LOCUS       AP017609               14428 bp    DNA     circular INV 28-SEP-2016
DEFINITION  Ramazzottius varieornatus mitochondrial DNA, complete genome,
            strain: YOKOZUNA-1.
ACCESSION   AP017609
VERSION     AP017609.1
DBLINK      BioProject:PRJDB4588
            Sequence Read Archive:DRR013908, DRR013909, DRR013910
            BioSample:SAMD00054187
KEYWORDS    .
SOURCE      mitochondrion Ramazzottius varieornatus
  ORGANISM  Ramazzottius varieornatus
            Eukaryota; Metazoa; Ecdysozoa; Tardigrada; Eutardigrada;
            Parachela; Hypsibiidae; Ramazzottius.
REFERENCE   1  (bases 1 to 14428)
  AUTHORS   Kunieda,T., Yokobori,S. and Katayama,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2016) to the DDBJ/EMBL/GenBank databases.
            Contact:Takekazu Kunieda
            The University of Tokyo, Department of Biological Sciences,
            Graduate School of Science; 7-3-1 Hongo, Bunkyo-ku, Tokyo
            113-0033, Japan
            URL    :http://www.biol.s.u-tokyo.ac.jp/users/saibou/kuma/
REFERENCE   2
  AUTHORS   Hashimoto,T., Horikawa,D.D., Saito,Y., Kuwahara,H.,
            Kozuka-Hata,H., Shin-I,T., Minakuchi,Y., Ohishi,K., Motoyama,A.,
            Aizu,T., Enomoto,A., Kondo,K., Tanaka,S., Hara,Y., Koshikawa,S.,
            Sagara,H., Miura,T., Yokobori,S., Miyagawa,K., Suzuki,Y., Kubo,T.,
            Oyama,M., Kohara,Y., Fujiyama,A., Arakawa,K., Katayama,T.,
            Toyoda,A. and Kunieda,T.
  TITLE     Extremotolerant tardigrade genome and improved radiotolerance of
            human cultured cells by tardigrade-unique protein
  JOURNAL   Nat Commun 7, 12808 (2016)
  REMARK    Publication Status: Online-Only
            DOI:10.1038/ncomms12808
COMMENT     Project website
            URL: http://kumamushi.org/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: PCAP.REP assembler v. 06/07/05;
                                     SOAPdenovo v. 1.3
            Assembly Name         :: Rvar_4.0
            Genome Coverage       :: 177.5x
            Sequencing Technology :: Sanger: ABI 3730xl DNA Analyzer;
                                     Illumina: Genome Analyzer IIx sequencer
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..14428
                     /db_xref="taxon:947166"
                     /mol_type="genomic DNA"
                     /note="contig: MT"
                     /organelle="mitochondrion"
                     /organism="Ramazzottius varieornatus"
                     /strain="YOKOZUNA-1"
     CDS             1..1533
                     /codon_start=1
                     /gene="cox1"
                     /locus_tag="RvY_mtCox1"
                     /product="cytochrome c oxidase subunit 1"
                     /protein_id="BAV58161.1"
                     /transl_except=(pos:1..3,aa:Met)
                     /transl_table=5
                     /translation="MRWMFSTNHKDIGTLYFIFGIWAATVGSSLSMIIRSELSEPGSL
                     FAEEQLYNVTVTSHAFIMIFFFVMPILIGGFGNWLVPLMIGAPDMAFPRMNNLSFWLL
                     PPSFLLISTSTMAEQGAGTGWTVYPPLSNYFAHSGPAVDLTIFSLHIAGVSSILGAIN
                     FISTIINMRTPAMSMENMPLFVWSVLITAVLLLLALPVLAGAITMLLLDRNFNTSFFD
                     PAGGGDPILYQHLFWFFGHPEVYILILPGFGLVSQIIVHYSGKHLTFGHLGMIYAMST
                     IGLLGFIVWAHHMFTVGMDLDTRAYFTAATMIIAIPTGIKVFSWLSTIYGSKSLMHAP
                     MQWVLGFIFLFTLGGLTGIVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIIAGITH
                     WFPLFTGTQMNNKWLTAQFFSMFIGVNMTFFPQHFLGLAGMPRRYVDYPDTFYLWNNV
                     SSLGSILSIAATIFLFFIIWESLISQRKILFIASSNSVMEWKHNFPPVLHSYSQLSLI
                     NY"
     CDS             1535..2216
                     /codon_start=1
                     /gene="cox2"
                     /locus_tag="RvY_mtCox2"
                     /note="TAA stop codon is completed by the addition of 3'
                     A residues to the mRNA"
                     /product="cytochrome c oxidase subunit 2"
                     /protein_id="BAV58162.1"
                     /transl_except=(pos:2216,aa:TERM)
                     /transl_table=5
                     /translation="MASWEQLNFQNSFSPLMEQFIFLHDHIMSILTLIMLIVGYSLSK
                     LCLSKFNVTKQSENHELEILWTFLPGVFLIIIAFPSLRLLYLSEESEKSPLNIKTMGH
                     QWYWSYEYSDFKDLEFDAFMSPVEKTTSFRLLETDNHTCIPTNTPIQMFVSSTDVLHS
                     WTIPAMGVKADSTPGRLNIINIIAMKPGLFYGQCSEICGTNHSFMPITLDTRPIFFFK
                     EWVKTMINS"
     tRNA            2217..2279
                     /anticodon=(pos:2244..2246,aa:Lys,seq:ttt)
                     /gene="trnK(uuu)"
                     /locus_tag="RvY_mtTrnK"
                     /product="tRNA-Lys"
     tRNA            2280..2344
                     /anticodon=(pos:2313..2315,aa:Asp,seq:gtc)
                     /gene="trnD(guc)"
                     /locus_tag="RvY_mtTrnD"
                     /product="tRNA-Asp"
     CDS             2345..2503
                     /codon_start=1
                     /gene="atp8"
                     /locus_tag="RvY_mtAtp8"
                     /product="ATP synthase F0 subunit 8"
                     /protein_id="BAV58163.1"
                     /transl_table=5
                     /translation="MPHMSNLPWMSIYITMFVMMNLIFMSYSSPLHNSTNKKLSTKLL
                     SEKNKWLW"
     CDS             2497..3156
                     /codon_start=1
                     /gene="atp6"
                     /locus_tag="RvY_mtAtp6"
                     /product="ATP synthase F0 subunit 6"
                     /protein_id="BAV58164.1"
                     /transl_table=5
                     /translation="MMTSLFSSFDPMSGFFSMNYLSFLTLLMSPICMDFMFLQKSRNK
                     FINLDMYASIESELKSTISNSFKKGKTNILMGVFFSLLLMNLAGLVPYVFTSTAHMTV
                     TLSMTLPFWLGFISFSLINNTNHFFSHLVPLSTPLPLSQFMVIIESVSQLIRPITLSV
                     RLAANMTAGHILMGLASSNVTMLNLSSSILIMLIILETAVAFIQSYVFTILISMYMNE
                     A"
     CDS             3156..3939
                     /codon_start=1
                     /gene="cox3"
                     /locus_tag="RvY_mtCox3"
                     /note="TAA stop codon is completed by the addition of 3'
                     A residues to the mRNA"
                     /product="cytochrome c oxidase subunit 3"
                     /protein_id="BAV58165.1"
                     /transl_except=(pos:3939,aa:TERM)
                     /transl_table=5
                     /translation="MINQNHPFHLVFNSPWPIFTGSSVLTMLIGTVNWMCTKSPTMMN
                     MGLLLTIFNTSQWWRDVSRESSYQGYHSNLVMNGLRWGMILFITSEILFFFSFFWSFF
                     HSSLAPNLELGLMWPPLGIAAINPFQVPLLNTSVLLASGVFVTWAHHGLIEQNNKIMN
                     TNMMVTVVMGLYFTSLQAWEYWESSYSMSDSSFGSTFFLATGFHGLHVLVGTIFLLVS
                     LMRHNLNMYSLNHHLGLEASIWYWHFVDVVWLFLYSFLYWWSY"
     tRNA            3940..4000
                     /anticodon=(pos:3970..3972,aa:Gly,seq:tcc)
                     /gene="trnG(ucc)"
                     /locus_tag="RvY_mtTrnG"
                     /product="tRNA-Gly"
     CDS             4001..4343
                     /codon_start=1
                     /gene="nad3"
                     /locus_tag="RvY_mtNad3"
                     /note="TAA stop codon is completed by the addition of 3'
                     A residues to the mRNA"
                     /product="NADH dehydrogenase subunit 3"
                     /protein_id="BAV58166.1"
                     /transl_except=(pos:4343,aa:TERM)
                     /transl_table=5
                     /translation="MMIPTFSLIAIIIILMALSYVMKTQNRVKWQEKMSNFECGFDSN
                     HTNRMAFSLRFFIITVIFLVFDIEIAVILPSPMVEESLSIKSSTMINWSFFTLLLGGL
                     IFEWQQGALEWS"
     tRNA            4344..4405
                     /anticodon=(pos:4375..4377,aa:Ala,seq:tgc)
                     /gene="trnA(ugc)"
                     /locus_tag="RvY_mtTrnA"
                     /product="tRNA-Ala"
     tRNA            4406..4458
                     /anticodon=(pos:4424..4426,aa:Arg,seq:tcg)
                     /gene="trnR(ucg)"
                     /locus_tag="RvY_mtTrnR"
                     /product="tRNA-Arg"
     tRNA            4465..4525
                     /anticodon=(pos:4493..4495,aa:Asn,seq:gtt)
                     /gene="trnN(guu)"
                     /locus_tag="RvY_mtTrnN"
                     /product="tRNA-Asn"
     tRNA            4526..4582
                     /anticodon=(pos:4546..4548,aa:Ser,seq:gct)
                     /gene="trnS(gcu)"
                     /locus_tag="RvY_mtTrnSgcu"
                     /product="tRNA-Ser"
     tRNA            4583..4644
                     /anticodon=(pos:4614..4616,aa:Glu,seq:ttc)
                     /gene="trnE(uuc)"
                     /locus_tag="RvY_mtTrnE"
                     /product="tRNA-Glu"
     tRNA            complement(4644..4706)
                     /anticodon=(pos:complement(4673..4675),aa:Phe,seq:gaa)
                     /gene="trnF(gaa)"
                     /locus_tag="RvY_mtTrnF"
                     /product="tRNA-Phe"
     CDS             complement(4707..6348)
                     /codon_start=1
                     /gene="nad5"
                     /locus_tag="RvY_mtNad5"
                     /note="TAA stop codon is completed by the addition of 3'
                     A residues to the mRNA"
                     /product="NADH dehydrogenase subunit 5"
                     /protein_id="BAV58167.1"
                     /transl_except=(pos:4707,aa:TERM)
                     /transl_table=5
                     /translation="MTLWLSGFFFVFFLIMTFFLFSMGVTVIEFQLFTSFFTSLSVSF
                     VIDFYSILFASVVSFISAMIFFFSQFYMDGDTQQKGFSLLLSGFVISMFFLIFSPNLF
                     FLLLGWDGLGLVSYLLVVYYMSVSSSVAGMLTFLMNRVGDIFFLFSLSLFSLFSLFSY
                     FDNKALVFVQMGAFFLLITFITKSAQIPFSSWLPAAMAAPTPVSSLVHSSTLVTAGVF
                     LLIRFSPLMLKFFYFLIVISVFTMLMAGTMANLEWDMKKIIAYSTLSQLSFMMLSYST
                     GLIIFCFFHLLTHALFKASLFMSGGLVIHSEDSSQDFRNMSPFSSGKKLFASSFVVCI
                     LSLCGFPFLSGFFSKDLILDTLLSSFVLIILFLIGVFMTILYSLRFSYYMLISLSSFR
                     SSLSGVYENVKYLILPIWSLIIFSIVMGSFWSEFFFNFFFFFTYLLSIWKLFYLMLVA
                     FLSLAYMFILKKIFFLKLYFFSFMWVLNQNMTARGVKLFTIMADKIFCFLDQSWWEFY
                     GPQNIFFSFTSASVLVMSFVEWSLVYFFALFIFLLFFFI"
     tRNA            complement(6349..6410)
                     /anticodon=(pos:complement(6376..6378),aa:His,seq:gtg)
                     /gene="trnH(gug)"
                     /locus_tag="RvY_mtTrnH"
                     /product="tRNA-His"
     CDS             complement(6414..7745)
                     /codon_start=1
                     /gene="nad4"
                     /locus_tag="RvY_mtNad4"
                     /product="NADH dehydrogenase subunit 4"
                     /protein_id="BAV58168.1"
                     /transl_table=5
                     /translation="MRYFSILILLIMLSLPLMMFSFLGAVDLAVLFVLFLFTIFTGGP
                     IFFISEILFFDKISFLLIILSFWLFSLMFLLGQKYKILKVSLMKYKMYMYILMSFIVF
                     SVMFSDLMAFYIFFEISLVPLVFIILGWGYQVERVQAFFYLFLYTMFGSLPLLFFFLL
                     TYSYLSLDWLMLYYLKNYSENFVLLLFLAMMIAFFIKLPLYGFHLWLPKAHVEAPVSG
                     SMILAAVLLKLSLYGFYRVSPLMKPLFFFFFFALVFLFWGALLSSLVCLRQTDMKSLI
                     AYSSVGHMGVMLGGFFFFSQMGLKAAIIIMMSHAFCSSALFYLVNFHYERSYSRQIFN
                     NRGQFIFFGMLMSFWFLFLAINFSAPPFLSLVGELGVFISSFGKDLTYMYVLGLASFV
                     VAAFCIYLFSVVIHGLGLKHYILQVEMDLNFFVLSYHFLPALLMVLLLDFF"
     CDS             complement(7724..7996)
                     /codon_start=1
                     /gene="nad4L"
                     /locus_tag="RvY_mtNad4L"
                     /product="NADH dehydrogenase subunit 4L"
                     /protein_id="BAV58169.1"
                     /transl_table=5
                     /translation="MSFLFSFMLIYMAFLFVLKFDHLLSIFISLEFLGLFLFMLLIFF
                     LNYFFLFTLFFLVITASESVLGLTLFVYFIRSSMKDYVYSFGILVF"
     tRNA            7998..8060
                     /anticodon=(pos:8029..8031,aa:Thr,seq:tgt)
                     /gene="trnT(ugu)"
                     /locus_tag="RvY_mtTrnT"
                     /product="tRNA-Thr"
     tRNA            complement(8060..8122)
                     /anticodon=(pos:complement(8088..8090),aa:Pro,seq:tgg)
                     /gene="trnP(ugg)"
                     /locus_tag="RvY_mtTrnP"
                     /product="tRNA-Pro"
     CDS             8124..8621
                     /codon_start=1
                     /gene="nad6"
                     /locus_tag="RvY_mtNad6"
                     /product="NADH dehydrogenase subunit 6"
                     /protein_id="BAV58170.1"
                     /transl_table=5
                     /translation="MKEIMIMSSITLWFFSLFQHPLILVGILTVQSAPAIYSALHASH
                     SGWMAFLLFLIFLGGLLIIFVYLSALIPNEIFLPSRMENASFSLLALLPILWSMKTIK
                     FSFFNHSQSPVSDFAHLFYHNMFTFMLCYLFISLTATMYITSKYKTPMKSSYYDKYTK
                     NPPPN"
     CDS             8623..9675
                     /codon_start=1
                     /gene="cob"
                     /locus_tag="RvY_mtCob"
                     /product="cytochrome b"
                     /protein_id="BAV58171.1"
                     /transl_table=5
                     /translation="MMNSALVDLPAPSNITHFWNFGSLLGVCLMTQIITGIFLAMHYS
                     SSIDLAFDCISHLMRDVQGGWLMRVIHANGASLFFLAFFIHIGRGLYFKSYVLNMTWI
                     SGVTIFLMSMMTAFLGYVLPWGQMSFWGATVITNLLSAVPYIGTPLVEWVWGGFSVNN
                     ATLTRFFSLHYLLPFVISLLVIVHLTFLHEQKSSNPLGLRLGSDKITFHPYFSLKDLT
                     SLLLIMFMFMMINYTFPFSLMDAENFIPANPMVTPVHIQPEWYFLFAYAILRAIPNKL
                     GGVMALLLSILMLIPLILQSSMKQFNKENQKNMFFWFFVMIFLILTWLGMKPVEEPFL
                     SMSIVSTFFYFSWFFI"
     tRNA            9677..9733
                     /anticodon=(pos:9695..9697,aa:Ser,seq:tga)
                     /gene="trnS(uga)"
                     /locus_tag="RvY_mtTrnSuga"
                     /product="tRNA-Ser"
     CDS             complement(9733..10650)
                     /codon_start=1
                     /gene="nad1"
                     /locus_tag="RvY_mtNad1"
                     /product="NADH dehydrogenase subunit 1"
                     /protein_id="BAV58172.1"
                     /transl_table=5
                     /translation="MLFMFDVSVYYFQVLIFVMVAVAFLTLVERKVLSYSQLRKGPNK
                     LGFVGLLQPFADALKLFSKEEMVPVSSNFLLYWFSPILGFVITMLLWVSLFSFSGYLD
                     FKFSLLFFLCCISLSVYGVIFSGWSSNSKYALMGGLRTVAQTVSYEITLAFIFLSLVF
                     FFVSYSFFEIYNFHTYFSFFFFLFPLAVVFFISCVVETNRAPFDLAEGESELVSGFNV
                     EYGGLKFALIFMAEYASILWMSLLCTFFLFLNFSFLFNFCFFSFFVFLFLIFRSSFPR
                     LRYDYLMYLTWKKFLPLVLIFFFFSFLLV"
     tRNA            complement(10651..10712)
                     /anticodon=(pos:complement(10681..10683),aa:Leu,seq:taa)
                     /gene="trnL(uaa)"
                     /locus_tag="RvY_mtTrnLuaa"
                     /product="tRNA-Leu"
     tRNA            complement(10716..10778)
                     /anticodon=(pos:complement(10748..10750),aa:Ile,seq:gat)
                     /gene="trnI(gau)"
                     /locus_tag="RvY_mtTrnI"
                     /product="tRNA-Ile"
     tRNA            complement(10779..10834)
                     /anticodon=(pos:complement(10803..10805),aa:Leu,seq:tag)
                     /gene="trnL(uag)"
                     /locus_tag="RvY_mtTrnLuag"
                     /product="tRNA-Leu"
     rRNA            complement(11224..12351)
                     /gene="rrnL"
                     /locus_tag="RvY_mtRrnL"
                     /product="large subunit ribosomal RNA"
     tRNA            complement(12352..12406)
                     /anticodon=(pos:complement(12386..12388),aa:Val,seq:tac)
                     /gene="trnV(uac)"
                     /locus_tag="RvY_mtTrnV"
                     /product="tRNA-Val"
     rRNA            complement(12407..13157)
                     /gene="rrnS"
                     /locus_tag="RvY_mtRrnS"
                     /product="small subunit ribosomal RNA"
     tRNA            complement(13158..13224)
                     /anticodon=(pos:complement(13193..13195),aa:Gln,seq:ttg)
                     /gene="trnQ(uug)"
                     /locus_tag="RvY_mtTrnQ"
                     /product="tRNA-Gln"
     tRNA            13221..13282
                     /anticodon=(pos:13251..13253,aa:Met,seq:cat)
                     /gene="trnM(cau)"
                     /locus_tag="RvY_mtTrnM"
                     /product="tRNA-Met"
     CDS             13283..14242
                     /codon_start=1
                     /gene="nad2"
                     /locus_tag="RvY_mtNad2"
                     /product="NADH dehydrogenase subunit 2"
                     /protein_id="BAV58173.1"
                     /transl_table=5
                     /translation="MNKNLPLMSMFYLISLMGMISSNNWFMFWIFMEMNSLCFIPLML
                     IKKTKKGGEASLLYFIVQGISSMFLLMAMINEESSLMDVSEPNSSLITVAFLKMGAGV
                     FFNWLFLLSFSITLSILLLILTLQKLSGFFLLLLSQAGLSYLMLIFIFLSSFMAMFIN
                     MKQNLFKSMLTVSSLSNTSWLLTAVVTTYSGWMFYFAVYSFSLVLSSTMNNKYLDQNY
                     RNSDTLENPLLFLSMGGLPPMPGFFPKILILMNLSYSRLSLLSIFLLLAACVDIFIYL
                     RFSFTSALKNNGNLMYCKAVTTKSIKMLSLSAVTMVTMMAIML"
     tRNA            14244..14306
                     /anticodon=(pos:14274..14276,aa:Trp,seq:tca)
                     /gene="trnW(uca)"
                     /locus_tag="RvY_mtTrnW"
                     /product="tRNA-Trp"
     tRNA            complement(14305..14360)
                     /anticodon=(pos:complement(14336..14338),aa:Cys,seq:gca)
                     /gene="trnC(gca)"
                     /locus_tag="RvY_mtTrnC"
                     /product="tRNA-Cys"
     tRNA            complement(14364..14426)
                     /anticodon=(pos:complement(14394..14396),aa:Tyr,seq:gta)
                     /gene="trnY(gua)"
                     /locus_tag="RvY_mtTrnY"
                     /product="tRNA-Tyr"
BASE COUNT         5780 a         2364 c         1768 g         4516 t
ORIGIN      
        1 ctgcgatgaa tattttcaac aaaccataaa gatatcggaa ccctatattt tattttcggc
       61 atttgagccg ccacagtggg aagatcactt agtataatta ttcgttccga acttagagaa
      121 cccggctcac tgtttgccga agagcaactt tacaatgtca cagtaaccag acatgccttt
      181 attataattt ttttttttgt tatacctatt ctgatcggag gctttggaaa ctgattagtc
      241 ccacttataa ttggggcgcc ggatatagct ttcccacgaa taaataattt aagattttga
      301 cttctgcccc cctcttttct attaatctca acaagcacaa tagctgaaca gggggcagga
      361 acgggatgaa ctgtataccc gcctttatcc aattattttg ctcatagtgg ccctgccgta
      421 gatttaacca ttttctctct ccatattgct ggcgtctctt caattttggg agcaatcaat
      481 tttatttcca caatcattaa catgcgaaca cctgccataa gaatagaaaa cataccatta
      541 tttgtgtgat cggttttaat tacagccgtt ttactgcttt tggcccttcc tgtactagct
      601 ggtgctatta ccatactttt acttgaccga aattttaata cttctttttt cgatccagca
      661 gggggagggg accctattct ataccaacac ctattttgat tttttggcca cccagaagtt
      721 tatattttaa ttcttccggg gttcgggcta gtgtctcaaa ttattgtaca ttacagagga
      781 aaacatctga ctttcgggca cctaggaata atttatgcca tgagaacaat tggtctatta
      841 ggatttattg tatgagctca tcacatattt actgtaggta tagatctaga cactcgagct
      901 tacttcacag ccgcaactat aattattgca attcctacag gtattaaagt tttcagatga
      961 ttaagaacaa tttacggaag aaaatctcta atacacgccc ctatacaatg agtattgggt
     1021 tttatttttc ttttcaccct tggaggatta acaggaattg tcttgtccaa ctcctcgtta
     1081 gatattgttt tacatgatac ttactatgtc gtagctcact tccactatgt tctctcaata
     1141 ggagctgttt ttgcaattat cgcgggaatt actcattgat tcccgctttt tacaggcacc
     1201 caaataaata acaaatgatt aacagcgcag ttttttagaa tatttatcgg agttaatata
     1261 acattttttc ctcaacattt tctaggacta gccgggatac ctcgacgata tgtagattac
     1321 ccagatacgt tttatttgtg gaataatgtt tcttcattag ggtctatctt gtctatcgca
     1381 gctacaattt ttttgttttt tattatttga gaaagcttaa tttcacaacg aaaaatttta
     1441 tttatcgcaa gctctaatag agtaatagaa tgaaaacaca actttccgcc agtgttgcac
     1501 tcatatagcc aactaagatt aattaattac taaaatggct agctgagagc aattaaattt
     1561 tcaaaacaga ttttcacctc ttatagagca atttattttt ttgcatgacc atatcatatc
     1621 tattctcaca ctaattatac ttattgttgg atacaggctg agtaaattat gccttagcaa
     1681 atttaatgta actaaacaaa gagaaaatca cgaattagaa attttatgaa cttttttgcc
     1741 aggagtattt ttaattatta tcgctttccc gtctttgcgt ttactttact tatcagagga
     1801 aagagaaaaa tctcccttaa atattaagac aataggacac caatgatatt gatcatatga
     1861 atacagagat tttaaagatc ttgaatttga tgcttttata agacctgtag aaaaaaccac
     1921 ttcttttcgt ttgctagaaa cagataatca tacctgcatc ccaactaaca ctcccattca
     1981 aatatttgta tcttcaacag atgttttaca ctcatgaacc attccagcta taggagtaaa
     2041 agctgattcc actccaggac gactgaacat tatcaatatt attgcaataa aaccaggttt
     2101 attctatgga cagtgttcag aaatttgcgg aacgaaccac agttttatac ccatcaccct
     2161 tgacacacga ccaattttct ttttcaaaga atgagtaaaa acaataatta acagataatt
     2221 ttaaagcttt aatgcatcga gcttttaatt cgaagacaca gaatagtctg tttaaattag
     2281 aaaatttaat taaaaaaaaa taatataaag ttgtcaactt taaattacca gactgtaatt
     2341 ttctataccc cacatgtcaa acttaccgtg aataagaatt tatatcacca tatttgttat
     2401 gataaatcta atttttataa gttattcatc ccctctacat aatagtacca ataaaaaact
     2461 ctcaacaaaa ttattgtctg aaaaaaacaa atgattatga taacaagact gttttcatcg
     2521 tttgacccca taagaggttt tttttccata aattaccttt cttttttaac tttgctaata
     2581 agaccgattt gtatagattt catattttta caaaaaagtc gaaacaaatt tatcaactta
     2641 gatatatacg catcaattga aagagagtta aaaaggacaa tttcaaactc ttttaaaaaa
     2701 ggaaaaacca atattcttat gggtgtattc tttagtttat tgcttataaa tttagcaggc
     2761 ttagtacctt atgtattcac aagaacagct cacataactg taaccctatc aatgacacta
     2821 ccattttgac tgggttttat ttcattcagt cttattaata acacaaacca tttttttagc
     2881 catttagtgc cactaagcac cccccttccg ctctcacaat ttatggtaat catcgaaaga
     2941 gtaagtcaac ttattcggcc aattacttta tcagtgcgat tagctgctaa tataacagct
     3001 ggacacattt taataggact tgcaagtagc aacgtgacta tgttaaactt atctagcaga
     3061 attcttatca tgcttattat tttagaaacg gcagtagctt ttattcaaag atatgtattc
     3121 actattctaa tctcgatata cataaatgaa gcctaatgat caatcaaaat catccctttc
     3181 atttagtttt taacagacca tgacctattt ttacgggaag aagtgtatta accatgctta
     3241 tcggaactgt aaattggata tgtactaaat cccccacaat aataaacatg ggactcttac
     3301 tgacaatttt taacacctcc caatgatgac gcgatgtttc acgggaaaga tcttaccaag
     3361 gctatcatag gaacttagtc ataaatgggc ttcgatgagg aataatctta tttattactt
     3421 ccgaaatttt gtttttcttt tcgttttttt gaaggttctt tcatagaaga ctagcgccca
     3481 acttggaatt gggattaata tggccaccct taggaattgc agccattaac ccattccaag
     3541 ttcctctttt aaatacttca gttcttctag caagaggagt ttttgtaact tgagctcatc
     3601 acggcttaat tgaacagaat aataagatta taaatacaaa tataatagta acagtagtaa
     3661 taggcttata cttcacttcc cttcaagctt gagaatactg agaatcatct tactcaataa
     3721 gagattcaag atttggaaga actttctttc tagcgactgg atttcatgga cttcacgttt
     3781 tagtgggaac aattttttta ttagtgtctc taatgcgaca caacctaaat atgtactctt
     3841 taaaccatca tttaggctta gaagcttcta tctgatactg acattttgta gacgtagtct
     3901 gattgttttt gtatagtttt ctttattgat gaagttatta cacttttaat atatttagta
     3961 tatttgattt ccaatcaaaa agtttgactc aaacagtgta atcataattc ctacatttag
     4021 acttattgca atcattatta tcttaatagc cctctcctat gtaataaaaa ctcaaaatcg
     4081 ggttaaatga caggaaaaaa taagaaattt tgagtgcgga tttgattcta accacactaa
     4141 ccgaatagcg ttttctttac gattttttat tattacagta atttttttag ttttcgatat
     4201 cgaaattgct gtaattcttc cgagccccat agtagaagaa agtctttcca ttaaaagaag
     4261 aacaataatt aattgaagat tttttacctt actattgggg ggcctaattt ttgaatggca
     4321 gcaaggtgct ctagaatgat catgggagtg tatttaaaat aataaaattt aaattgcaat
     4381 taaaaattgt caacgacctc acccaaaata agatatggta gtttcgacct acttttagat
     4441 tcatttaatc cttatttatc ataataaatt gtgactgaaa cagtgtttag atgttaacta
     4501 aaatcataag aaaacttcaa tttaaagaat ttaaaattta aagccgctaa ctttaataat
     4561 tgtgcatagc atgaagattc ttaaataaat aatgtaaact aacatattat aatttcatta
     4621 taaaaatgcc aaaggtttta ttttgtaaaa gaaaattact tttattagat tcttcaaatc
     4681 taagctttaa tataagctac ttaaacagat gaaaaaaaat aataaaaaaa taaaaagtgc
     4741 aaaaaaatat accaatcttc actcaacaaa agacatcaca agaacagaag ctgaagtaaa
     4801 agaaaaaaaa atattttgag ggccataaaa ctctcaccaa ctctggtcta aaaaacaaaa
     4861 aattttatca gctataatag taaataattt aacacctcga gccgtcatgt tttgatttaa
     4921 aacccatata aaactaaaaa aatataattt taaaaaaaaa atttttttta agataaatat
     4981 ataagccaaa gacaaaaatg ctactaatat caaataaaaa agttttcaaa tagataataa
     5041 ataagtaaaa aaaaaaaaaa aattaaaaaa gaactctctt caaaaagaac ctataacaat
     5101 agaaaaaata attaaactcc aaattggcaa aatcaaatac ttcacattct cgtacactcc
     5161 agataaagat gaacgaaaag aagaaaggga aataagcata taataagaaa atcgtaacga
     5221 atacaaaata gtcataaaca ccccaattaa aaataaaata ataagcacaa accttcttaa
     5281 taaagtatct aaaattaaat ctttagaaaa aaacccagat aaaaagggaa acccgcacaa
     5341 agacaaaatg caaactacaa aagaagaagc aaataatttt ttgccggaag aaaaaggaga
     5401 tatattacga aaatcctgtc ttctgtcttc tctatgaata accagccccc ctcttataaa
     5461 aagagaagct ttaaacaaag catgagttaa taaatgaaaa aaacaaaaga tgattaaacc
     5521 agttgaataa gaaagtatta tgaaagaaag ttgtcttaaa gtagagtatg caataatttt
     5581 tttcatatct cattctaaat tagctattgt cccagctatt aatatggtaa aaactgaaat
     5641 aacaatgaga aaataaaaaa acttcaatat caaaggacta aaccgaatca gaagaaatac
     5701 cccagccgtt acaagtgtag aagaatgaac taatgacgaa actggagtgg gggctgctat
     5761 cgcagctgga agccaagacg aaaaaggaat ctgggctctc tttgtaataa aagtaattaa
     5821 taaaaaaaaa gctcccattt gtacgaatac taaagcttta ttatcaaaat atgaaaataa
     5881 tgaaaacaaa gaaaacaaac taagagaaaa aagaaaaaaa atatctccga ctcggtttat
     5941 caaaaaagtc aatattcctg ctactgaact ggaaacactc atataataaa ccactaataa
     6001 ataagaaact aagcccaaac cgtctcatcc aagaagtaaa aaaaataaat taggactaaa
     6061 aattaaaaaa aacatagaaa taacaaaacc actcaacagc aaagaaaacc ccttttgctg
     6121 agtatctccg tccatataaa attgagaaaa aaaaaaaatt atagcagaaa taaaactaac
     6181 aactgaagca aacaaaatag aataaaaatc aattacaaaa gaaacagata aagaagtgaa
     6241 aaaagaagta aacaattgaa attcgataac tgtgacccct atactaaata aaaaaaaagt
     6301 cataataagg aaaaaaacaa aaaaaaaccc ccttagccat aaagtcaata ttagttggaa
     6361 agccattttt gtaaccacaa tacaatattt tacacttaaa ttaaactaat actttaaaaa
     6421 aaatctaata gcaagactat taataatgca ggcaaaaaat gatatgaaag aacaaaaaaa
     6481 tttaaatcta tttcgacctg caaaatatag tgcttcaacc ccaatccgtg aatcaccact
     6541 ctaaacaaat aaatacaaaa agctgccaca acaaaacttg ctaaccctaa aacatatata
     6601 taagtcaaat ctttgccaaa agatctgata aaaacaccca actctccaac taatgacaga
     6661 aaagggggag ctgaaaaatt aattgctaaa aacaaaaatc aaaaagacat aagtatccca
     6721 aaaaaaatga actgaccccg gttattgaaa atttgacgag aataagatcg ctcataatga
     6781 aaatttacta aataaaaaag agccctagaa caaaaagcat gagacattat aataataatt
     6841 gcagctttta accctatttg tctaaaaaag aaaaaccccc caagcatcac tcctatatga
     6901 ccaacggaag aataagcaat taaagatttc atatccgttt gtcgcaaaca tactaaacta
     6961 cttaataaag cacctcaaaa taaaaaaacc aaagcaaaaa aaaaaaaaaa aaataaaggc
     7021 tttattaaag gtgaaacacg ataaaatcca tacaatctta actttaataa aacagcagct
     7081 aaaattatag accccgaaac aggagcttcg acatgagcct tagggagtca taaatgaaag
     7141 ccgtaaagag gcaacttaat aaaaaaagca attattatag ctaaaaataa taataaaaca
     7201 aaattttccc tatagttttt taaatagtat aatatgagcc aatctaacga taagtaactg
     7261 taagttaaca aaaaaaaaaa tagcaaaggt aaagaaccaa acatagtata aagaaataaa
     7321 taaaaaaaag cttgaacacg ttcaacctga tagccccacc ccaaaataat aaaaactaga
     7381 ggcacaagag aaatttcaaa aaaaatgtaa aaagccatta aatctgaaaa catgactgaa
     7441 aaaacaataa aacttatgag aatatatata tacattttgt attttatgag agacactttt
     7501 aaaattttat acttttggcc caacaaaaat atcaaagaaa aaagccaaaa agatagaatg
     7561 ataagcaaaa aagaaatttt atcaaaaaat aaaatttcag agataaaaaa aataggaccc
     7621 ccagtaaaaa tggtaaacaa aaataaaaca aaaagcacag ccaaatcaac cgcacctaag
     7681 aaagaaaata ttattaaagg caagcttaat ataattaata aaattaaaat actaaaatac
     7741 cgaatctata aacataatct tttatagaag aacgaataaa ataaacaaaa agagttaaac
     7801 ccaatacaga ttccctagct gtaataacta aaaaaaataa cgtgaacaaa aaaaaataat
     7861 ttaaaaaaaa aattaaaagc ataaataaaa acagccccaa aaactctaaa gaaataaaaa
     7921 tagaaagaag atgatcaaat tttaatacga aaagaaacgc catataaatc aatataaatg
     7981 aaaaaagaaa agaaatagct aaaatagttt aaataaaaac gcagaccttg tatgtctaca
     8041 atacttaaaa gtttttaact tcagaaagaa aatcacatct taaatctcca aaatttaaat
     8101 tttatagtta aactatttcc gaaataaaag aaatcataat cataagaaga atcactttat
     8161 gatttttcag ccttttccag caccctttaa ttctagtagg cattttaact gtccaaagcg
     8221 ccccggcaat ttattccgct ctacacgctt cacacagggg atgaatagct tttttattat
     8281 ttttaatttt tttaggggga ttgttaatta ttttcgttta tctttcagcc ctgattccta
     8341 acgaaatttt tttaccctcc cgcatagaaa atgctagatt ttctctctta gcattgctgc
     8401 caattttgtg atcaataaaa actattaaat ttagcttttt taaccataga cagaggccag
     8461 taagagattt tgcccactta ttttatcata atatatttac atttatactg tgttatttat
     8521 ttatttctct taccgcgaca atatatatca catccaaata taaaacacca atgaaaagat
     8581 cttattatga caaatatacg aaaaacccac cccctaatta aaatcataaa ttctgctcta
     8641 gtggatctac cagccccttc taatatcact cacttttgaa attttggatc tcttttaggg
     8701 gtatgcttaa taactcaaat tattacaggc atttttttag caatacacta cagatcaaga
     8761 attgacttag cttttgactg tattagacat ttaatacgag acgtgcaagg gggttgacta
     8821 atgcgagtaa ttcacgccaa cggagcatca ctattttttt tagccttttt tattcatatt
     8881 ggtcgaggat tatattttaa atcatatgtg ctgaatataa cttggatcag aggagtaact
     8941 atttttttaa tatcaataat aacagcattt ttaggctatg tcttaccttg aggacaaata
     9001 tctttttgag gagcaactgt aatcacaaac ttattatcgg cagtccccta tattggaaca
     9061 cctttagtgg aatgagtgtg aggaggcttt tctgtaaata atgcaactct tactcgattt
     9121 ttttcattgc actatttatt accttttgtc attagactat tagtaattgt tcatttaact
     9181 tttctccacg aacaaaaatc cagcaaccca ttaggcctac gattggggag ggacaaaatc
     9241 acttttcatc cttatttttc tttaaaagac ctaacgtcac tacttttaat tatattcata
     9301 ttcataataa ttaactatac tttcccattt tctttaatag acgcagaaaa ttttattccc
     9361 gcaaacccta tagtcacacc cgtgcacatc caaccggaat gatattttct attcgcctat
     9421 gctattctac gcgcaattcc taataaatta ggaggtgtca tagcacttct actgtcaatc
     9481 ttaatattaa ttcctttaat tttacaatca tcaataaaac aattcaacaa agaaaatcaa
     9541 aaaaacatgt ttttttgatt ttttgttata atttttctaa tcctaacatg attaggaata
     9601 aaacctgtag aagaaccttt tttaagaatg agaattgtaa gcacattttt ttatttcaga
     9661 tgatttttca tttaaaaacc gctatctaat gttttgaaaa cataaaaaaa gtattaaata
     9721 tacttatcgg ttttaaacta aaaggaaaga aaaaaaaaaa aaaataagaa ctaagggtaa
     9781 aaactttttt caagttaaat atattaaata atcataacgc aaacgaggaa atgaagaacg
     9841 aaaaattaaa aataaaaaaa caaaaaaaga aaaaaaacaa aaattgaata aaaaagaaaa
     9901 gttcaaaaaa agaaaaaaag tacataaaag tctcattcat aaaatgctag catattcagc
     9961 tataaaaatt aaagcaaact tcaaacctcc gtactctaca ttaaaaccgg agactagctc
    10021 agattctccc tcagccaaat caaaaggagc tcgatttgtt tcaacaacac atgaaataaa
    10081 aaaaactact gccaaaggaa aaagaaaaaa aaaaaatcta aaataagtat gaaaattata
    10141 aatttcaaaa aaactgtatg aaacaaaaaa aaaaactaaa gacaaaaaaa taaaagcaag
    10201 agtgatttcg taagaaacag tttgagcaac agtacgcaga ccccctatca aagcatattt
    10261 agaattagaa gaccatcctg aaaagatcac gccataaact cttaaactaa tacaacacaa
    10321 aaaaaataaa agagaaaatt taaaatcaag ataaccagaa aacctaaaca aagaaaccca
    10381 taacagtata gtaataacaa aacccaaaat tggagaaaac caataaagca aaaaatttga
    10441 agacacagga actatttctt ctttggaaaa caatttcaat gcatccgcaa aaggttgaag
    10501 aagaccgaca aaaccaagtt tattgggacc tttacgaagt tgcctgtatc ttagcacctt
    10561 acgttcaact agtgttaaaa aggcaacagc aactataaca aaaattaaaa cctgaaaata
    10621 gtaaacagaa acatcaaata taaagagtat ttttagaaaa ataaaattta tatttgaatt
    10681 ttaaattcaa agcactaatc tgccacacta aactacttta agaaaatgta aatttatata
    10741 ctaccctatc aagatagtcc tttttcaggc atcttaaagt gtataaaata catttttaaa
    10801 tcctaaattt aacacactaa tctgccaaca aaaattttta aaaaactata taaatataat
    10861 aatataaaac atttttaatt acattttaaa tcgctacgcc caaccaagtt tcaatattaa
    10921 attaattaat gaacaaataa ataagaaatt atataagaat aataaataaa taagaaaaga
    10981 aacaaaaata agaataagag aaaaagcaaa tagaaaagat gacctcatac aaaataaagc
    11041 aggcaagggc gaccccaaaa ggtcggttgt tctgaaactc ctttttccaa ttatatattg
    11101 aagaaaacta ataataaata taatatattt attttactga cactttttaa aatctggccc
    11161 aaagggcgcc tcaataaata gagacttttt tttttttttc ttaattttaa tatttaataa
    11221 caattaaact aaataggagt cctttcgtac tatctatttt attttatttt gtcaaaaaag
    11281 ataaagacca acctggctta caccgatttg aactcagatc atgaaaagtt ttatttgtcg
    11341 aacagacaaa cttaaaaaag atctgcccct tcaagtgact ttaatccaac atcgaggtcg
    11401 taaactttta aaacgatttg aactcttctt aaaaataacg ctgttaaccc caaggtaatt
    11461 tatttttcat cactcataag tggatcttct tttttgccaa taaaaatttt ttttataaat
    11521 gagatttcat taaccgcccc agttaaaata agtttatatg agaaaaacaa aagaattatt
    11581 aaaactctac ggggtctttt cgtcttttta ttaataaaga gtattttcac tctacatcta
    11641 acttcaactc aataaaaaaa ataaaaaatt ttttcaaaac gcctttcatt ccagtcccca
    11701 ataaaaagac aaatgattat gctaccttag catagaaatc tacggccgtt aatatctcac
    11761 cgggcagaca tcatactaaa ttatatctca gtactatgtt tttgcaaaac agatgaaaaa
    11821 atacagtcaa attaatttta aatattttaa atgctattac acaccgagta aacaataatt
    11881 ctactaattt tctcatagtt ttatagctat cgcctattaa attaaatttt tatttcaact
    11941 acgataataa aataattagt aaattaataa gttataaaac tttacacttc taattttaat
    12001 aaaatatcaa aaattttgct attgggaaaa gtaagataaa aatttaaact tttaagcttg
    12061 catctgaaag aaaaaaaaat aaatttaaat ctaattaact agatacctat tgaatcaaga
    12121 ctttttatca ctttttaatt ttaaattcaa attttccact ctgaaacggt aagaatccta
    12181 ataattaaaa aaacttcaat aatcgagaaa caataaaccc aatcaaataa aaaaatcctt
    12241 aaccccaagg cacgaccctt caattcattg tttataataa ttttcttttt taacaaaaat
    12301 atgttgcttc tctttacata aaatttaaat tttaatatta ttgttttttc tttaaagcaa
    12361 cccttgttaa ggataataat tcattgtaaa agaataaaat actttaaagg ctaatcttcc
    12421 gattagccca ctttgttacg actttttttt cctaagggaa aaagtgacgg gcgatatgtg
    12481 cacacccgga aaaaatattc aaaataaaaa tatatgtatt tttactttca aatccaatta
    12541 tttttaaata tcctacttaa attaacaaaa aagaaattgt aaccaatctg acctttgcta
    12601 taaactatat gtagatctga aaattaaagt taattcttta tttagtgaag ccaaaagcaa
    12661 tatatcgacg acgatatata aattcaaata agcaaagtaa attcttgcgc gtactttctt
    12721 ttagcagaca gctccctctg ataaaccaaa tgccgccaaa ttttttaaat tttaaatatt
    12781 taaacctcac tcctttggct attacaaaaa aataacaagg tatctaatct tggtttttat
    12841 gatttttata aaaaaaacta tttaaaaatc tcctataaga agaataattt tacttacaaa
    12901 cctgtcctgc cgtaaattat attaattaat ttatctcaca taaaaacatc aaagtatata
    12961 accgcagctg ctggcatact ataagcttga taaaaataat taaaatcttt tgtcaaaatt
    13021 tatataaaat tttttagtac aacacaagct ctcaaaaaaa ttatgttcct aaattttcac
    13081 tttatttttc aaaaccaata tcaaattttt tacatgttaa aatattataa aacaaataaa
    13141 aaattaagta atattaatta ttataaaaat atttaaattt ttctttcaaa atcaaaattt
    13201 gatataccaa tatattatat aataggataa gctaaacaag ctattgagtt catacctcaa
    13261 cgataaaacc cttttcttat taatcaataa aaacttaccg cttatgagaa tattttattt
    13321 aatcagacta ataggcataa ttagctcaaa taattgattt atattttgaa tttttataga
    13381 aataaattcc ttatgcttta tcccattgat attaattaaa aaaacaaaaa aagggggtga
    13441 agcttcttta ttgtacttta tcgtgcaagg aattagctca atatttttat tgatagccat
    13501 aattaatgaa gaaagttcac taatagatgt atcagaacca aacagcagcc tcatcacagt
    13561 agccttttta aaaatagggg caggggtttt ttttaattga ttattcttat taagcttttc
    13621 cattacttta agaattttat tattaatcct caccctacag aaattaagag gattttttct
    13681 tcttctttta agacaagccg gcttgtctta tttaatatta atctttattt ttctttcttc
    13741 ttttatagct atattcatta atataaaaca aaatttattt aaaagaatgt tgacagtttc
    13801 aagattgtcc aacaccagat gactcttgac cgcagttgta acaacatatt ctggatgaat
    13861 attttatttt gcagtgtact cattttcttt agtattaagt tcaacaataa ataataagta
    13921 tttagaccaa aattaccgta atagagacac gctagaaaac ccccttttat ttttaagcat
    13981 aggaggactc ccccccatac caggattttt ccctaaaatt ttaattctga taaatttaag
    14041 atattctcgg ttaagattgc taagaatttt tctccttctt gccgcgtgtg tagatatttt
    14101 tatttattta cgattttcct tcacaagagc attgaaaaat aatggtaatc ttatatattg
    14161 taaagctgta acaacaaaga gaattaaaat actgtcttta agagcagtca ctatagtcac
    14221 aataatagca attatattat aaaaagattt taagttaaaa aaactaatgt gtttcaaaca
    14281 cttcaataat gaaaatttaa atcttaattt taaagaaaaa ctttttaaat atgcttgcaa
    14341 catatcatat aaataaaatt tcataacaaa aagaaaaaat ctatatgtaa atttacaatt
    14401 taccgcctat actcagccat tttgacta
//