIVALARYIKAPSIVYHTKRKALKRLLSTYSFVYEA
                     TDEDGYAIYRMALNG"
     CDS             493355..494326
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04380"
                     /product="hypothetical protein"
                     /protein_id="BBN80453.1"
                     /transl_table=11
                     /translation="MGSKSRSRSSQTTNNTSTSIGVHGDNNGYITNGDGNTYNITQTD
                     HGLVGAIQSIGGNMADASIAGFDTASDMTRDGFGFASNINRDSLDFAGDTLEDSFSFG
                     EEVITQAGGAMTDAMVFGERALAQMGDTSRDAVVLSENAMGITSDIATDSIDAQNALT
                     RDAINENSDLAREVMAISAGINSDVVGFASDTLGTTVNALGEANAHISDVASDSMHNS
                     AQLASMTIDTVDNTNARMTDVAVYSMDNASNLAKDLGAQFIEATSESQQKFSDQTILA
                     HRQALQFADHASRSDGQQLAISTNKTMMYVFLGLGSMGAAALLFRGR"
     CDS             494326..495843
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04390"
                     /product="hypothetical protein"
                     /protein_id="BBN80454.1"
                     /transl_table=11
                     /translation="MLLRKQLEANYITEINAVGQFIKLVNCENKVKLRATRSGNTVIE
                     TEIRAGFELQTAERFDLLVLNSDVEQSIDIWVSKHSLKYDAPAGGSNRALSYSAEHYG
                     GTQKILPFEASRMAVTLFSDTHDFWYGGEGCTPETGIPVRAGVEKKINSSSEVFVSID
                     EPPLYISGSTYNTINELDGGAGRYDGGYGEELPEYTATAVTANALYIPERHISQYRNY
                     GTIRISETGAKLLNVTGDIRDIVVMDYDKDKVAMLYDNGIIMVYESGNKVAEYNTLYA
                     KSPLNWKKLIYDGERFYAYHWGEEAMNWYTPSDTSAPVFWLALDRNLFIRKTFYDKDT
                     NRVLAICNKDGHQFIYDITGASGLCESFPHALGQDINGSLGSIITFPDMRFSSTHITA
                     YAGGKGLVFNRQSGAITELINIQFVSAQSRGVIYVIKDGKQLISEDDGLTFSPIPNDT
                     TDFGGGVVFGTFSGSKFVTYPLTKNVDGTYKARIYDTVVSQASAISKLRVFKEMK"
     CDS             495894..496298
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04400"
                     /product="hypothetical protein"
                     /protein_id="BBN80455.1"
                     /transl_table=11
                     /translation="MATKQTTRGIRNKNPLNIEAGENWLGLVGTDGRFAIFESAEHGI
                     RAAARILRTYAAKYGIADIAGIISRWAPPTENDTANYIEFVSKRVGVDSKKPLSPNEY
                     SKVIEAMIVMENGEQPYTAEQIQRGFEWGFYG"
     CDS             496291..496671
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04410"
                     /product="hypothetical protein"
                     /protein_id="BBN80456.1"
                     /transl_table=11
                     /translation="MGNFISKNLSLLLTIGGLYYVYKYIDSGSKSFTEPLGNLLAKLQ
                     FKVNGSHDIKREWAGFFLDRSKLDFSYKVKDELWLEAILKLNQHNQELVDTIFDADMR
                     LRPEYQVLLDGEVSPQTIATVQAR"
     CDS             496674..496835
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04420"
                     /product="hypothetical protein"
                     /protein_id="BBN80457.1"
                     /transl_table=11
                     /translation="MSDSAILGILIQAGVGIATIATIKTDVKWMKDTFKEELKSIKER
                     LTKLEDKRC"
     CDS             496829..496966
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04430"
                     /product="hypothetical protein"
                     /protein_id="BBN80458.1"
                     /transl_table=11
                     /translation="MLGIFSKYVLTRICIYTAERLAKRSDNKLDDQIVDVVKQALGVK
                     I"
     CDS             complement(497122..497973)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04440"
                     /product="hypothetical protein"
                     /protein_id="BBN80459.1"
                     /transl_table=11
                     /translation="MSISSIITKTPLRAALTLFVATALIVFLITAFWPQVSSFIFPNT
                     TLGLYDKSFWENVLVEAHGLVFDIFVLGLIFVWMDTYRQKRESIDRDLENLCDFNTLT
                     DNIYLKKKVNIIKRLNKNKIYKIDVTDLIINKKTRIKDISFEHSNLFGLKIMDCQVFN
                     LKIKNSKLNSADFSKSVIRNSEITGSYLKNVSFKSATLVGLNFMNSDLVRAKFDSANL
                     QSADLRGCNLERTTFTNANLKNANLKECSNLNYNALLGAKCIDYLKADKSIIEELKKR
                     KPEMKIS"
     CDS             complement(498224..499291)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003693486.1"
                     /locus_tag="PA25_04450"
                     /product="integrase"
                     /protein_id="BBN80460.1"
                     /transl_table=11
                     /translation="MAGFRIEKRKLSSGELRYKCIVREKSQGKIIHNESKTFSTKALA
                     DTWGKKRVYELESQRVTEKKNIVTLGTLLNMYFENHDLWSRTGRTKQYVIKMLMDCDI
                     AKIRSNELKVSDLIEHCTNRRDAGASPATIYHDIAYLRSVMKEANPVWNVDANYQIFE
                     DAVPILIKMGLVGKSQKRTRRPTSEELKRLRQGLQKRMAFRPNSTKRIPYLDILDFSL
                     LTCMRIGEVCKITWDDLNTEHKTVMVRDRKDPRKKAGNHMIVPLLGGSFDIALRQPKI
                     DERIFPHNPRSVTAGFQRVRNELGIEDLRYHDLRREGASRLFEKGYTIEEVAQVTGHR
                     NLNILWQVYTQLFPHKLHEKK"
     CDS             499402..500412
                     /codon_start=1
                     /gene="dusA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q5E844"
                     /locus_tag="PA25_04460"
                     /product="tRNA-dihydrouridine(20/20a) synthase"
                     /protein_id="BBN80461.1"
                     /transl_table=11
                     /translation="MQNPVKSSGNPVNTSDSAFRRFSVAPMLDWTDKHCRTFHRKLTK
                     HAVLYTEMITTGAILFGKGDYLSFGEHEMPVALQLGGSDPKALAECAKRAGEHGYSEI
                     NLNVGCPSDRVQNGRFGACLMAEPQLVAECVGAMKAQVDIPVTVKTRIGIDEQDSYEF
                     LTALIEASAKVGCDDFIIHARKAWLQGLSPKENREVPPLDYPRVYQLKKDYPELHISI
                     NGGVKTLDDSLHHLAHIDGVMVGREAYSNPFMLSQVDELIYGDEAFLQTRHQVVRSMY
                     DYFEQQMSSGANFWHIARHMLGIFQGQPGARGFRRHLSENGHKKGADISVMEKALSFV
                     PE"
     CDS             500636..501325
                     /codon_start=1
                     /gene="pspA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071928.1"
                     /locus_tag="PA25_04470"
                     /product="phage shock protein PspA"
                     /protein_id="BBN80462.1"
                     /transl_table=11
                     /translation="MALINRIEDLIKSEVNAFLDKAEDPQKLAAQLLIDLNDALSECR
                     STAAAIICEQKALERRQANQQKQIDMWQQKAEHALSKNREDLAKAALKEKQQLVDAGL
                     ALEQQKQSLDETLTKLKGDADTLASKIHTLKAKQQQFERAHRTVNAQLKSRSVLHSQE
                     VENVLARFGHLEHKVERIEAQVESYELGQSSTAQQFEQFERDEKIEAELASLKQQMQQ
                     KSAQVSAQVSA"
     CDS             501335..501538
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04480"
                     /product="hypothetical protein"
                     /protein_id="BBN80463.1"
                     /transl_table=11
                     /translation="MSIYREKKAYFRDLRNKKLAGVCAGIGQRFDIPIWLTRVLTVLL
                     FLKFPLMVAMAYGVSYAVLPSKS"
     CDS             501553..501876
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04490"
                     /product="hypothetical protein"
                     /protein_id="BBN80464.1"
                     /transl_table=11
                     /translation="MKTAFLVLIALLICSTLSWLNSPLAWLSVPDFVMELSWVGMELF
                     TVLVGAIAFIAIIALLGMGLIGAILVVLIGLVLALLFNSIVIVFPLLLLVGVGWLVME
                     PKSAC"
     CDS             501962..502471
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04500"
                     /product="hypothetical protein"
                     /protein_id="BBN80465.1"
                     /transl_table=11
                     /translation="MFSKYLGIFVVTTLILFPSFVFSEHAQVQNKQLSLDVSNANIRQ
                     FLPAAKSTAAYFFLANHSNSERVLKSASISKIGRVEMHEHVHHNGMMRMQQVSEVIIS
                     AHDNVAFKPGGYHLMAFEPTQVLKKGEQLTLTLYFANGEQLQSPIKVISLQDEIKQNG
                     HDHSQHNHH"
     CDS             502480..503466
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073652.1"
                     /locus_tag="PA25_04510"
                     /product="hypothetical protein"
                     /protein_id="BBN80466.1"
                     /transl_table=11
                     /translation="MQQHIGKFFGALGAFIFLGYLLAVYWSVEPDEFDVVARATEQAQ
                     RNNEKVVTGYVTTNTLISVSETLLNKPGGYLSNDMLPPSVLMDNMPAWEYGALEMVRD
                     LALSMRKDFSRSQSQSTEHPELKMAQPQFNISSTAWAWPSAEGEYQRGIDYLKEYRAK
                     IASPAERDSQFYARADNLRGWLKEAEKRLGSLSQRLSASVGQDRMNTDLAGDSAANQA
                     TYAPSHSEIKTSWWKIDDVFYESRGASWALLHFLKAIEHDFADVLAKKNAAVSLQQII
                     RELEATQESVWSPMILNGSGFGLVANHSLVMANYISRANAALIELSELLAQG"
     CDS             503470..504231
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014208017.1"
                     /locus_tag="PA25_04520"
                     /product="membrane protein"
                     /protein_id="BBN80467.1"
                     /transl_table=11
                     /translation="MKKYCIAAALSMACLAPVAQADTLLGLYLGAEGWQADNSGNFAE
                     KGNAQSFNFDDETFSSYYAALEHPIPLVPNIKLRYTELELRGATTLSETFEFDGKNFT
                     VGTAANTVTDLNHVDYTLYYEVFDNDLVSFDFGLNLKQFDGSIRLDGTVEGVQTTEVR
                     DFSGLVPLGYLRAQVGLPMTGFSVFAEGSMLAIDDSKIQDYQVGVAWEIIGSMAMDVS
                     VRAGYRSVVLELDDVDDISTDIDASGPFAGVEIHF"
     CDS             complement(504288..505166)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261128.1"
                     /locus_tag="PA25_04530"
                     /product="TIGR03899 family protein"
                     /protein_id="BBN80468.1"
                     /transl_table=11
                     /translation="MSVKNAQAKASLATLIEEKLGFTMVKSRDFGTRSGSDNSYSAKG
                     TMPIQYSVRSDDSILKRALKRQQLNKIQRQHNIEQITAFALSVCPDVTSQGRPDPDWL
                     EHFINLAEDIANQNMQKLWAKILVGETVSPGTFSVKSLQTLKQMTQREASALQKCAAL
                     CGYLEKEDSYLILLGYYKKPSFFDLLRKGNKESINLGVAGLSFPNILTLMDINLIYRK
                     EIESASLKQGQPIQFSFHSKKLTLTPKHNELVLSYYKLTQTGDELKKLVSSPINKKYK
                     QQLEHALSDEFECHWS"
     CDS             complement(505163..505657)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04540"
                     /product="hypothetical protein"
                     /protein_id="BBN80469.1"
                     /transl_table=11
                     /translation="MAALLFVVTGLLLPHKYQLKQQMTFSTTDKTQLSSLLDLRRWSE
                     LMAWQRISKSQQLYFSSPSQGIGAHASIEHQLATVELTITKQTPQGIHFSVLFNNEHS
                     AQGQVRFVQQDQSTTVIWQISGTINSTLLGGYAALYLEYNLRQLIISAFNNLQTELKL
                     RAAI"
     CDS             505884..508088
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011388417.1"
                     /locus_tag="PA25_04550"
                     /product="diguanylate cyclase"
                     /protein_id="BBN80470.1"
                     /transl_table=11
                     /translation="MASEQDDFLFLDHDEDTQEVEVASAAWDILIVDDDPEIHSVTTL
                     ALSGVEFWGRSLFFHHAYSGAEAIEKLIHNPEISVMLLDVVMETDDAGLTVVKRVREE
                     LKNNNVRIILRTGQPGHAPEEQVIRDYDINDYKMKTELTRSKLVTSMMTAVRSYSQIC
                     ELEAQSLALSSILEACKGILGHSDIRSFSLAVVTHLARILGSEPNGIVSGQLGNDKRV
                     TVLGGTTQFQDSFGEGLEQLDNGRVIMQVQNCFDSGEHQRTEHDITVLLKGKNRSAAI
                     YLELDVQPSESQLQSMEVFLANVSVGLDNIKLFNELRDVAYKDPLTKLPNRACFTEQI
                     AKYYKSTNSDLLLILIDIAQFSDINNGLGQEVGNQLLIAVMTRLKQEFPQTEFLARIG
                     ADVFAMLLPAHAFDERLFMDSLLTPYQVNEHVLSIHFRVGVCEQGDFASSGLDTLKLA
                     YIALNQAKQENRAIGRYTPDLEEKMAWKLGLIRQLRQDFEHRKLEVWYQPQLCFKTLE
                     VVGCEALLRWPSGNGRYISPGIFVPLAENAGLIVDIGQWVLEQACEQQKKLAQMGKEI
                     SIAVNVSVPQFKVPNYAQSIKNTLLEYKVEPKYIELEVTESVVMDEVGAVIETLRELE
                     EFGIEVAIDDFGTGFSSLSYLQTLPFSRLKIDRAFIKDIPQNDSGAIAELVISLARHL
                     GRKTIAEGVETQEQSDFLRKMGCDEVQGFMYAKPMPSDELMNFLRTYKPKST"
     CDS             508184..510364
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EJZ5"
                     /locus_tag="PA25_04560"
                     /product="UPF0313 protein"
                     /protein_id="BBN80471.1"
                     /transl_table=11
                     /translation="MSTLKAERPLFSYPKYWAECYGTAPFLPTTRKEMDALGWDSCDI
                     VLVTGDAYVDHPSFGMAVIGRVLEAQGFRVGIIAQPQWSNKDAFMSLGKPNLFFGVTA
                     GNMDSMINRYTAEKRMRHDDAYTPGNIGGKRPDRAVVVYSQRCREAYKDVPLVIGGIE
                     ASLRRIAHYDYWQEKVRRSIIFDAKADILIYGNAERPLVEVAHRIAKGDSIDDIQDVR
                     GTAVIRKTPLPQWRGSDSTAIDKVGKIDPIPNPYGADDVGCSKSEFAKAGIDLSADAA
                     KPIMVQPPRLKPWEKVYVKLPAFEQVSVNKPLYAHASRILHQETNPGCARALFQRHGD
                     RYVWVNPPAFPLETEEMDAVFGLPYQRVPHPSYADAKIPAYEMIKTSVNIMRGCFGGC
                     SFCSITEHEGRIIQSRSEESILEEIEQIRDKVPGFTGVISDLGGPTANMYKLRCKSKK
                     AESTCRRLSCVYPDICKHMDTDHTPTIELYRKARDVEGIKKILIASGVRYDLAIEDPR
                     YVKELVTHHVGGYLKIAPEHTEQGPLSKMMKPGMGTYDKFKALFDKYSKEAGKKQYLI
                     PYFISAHPGTTDEDMVNMALWLKANDFKLDQVQNFYPSPMANATTIYHTEMNSLRNIK
                     NNKEHVSVPKGARQRRLHKAILRYHDPSGWPMIREALRSMGKANLIGKGPNCLVPEEG
                     RAEKGQRPNRAKSGRAALTRHTGFSQFKKANTKPKVSSNRQRAK"
     CDS             complement(510421..511482)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04570"
                     /product="hypothetical protein"
                     /protein_id="BBN80472.1"
                     /transl_table=11
                     /translation="MALLGAGLALPMPIMAKEHCNKKSGSELEKCNKAFAKMIFASPY
                     DTKQWRSCPHMHQQLKKNIEQFSDEKIYFDIFHKGALGVGTELTALVARGSIHGALIS
                     VSNLTPILSALDILNIPFWCSERHNYLKLLSSKIWQEQIIDKIHQQGKLQILMHYLPG
                     TRTATSTKHYGKTIKTPNDMHDVVFRIPASKVLQQFYDLCGTSAVRVPWKKAATLAKG
                     GRIEALDPSVVGLFNGPGNLKEHLGVISQIKSVQDGWLLVVNQSWFNGLPSKLRQALL
                     DASEKTFHEHLAQIPRVEQYCELALKQLGTQFYTPSVDEIAQWHAKAGHQLPQWRSFK
                     QNLLGDEALFSKFYDAAHN"
     CDS             511666..513120
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04580"
                     /product="hypothetical protein"
                     /protein_id="BBN80473.1"
                     /transl_table=11
                     /translation="MQISQSKLMFKLVLTVGGAICMLIIWLFVSSTQQYLNTEKRLSH
                     LHHLFHQVQQTYAVAAQQPQRISEYKVALQSFLGTLVENKSLLTGSLDEASLAWLNDL
                     RVDASIKDEALLQQHERLVQAFLALPNSASTSAWQNNLKWWSLLVMAMILWGALLYCL
                     YRKLAYSIVLTQQVLMAAKGAQSYQLPEALSGQLAAEQELTELLKFIDVLATRLDEVH
                     SRFIEEAQEATLGSMTQGFSKSLLKTVEHAATHQKRLTTIMNKLDSGQVNDEQITQLH
                     TKSRQILNQLDEELANVYELLADFEQISNYHQFDIEVEFNLKTLVEGVFARHHQELAV
                     EQFHVSYEIPDNLKLNSAPAVFEQIYHHCISNSVKHAKSNDRVLHIVVSAMVVNDYVH
                     LYFKDDGVGIDSELLPILAEPTLNSRQHFGKHGLGLSVIHHLVRDKLHGEFKIQSPAH
                     GGACIHIVLEKTHFELDVSGSKGNHRKQNAKNPL"
     CDS             complement(513364..515193)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073230.1"
                     /locus_tag="PA25_04590"
                     /product="hypothetical protein"
                     /protein_id="BBN80474.1"
                     /transl_table=11
                     /translation="MRKLTVIAAAISVALLGGCQQTAEKPAPTQQVQQVEQSEVEKAN
                     AFFEEVFMRGVMRSPIYQTYMGIKKDYDKWDDESEARDLEDLALTKKDLATLKTIDRS
                     KLDEATQVSYDLMKQNLENEIADFKWRYHNYPVNQMFGTHSMVAAFLINQHQITDVKD
                     AQAYISRLNGVPKVFDQLIDNLKIRADKGIIAPKFVFPYVIESSENIIVGAPFESGKD
                     STLLADFKRKINKLSIDENEKSALVAQATEALKVAVKPAYSKLISYLEQLEKRADTRD
                     GAWKFPDGEAFFNNALARTTTTDLTAEEIHKIGLSEVARIHDEMREIKDKVGFKGDLK
                     AFMEFMKTDKQFYLPNTEEGKEQYLKEATALIDNMKSRLDELFIVKPKADMIVKRVEA
                     FREKAAGKAFYQQPSPDGSRPGIYYANLYDMEAMPTYQMEALAYHEGLPGHHMQIAIA
                     QELEGVPKFRKFGRVTAYVEGWGLYSELVPKEMGLYKDPYSDFGRLAMELWRACRLVV
                     DTGIHAMKWTRQEGIDYYVNNTPNAKSDGVKMVERHIVMPSQATAYKIGMLKILELRE
                     AAKKELGDKFDIRQFHDVVLKNGPLPLNVLERFVDQWVASKKA"
     CDS             complement(515273..516409)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704790.1"
                     /locus_tag="PA25_04600"
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="BBN80475.1"
                     /transl_table=11
                     /translation="MKLPPLSLYIHVPWCVQKCPYCDFNSHSLKGNIPEQEYVQHLLN
                     DLKADLHLVQQRKLHSIFIGGGTPSLLSADAYDYLLQEINKLIEFEQGIEITLEANPG
                     TVETDRFKHYVAAGINRISIGVQSLQEDKLTALGRIHGEQEAINAAYEAKQAGLASFN
                     MDLMHGLPNQSLSDALSDLQRVIDLAPPHISWYQLTIEPNTQFASKPPKLPEDEILWD
                     IQEQGQALLAQAGYHQYEISGYAKSGYQCKHNLNYWQFGDYLGIGCGAHGKITQPSDG
                     AILRTVKVKHPRGYMDLTKPYLYESWQVAPQDRSFEFFMNCFRLQQPCSKQAFVDFTG
                     LPLIEIEGQLNQAQKNGLLLDQGDSWLVTNKGHRYLNDLLQSFV"
     CDS             complement(516406..516999)
                     /codon_start=1
                     /gene="rdgB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KGJ7"
                     /locus_tag="PA25_04610"
                     /product="non-canonical purine NTP pyrophosphatase"
                     /protein_id="BBN80476.1"
                     /transl_table=11
                     /translation="MTQQIVLATGNQGKVKELASMLSELNIEVLPQSQFNVPDVAETG
                     TTFVENAIIKARHAAKVSGLPAIADDSGLEVDALDGAPGVYSARYAGDDATDQSNIDK
                     LLNDLEGQTQRTARFWCVLVYMRHADDPTPLICQASWDGEITTQQQGREGFGYDPIFF
                     VPQLNCTSAELSKDEKNAISHRGQALKILAKQLQANA"
     CDS             complement(517006..517443)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707384.1"
                     /locus_tag="PA25_04620"
                     /product="hypothetical protein"
                     /protein_id="BBN80477.1"
                     /transl_table=11
                     /translation="MKKLVSFALLLFVCAFAHANSEQGAQFKNLGPWQVHYIAFPSTF
                     IQPTIAQAYDLERSNYKAVVNISVLKNNTEKTAQKAILSGEARNLIGNKQELEFKEVV
                     DGDAIYYLAQIAYNNEETYRFTINIAQGNNQQVLKFQQKFYVD"
     CDS             complement(517455..517988)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707386.1"
                     /locus_tag="PA25_04630"
                     /product="membrane protein"
                     /protein_id="BBN80478.1"
                     /transl_table=11
                     /translation="MNAMHFLIGIVFDLFLMVVLLRFWLQLVRADFYNPLSQTVVKVT
                     SFAVNPLRKIIPGAGGLDLASLLLAFIVGFAKVSLLMVLFYGGWHPLSALIQGAITVL
                     KEAFSLVFWILIIRAILSWVAQGYNPIAAVFDQLTEPMLKPIRKIIPPLGGLDLSILV
                     LLIGMQFLQLLVMDLLS"
     CDS             complement(517999..518820)
                     /codon_start=1
                     /gene="proC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87LJ5"
                     /locus_tag="PA25_04640"
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="BBN80479.1"
                     /transl_table=11
                     /translation="MSNKTIAFIGTGNMSYAIIGGMIKNGFAPQSIIATNRNQDKLAK
                     VAADFHVQTTSDNTQALRDADVIVLSVKPQMMAELCQSFIDSGVDFSDKLFISVAAGI
                     TVARLRAMLAQKVKMVRCMPNTPCLLGRGVCGLYGEDISAEEREYVSQVFSATGIATW
                     VEQESQINDVIAVTGSSPAYFFLFMEAIEEKAKALGFSDEQARQLVQQTALGAAEMAV
                     SQSDISIAQLRANVTSKGGTTHAAVEHLKSQNLHSTVAGAMDACIARAEEMEKEL"
     CDS             complement(518835..519530)
                     /codon_start=1
                     /gene="yggS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011261215.1"
                     /locus_tag="PA25_04650"
                     /product="YggS family pyridoxal phosphate enzyme"
                     /protein_id="BBN80480.1"
                     /transl_table=11
                     /translation="MVTIAERLKLAYDRVKKAAQQRQYDHPNDQPVTILAVSKTKPVE
                     LIEQAYAHGQRQFGESYVQEAVDKILHLKEKKDIEWHFIGPIQSNKSRLVAEHFDWVQ
                     SVERLKIARRLNEQRPNNLMPLNVLIQVNISADENKSGCQLEELDELAEFIHNSRQLN
                     LRGLMTITEQTDDTNKQLQYFQQMKSCFDRLKDQYPQLDTLSMGMSGDLEPAITAGAT
                     MVRIGTDIFGSRK"
     CDS             519561..520604
                     /codon_start=1
                     /gene="pilT"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073221.1"
                     /locus_tag="PA25_04660"
                     /product="twitching motility protein PilT"
                     /protein_id="BBN80481.1"
                     /transl_table=11
                     /translation="MDITELLAFSVQHQASDLHLSSGVSPMIRVDGDVRRVNIPALEA
                     KDVNSLVYDIMNDNQRRDYEQNLEVDFSFEVPNLARFRVNAFNTNRGPAAVFRTIPSS
                     VLSLDDLGAPDIFRKIAEYRKGLVLVTGPTGSGKSTTLAALVDHINATQHYHILTIED
                     PIEFVHKNQKSLINQREVHRDTHSFNAALRSALREDPDVILVGELRDLETIRLAMTAA
                     ETGHLVFGTLHTTSAPKTIDRIIDVFPGEEKDMVRSMLSESLQAVISQTLVRKVSGGR
                     IAAHEIMLGTPAIRNLIREDKIPQMYSTIQTGAIHGMQTMEQCLSNLVNRGVISQQDI
                     PGKGHDEQNQRNF"
     CDS             520617..521732
                     /codon_start=1
                     /gene="pilU"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073220.1"
                     /locus_tag="PA25_04670"
                     /product="twitching motility protein PilT"
                     /protein_id="BBN80482.1"
                     /transl_table=11
                     /translation="MLDKYLQLMVDKHASDLFVSAGLPISVKVDGELRPMEDGPIDAA
                     KSLELVESIMTDKQKTQFHEHKECNFAIVTALGRFRVSAFWQRDCAGMVIRRIITEIP
                     DVKDLGLPSVLTDVIMSKRGLVLFVGGTGTGKSTSLAALLGYRNRNQRGHILTIEDPI
                     EFVHEHKKSIITQREVGLDTETFEAALKSSLRQAPDVILIGEIRSQETMEYALSFAET
                     GHLCVATLHANNANQAIDRIMHLVPKEKHDKLKYDLALNLRAIVAQQLIPSSKGEGRE
                     AAIEILLNTPLVAELIKKGDVGSIKEAMAKSKEMGMQTFDQALFELYKQQRINYADAL
                     HHADSPNDLRLMIKLQNNEQQGAGFLQGVTVDGLDKQ"
     CDS             521713..522591
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04680"
                     /product="hypothetical protein"
                     /protein_id="BBN80483.1"
                     /transl_table=11
                     /translation="MGSISSKLCRVLLLSACFGSSSSLVAKDTVQMYIRDDVFADYQR
                     FVNGRAVQDIDNFSGDYIRRDVVDMILVQKALLLGGFDKPFDYQVGNVNFRNTKLLEQ
                     GKLLLSFDSYWLADARPLEAHIFISDAVIRQGEYYAGLYYSPNNTKVSSLSSYEQLQK
                     LSAVSTPRWRTDWNTLQQLPLKRHVIEHEWIAQARMVSMRWVDFMLMPLMPDKGNEYK
                     LEGIHLVAHPKWVVLLDGSRHFVVSKHHPDGERAFAALQKGLAKLRESGQIKLAYQQA
                     GFVPDWSSMQLLAPTQ"
     CDS             complement(522593..523039)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EBZ8"
                     /locus_tag="PA25_04690"
                     /product="putative pre-16S rRNA nuclease"
                     /protein_id="BBN80484.1"
                     /transl_table=11
                     /translation="MTKKERARLGERTVMGFDFGTKSIGIAVGQELTGTATSLGAIKA
                     KDGIPNWSDIAIHIEQWQPDLLVVGLPLNMDGTNQHVTFAAKKFANRLHNNYRLPVET
                     QDERLTTADAKARLFEQGGYRNLGKGNVDSMSAVIILESYFEHLWQ"
     CDS             complement(523048..523605)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KUP8"
                     /locus_tag="PA25_04700"
                     /product="UPF0301 protein"
                     /protein_id="BBN80485.1"
                     /transl_table=11
                     /translation="MQSLENHFLVAMPSLQDPFFKHTVTYICEHNEDGAMGLVVNHPI
                     DVTVGELLDKIEIDNDKSTSAAAEHVFAGGPVHTDRGFVLHTPKPGYSSSQELSSDIM
                     ITTSKDVLASLTSNARPDAFLITLGYAGWERGQLEKELLENSWLVIEADPAIIFNTPP
                     EQRWEKAVQMLGIDAAQLSSQAGHA"
     CDS             complement(523628..524584)
                     /codon_start=1
                     /gene="gshB_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A1JPT4"
                     /locus_tag="PA25_04710"
                     /product="glutathione synthetase"
                     /protein_id="BBN80486.1"
                     /transl_table=11
                     /translation="MAIKLGIISDPISGFNIKKDTGFAMMMAAQKRGYELYYMEMGDL
                     FLYQGNAKATAAKAKVFDDTNHWYELEQKQSIDLSDLDVILMRKDPPFDTEYIYATYI
                     LERAEQAGSLVVNKPQSLRDANEKLFTAWFSEHTPDTLVTRSQTHIREFLAKHQDIIL
                     KPLDGMGGASIFRVKQDDPNIGVICETLTEHGQRFAMAQQYIPEIKQGDKRVLVVDGE
                     VVPYCLARIPQGGETRGNLAAGGRGEARPISEDDLRIAQAVAPTLKEKGLLFVGLDII
                     GNKLTEINVTAPTCVKEIENAYDISIMDMFYDAIEVKLAHTK"
     CDS             complement(524635..525417)
                     /codon_start=1
                     /gene="rsmE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EIK7"
                     /locus_tag="PA25_04720"
                     /product="ribosomal RNA small subunit methyltransferase E"
                     /protein_id="BBN80487.1"
                     /transl_table=11
                     /translation="MQNFTIATLLLSNRPIMRIPHIYQPSALSLHSQISLDDNAAGHI
                     ARVLRMQVGDKVSLFNGQGGEYLCELTDVSKKKVIVQPVEFVDNDCESPLKIHLGQGI
                     SRGDKMDFTIQKSVELGISEITPLFTTRCGVKLSGERLAKKHAQWQKIAIAAAEQSGR
                     NTITVIHPPVDITAWLTQPSDELKLTLHPRAEHSIKTLPTPSKGVRFIVGPEGGFTDE
                     EIQATSEQGFIDVRLGPRVLRTETAALTVLSALQLQFGDLAL"
     CDS             complement(525475..525948)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04730"
                     /product="hypothetical protein"
                     /protein_id="BBN80488.1"
                     /transl_table=11
                     /translation="MSLKLDNFLLVDSNKEFSREYAEYLLKHSPNNESQIIAAGDNTR
                     HLLKMMFDNLIKDYCYCDFANEISVSELATYLNEHHQISGVLIPNVDYFLASKEQQFI
                     FNSLHPVRYLLEQTKDGAFEYKKVTDQANNNHLSCNSNLSAIGEDIEALLCKQDS"
     CDS             complement(525980..526873)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04740"
                     /product="hypothetical protein"
                     /protein_id="BBN80489.1"
                     /transl_table=11
                     /translation="MTYLSLANINFFAILSSFAVICLVVSLLRLRVQYRAKQALQEEL
                     AKRDNFALGISYACQISVIAFSVAYFFYDIKYATVIEAPLRSAFTLSLILLFVYIGQY
                     IHRKWILYQFNEEQAILKQNICAALVDSGMLIANGILVLGLYHWVHPKGVSDLLVVCL
                     SFFLLQGLFALDSKFRESRFAKFNQGASLQQNFNLDNTSIGIRYAGKTIGLALAIYAG
                     LHSAHYHGAMIVENLFSVILHCGLMWVLLYTGSAILLYFSLPKVDIGLEVDHQDNIGI
                     ACIEFAVFLSMGYLLINTFSV"
     CDS             526955..529756
                     /codon_start=1
                     /gene="glnE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3CPN4"
                     /locus_tag="PA25_04750"
                     /product="glutamate-ammonia-ligase adenylyltransferase"
                     /protein_id="BBN80490.1"
                     /transl_table=11
                     /translation="MHDIALPTNLAHQAHERWQVLYNEQTPNPDLLRLLAMSDFAFRV
                     LQQSPELADWLLDETQMKSRDIPNPLTADLSVLSERDCFELLRKYRQRYWLKVMWLDL
                     VKGNDIADSIRYISQLSEQLIDAANRWAFAQTVKQCGTPLDESGKALSMMVIGMGKLG
                     GGELNFSSDIDLIFCYPQNVPTQGGRRSVEAQVFYTKVAQKLIAALNQVTVDGQVFRV
                     DMRLRPFGDSGPLVMSLSAMEDYYQDQGREWERYAMLKARLLGQQTPHWPAFYSMLRP
                     FVYRRYIDFSVIESLRKMKHMIAQEVRRKGLVNNIKLGAGGIREVEFIVQALQMIRGG
                     RDTSLQTPSILNALSQLKALEVIPSGIVHSLQDNYLYLRKIEQYLQAFDDQQTQTLPD
                     DAVSQARLVNLMGVENYDACLAMLQTRMTKIREEFSQVIGDEPLEHTQSDEAFTYVWL
                     EEDTEQLAGRVDTTQIQLWHNALQEFKAALTKRQVGARGADILDKLMPCLLHQAAELS
                     LGGDVLSRVLKIVTTVVSRTAYLELLYENQGALKQLLFLTSHSQWIAEHIAKYPILLD
                     ELLDPAALYKPLPLNAYKLEIRQYFLRIEQHDLEQQMEALRQFKQAHQLRIAAADATN
                     VLSIMQVSDHLTALAEAIIEQSVNLAWQQMTERYGAPQGSHEDEKGFAVIAYGKTGGW
                     ELGYDSDLDLVFVHNRDGDSDTQGDKPISSRQFYLKLAQRLMHLFNTRTASGILYELD
                     TRLRPEGNSGLLAINLESYYQYQLQQAWTWEHQAIVRARLVYGQADMRARFMQIRASV
                     LQQPRAHEKLLSDVTSMREKMRAHLSKDTDELFDLKQGLGGMTDIEFIVQYLVLNNAQ
                     HSPELIEYTDNIRILACARKLGILPEQAQSVLSEAYCFFRELYHNQSLNGQGKCIAKD
                     PQIRTLTDKVTEIYVATLT"
     CDS             complement(529812..530477)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04760"
                     /product="hypothetical protein"
                     /protein_id="BBN80491.1"
                     /transl_table=11
                     /translation="MVMKKNPKTRPKQPAPTPVRRKKAARKVSAAWFWVKHLSLAVIL
                     IASAYYFLFGAMPKMSVSTTANVAAQGFSQFYESFRNRTTSRDTERAKFVIELGNPSF
                     ALDEALKDRERAVKASSQRWTGEHQARRFESGDTLKGVLATYARQEDIELFWYLDKDY
                     VVKHNFRVDSNFLSALYQVGRAINDDFEYEIFTFFCHRQRAAVITEKPTRFVRDNCRK
                     LSG"
     CDS             complement(530487..531413)
                     /codon_start=1
                     /gene="htrB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A1JN09"
                     /locus_tag="PA25_04770"
                     /product="lipid A biosynthesis lauroyltransferase"
                     /protein_id="BBN80492.1"
                     /transl_table=11
                     /translation="MVTTPTFKWSFLAPRYWLTWIGVLFLYLISWLPQRVQFFFGRLL
                     GRLVHRFVKKRRHIAQVNVALCFPHLTKAQQAEMVLRNMENTGIATLETGMAWWWPQW
                     RIKSVIGSIEGIELVEEVQQQGKGVLLLVPHMLHLEMLGRILGSEQQGIGFYRPHNNP
                     LMEYFMTKGRLRSNESLITKRDVKGLLQALNKKKMCYYLPDQDYGRNRCEFAPFFCVP
                     DAATTTGTLLFSSSKKCETLSLSGTRDAKGKYHLKIYPAMTDFPSENAKQDVTRVNQR
                     MEQSIMLAPEQYMWLHRRFKTRPDENAPSYYG"
     CDS             complement(531519..532865)
                     /codon_start=1
                     /gene="tolC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011262654.1"
                     /locus_tag="PA25_04780"
                     /product="outer membrane channel protein"
                     /protein_id="BBN80493.1"
                     /transl_table=11
                     /translation="MKKSLLSLLVGLSCALTTNLSHAEDLLQVYDIATANDPTVLKAK
                     AQADAQKYAQEQALSVLLPQLGFESSYRQVDSDGFSPQQNDLTGYTMGSGFQDTFSRS
                     IALQQTIFNMSSWQNLDIAKKQAMQAMTQYELTQQELVVRIAQGYFDVLSALDNLEFV
                     QAEKRAIERQLEQTKQRYEVGLTAITDVHEAQAQFDQSVANEIVAKNDVETAREALRT
                     ITGKYHNKLDSLNTDTFSTVTPSKQATDFVGVAKEKNLSLALAKASLDIAEDQIELAK
                     AGHYPTVGLSASYGDSLTDSNGRLNVPREDQTSVALTLNVPIYSGGQTMAATEQARAL
                     YVGASQDLEASMREVTRSVITSYNQVMSNVATYRALEQAVVSAESALQATEAGFEVGT
                     RTIVDVLVSTQNLYNAKRNLANLRYQYVLSSLRLKQATGTLSRSDLEAINKGLVQS"
     CDS             533086..533706
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011707476.1"
                     /locus_tag="PA25_04790"
                     /product="ADP-ribose pyrophosphatase"
                     /protein_id="BBN80494.1"
                     /transl_table=11
                     /translation="MSSISSFNNKDVTLESVETIFNGFFKIQLYQFRHALFAGGMSQT
                     ISREILERGHAVAVLPYDPVTDSILLIEQIRIGAMASKSSPWLLECIAGMAEGSKQYE
                     EVARKEALEEAGLELKDLHYMTSYLSSPGGTTERLYLYLAKADLSNAGGIYGLESEGE
                     DIKSHVIPYAKAIDLLQSGEIDNAATVISLQWLALNKDKVLAQWVK"
     CDS             533726..534181
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002212183.1"
                     /locus_tag="PA25_04800"
                     /product="hypothetical protein"
                     /protein_id="BBN80495.1"
                     /transl_table=11
                     /translation="MSDMALARDYVQSLPKYITLCERNYLRALKLLPPEELGAQRAIE
                     LANIHYVIEVQGCAKYTTDIAIKQTSNASVFFPSLHLEVRLYHDARVAEVVHHDYHQR
                     IKPSYRYPNPKMHQKDEKYQVNAFLADWLMACLESGKVPLNWDVNNGLV"
     CDS             534168..534941
                     /codon_start=1
                     /gene="cpdA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPL0"
                     /locus_tag="PA25_04810"
                     /product="3',5'-cyclic adenosine monophosphate
                     phosphodiesterase CpdA"
                     /protein_id="BBN80496.1"
                     /transl_table=11
                     /translation="MAWFEQKYAFAHSTIRLAHITDSHLFADPQGVYFEVNTAQYLRR
                     VLAQLATQSLDAVIFGGDLTQDHTLASYTLFAQLVAESSLPCPVFWLPGNHDEVELLN
                     HISHGQIHGAKHLYNEQMDILLLNSKGVTPAGWCDEHHLAEIEQVLNSTASKTLVFCH
                     HHPVPIQGYLDKHMLENGPQLLNTLVDSKQVLALVHGHVHNEYHQRFRELDIFATPAT
                     SIQFTKGTAHWQQQDLGPAWRLIQIEGDTLATEVVWLNG"
     CDS             534926..535492
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_002345735.1"
                     /locus_tag="PA25_04820"
                     /product="esterase"
                     /protein_id="BBN80497.1"
                     /transl_table=11
                     /translation="MVKRVIYIHGFNSSELSAKAQQFGAWLAHQPLSCEYITPRLHFD
                     PRIAILQLESVINEQTVLLGSSLGGFYATYLSQRHNLPAVVINPAVRPFELLADYLGA
                     QYNPYQQIHYHLKHEHVLALKQLYVAHLTKPELLMLLQQMGDEVLPYQQALQYYQACQ
                     QRIDFAGDHSFMDFQRYFDTVVNFLKIT"
     CDS             535525..537420
                     /codon_start=1
                     /gene="parE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EAK3"
                     /locus_tag="PA25_04830"
                     /product="DNA topoisomerase 4 subunit B"
                     /protein_id="BBN80498.1"
                     /transl_table=11
                     /translation="MSEQNYNAEAIEVLNGLEPVKRRPGMYTDTTRPNHLGQEVIDNS
                     VDEALAGHATKIDVILHEDNSLEVIDDGRGMPVDIHPEEGLPGVELILTKLHAGGKFS
                     NKNYQFSGGLHGVGISVVNALSSRVEITVKRDGQVYEMAFEHGDKVQDLDVTGTVGKR
                     NTGTSVHFWPDASYFDSANFSLAKLNHVLKAKAVLCPGLRIRFINKQTKETQEWHYEA
                     GLEDYLKDSAQGYEVLPKAPFTGSFSGSTEGVDWALHWLPEGGESITESYVNLIPTAQ
                     GGTHVNGLRQGLLEAMREFCEFRNLLPRGVKLTPEDIWDKCSYVLSVKMQDPQFAGQT
                     KEKLSSRSCATFVSGIVKDAFSLWLNEHTDTAELLAELCISNAQKRLRAAKKVVRKKV
                     TSGPALPGKLTDCSGSETERSELFLVEGDSAGGSAKQARDREFQAIMPLRGKILNTWE
                     VESGQILASQEVHDISVALGIDPDSEDLSGLRYGKICILADADSDGLHIATLLCALFV
                     RHFPTLVKQGHVFVAMPPLFRIDVGKEVYYALDEDEKKGVLDRIEAEKKRGKVNVQRF
                     KGLGEMNPLQLRETTMDPNTRRLVQLTLDEQEHTMEMMDMLLAKKRSSDRKEWLENHG
                     DKAQVEV"
     CDS             537425..538528
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010940868.1"
                     /locus_tag="PA25_04840"
                     /product="sorbosone dehydrogenase"
                     /protein_id="BBN80499.1"
                     /transl_table=11
                     /translation="MLRHILITASLIGSTFSYGADELLSRLTLPKGYEVSYFAKNVDN
                     ARQLAVSKSGVVYAGSRKAGNLYALIDNNQDGVADRKIVLAQGLNMPSGIALHNGDLY
                     VAEVNRIIRFKNIDKQLPKPSFEVVFDKLPTERHHGWKFIRFTDDGELLIPVGVPCNV
                     CAEDERFGRIFSLNLQTKKLTTIAQGVRNSVGFDINPQSGALWFSDNGRDMMGDDIPP
                     DEINRVSFEGEHFGFPYVHGGSVLDPEFGKGKTLVDMQKYTAPKLALQAHVAPLGIHF
                     YRGKQFAKDMHNKLLVAEHGSWNRSKKVGYRVMMATIKEGEITAYEPFISGFLDKEQT
                     LGRPVALAELADGSLLVSDDFANAIYRVRYNNK"
     CDS             538537..540840
                     /codon_start=1
                     /gene="parC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KPK2"
                     /locus_tag="PA25_04850"
                     /product="DNA topoisomerase 4 subunit A"
                     /protein_id="BBN80500.1"
                     /transl_table=11
                     /translation="MTDPQTLSLQGIEQQTMGRFTEDAYLNYSMYVIMDRALPHIGDG
                     LKPVQRRIVYAMSELGLSAAAKYKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSY
                     RYPLVDGQGNWGAADDPKSFAAMRYTEARLSKFSEVLLKELGQGTVDWTPNFDGTMDE
                     PKVLPSRLPHILLNGVTGIAVGMATDIPPHNVKELATACCMLLDQPKTSLEELLEVVQ
                     APDYPTDAEIITAKSDIQKIYTTGRGSIKMRAVYTEEQGDIVITALPHQCSGAKVLEQ
                     IAAQMTAKKLPMVADLRDESDHENPTRIVIVPRSNRVKLEPLMAHLFATTDLEKSYRV
                     NLNMIGLDGRPKVKDLLQILSEWLVFRRETVRRRLQYRLDKVLARLHILEGLMTAFLN
                     IDEVIEIIRTEDKPKEELIARFELSDKQAEAILDLKLRHLAKLEEVKIRGEQDELSIE
                     RDKLELTLGSERRMSTLMKKEIQEAAELYGDERRSPVIERSEAKALSEKDLIPSESVT
                     VVLSDKGWARVAKGHDIDAEGLSYRSGDSYKASAKGRSNQPAVFLDSSGRAFATEAHS
                     LPSARSQGEPMTGRFNMSTGSNFEHVVMGDEKTLYLMATDGGYGFITEFNDLVSKNKN
                     GKALVSVPKGAQLMAPITVNDVATDMCMAISNEGRMLLFPLRDLPKLGKGKGNKIISI
                     PSAKVQAREEFVKVLACVPEGSSVTLHAGKRKLTLKPSDLEHYYGERGRRGNKLPRGL
                     QRVDEYEIERKNVAPEDAEAPLEQSDD"
     CDS             complement(540938..541198)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04860"
                     /product="hypothetical protein"
                     /protein_id="BBN80501.1"
                     /transl_table=11
                     /translation="MKNNLAVRKAQVDKFKNELQVGIRNLRRERGLTQKQFGAILGVD
                     QATISNFESGKTVMNIIQAYEIALIFGKDLAVPRLSISAQPN"
     CDS             complement(541624..542439)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04870"
                     /product="hypothetical protein"
                     /protein_id="BBN80502.1"
                     /transl_table=11
                     /translation="MVEGEDLRAMRINAGITQQDMARKLNCDRKTIINYELDVSDIPA
                     QKLFRWLQCCKLDFSVLLGEIKAIRETAQSNGKAKLLDFITLAFVLSQFWDSTIVTSW
                     YLLLLGLCTLYGTFTKNINIVHITGFVFVMTASNYIIFETGLINNVTPSGNLLLQGTL
                     IYGVQLLFSITTVLILIFRVQLSRLLSKSNSIKLTHFDGIFHWLYLYTSLIYLLGLLE
                     NIAWSYFELKSWTLIYDNFEGLIYIAWALCCGALLTMMICSSKGDNTREVNSL"
     CDS             complement(542514..543104)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04880"
                     /product="hypothetical protein"
                     /protein_id="BBN80503.1"
                     /transl_table=11
                     /translation="MKLSNLILFTIASIAFFYIQLWDDRIVTPLYLFLLGFSTIYGVY
                     TKNINMAHIAGFIFILTGISHIIFETGLINEATPEENKLLQGTLIYGTQLLISLLIAI
                     VLIFRVQTSRALSKSKNIELTHFDGVFHWIFIYMAAVNLLALLENIAWSYFELKSWTL
                     IYDNFEGLIYIAWALCCGALLTMMICSKKPTEQLAQ"
     CDS             complement(543108..543407)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04890"
                     /product="hypothetical protein"
                     /protein_id="BBN80504.1"
                     /transl_table=11
                     /translation="MTQLSPLSILKRMNFFMPPNYKQKKSAHNGELIKNICMSINESA
                     GSSKPERKTYSTKSARELPKDCCAFVVGGGTANKPPRVTQAIILLPIPILDDSQG"
     CDS             complement(543404..543661)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04900"
                     /product="hypothetical protein"
                     /protein_id="BBN80505.1"
                     /transl_table=11
                     /translation="MINGDDLRAMRVNAGISQDAMAKKLKCDRKTIINYELGVSDIRS
                     KQLFMWLVYCKIDSGSLLNEIKQIRDQVNSKQKPNLQDDEQ"
     CDS             544120..544698
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_04910"
                     /product="hypothetical protein"
                     /protein_id="BBN80506.1"
                     /transl_table=11
                     /translation="MPHRFNLIKDTSKSVSVFLDVVPDFRLDKDLDPSVYMQKHWSAF
                     YKVHPESSNSINGTFFELLFSTVLINKGILPFYYQAKAAFVPNVEYDILINTEEVGPI
                     CISLKTTLRERYKQADLEALVLKNVHRRSLAYLVTSDDIKNINKKIENGEIVSIDKAY
                     NIDNIDELVSDLKNYKIVEPEMVRTISGKEIT"
     CDS             complement(544765..545808)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6H1I7"
                     /locus_tag="PA25_04920"
                     /product="cytosine-specific methyltransferase"
                     /protein_id="BBN80507.1"
                     /transl_table=11
                     /translation="MKQIFSDLTAKDIKKDHENLAIMTHKVEQEKNKNKKFTFIDLFA
                     GIGGIRRAFESIDGGCVFSSEIDLYAQHTYYANYGVVPFGDITKIEKSSIPDHDILCG
                     GFPCQPFSSIGKREGFAHPTQGTMFDEVLKVIDEKHPKVVFLENVPGIVNHDNGNTLS
                     TIISELEKRNYQCHHTLLNAKDFGVPQNRNRFYLVAFSFPCSFEFPTPPMEVVNIGDY
                     IEKNISGYSISEHLQKSYLFKKDDGRPILVDQHSKGHVKTLVSTYHKIQRLTGTFVKD
                     GETGIRLLTANECKAIMGFPPDFVIPVSRTQMYRQMGNSVCIKVVGEIAKQIDLVLMK
                     ELTSRLKTNNKMA"
     CDS             complement(546105..546965)
                     /codon_start=1
                     /gene="yicC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011260977.1"
                     /locus_tag="PA25_04930"
                     /product="hypothetical protein"
                     /protein_id="BBN80508.1"
                     /transl_table=11
                     /translation="MIHSMTAYARREVKGDWGTGVWEIRSVNQRYLETFIRAPEQFRA
                     MEPVVRERLRKHLQRGKVEVYLKFTANPAHVGELSINETLAEQLIKSAQWVQQHSQGD
                     INPVDILRWPGVMEAQEIDLDTVNGELLAGFDELVEDFKAARASEGENLETMITTRLD
                     SILEQVAIVEGHMPEVSKWQREKLTTKLEELKAEIDENRLEQELIYLAQKQDVAEELD
                     RLKSHVKETHKILKKGGACGRRLDFMMQEFNRESNTLASKSINTEITTAAVELKVLIE
                     QMREQIQNIE"
     CDS             547149..547862
                     /codon_start=1
                     /gene="rph"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8E9L4"
                     /locus_tag="PA25_04940"
                     /product="ribonuclease PH"
                     /protein_id="BBN80509.1"
                     /transl_table=11
                     /translation="MRPSERTANQIRPVTFTRNYTMHAEGSVLVEFGNTKVLCTATVE
                     AGVPRFMKGQGKGWITAEYGMLPRSTHTRNNREAAKGKQGGRTMEIQRLIARALRAAV
                     DLKALGENTVTIDCDVLQADGGTRTASISGACVALVDALTHMRAKGMINTNPLKFMIA
                     AISVGVYNGEAITDLEYLEDSEAETDMNVIMTETGKLIEVQGTAEGEPFSFEELDELL
                     ELAKHSIREIIDLQKKALA"
     CDS             547894..548538
                     /codon_start=1
                     /gene="pyrE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87T92"
                     /locus_tag="PA25_04950"
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="BBN80510.1"
                     /transl_table=11
                     /translation="MKAYQKEFIEFALEKQVLKFGEFTLKSGRTSPYFFNAGLFNTGR
                     DLARLGRFYAAALEDAAIEYDVLFGPAYKGIPIATTTAVALADHYNKDVPYCFNRKEK
                     KQHGEGGSLVGSALEGRIMLVDDVITAGTAIRESMEIIAAAGADLSGVLIALDRQEKG
                     KAELSAIQEVERDFNTKVVSIVKLADLITYLEEQGSMGEHLAAVKAYRDQYGVA"
     CDS             548761..550131
                     /codon_start=1
                     /gene="mpl"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KP18"
                     /locus_tag="PA25_04960"
                     /product="UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-
                     m eso-2,6-diaminoheptandioate ligase"
                     /protein_id="BBN80511.1"
                     /transl_table=11
                     /translation="MVSQQKQQKHIHILGVCGTFMGGIAAIAQALGYKVTGSDQNVYP
                     PMSTQLESLGIELTSGYDPKQLEPAPDMVIIGNAMSRGNSCVEYVLEKGLPYTSGPEW
                     LKHNLLQDAWVLAVAGTHGKTTTASMLAWVLEYAGLRPGFLIGGIVQNFGVSARVSDT
                     PFFVIEADEYDTAFFDKRSKFVHYLPRTLIMNNLEFDHADIFKDLDAIQTQFNHLLRT
                     LPSQGKAIYPADDEALVDVIKRGFWSQQETLNGDWTYKLLERDGSQFEVYLSGKLEGV
                     VSWDAIGEHNVKNAIMTIAAARHVGIPVAVSIDALREFKSPKRRMELLGEANGVHVYD
                     DFAHHPTAIKTTLAGLKAKVGEEPVIAILEPRSNTMKMGVHQHTLLASLAQADEAYLF
                     EPQGLGWSLKDEAHKAGRHCFDSTDEIIAKVCEKAQPGQHILIMSNGGFEGLHQKLLS
                     ALKANA"
     CDS             550160..550783
                     /codon_start=1
                     /gene="ubiX"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87SV7"
                     /locus_tag="PA25_04970"
                     /product="flavin prenyltransferase UbiX"
                     /protein_id="BBN80512.1"
                     /transl_table=11
                     /translation="MNNFKPAITLAFSGASGAPYGLRLLEVLVAMNYQVFVLISSAAR
                     VVLDTESNIKLSGNEQKATQQLSELFNAQPEQIQVFGKDNWFSPVASGSAAPKKMVVC
                     PCSAGSVSAIATGASDNLLERAADVVIKERGQLILVPRETPFSSIHLENMLKLSQLGV
                     TIMPAAPGFYHQPQSISDLVDFMVARILDHLNIEHTLTKRWGYGEQH"
     CDS             550785..551705
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011073574.1"
                     /locus_tag="PA25_04980"
                     /product="ABC transporter"
                     /protein_id="BBN80513.1"
                     /transl_table=11
                     /translation="MTIALNIQGLRKVYKNGVEAVKGIDLQVEQGDFFALLGPNGAGK
                     STTIGVIASLVNKTEGQVEVFGHSIDTALEDAKSELGLVPQEFNFGQFETLNQILVNQ
                     AGYYGVPRALAHERAEKYLKQLGLFDKKDKQARTLSGGMKRRLMIARALMHEPKLLIL
                     DEPTAGVDIELRRSMWDFLREINQQGVTIILTTHYLEEAELLCKNIAIIDKGMIVENT
                     TIKALLAKLDKETFVMDLKSPIQPVSLDGYAFKMVDDHTIEVEVAKSQGLNEVFTQLT
                     TQGNTVLSMRNKANRLEELFVGLLEQGRAS"
     CDS             551702..552475
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KP13"
                     /locus_tag="PA25_04990"
                     /product="transport permease protein"
                     /protein_id="BBN80514.1"
                     /transl_table=11
                     /translation="MSLGRYSVALKSIWIKECIRFLRIWVQTLVPPAITMTLYFVIFG
                     SLIGSRIGDMGGFSYMEFIVPGLIMMSVITNSYSNVASSFYSTKFQKSIEELLVAPVP
                     NYIIVLGYMGGGMARGILVGFIVTLVSLFFVDIQIHNLGVIIATVILTSAVFALGGLI
                     NAVFANSFDDISIIPTFVLTPLTYLGGVFYSITLLPEFWQGVSQVNPIIYMVNAFRFG
                     FLGVSDVNIYVAFTVLLAFISGLFILALSLIRRGVGLRH"
     CDS             552475..553143
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05000"
                     /product="hypothetical protein"
                     /protein_id="BBN80515.1"
                     /transl_table=11
                     /translation="MSDANSRSIVSNQPSLHDKLDEIVNKHLSAEFKKPIAQHTQRAF
                     DEVNERVQAFEGPIILDSCCGVGESTANLAKQHPDALVIGIDKSSHRLEKHDVEYKQT
                     ESGQYVLVQADLNDFWRLAVEANWRPTHHYLFYPNPWPKAKHVQRRWHGAAVFPYIVK
                     LGGRLEVRSNWDIYVKEFARALQLAGYPTPVEPYHSDTAITPFERKYWASGQSSTRLV
                     AQLP"
     CDS             complement(553111..554967)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05010"
                     /product="hypothetical protein"
                     /protein_id="BBN80516.1"
                     /transl_table=11
                     /translation="MTWSLIGFSLFVSSLAGYVAYTYQSTRTAIMTDIDEQLLRAAKS
                     TQLLVGDDYHDRLNAISTEEYQHKSAQLTALAKAIGVEYVYTMVYRPPHVHFTASSFT
                     TSDIKNNKLTQFFDQYKEATVINKAAFQSTEPVFEVSKDKWGHFKTIFVPYISSNGTA
                     YITGADMTISQVDALLQESVAKATLTATFFFFIAVLVATFYIALYRKSMSTDARTGFA
                     NRVALEQDLGKKQDQHLSLAIISVDELEDIISFYGTHVGDSVIQKVMEYFKPITSPHR
                     VYRLATSKLVIMSNIKEGEAHLSQVIADFPKSTPILTKPHLYIQLHAGIASGNKSLLL
                     ENALIACRQAKQNQQPICMFSIDSQDARLKQKNHLAIANILQGAFSDNRIATYFTPRV
                     DPKTQQIVQYHCSARIVTEQGAILKTESFSEVVRQSRLQSQLTRNIFTQCIERFRKSG
                     TSWSIKLSYHDATDPQLLDFLDQELRRYPQPQLITFELDEKDVLAHFNAMAVCINVLK
                     SKGVKVLINAVSSGLLTVSRVMKLNIDMILLDESNTAHIADDNQVFDFIKHISKLCHD
                     KNIMLLVAGVESEQQYNKLSKAGVDLVEGRYIASAAPHLCAKLRQLSNQARA"
     CDS             555392..557020
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011071894.1"
                     /locus_tag="PA25_05020"
                     /product="glutamate decarboxylase"
                     /protein_id="BBN80517.1"
                     /transl_table=11
                     /translation="MGPKRCAVASEESLMRIFTVPEAPDSTLSKIELEISSNLAGFLN
                     ENIAAIEKPLHEIEKDFQSAVIPEEPMFVSDYAQDIMEQLVAHSVHTAAPSFIGHMTS
                     ALPHFVLPLSKLMVGLNQNLVKIETSKAFTPLERQVLGMMHHLAYGASDKFYDKWMHS
                     ASTSLGAFCSGGTVANITALWIARNRLLKADGEFKGIAAQGMVAAMLHYGYKGLAVLV
                     SERGHYSLGKAADVLGLGRDNFIAIETDANNKVNVQKMREKAQQLEAQGIKVMALVGV
                     AGTTETGNIDPLQQMADLSEELGCHFHVDAAWGGATLLSGSNRYLLDGIERADSITID
                     AHKQMYVPMGAGLVLFKDPAASDAIEHHAEYILRKGSKDLGSHTLEGSRPGMAMLVHA
                     CLRVIGRKGYEMLIDKGIEKAKYFASLIEQDPDFELISQPELCLLTYRYVPQEIRKAI
                     ENANEQERIDIYAALNRFTASMQKRQREAGISFVSRTRLTPVQYDNQPTVVFRVVLAN
                     PLTSHDILQGILDEQKALAKTDPVFKKYLSKYMK"
     CDS             557150..558190
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05030"
                     /product="hypothetical protein"
                     /protein_id="BBN80518.1"
                     /transl_table=11
                     /translation="MFIDLSAVTQRLRRMSSEELDVSGSYQNFLLDLILEGKQTLGVE
                     HVSVWLFDDISAPKKLINVASTNWQQDLSEDEYPELLCEHFPSYFKAITTGISIDAND
                     ATIDPRTCEFKESYLDVYNITTMLDTVIFKNGIPHGVVCFEGTGETRCWQGAEIAYAE
                     MMADCCSRRLLVNDLWCLQQQLTELAFQDALTGLKNRRYLMDYAHREISRHIRSGQQL
                     SVVMLDIDHFKLINDSYGHEVGDVVLKAFAQRCQQALRTEDCLCRLGGEEFIALLPNT
                     PTEGAMEVAERLRRDVEMHIIESGTHYIQVTVSCGVGEVSLAKPFSQSLKEADRAVYS
                     AKAKGRNCVVMY"
     CDS             complement(558308..559108)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011963866.1"
                     /locus_tag="PA25_05040"
                     /product="esterase"
                     /protein_id="BBN80519.1"
                     /transl_table=11
                     /translation="MKTLFVMLFALIAFASHGANFSKVDLPSSQFMSASPQVTIALPA
                     SYKQDKSKHYPVLYLLDAKLNDESVFGMLQRLHSSNGANEHIIVGIESHDRLNDFAPT
                     VNKDPRGPVGAGGGADKLLDFIQSELMPNINKNYRTKPHNVIAGHSIAGLLVMHSFHA
                     RPSLFQAHMAFSPAVWWGARETAQATKQYVLSDKKVGSFLYMNIGSEGGEMRQVYDDL
                     SQTILRNRSTDLVVQLDTFNDEDHDFTMAVGLYHALRALHQYQQDNKL"
     CDS             559353..560228
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05050"
                     /product="hypothetical protein"
                     /protein_id="BBN80520.1"
                     /transl_table=11
                     /translation="MNKIVKLTTLFSSVFLAANAFSADEIWSITSDSQLNGEVIGNSE
                     VFDVRIHQGRFILSNQAAPSNATMSGNILSGTVDGVAYSTPIITFTQFTSDATYAYRG
                     QYIGDGIYQGTWFNNNGGSGDFSLNMGQPPISEGPGTIAVGVNISSAVASSIYDSGHP
                     ASAAFDGKTGTNEVSWYSKHTEANPWLRFSTEQPTVLKSYRMSRAYCKTAAYTPGTWT
                     LSGSNDGTNWQVIDIVDTDQLENFNTVACGQMAIDYIIDVNKRGSYIDYKFDFVTSSA
                     SSVAGVGIGEIELFK"
     CDS             complement(560373..560924)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05060"
                     /product="hypothetical protein"
                     /protein_id="BBN80521.1"
                     /transl_table=11
                     /translation="MNNTKVIAISGMSGSGKTTQVKLLAHLFDCPYLLFDDYSNECTY
                     PSDMAQWLREGANVSLIRSPGFVNALHHLVTSSSRPFVFIEEPFGKERAATRTLIDTV
                     ILLDTPAEVCLSRVIKRHIAHNHANAATSINKYLAQYDSHYREIYISVVNQVRQNADL
                     VVKDVTSIADTTQFISGWLSKSQ"
     CDS             complement(561441..562232)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013098370.1"
                     /locus_tag="PA25_05070"
                     /product="carboxyvinyl-carboxyphosphonate
                     phosphorylmutase"
                     /protein_id="BBN80522.1"
                     /transl_table=11
                     /translation="MTFKELHTQVQPLLLCNVWDVPSVQIAQELGFAAIGTSSAAIAN
                     VLGKQDGEEVYFTELLNIVAAIAKHSSLPLSVDIEAGYAELPEDIANNIIMLAKLGVV
                     GINIEDSIVENGQRTLVDAEKFAHKLSAIKAQLTQAHVDMFINVRSDTYLLGVETPLE
                     ASLQRAALYHEAGADGLFFPCLHLATDIQAITSVTALPINVMCVPELVDFNTLKNLGV
                     KRISMGNFVHQAMLSSLKAALSAITASGAFTPLFDNWRNHAIGHL"
     CDS             562483..563514
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05080"
                     /product="hypothetical protein"
                     /protein_id="BBN80523.1"
                     /transl_table=11
                     /translation="MYKFFITFFAILCTFKLVAAEIANYPMNGNLVDIGPNSFNGKVV
                     YGSVSSARDRHGKIGGALSFGGDVVEIAQLRNYDFGSELTISFWMNRRSSQNYMGIIN
                     NGYTTESFDIRMGRENNGTFIFAQSNWTNGRTSVGSRNVIQIGRWHHVAIVLNNGSSK
                     MFIDGNLIQEQVTNSGSLAIINRPVIIGANANGRNHENFVGYLDDIILFDEALSDEAV
                     LSIANDSYSSAYNIQLAPTSPSPSVPLIGGSINYDLAFNNDSTNTTSDFNIWAVITLE
                     DGQDIVVQPSTPISVAPGSTYLLSAQPITIDGWLPAGQHTFRWYVSDPSKTGGNILSA
                     KFTFVKLAN"
     CDS             complement(563627..564985)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011105607.1"
                     /locus_tag="PA25_05090"
                     /product="glutathione-disulfide reductase"
                     /protein_id="BBN80524.1"
                     /transl_table=11
                     /translation="MAQHFDYIAIGGGSGGIASANRAAMRGAKVALIEAKHMGGTCVN
                     VGCVPKKVMWHGAQVAEAIKLYAPDYGFDVELKNFDWAKLVESREAYIGRIHKGYDGY
                     LAKNGVTVINGFAKFVDNHTVEVNGEHYTADHISIAVGGRPSIPNIPGAEYGIDSNDF
                     FALNEQPRRVAVIGAGYIAVELAGVLNSLGTETHLFVRKHAPLRSFDPMVVETLVEVM
                     EKEGPTLHTHAVPKELTKEADGSVTLHLENGQSHSVDQVIWAIGREPVTDLINLEATD
                     VQTNERGFIKVDEYQNTSVKGIYALGDIMEGGIELTPVAVKAGRMLAERLFNPELPDA
                     KMDYNLVPTVVFSHPPIGTIGLTEPQAIEQYGEDNIKVYTSTFAAMYTAVTQHRQPCK
                     MKLVCAGPDEKVVGLHGIGFAVDEMIQGFGVAMKMGATKADFDSVVAIHPTGSEEFVT
                     MK"
     CDS             565129..567174
                     /codon_start=1
                     /gene="prlC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011262844.1"
                     /locus_tag="PA25_05100"
                     /product="oligopeptidase A"
                     /protein_id="BBN80525.1"
                     /transl_table=11
                     /translation="MSNPLIGLEGLPPFSKIQPDHIVPALKKAIAHCRDTIDEVLKND
                     AFTWQNLVLPLEEADDKLSRMWSPVSHMHSVVNSDALRKAYDECLPLISEYSTFAGQH
                     QGLYEAYKSLKESDAFAQLSMAQQTTIDNALRDFTLSGIALSEEKQKRFGEISARLSE
                     LAAKFGNNVMDATQAWQKHITDESQLSGLPESALALAKHTAEAKGLEGWVFTLDFPSY
                     LPVMTYADNRELREEAYRAFVTRASDQGPNANEFDNSSIMNEELALRHEAAQLLGFDS
                     YAHKSLATKMAESPAQVFTFLNDLAEKSKPQAQAEVDELVKFASNEHGIDKLEAWDYG
                     YYGEKLKQAKYAISDEQLRPYFPADTVLNGLFTTVQRLFGIKVTEIKEFDSYHPDVRF
                     FAIHDKNDELRGHFYLDLYAREHKRGGAWMDDCMGRKERANGQLQTPVAYLVCNFNKA
                     VGDKPALFTHNEVTTLFHEFGHGIHHMLTQVDAAPVAGINGVAWDAVELPSQFLENWC
                     YEEEALNFISGHYETGEPLPKELLDKLLAAKNYQSAMQMLRQIEFSLFDFHIHADYQG
                     DDKDYIQAKLNAVREKTAVIKAPEFNRFQHSFSHIFAGGYSAGYYSYKWAEVLSADAY
                     SKFEEDGIFNEQTGREFMEHILEKGGSEAPMVLFTRFRGREPKVDALLRHSGINSAA"
     CDS             567311..568447
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05110"
                     /product="hypothetical protein"
                     /protein_id="BBN80526.1"
                     /transl_table=11
                     /translation="MLAIDDDKLAHCIIEEALSSSCRLLHAKSGEEGIRLAQKYQPDI
                     ILLDVEMPGMNGFEVCEQMKTMEQLADTPVMFLSSKGSLSERMKGYNSGAADYIVKPF
                     ESLELLARIEVLDTYRKQSLQLKQDMERAQVTAEIAMTDSGDMGRIMRYVGQSYHAHD
                     LTSLSDYFFEFFVPLKLNVAVVFWYHDSEVFFSHNGTIQPIEQELLEKHRDGNRFVDF
                     GQRTIINYPKVSLLVKNMPIDDSALYGRYKDLLPHILEATNAKLKDMEISEEAISKVE
                     QIGFSFEELSEQLHSVDEQHARKVAEFTELTYQMRNTLPNEQAVQLEKLHEHFDFLNE
                     ELNIIKSKLNEITRVRYQLSESLSKIAKPWGEDEVAAQTDIELF"
     CDS             568547..569317
                     /codon_start=1
                     /gene="rsmJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KVR6"
                     /locus_tag="PA25_05120"
                     /product="ribosomal RNA small subunit methyltransferase J"
                     /protein_id="BBN80527.1"
                     /transl_table=11
                     /translation="MLIHTPFVENHPYLIELEARFALTQWASQSNKIDNPQFQLLYDE
                     KGLQLAKVDEPKLGAVLVDFVTGAAAHRRKFGGGKGQAIAKAVGLNKGATPHVLDATA
                     GLGRDAFVLAALGCKVTLHERHPVVAALLYDGLQRAYQDIEIGPWMKQNMQMQFGSSH
                     DLLASSQVQPDVVYLDPMFPHREKTALVKKEMRVFQDLVGADGDADNLLDFAYQLAQK
                     RVVVKRPDYAPFLNNKTPSMQIKTKKNRFDVYVKAAMK"
     CDS             569459..571384
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011074229.1"
                     /locus_tag="PA25_05130"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BBN80528.1"
                     /transl_table=11
                     /translation="MRVSSFTRLLAILLASASVFLAAVLVWASQVLSALDSQNMAYTQ
                     LKNTILIDLEGSIEDYLGTGDGQYLNQSSELIEKIKQQHLRVLPPVLSENMHMQLEQL
                     NTDINGKYRALGKLSGNEMALLDNALRQMSGSASSLINYTLKAPEHELAASYHQLAGD
                     YYAQVSNLSIYTYQLVMSFDEDTENNLQQTVSRLQKLADQINRLDNLGVMSEVDEDEL
                     FFGAEAEDLAEEIKAELTSWPNRFERDLRSTLTQSKKRQSGIRSLRADIKKVSGVMLS
                     AEQQLKTQQDALSERVLIIFGIAIGLLMLLAAGVYLVQRNQVLQPLRHLRDGFAYLIE
                     SNDLKNIQSKNPNTELGEIATYFNQLIERQRAEAQEREQMLKVINEFMQQMSDHLAKI
                     SEQSDTTYARVEQTQTMLEQVKSLGSEASDINSQVSDNANQTFSAMNQSVNFAESMLS
                     ASSKNQQRVEEGLESLNELLTGVADVGKVIEIIRNIAEQTNLLALNAAIESARAGEHG
                     RGFAVVADEVRKLAQQTQDSLTDINAQLNILGENSGRVSTQISALAEDAELQTHHAQE
                     LKKNSEGVAKSAQNANQVASHAMELAQQQSGLLDNFSEEMDQMKSQVNSSSQQVCDIQ
                     ARLQEQMQQIKHSLGLV"
     CDS             571774..571932
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05140"
                     /product="hypothetical protein"
                     /protein_id="BBN80529.1"
                     /transl_table=11
                     /translation="MFNEGVTVGTFSAANSEKSKVRLELLLYDDYEQRLNSYRQAYAG
                     QDELTLYI"
     CDS             complement(572140..572643)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05150"
                     /product="hypothetical protein"
                     /protein_id="BBN80530.1"
                     /transl_table=11
                     /translation="MQQVIQLTVEHTTYQTIYWGKAKCYTQGEWLAKYYSYSILRSVH
                     LSKGSGLDYKSCWAEIPFERQQASTTEICDYKPTTPISLYRVEGDTTAIVTLNGSDQD
                     GSITRYELWVDGVRQTGNTAQLVGAQGDSFEVRGRVTDNDGDTTETSKSVSLIFRPPA
                     RYDKYLC"
     CDS             complement(573186..573566)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05160"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="BBN80531.1"
                     /transl_table=11
                     /translation="MYNALNVVSAFDVGNGLSLYQQAAQNKGQEGQIDRDIIDILACK
                     DCIVTLDALHRQTNTLETIVKNKGDFIIQVKANQRNLHNAITEHFKAHYDSKGQREET
                     QSNDHAHGRSESRLVMQLPSKLPK"
     CDS             574198..575004
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05170"
                     /product="hypothetical protein"
                     /protein_id="BBN80532.1"
                     /transl_table=11
                     /translation="MKVRVLKNTAVLAVLLASSSVFANAVQNDSRLEYQTGNVIYAIP
                     ANQAENVDTIIDLIDSNNDVSPFGVTKVELEGSEVIHTGFADIKASGNLIALKPYNAT
                     DVNAPDETFRFTCPSNMFLQRVSSYHVNWAEDRRFSFECAKFKTASGSRVYRGSVRWS
                     GFVNEPDQALNYTCRDGEFLVGMYSEHVQWAEDRRFKFACAAMRENSYLGTFLKPELC
                     SEDGPSSLDRPWDLGTTRGALIGMKSEHVNWAEDRKTTVTYCLDANNDDW"
     CDS             575711..576277
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05180"
                     /product="hypothetical protein"
                     /protein_id="BBN80533.1"
                     /transl_table=11
                     /translation="MMLVSRNSYLAVSNGTNPHVEFWGVWAEYNERVLSCCYKWLHND
                     SDQIEDAMALTREKAFHAYRNNIGCIENMFAWLCRIAHNVCMDIHRLSSKENDLVGIV
                     SGSPSQFYFSENYSRTLESDYESRDLYQQLSHAINDLPNDLKQAIQYKFIYEMEYAEI
                     AQRLQITPENVRKRVQLARKKLSALRAC"
     CDS             576454..576969
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010932308.1"
                     /locus_tag="PA25_05190"
                     /product="transcription antitermination protein NusG"
                     /protein_id="BBN80534.1"
                     /transl_table=11
                     /translation="MNNQRQWFVVYTKANCEKKFADQVNKLQSNCEAFLPVIQQSKQW
                     SDRVKVIDTPLFKSYVFVFIDGNEFQQLKRFSGFVSYVKFNNLPAIINQNEIEKIKQF
                     VLNGNIVDVLANRLVKGMHIEITSGSLKGYRGKLVERRNKKFVAVEVEGLEQSMLLTL
                     PVELLKPVQED"
     CDS             576972..577400
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q83CS4"
                     /locus_tag="PA25_05200"
                     /product="lysozyme"
                     /protein_id="BBN80535.1"
                     /transl_table=11
                     /translation="MAVLTEQGLQMLKEQLLRYEGLSLKPYQCTQGKVTIGIGRNLTD
                     RGITLEEANFLLSNDIKDVLVQVSSNISVFNTLNEARKLILLDMAFNLGVAGLTKFKK
                     MIAALEGQNYEDAAREMLDSRWANQVGHRAKELAEKMIEG"
     CDS             577404..579383
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05210"
                     /product="hypothetical protein"
                     /protein_id="BBN80536.1"
                     /transl_table=11
                     /translation="MSSHAFNLDSGQSALERETAHRLYVFANALKSQDEQVGDAFANL
                     HEVLDKLIATPRFKHVCRVFSLSTQEISMLALVYLQAQDPDLIAPFLGLSWFEQGPML
                     SLDKLLTLLDSALNKQQSMVHINCGSAVFKWGLLRLQNDEYDLQRSVYITPFVQSFLC
                     FGSYKSTELNYFALLPLQADPVFSACGYVQHELMNFDLVQLQGGDEQLNQWFVAQSAV
                     QHQVKAAQYITEQAEQINFNDVVRELACLLLQASGEPVLLYWPNLAALPKAYLRKLST
                     LLSSNNTLTLITQSEDLTLGDIFTNTHSEPMQEPSLAQRAQAWLALCANEVATEQDKT
                     YANQLAAKYPVALANMQRLAEKAKQYDPSDYWQTLQGLCFESQSQYCDELAKLCQARY
                     TLKDMMLQDKVATQLHELVARVNMQTTLQARLPRFNQGCKALFWGKPGTGKSMAAEAI
                     AGELQLPLYIVNLANIASKWIGETEKHLAKLFDSAERNNAVLMFDEADAIFAKRSEVE
                     SSHDKNANMGVSYLLQRMEHYSGLLLLSTNFKNNLDEAFLRRFHGVIEFTLPTEQERI
                     AIWTHHLAGNADSHLQQGINKLAALFELSAAQIINICEVALLQSLMANKPLIGRNEIA
                     MAIHREMAKQHGGFMAQQSLTNWLQGDKHGSNAYL"
     CDS             579361..579999
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05220"
                     /product="hypothetical protein"
                     /protein_id="BBN80537.1"
                     /transl_table=11
                     /translation="MDPTLIYKVQQALKALLEQTVLPYSNNVLLGLGGSQTKLSFQAP
                     DKAFFDKIVSDIPVINCYLIGITEDIQRRQSEPPRTQMNFTQTHRTRFIEPRFISLSY
                     MMTVWSKDEEQGAEIEHLFLSHLIAGLGKFDFIPEDIMQAQQIDISPYGVRSQLFGNE
                     HSEKITGQVWQALGSTPKPTVIYSLSLPMPVFDPVQLPIIKEMNNKLDNKPS"
     CDS             580095..582644
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05230"
                     /product="hypothetical protein"
                     /protein_id="BBN80538.1"
                     /transl_table=11
                     /translation="MSTSDRNAEIKSYFQRGDIPTQEDFGELVDAATTDKIANQRLPE
                     QIDLSVLGQSSLLKAKVLIGDGAQITNIANQHLPKQIDLTTATGDGTASLTTEQLTAT
                     TVSAAALIGDGAQVTNLANSNLPKHIDLTAATGDGSASLTTEQLSATTVSANALIGDG
                     AQVTNLANSNLPKQIDLTTATGDGTASLIADKVYATLIGDGSQVTGLDVSNLSGGKID
                     NSLLNEASQSTQGIAKFATVSDLENGTIDSVVSAGDLKSALDSSKGYVDQELALLQAG
                     IKFKREVATVFTDNYDLTLGVPTELVNGYLIQTGDRVLFSAQDALAENKVWVAQADNT
                     WLLAEDFDNTPEQELSAGISVEVLKGSDLEYSIWTVSEVSTVDTQVLLTWRKRNDVVN
                     YQPGDGIVFDGLTIKGDQTWVEGVVQNTTINASSLQGEIASNQIANTIENKTFTGNGA
                     GLTDLNADNIISGSLDITRLPSQLDFTRGDTVANSSVQASRFIGDGSELSNISIGNLP
                     VASLEEVLAGDQSKLTTAQHGAWLNQKIDVLSCLTRIPLPIACIETTQDIDIDNVPSE
                     IDGYALKNGDLVLFNAQVNQRENHIWQVNKLTEGFSAQPTDLYLPTDMRQGDAVIISH
                     GDRYQNQAFLLKTHHRTESGDVYKWQATETLSIAGTGLVQDNSRFSVDFASEDDVTNR
                     ALDKVVGSALLQQQLTTLTPSQLQFSGANQPSVQSIAQNLEAIGAQAEQTLPTVSAVN
                     TLLNKIQAVDSQSHNTDFTIEHNTTCFLQLNAGQEVTITLDESVNHFRVIDFASWDNT
                     NAIVLSQASQANTLKLQLETSLKKIDFYKVDNGWHIFDGMGNKGELQASPA"
     CDS             582753..583259
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05240"
                     /product="hypothetical protein"
                     /protein_id="BBN80539.1"
                     /transl_table=11
                     /translation="MNNFINVIQKLEELSARDSNQTLNINQLSSALYKVRTDMAQHLD
                     TQSTDLHRIEDIADVLGYSGRVQAKLTEWPTDQLANPSLDLVLLGLMDVFIDDRILIQ
                     EGQWQGIYQVKDQGGTRVIDQTDRQLIPEDAVVVVKRLDGVGTVIEHIICQLSGNVWT
                     ERVILAAP"
     CDS             583273..583761
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05250"
                     /product="hypothetical protein"
                     /protein_id="BBN80540.1"
                     /transl_table=11
                     /translation="MFTTLRERLKRYFITGAKPTQAQFAEFLDAALIQSDDGITKQSS
                     ELGQVLTFSLPEHHQANTVFQQSVCIQGDLIVEGQLLGAPSSSTTTTPTNQVYSAPAN
                     QHVAYANTQSASVPIGCILLYCGAHIPEGFLACDGLNGTPNLAPPVDNPIQPIRYIIK
                     MR"
     CDS             583842..584210
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05260"
                     /product="hypothetical protein"
                     /protein_id="BBN80541.1"
                     /transl_table=11
                     /translation="MYQSLSHDQQELETRPVQRQAMSREARLKDNVGSMMGVDLSHVN
                     VHTNSSKPAQLNAHAYAQGSEVHIAPGQERHLGHELAHIGQQMQGRVQATTQFAGQAV
                     NDDPKLEHEADVIGAKAESM"
     CDS             584344..585759
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05270"
                     /product="hypothetical protein"
                     /protein_id="BBN80542.1"
                     /transl_table=11
                     /translation="MYEQIEKPKENTASADSRKSRAVANSFSQKKNGGKLANQFLDNR
                     PEAVTQRQLLKNISSDVYEKQLTPVPLLQHQSALQKKDLTQKNGGHLLGAATDTNFAL
                     APGMQVAPDRGNLYAKTLAPAVTPANKIAAIGEIATEMGRIGAFESKKNYHYRKSWGQ
                     VGGPLKMNMLRRIEAKVNNKIPEADRNIDDFYYASGPSFIFGTDQDKADLDREGQKLA
                     TRKNNLERGVGPEADYLNIEEIDSADMNAYRGNNTLRFLDPFVVDISVPYGAGAPYYT
                     LTMRVQYSVNAHGYVIKVTDTGAGIDSTINDGDAANPTGTGIPSTFNFKHDTTDNRDL
                     GTLVAGVNPANTRKQNEIGIDAHAKVAAEGSRWLCVKALGGTLHNNSKFYIAHVLTAA
                     DVFAGTPGQLGDNMTYYVDFKTLWGLWDSDFSADYNITNAVTRSKLVEKYKKASYREN
                     LIYRVATAGFAAGAGGYDLNQ"
     CDS             586643..587287
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05280"
                     /product="hypothetical protein"
                     /protein_id="BBN80543.1"
                     /transl_table=11
                     /translation="MLQLSRYIHRNPIETQSPLVEDLAQSPWSSYPACIGQAKAEPWL
                     ECEYTYAVLGHRYKFKQYQRFVLGGNDEELMTFYSKGNTASVLGCPSFKAWVQTQYFT
                     EVTRAAVIQQLQPELDITAIIAAVAAFYDCPISQLTEVNKGPTKGFEGRKVAMYFCQE
                     LLAANLRDIAKHFQLGHGGSVSFITHQIRQRQKSDKVFAQFLGEIFTFIMKQAA"
     CDS             complement(587370..589472)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011021631.1"
                     /locus_tag="PA25_05290"
                     /product="hypothetical protein"
                     /protein_id="BBN80544.1"
                     /transl_table=11
                     /translation="MRLQDHWAHKATVPTLCILLIVSVLAFVINGAYQVKQSRTFGQQ
                     VREQVKYQTLAAAKEVDNALSTIMTSVDSFADNVTTIHDKTYVATLLEDEFTVNEELY
                     SLNVTFHPYQYQSNIRYFSPYYERFSGTVRKYNLVDYDKPYDEFSWYHRPLKEGPVWT
                     EPYYEPQNNVLMTTYSVPFYKSKDAQSLGEPPLGVVPSDISLNQLTISLKQLDLGLGG
                     YGILFSQQKNLISHPVFSHVREMAHFNELVKEPEFAYLSKISGCFENDLEYLFFNGET
                     LSNDEHYAACTKIPNTNWTLITRMSADMFTMDKDKRRQSLIQIIAWGCASLTFMVLLL
                     TKNRKLTWTQNNVLLSVILILSTTMVLELARSFKTLEKSSNVTITTQAQREAFASSYK
                     DRLEKMHVASPVFIATGLYVESLEFLNANNVHLTGHAWQKLTAEQRKLIEPKLSFNHT
                     VNSEVTQAYRKELQGGGLLVGWRFSIETRQQFDYSKYPFDHKSIELSFNEADMGGNVI
                     LVPDLESYDKLSKMDNPAVSPTIVLDEWQLKSSYFVYRFENYNTNFGLDTFFNQNVAP
                     ELNYSINIEREFVGPFVTTLLPVMVMVCLLYACVVSMKYTPYGDLRNNITAVVFTILL
                     AHYSIREHLQIDEVVYFEIFYFLLYLVSSLFMLIAHQYYKAMALNGDGKIYKQLANIW
                     FWPMMTVSIFLITVLTYY"
     CDS             589913..590512
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05300"
                     /product="hypothetical protein"
                     /protein_id="BBN80545.1"
                     /transl_table=11
                     /translation="MKLPLACNAYYYSNFMSDELSTSLLNWLMSEFDLSQPEELEFPD
                     GTRSSILPWRMMFLAPNLASSDQFPLHHGRRADTCAELEQLRHQIAQCTGVNLAVAVC
                     LYYPNGEESLGFHSDLPAFGSTDVIASISLGAQREFLIRSQNNPSEQQSVTLEHGSLL
                     VMGKGFQDMYEHAVARGAVDMGPRFNISFRQFGYRQNEV"
     CDS             590787..591767
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010943398.1"
                     /locus_tag="PA25_05310"
                     /product="transposase"
                     /protein_id="BBN80546.1"
                     /transl_table=11
                     /translation="MPRPQRIEYPHAFYHVMNRGRERQTIFHDERYFQAFLVTLGEAQ
                     SRFGCIIHAYCLMSNHYHLLIETPNANLGRIMRHVNGVYTQRYNRLKQTDGPLFRGRY
                     KAILVEKGAYLLQLSRYIHRNPIETQSPLVEDLAQYPWSSYPAYIGQAKAEPWLEREY
                     TYAVLGHRYKFKQYQRFVQGGNDEQLMTFYSKGNTASVLGCSSFKEWVQTQYCTEVTR
                     AAVIQQLQPELDITAIIAAVAAFYDCPISQLTEVNKGPTKGFEGRKVAMYFCQELLAA
                     NLRDIAKHFQLGHGGSVSFITHQIRQRQKSDKVFAQLLGEILTFIMKQAA"
     CDS             591894..592919
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05320"
                     /product="hypothetical protein"
                     /protein_id="BBN80547.1"
                     /transl_table=11
                     /translation="MYDYAHQTKSQLERSHQAAQLSTKLMPSAIQKRGRDFSHVSQPF
                     CSSYLSKRLSSPSITTVLQRAVLTRAMHNISQEADTKEELGEALKQANYSNDIASEII
                     HRWLEKHSIAADEHVYAYFKNGYGIEIEKFYGGEEPSDEVDESYETQVAELVLNDTAH
                     GGGLYAEYLLAEGTDPIQAKRTPNSMSGPKDFTTSNSGDFEDSFYILGGSGEIDFETL
                     PTKAAHTAHVPPGKRKKTPLKHANITWTDPHSSGSKADSLINLNDHPDVKSNAVTIDT
                     DDRPQHFRLADYLYAKKKGWKFASDTSKFRNGKWTWHHLATQYHMVLVDMEVHAKHGH
                     NGGVFLW"
     CDS             593324..593878
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05330"
                     /product="hypothetical protein"
                     /protein_id="BBN80548.1"
                     /transl_table=11
                     /translation="MKNKLRLASFTALLLFVPQSYAKTVSYTGTNCVDKYAKQGESRL
                     KYRHHSASGIENTTDSSVTVFCPVNLEQDNLIDKVVVYASTHKANSSIFSCSLSVTGM
                     YNPGVTIASLSASNSDKARFGLELLANDAYEQRLQSYRQTYADNSEASAYLTCSIPGV
                     AQAHLNTKYGYTRLIGYTVKYKDY"
     CDS             594072..594671
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05340"
                     /product="hypothetical protein"
                     /protein_id="BBN80549.1"
                     /transl_table=11
                     /translation="MKLPLACNAYYYSNFMSDELSTSLLNWLMSEFDLSQPEELEFPD
                     GTRSSILPWRMMFLAPNLASSDQFPLHHGRRADTCAELEQLRHQIAQCTGVNLAVAVC
                     LYYPNGEESLGFHSDLPAFGSTDVIASISLGAQREFLIRSQNNLSEQQSVTLEHGSLL
                     VMGKGFQDMYEHAVARGAVDMGPRFNISFRQFGYRQNEV"
     CDS             594833..595690
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011038647.1"
                     /locus_tag="PA25_05350"
                     /product="esterase"
                     /protein_id="BBN80550.1"
                     /transl_table=11
                     /translation="MKSNVLIALFSLLPFFALYANEYQPVSMAGTQMVPIQDSKNNRQ
                     YALYIKLPKSYSTETAKRYPVLYFTDALWHMELLSGASYFLLEEMILVGISWQTDISE
                     QVKAKEGGYFSRYRDYSVQPSKDAAKQEKYQFGQANRHVAFIKNDVFSYVDNTFRTKP
                     HARTYFGFSLGGLFGAYALLTQPDMFKNYILGSPAIWRNSPYLFSKQSALLKDKNLKI
                     NVFISYGEREERLSKHVDELVTTLKGKQYPSISTIEHMVIDSSGHSDSFPMMGVASIK
                     WLSSLTSEL"
     CDS             complement(595928..598024)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05360"
                     /product="hypothetical protein"
                     /protein_id="BBN80551.1"
                     /transl_table=11
                     /translation="MTQPTIFYVQDFKIDLSQSLIIRGEQCSKVEPKVLKVLYVLAKH
                     QNEVVTHQVLMEQVWQGAEVVPNALQRCIAILRKELSDDAKAPKIIATHPKIGYRLLS
                     NVVWDPPSNERKKPQSNKHLRALKLTPATFSLVFACVLLLALQLFWVEDPHSQYAQLS
                     ELTRTDAHESHAIYSPNAQYVVFNRYAGQCKSHIWAKQLQSGHEAQLTSKAGQFGAVS
                     FTPDGRELVFAAHEQCNKTHNNTQKQSQCWALATLDFAQALSKPVTPNKRYQCNAQQL
                     MTPKALANHQYVFLQFDGIRNVLMHYNDLNKTTSTLYSSKKYAVYHFDYHPKRQQFAL
                     FTRAENAQPQLILLDKQAKVQHQVTLTSSPSHHAIEPLKGNYNAQGEYLLAVHNNQLF
                     KISLDGKVSKIATPSTRLVSAAQHPDKHTLIAVQGSKDIDIAVIELNTQSKRPTIDDL
                     NTIATPYPSLARSKEQERQARFIDEQRTVFISNLTGQDELWLTHTNNGKTQLTSNKQG
                     GAIHNYAWSNDNHQLAWASNGQLKITDLTGDTNVVSTHKPIYSVLNWVDNNTLLVLIN
                     DKAPNALYQFDIHHNALTSLKLEHVQNAWVNQDQLIFSTSQGGVFRRSITPSTTSPVP
                     LPAINGNALVIKNDAIYSVDKQTFTLNKYSTSGDLIQTLATLKPTAWKITDITSNKLL
                     LEQFIAIDQELVILQQ"
     CDS             598296..599768
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05370"
                     /product="hypothetical protein"
                     /protein_id="BBN80552.1"
                     /transl_table=11
                     /translation="MTLSVFANSKAQQVIKHAVNAYGANKLNTLKNIKVHDKQLHFSQ
                     WQSGHAHQGDMVSYLNEQQLEFAIDFSNQRKVFKRATTYLVGGHGSNSPSILHRLYSD
                     GKGYTVDHALLQTILSQRVTFENVDLGQSLLVDTLIVKQLNKDKAASLWSDIAYIQGQ
                     AHDVLTVFAGTKQEYVVYINRQTGYLARVLKRQGGQLASYDFLNHQHSKGLVWAKQVF
                     AGTEKGPLFYTDNRKVEFNGTDNALFSLPENYRPRPKVSPVDVSKHTIRELAPGVYYV
                     GKGWSYTLFVDVGDYFISAGAWQMAEQNQDWSNNVALLRQTTGSDKPIKQHVISHHHT
                     DHLMGVKDVLAQGAALIIHPNDIKAVQTHLNTTLEEKQLIKVSKQGQRIAGKLQLFDV
                     PNSHANHNLVIYLPEHKLLFTEDMFGSSFKKAFNSPSNWPDLDAFHRLKLLSDKINQL
                     GLDVEQFVSSHHYRVLNKAELEQAKAITLHAKEVLLDRVF"
     CDS             complement(599915..600133)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011704507.1"
                     /locus_tag="PA25_05380"
                     /product="hypothetical protein"
                     /protein_id="BBN80553.1"
                     /transl_table=11
                     /translation="MRDSLKARIIEVCNSKIAYKGDNVGLSFYAFFSNKNKDPELLME
                     AATWWIHTHQLDHFEKALKIKTMVEQEL"
     CDS             complement(600320..601354)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05390"
                     /product="hypothetical protein"
                     /protein_id="BBN80554.1"
                     /transl_table=11
                     /translation="MFKLNKSLHKWLSLFVGLQLIIWLATGLYFNLMDHKKGSGNANL
                     RPVAHTAGNLNAPLLPLKSLEFAPAKQVKLLWVLGHPYYQITHQSGVHSYQAKQVTLL
                     DAYTGQKAAINETLARTIALKSFKGATDIISATLLKPPINELPKQENPLWQVMLSDAE
                     NTNVYIDSHSGHVIAHINDDRRLRDLMFMLHFMDYFGTGGFNHWLIIVFAIATLLLSM
                     TGVTWLVERYKAGQLSIAFKSKKQRITIKELAQKQTHELELKTNISLFDGLADVGLQL
                     PSNCGGGGTCGLCRVKCNHSIGVTDADKAKLSSSKLEQGYRLACQHNTQAITEIEVRC
                     FASDKPHSKP"
     CDS             complement(601358..602029)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05400"
                     /product="hypothetical protein"
                     /protein_id="BBN80555.1"
                     /transl_table=11
                     /translation="MAFIGVQFLIWSITGLYMVTMDIHYIHGESLQRQNQHPIAVNQV
                     NYSLSDLHSEYPGAHQVTLTQLMAEPVYHFIDKDHTQRLIDAKTGQLLPLIDKLQALK
                     IAKHQYTSGDAIASVQLIDNQSQLPSELASRHLPVWQVVFDNVWAPTFYISQNSGDIV
                     TKRHFLWRLFDWMWRFHIMDYDDGENVANWFLLLIALLGTLAALFGATLTYQRVFKPN
                     SQGAN"
     CDS             complement(602049..605207)
                     /codon_start=1
                     /gene="cusA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011263309.1"
                     /locus_tag="PA25_05410"
                     /product="cation transporter"
                     /protein_id="BBN80556.1"
                     /transl_table=11
                     /translation="MIEAVIRWSVGNRFFVLLTTLIIAFAGVFSLKNTPVDAIPDLSD
                     VQVIIKTSYPGQAPQVVQDQVTFPLTTAMLSVPGAQTVRGYSFFGDSYVYIIFDDDTD
                     LYWARSRVLEYLSQVAASLPDSAKPQLGPDATGVGWVYIYALTDKTGKHDLSQLRSLQ
                     DWFLKYELQTVPGVSEVAAVGGMVKQYQVQVDPDKLRAYNIPLDHIQTALKRGNQETG
                     ASVVEMAEAEYMVTATGYIQSVSDIEKIPLGINEQGTPLRVGDVATVNLGPQMRRGIA
                     ELNGEGEVVGGVVVMRFGENAQKTIEGVKAKLASLQGSLPEGVEVVTVYDRSKLIENA
                     VDNLWSKLLEELAVVAIVCVVFLFHLRSSIVAVITLPLGILVSFIIMYMQGINANIMS
                     LGGIAIAIGAMTDGAIVMIENMHKHMEKTPLTDENRWQIVAKSASEVGPALFFSLLII
                     TVSFLPVFILEAQEGRMFAPLAYTKTYAMAAAAGLAITLVPVLMGYFIRGKVISERKN
                     PLNRMLIALYMPVLKQVMKFPKLTIVFAIAITVVGFYPVNKIGSEFIPPLDEGDLMYM
                     PTTYPGISIGKARELLQQTDKLIRTVPEVENVFGKVGRAETATDPAPLTMIETFIQLK
                     PKSQWRAGVTTETLKAELNELVTFPGLTNAWVMPIKTRIDMLATGIKTPVGIKVAGAD
                     LDIIQDIGQQIERILPEVAGTASVYSERVAGGRYIKVDISRQKASRFGLNIADVQQVV
                     ATAIGGMNVTQTIEGQERYPVNLRYPQDYRDSPEQLARLPVVTPSGERIALGDVARVY
                     IETGPPGIKSENARINGWTFIDIDGVDVGSYVANAQAHLAKNLDLPAGYSITWAGQYE
                     YMERAKAKLSYVLPLTLAIIIILLYLNFRALSEVAIIIVTLPMAMIGGLWLMYLEGFN
                     FSVAVGVGFIALAGVAVEIGVIMLVYLNQALQELKANAQQAGQTISQHMYREALLHGA
                     GMRVRPVMMTVATIIIGLLPILYGSGTGSEVMSRIAAPMVGGMSSAVLLTLIVLPAIY
                     SMVKQADIAQFNKGIENNDKNN"
     CDS             complement(605219..606964)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005482717.1"
                     /locus_tag="PA25_05420"
                     /product="hemolysin D"
                     /protein_id="BBN80557.1"
                     /transl_table=11
                     /translation="MSANKTTLIALLVGLALGVGVTASLQSPGSGNASNADTTDSSGE
                     KKPLYWVAPMDSNYRRDKPGKSPMGMDLVPVYEEDSGDDHGPGSVKIAPHVVNNLGVR
                     TAPVEFKSMHTQISTVGYVQYDEDQLVHIHPRVDGWVEKLYIKAVGNPVEKGQPLYTL
                     YSPQLVNAQEELLIALKRNNGSLINAAKDRLKALQLSEQFIRELEKTQKVHQTITFYS
                     PQSGVIDGLKIREGFYVKPGNTLMSIAKLDQVWVEAEVFERDTALIKQGLPVTMTLDY
                     LPGKTWQGSVDYVYPVLNSKTRTLRVRLKFDNPNSELKPNMFAQVAIDANIDDPVILV
                     PKESVIRTGKQDRVVLALGDGQFKSIAITIGRVGEQYIEVLDGLNQDDEVVTSAQFLI
                     DSESSKNSDFKRMEDNAPANAVWMQGEVNSVMATHSMVNITHDPVKEWDWPAMTMDFD
                     VAEQVDINTLKAGQTLHFEVTKTDDGNYQVTGIHIMSEPSNEVSSATVDGQINAIDKG
                     ARVLNISRGAIKKWDRPAATMDFLVSDEIDLSQFSTGDEITFTFEIRDDFVVTEIALK
                     ALDNSDASDAHTNHE"
     CDS             complement(606964..608349)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05430"
                     /product="hypothetical protein"
                     /protein_id="BBN80558.1"
                     /transl_table=11
                     /translation="MTKVFIQAALASLLIPFCASINAEQAAQQTISLNDAISLAQQND
                     PWLHSSRLKQSAVEHKSVAAGTLADPKVSIGMMNLPTDGWDFAQEGMTQFKVGVSQMF
                     PRGDSLAIKSAQLKTSAKQFPLQREDRHAQLTRLISELWLEAYLAQRTIALINQDRVL
                     FEQMAQIAKANYSNAIGKTRQQDVIRAQLEIIQLEDRLTVEQQKRETALERLNEWLQL
                     FSIDNLDNLQSLKAATPPIILPNELPKIALTYAQQLKPDAYQRSDAVTLLLNHPALRA
                     IDVKHQVSKKTIELSEQQYQPQWGVNASYGYRDDMPSGSSRADLFSVGVSFDLPLFTE
                     NKQDKQVAAAVAESEAIKTEKYLMLKQMLSALEKELAQLTRLSERQALYKQQLIEQTH
                     HQAEAALTAYTNDDGDFSDVVRARITELNANIAALKIDVDALKSVAKINYLLTQSNHT
                     MTEPTQQLGDQ"
     CDS             complement(608448..608780)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05440"
                     /product="hypothetical protein"
                     /protein_id="BBN80559.1"
                     /transl_table=11
                     /translation="MFKPISLILVAFAVLIALTGQAMAVATMPCETSLTNHQSMMEME
                     HGQTKSTMDCCDTQCTCPASACLSVVYLDNEHLPAFEYQIAEPRLHLLPQSPHAVTAS
                     LYRPPIIA"
     CDS             609138..610943
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011267118.1"
                     /locus_tag="PA25_05450"
                     /product="diguanylate cyclase"
                     /protein_id="BBN80560.1"
                     /transl_table=11
                     /translation="MGVNKTAELEKSILKNIIEHGTVTTLFQPIYDISKQEVLGFEAL
                     SRGADCLEMPERLFKAASEHNKLSELELLCREKAIERFVEQQLPGKLFLNVSPNTLLD
                     PCHPKGETRHLIEKYGLAANRVVIEVTEQDRVDDGFLLLKAIEHYRQLGFNIAIDDLG
                     AGYSGLKQWSELCPEYVKVDRYFIDFCDQSIVKREFLKSIIELAKATSTAVIAEGIER
                     VEELALLEKLGIVNAQGYLLAYPQKEPERALEASQWLALNLKPPTSSIEHSMSIGWLA
                     LAQSAIHQCTQCKDAHKNFEADKQLMSLAVVNDNREPIGLLHRDQLTEVFAAPYGHAL
                     YAKKSVMELMDKQPLIVDENAQLDQVSQQITEQEFDIRRHIIITRDGKYLGLAPLRDI
                     LKHITEEKIRHAQHANPLTMLPGNVAINEAIETRLRKQSGFSLAYIDLNHFKQFNDLY
                     GYASGDSVIKLLADVTVQACEGSPCFVGHIGGDDFMVVFDGDDAQQLCHQIISNFEQQ
                     SKAFFTPEHVKSGGYWATNREGQKQFVPLLTLSIGLVRPDLDNCKNSHQVAALATDAK
                     KEAKRYRNSYLFVCNRRRPSVSSVQHQHIETECSA"
     CDS             611047..611928
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003114256.1"
                     /locus_tag="PA25_05460"
                     /product="hypothetical protein"
                     /protein_id="BBN80561.1"
                     /transl_table=11
                     /translation="MRKFVLLCLLCSWAGCAVAGQVIYVAKEQRTLYDRDLYLYELLD
                     LALKKAQFDVQIEHVKVHPHQQRTLLALGQGEVDLHWSMTSPEREQLATAIRVPLFKG
                     FIGKRALLVNKSHLSQFDEIKSLADLSKLTAVQGHDWPDTKILGHNNLSVRPMANYKA
                     MFAMISRGRLDYFPRSFIEVGAELANQKTDNLVVLPSIYLHYPSAFYFFVNKEKPQLA
                     NALTKGLARLQASGEFDALFERYFADVLAKLPFDKDTQVLELQNPYFEIPVTAELSTP
                     PVVLNDSQAIPSKSKKH"
     CDS             complement(611974..612777)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011705600.1"
                     /locus_tag="PA25_05470"
                     /product="inositol monophosphatase"
                     /protein_id="BBN80562.1"
                     /transl_table=11
                     /translation="MHPMLNIAVRAARNAGKVILRACEDLSKVEAQQKGTNDFVTNVD
                     KDAEAVIRDTILKAFPEHSIVGEELGVIEGKDADYQWVIDPLDGTTNFIKGIPHFAVS
                     IALKVKGRVEQAVIYDPIRSELFTASRGQGAQLNSKRIRVTKSTEIAGSVLGTGFPFK
                     QKHHIDAYTEAFKALFVHTADIRRAGSAALDMAYVAAGRLDGFFEIGLKPWDTAAGEL
                     LVKEAGGMVMDFAGGAGYNQSGNIICGAPKLCQLMVKEMRPVLTESLLR"
     CDS             613007..613732
                     /codon_start=1
                     /gene="trmJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0KJ30"
                     /locus_tag="PA25_05480"
                     /product="tRNA (cytidine/uridine-2'-O-)-methyltransferase
                     TrmJ"
                     /protein_id="BBN80563.1"
                     /transl_table=11
                     /translation="MALQDIRIVLVNTSHSGNIGSVARAMKTMGLSKLYLVDPACEVD
                     SHASALAAGATDVLGDATIVNELSEAIEDCALTIGTSARSRTLSWPMVEPRECAQKLV
                     KESQNGPVALVFGRENSGLTNEELQLCNYHVCIPANPEYSSLNLAMAVQTLTYETRMA
                     FLDTQDAQPEADEAVYPSAKQMELFYAHLESTLNDTGFIIKQHPGMVMTKLKRLFNRA
                     RPEDQELNILRGILTSINKSTNK"
     CDS             613961..614452
                     /codon_start=1
                     /gene="iscR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q0WD07"
                     /locus_tag="PA25_05490"
                     /product="HTH-type transcriptional regulator IscR"
                     /protein_id="BBN80564.1"
                     /transl_table=11
                     /translation="MKLTSKGRYAVTAMLDVALHAEIGPVPLADISERQEISLSYLEQ
                     LFARLRKHGLVRSVRGPGGGYLLGRDVQSISVGDVINAVDESVDATRCHGEGGGCQSG
                     MRCLTHTLWSDLSVRIEEFLNNISLAELVANSDVQSVASRQDKSVNSAMKQLDNIQVS
                     CQL"
     CDS             614477..615691
                     /codon_start=1
                     /gene="iscS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A0A0H3CNC4"
                     /locus_tag="PA25_05500"
                     /product="cysteine desulfurase IscS"
                     /protein_id="BBN80565.1"
                     /transl_table=11
                     /translation="MKLPIYLDYAATTPVDQRVADEMMQCLTMDGNFGNPASRSHRFG
                     WQAEELVDQARNDIADLINADPREIVFTSGATESNNLAIKGAAHFYKKKGKHIITVKT
                     EHKAVLDTCRELERQGFEVTYMEVEENGLLDLKKLEAAMRDDTILVSVMHVNNELGVI
                     QDIATIGEMCRERKIMFHVDGAQSAGKVKIDLQELKVDFMSFSGHKAYGPKGVGALYV
                     RRKPRARLEAQMHGGGHERGMRSGTLATHQLVGMGAAFRIAKEDFDKDHAHISALRQR
                     LIDGVMSMDEVYFNGAIEQSVPGIVNISFNFVEGESLLMAVKDIAVSSGSACTSASLE
                     PSYVLRALGRNDELAHSSIRFSIGRFTTEEEIDYTVNLIKDSIGRLREMSPLWEMHQE
                     GIDLDSVEWAHH"
     CDS             615744..616127
                     /codon_start=1
                     /gene="iscU"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EEU8"
                     /locus_tag="PA25_05510"
                     /product="iron-sulfur cluster assembly scaffold protein
                     IscU"
                     /protein_id="BBN80566.1"
                     /transl_table=11
                     /translation="MAYSEKVIDHVENPRNVGSLDKNDPSVATGMVGAPACGDVMKLQ
                     IKVSEQGIIEDAKFKTYGCGSAIASSSLVTEWVKGKSLEEAATIKNTDISAELELPPV
                     KIHCSILAEDAIQAAIADYKSKQAK"
     CDS             616140..616463
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q87S26"
                     /locus_tag="PA25_05520"
                     /product="iron-binding protein IscA"
                     /protein_id="BBN80567.1"
                     /transl_table=11
                     /translation="MAVTLTDAAANRVQAFLANRGKGIGLRVGIKTTGCSGLAYVLEF
                     VDELDEGDEVFEHNDVKIIVDAKSLVYIDGTELDYTKEGLNEGFKFNNPNQKDECGCG
                     ESFTV"
     CDS             616560..617084
                     /codon_start=1
                     /gene="hscB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8EEU6"
                     /locus_tag="PA25_05530"
                     /product="co-chaperone protein HscB"
                     /protein_id="BBN80568.1"
                     /transl_table=11
                     /translation="MRYFELFNIPVDYNVDLAKINQQYLELQRVVHPDRFAGKGERDK
                     LLAVQKTAEINDALAVLKHPVKRAEYMLSERGVDIRAEQQTLQDPMFLMQQMEMREAL
                     EELPQSDDVEAAIEQFEQQIKALDVEFSQQLAQQLSSDSEQDLQQAADNIRKLKFVYK
                     LRDELARIEDSLFD"
     CDS             617132..618994
                     /codon_start=1
                     /gene="hscA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q9KTX8"
                     /locus_tag="PA25_05540"
                     /product="chaperone protein HscA"
                     /protein_id="BBN80569.1"
                     /transl_table=11
                     /translation="MALLQIAEPGQSAAPHEHKLAIGIDLGTTNSLVATVQSGEAKTL
                     ADFDGSVMLPSVVRYQAEGVVVGSAAQQASAEDPTNTLISVKRFLGKTQLEIEQSYGQ
                     LPYEFEQTDSGLAVNTVAGPVSPVQASAEILKSLRARAEASFAGEELQGTVITVPAYF
                     DDAQRQSTKDAAELAGLKVLRLLNEPTAAAVAYGLDSGQEGVIAVYDLGGGTFDISIL
                     RLNQGVFEVLATGGDSSLGGDDFDSALVSLFKLQTGINDLNAKELRLFINKAKACKEA
                     LSSYETVNVKLELREQSHTVTVTRAEFAELVMPLVKKTLRACRRAAKDAGVSNEEILQ
                     VVMVGGSTRMPVIREQVEGFFEKQPLTSIDPDRVVAIGAAIQADILVGNKPDSDMLLL
                     DVLPLSLGLETMGGLVEKIIPRNTTIPVARAQEFTTFKDGQTAMSLHVLQGERELVDD
                     CRSLAKFSLKGIPPMAAGAAHIRVTFKVDADGLLSVSAMEKSTGVQAEIQVKPSFGLS
                     DDQVAQMLKESMSNAKEDMQARMLKEQQVEALRVLEALEASLATDSALLNEQELAHLR
                     EQMTLLAQAREQAQSPDEIKNAIEKVDAASSEFASRRMDVSIKQALQGQSVDEV"
     CDS             618996..619334
                     /codon_start=1
                     /gene="fdx"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005417920.1"
                     /locus_tag="PA25_05550"
                     /product="ferredoxin, 2Fe-2S type, ISC system"
                     /protein_id="BBN80570.1"
                     /transl_table=11
                     /translation="MPQIIFLPHEELCPEGAAIEAPKGQTVLDAALKNGISIPHACEK
                     SCACTTCHVIVREGFDSLDESDELEDDMLDKAWGLEAESRLGCQAVIADEDLVVEIPK
                     YNLNIVNEEH"
     CDS             619590..621023
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011105930.1"
                     /locus_tag="PA25_05560"
                     /product="NAD-dependent succinate-semialdehyde
                     dehydrogenase"
                     /protein_id="BBN80571.1"
                     /transl_table=11
                     /translation="MVLFMQLKHSLIAGEWYQGAQHFAVINPANAHVLEEVSEVDEEG
                     VNQSLSAAKDAFVQLKNTSAAQRSQILYRWYELVIKEKESLAKLLTQEQGKPLKEALG
                     EVEYAAGFILWFAEQAKRNYGEIIPANDDEHQLRTIKQGVGVVLGITPWNFPLAMITR
                     KVAPAYAAGCSFLLKPSEQTPLSALALAKLALMAGMQKGVFQVLLTSDSAGLIKPLCE
                     NPDIRKLTFTGSTKVGATLLSQCAGTIKRTSMELGGNAPFIIFESANIDHAITGLMAA
                     KFRNAGQTCVAANRILIQQNIEQTVLDGLQKQVAQLVVGDGLAEDVDIGPLITVEAKQ
                     KAQKLVDDAIAQGAQVVYEGKKLDGHFMAPVILKGVTADMKIAQQEVFAPVVSVMSFS
                     DETQALSIANGVNEGLAAYFYSQDVSQIHRVSSALEYGMVGINEGMVSNPVAPFGGVK
                     RSGLGREGAHQGLDEYLEIKYLCQKFD"
     CDS             621117..621995
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070726.1"
                     /locus_tag="PA25_05570"
                     /product="hypothetical protein"
                     /protein_id="BBN80572.1"
                     /transl_table=11
                     /translation="MQQRVDAPTLIVLAGGLGSRFGGSKQITPLPILNRTIMELSIED
                     AYAAGVRRAVLIINAHIRHRLEQQILPRLPSDLEILLVEQHVSAVPEQFMEYAKHRQK
                     PWGTGHALLTAKPYIVGPAIVITADDYYGKQAYIQMVQHFDRAPQHMAMVAYPLKHTL
                     SSLGGVNRGICQLEGDKLVAVKECESIQQTERGITGLIDNQEQAIPSDTLASMTFWGI
                     TEALFVALEVGFHEFLRNYDSDVKKEYYLPTCIEQCIVSKQMDLTVYSAEDHWYGVTF
                     KEELAAVAGKINEQRS"
     CDS             622045..623118
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011070727.1"
                     /locus_tag="PA25_05580"
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="BBN80573.1"
                     /transl_table=11
                     /translation="MENSAVAAQLSQQFGLDGEQSVMNPIGNGHINTTMLLKDGEQAV
                     VVQKLNTDVFPKPEHLVENARAIEQHLAEKANNGEYTLNIIKHLPTVENDYLVNLEGG
                     VWRALEFIGGSYSEDVVDSVDKAQTAANAFGLFAKALDDFEAKQLHHVIPDFHNLAKR
                     IEAFEQVLAEDPHGRASECAQVIAFCQSQFSLADELHNTCKEIPLRPCHNDTKINNML
                     FCSKTNQSKAVIDMDTCMPGYWLFDFGDMVRTFCSPEAEDSLNLDNVIVRENIFCAIV
                     KGYVEPLAEILTEQEKQSFLLGAKVMPFMIGLRFLTDYLDGDNYFATHRAQHNLQRAR
                     NQFKLYQDVLAKEESLKNILARY"
     CDS             623240..624619
                     /codon_start=1
                     /gene="nagA_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8ECL7"
                     /locus_tag="PA25_05590"
                     /product="alpha-N-acetylgalactosaminidase"
                     /protein_id="BBN80574.1"
                     /transl_table=11
                     /translation="MTKMNRRAFLKAAGSAVGAAALTSTLSGCAQSASSIPTTRQGRS
                     VMGLVSEKLDIVRVAFIGVGQRGFGHVKRMSQIEGTRIVAICDTHGEVLNRSVDYLVE
                     QGAPKPKVYTGADLAYLDMLASDDIDIVIISTPWKWHAPMAIDTMNSGKHAFVEVPLA
                     LTVEEMWDIVNTAERTQRHCMMMENVNYGRDELMVLNMVRQGLFGELLHGEAAYIHEL
                     RWQMKEVEHKTGSWRTDWHTKRNGNLYPTHGLGPVSQYMNINRGDRFDYLTSMSSPAL
                     GRAAYAQREFSPEHQRNQAKYIAGDMNTTMIKTVQGRSIVVQHDTTTPRPYSRHNLIQ
                     GTNGIFAGFPNRIALEHGGDKSFHDWDYDMQRWYNEYDHPLWLRMGEEAQRNGGHGGM
                     DFLMFWRMIYCLRNGEPLDQDVYDGAAWSVISPLSAQSVMNRSVSVDIPDFTRGAWQQ
                     GKPLGIVGV"
     CDS             624704..625162
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05600"
                     /product="hypothetical protein"
                     /protein_id="BBN80575.1"
                     /transl_table=11
                     /translation="MPSEVALEHTVADYIEVYQERKNFERLLSFYAPSAQLEDMIYGH
                     FATDRNAIAKFYDWPNSKLTVLEGKPLFTVEQKVVDPLQNIAFFSGVFHRFSYFGEEL
                     GPWRFLIKLQFDKQGKIIHQQDWINYTPRSLITEGKNLNTPFLVDDKKGK"
     CDS             625163..625411
                     /codon_start=1
                     /gene="ykoF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072659.1"
                     /locus_tag="PA25_05610"
                     /product="hypothetical protein"
                     /protein_id="BBN80576.1"
                     /transl_table=11
                     /translation="MKISVEISKYPLHQEYIPFIKDFIERLNQHPELKVMTNSMSTQV
                     FGDYDVVMSVLQKNMKASFEAYGKIVFVCKFISGDLSV"
     CDS             625411..626037
                     /codon_start=1
                     /gene="pnuT_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011072658.1"
                     /locus_tag="PA25_05620"
                     /product="nicotinamide mononucleotide transporter"
                     /protein_id="BBN80577.1"
                     /transl_table=11
                     /translation="MTHSIEGIFSSLIASVYWEYMAALSGLIYVVLAVLERRSCWYAG
                     FVSTGMYAAMYWYDDVLVESILNIYYMLMAVIGWWVWRQGTKNSPLPIVSWSWQKHMC
                     IIALTSISALMLGALSHALYDYITLSYFDSFTLCFAVVVTYLVVKKVLENWLYWVVIN
                     MAPMYVYFMNGYYPTLALALLFTLISCIGYKCWYESYELKQGKALAQL"
     CDS             626024..626845
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05630"
                     /product="hypothetical protein"
                     /protein_id="BBN80578.1"
                     /transl_table=11
                     /translation="MLSSKLNTQAASDQLQRLMPAITCHTLTPLNKGLSNDNFLVESS
                     MGRLLLKSYKEHFPLGALKSQQQLARCQDITANVHAWDETLGIAVFDFLPGTDSPVML
                     TDSLLSTVLTVHQFEPSHTFSYASERLDILPLLKQLDKHIIREMEEAWAWSVAVLERL
                     PKTLAFFHNDLVKENLIVGKQGSKIIDFEYAAYNDTFFDLAALCCSFELTRAHRSNLL
                     ERYFALKKQLLPKYADNKLAAYQLGYLLLSIQWYEHRGHAELAIPLRHQLEQWQV"
     CDS             complement(626842..627024)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="PA25_05640"
                     /product="hypothetical protein"
                     /protein_id="BBN80579.1"
                     /transl_table=11
                     /translation="MTPMTTEQVAEFLGVKVERVKRLARENLLVAKDQDAEGHPIFDK
                     SDVEKYKELAQRLGGI"