LOCUS       AP014821             4150181 bp    DNA     circular BCT 16-MAY-2015
DEFINITION  Geminocystis sp. NIES-3709 DNA, complete genome.
ACCESSION   AP014821
VERSION     AP014821.1
DBLINK      BioProject:PRJDB3579
            BioSample:SAMD00027151
KEYWORDS    .
SOURCE      Geminocystis sp. NIES-3709
  ORGANISM  Geminocystis sp. NIES-3709
            Bacteria; Cyanobacteriota; Cyanophyceae; Oscillatoriophycideae;
            Chroococcales; Geminocystaceae; Geminocystis.
REFERENCE   1  (bases 1 to 4150181)
  AUTHORS   Hirose,Y. and Katayama,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-MAR-2015) to the DDBJ/EMBL/GenBank databases.
            Contact:Yuu Hirose
            Toyohashi University of Technology, Environmental and Life
            Sciences; Tempaku, Hibarigaoka 1-1, Toyohashi, Aichi 441-8580,
            Japan
REFERENCE   2
  AUTHORS   Hirose,Y., Katayama,M., Ohtsubo,Y., Misawa,N., Iioka,E., Suda,W.,
            Oshima,K., Hanaoka,M., Tanaka,K., Eki,T., Ikeuchi,M., Kikuchi,Y.,
            Ishida,M. and Hattori,M.
  TITLE     Complete Genome Sequence of Cyanobacterium Geminocystis sp. Strain
            NIES-3709, Which Harbors a Phycoerythrin-Rich Phycobilisome
  JOURNAL   Genome Announc 3, e00385-15 (2015)
  REMARK    Publication Status: Online-Only
COMMENT     ##Genome-Assembly-Data-START##
            Current Finishing Status :: Finished
            Assembly Method          :: GS De Novo Assembler v. 2.8
            Assembly Name            :: Gm3709_assembly_1.0
            Genome Coverage          :: 81x
            Sequencing Technology    :: MiSeq
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4150181
                     /db_xref="taxon:1617448"
                     /mol_type="genomic DNA"
                     /organism="Geminocystis sp. NIES-3709"
                     /strain="NIES-3709"
     CDS             201..911
                     /codon_start=1
                     /locus_tag="GM3709_1"
                     /product="phosphate regulon transcriptional regulatory
                     protein PhoB"
                     /protein_id="BAQ63236.1"
                     /transl_table=11
                     /translation="MEILIVEDEKEIAQLIHNCLTREGFNCHFAYDGLSALDNVKTIQ
                     PDLIILDLLLPKLDGLEVCNRIRNQATIKDPYILMVTAKGEEIDRVIGLSTGADDYLV
                     KPFSPRELVARVRALLRRSMRHGGQSQIYESPHFILNLDEHTAIRQLDSEGEEILDLT
                     ALEFNLLAVFMNYPGKVWSRTQLIDKLWGSDFFGDERVVDTHISRLRKKIEPNPAQPS
                     FIKTVVGVGYKFEDETNL"
     CDS             complement(1156..2211)
                     /codon_start=1
                     /locus_tag="GM3709_2"
                     /product="light dependent period modulator LdpA"
                     /protein_id="BAQ63237.1"
                     /transl_table=11
                     /translation="MLPLESLKQGRWFKLICGASYQHLPSIRNLALIYTLAGADCLDV
                     APDKAVIHSALEGIKIAQNYRQQAIDLGYNPHIRPLLMVSINDGEDPHFRKAYFNTNL
                     CSIDCPRPCEKICPAEAIKFDDRTIPIVNQHQGIVEELCYGCGRCLPICPINIIHTES
                     RIISTKEVLQWLDTLPINAIEIHTKQGHLQNFIQVWDMVKPRLQQLQLIAISCPYTDT
                     VTEYLTEIYQYIHPVNIPLIWQTDGRPMSGDIGSGTTHLTIKYAQKMKQTNLPGFIQL
                     AGGTNEYTIEKLNKLNLTPSKISGVAYGSKGRKIIADTLQRLEEMSTNNQIEEHPQLL
                     WEAVTQAFQLVSPIKKR"
     CDS             complement(2266..2841)
                     /codon_start=1
                     /locus_tag="GM3709_3"
                     /product="hypothetical protein"
                     /protein_id="BAQ63238.1"
                     /transl_table=11
                     /translation="MIIDGSLTMVNTYFGAFFPELTDSLFSTQGIMVMLLIAYGGAMW
                     MFLTSAPKVYTVMVSDLSIARQFYEELLDLPIADIPLHYYYNYEQSLGANSFDPIYMG
                     STINDSMPKPSDGLWYQLKKNTQLHIIGGASLGYKNCQRHVCFDRECLDALLLKVQSR
                     RLKYKIRQEIPLNFLVKDYDNRVIEMAEVNS"
     CDS             2931..3530
                     /codon_start=1
                     /locus_tag="GM3709_4"
                     /product="hypothetical protein"
                     /protein_id="BAQ63239.1"
                     /transl_table=11
                     /translation="MTIDSDVILELNHELIKPLQDLDDLKLWQLWQKSPHQARYLIVL
                     FYRYAYLTDMINNDLNNIETQQQYFERLWFFLFDRLSTYNIQENSLLSEVITQLINQF
                     FNEEKVIVTQTYQNDYNLQIRYLPLKYYLQKNLDKLPYLERIILVTKDKFTWEDEKIL
                     QYLRQQKQEVTLAEIKAYYTQAHSRLLNLLPIDIISIYL"
     CDS             complement(3569..3739)
                     /codon_start=1
                     /locus_tag="GM3709_5"
                     /product="hypothetical protein"
                     /protein_id="BAQ63240.1"
                     /transl_table=11
                     /translation="MGNAIDASCYIERQGKADHKIWYSSVSNKRFVVAQKILSRHTAN
                     AVLKQAGLPKSF"
     CDS             4028..5725
                     /codon_start=1
                     /locus_tag="GM3709_6"
                     /product="bipolar DNA helicase HerA"
                     /protein_id="BAQ63241.1"
                     /transl_table=11
                     /translation="MKSNQIQPLGSVIQGSLSEGLEVRLHPDISVEDMRVGKFLVVQG
                     TRSKFFCLLTDVSLGTSNPRIFTHPPDPNDDFWLDILAGSDTYGTIEIAPMLMLTLTN
                     KEEYGTKFDNIPSLNGIETELQLLPVKTIPSHFSQVYESTEGDFRSVFGWENDPHKCN
                     FAIGQPLDMDVPVCMDLGRFVERSNGIFGKSGTGKSFLTRLLISGIIRKQAAVNLMFD
                     MHSEYGWAAVSEGKQFSMVKGLKQLFPNRVEIYTLDAESTQRRGVPQAHELYLSYDQI
                     EIEDLKLIARELNLSEASLDNANVLASEFGRDWIYRLLNMTNEDIQIFCNEKQGHQGS
                     IMALQRKLKRLESLKYMRSACPHNYIKEILDLLEGGKHVVVEFGSQGNMLSYMLVTNM
                     ITRRIHNAYVKKAETFLQTKNILDRPRQLVITIEEAHRFLDSKIVHQTIFGTIAREMR
                     KYFVTLLIVDQRPSGIDNEVMSQVGTRITCLLNDEKDIDAIFTGVSGASGLRSVLAKL
                     DSKQQALVLGHAVPMPVVIRTRAYDGTFYEEIGDSDWQNKTDEEVFRIAENNFSDLF"
     CDS             6096..6677
                     /codon_start=1
                     /locus_tag="GM3709_7"
                     /product="ribosomal subunit interface protein"
                     /protein_id="BAQ63242.1"
                     /transl_table=11
                     /translation="MKFLIQGNNIEVTESIHDYVEEKLEKAVKHFQNLATKVDVHLSV
                     ARNARISNKHKAEVTVYANGTIIRAQEDSENLYASIDLVSDKIARQLRKYKERQLDKK
                     THSQVKTTDSVEEKPVEGTLIGDREPVLPTEVVRMKYFAMNPMTIDDALEQLQMVDHD
                     FYMFQNKETGEINVIYQRNHGGFGVIQPRHANV"
     CDS             complement(6709..7929)
                     /codon_start=1
                     /locus_tag="GM3709_8"
                     /product="diguanylate cyclase/phosphodiesterase with
                     PAS/PAC sensor"
                     /protein_id="BAQ63243.1"
                     /transl_table=11
                     /translation="MNQKYDIEQKFLNRTLQVGECIFQEGDKGDFAYIIDEGEVEIST
                     ITATNERIVLNVLQSGDMFGELALVDGSPRSASAYAKTNVVLTIVTSEQVKTRIEDAD
                     PILKLLLIVVMKYFRSETGRLRSNTQEVDLSSLETQKQEYQEKIFQAIELIRLESDLR
                     SGFKQEQLHPFYQPIVDLKTNLIVGFEVLLRWFSPTRGNVSPSIFIPLAESTSLIIPM
                     GEWLLDKALSAIDRIKKETNYDIFLSINVAEKQIHSPEFINILKEKIKVSGINPQQIK
                     LEILERSLFEGETALSLVEDCRNFGLPLVIDDFGTGYANLAYLKNFQFDTLKIDQCFV
                     KDLENNIKDQIICRTLIDLSHGLDMTAVAEGIENEEQLKILSSLKCNYGQGYFFSPPV
                     SLEKAIDFIKQYSN"
     CDS             complement(7964..8866)
                     /codon_start=1
                     /locus_tag="GM3709_9"
                     /product="hypothetical protein"
                     /protein_id="BAQ63244.1"
                     /transl_table=11
                     /translation="MINISTALPTFVITLREGFEAALIVGIVFACLQKAQKQEYYRWI
                     YSGVTAGIIASVSVGLLLWQSLQGIETSEYYYAPFIKQILKTLFALVAVSMLSWMLLW
                     MSKQAKSLKGEVEGAVNIALTNNNASKGVFLLVFIAVLREGFETVLFITAQFQSDFIS
                     PTIGAIAGLLLAVLMGWALFYWGVKINIRLFFQIMGVFLLLIVAGLVISALKNLDGGI
                     MILSQINPNYQNICLFDQDSCLLGMKVWNASNFLPDNEFPGILLKTLFGYRDQIYLLQ
                     LVCYFLFLGIVGNLYFSSLNPKNE"
     CDS             complement(8962..10308)
                     /codon_start=1
                     /locus_tag="GM3709_10"
                     /product="tldE/PmbA family protein"
                     /protein_id="BAQ63245.1"
                     /transl_table=11
                     /translation="MYNFQSNNDWEKSFNFVNEQLFNKLKKDEYLVVQLRAENTHFIR
                     FNNAKVRQTGIVIDAEVSVKLIGNQRVIYSEFPLTGNIDIDVKNALENLDYLRSSLKN
                     LPEDPYIVLPKNEGSSHEIYSGKLLNPDNAISEILKPVQGLDFTGYYTGGTIIRANYN
                     SLGQKHWFNTDSFFIDYSLINENEKAIKGIFSGRDWHKEKYDHQIKYHKQKLQQLNLP
                     IHEVKPGSYRTYLAPAAIADLLGMFSWGGISEASLRQGGSALAKLREGENLSSLFHLK
                     ENFHSGNVPRFNDFGEMSPDELPLIVAGKLVNSLISSRTALEYGLKSNGASSFESLRS
                     PELASGTLSEKEILKAIGTGLYLSNLHYLNWSDRRQGKITGMTRYGCFWVENGEIVAT
                     IKDLRFDDSLYSFFGKNLLALTDFREFIPEVSTYESRSLGGCLIPGGLVDGFTFTL"
     CDS             10770..11828
                     /codon_start=1
                     /locus_tag="GM3709_11"
                     /product="ferric iron ABC transporter"
                     /protein_id="BAQ63246.1"
                     /transl_table=11
                     /translation="MTESLILRVQGVSKKFTGNEFPAVNKVNFDLRQGELLGLLGPSG
                     CGKTTLLRIIAGFEKPSEGSIELGGQIVTGEGRWVEPEKRRTGMVFQDYALFPHLNVA
                     ENIAFGLKSKKPRPQNQDIRKRVTEVLQLVGLTGLEKRYPHELSGGQQQRIALARALA
                     PEPELILLDEPLSNLDVQVRERLRHEVRTILKSTNTAAIFVTHDQEEAMAIADKIGVM
                     AQGKLVQLGTPEDIYSCPECKFVAEFVTQANFLQATKQGNLWCTELGEWCLDTPVNFD
                     KGELMFRQEDVILKPDEEGVTVIQEREFLGREYRYCLQTVSGKRLHARTDVKTQLPVG
                     TKVKLDIAPKTLQIFPTL"
     CDS             complement(12073..14166)
                     /codon_start=1
                     /locus_tag="GM3709_12"
                     /product="translation elongation factor G paralog"
                     /protein_id="BAQ63247.1"
                     /transl_table=11
                     /translation="MAKDLSKYRNIGIFAHVDAGKTTTTERILKLTGKIHKIGEVHEG
                     AATTDFMEQEQERGITIQSAATTCFWKDYQFNIIDTPGHVDFTIEVYRSLKVLDGGIG
                     VFCGSGGVEPQSETNWRYANDSKVARIIYVNKLDRTGADFFRVIKQVKEILAATPLVM
                     VLPIGVETEFKGVVDLLTRKAWIWDDSGDPMNYSIQEIPADMVDDVELYREQLIETAV
                     EQDNDLMEKYLEGEEIAIDDIKRCIRKGTRDLVFFPTYCGSSFKNKGVQLVLDGVIDY
                     LPDPTEVNPQPEVDLEGNETGTFAIVDPEKPLRALAFKIMDDRYGALTFTRIYSGVLS
                     KGMTVLNTATGKTDRVGRLVEMHANDRIEIESAQAGDIVAIVGMKNVQTGHTICDPNQ
                     PATLEPMVFPDPVISIAIKPKQKGGNEKMGMALSKMVQEDPSFYVETDQESGETIIKG
                     MGELHLDIKVDILRRTHGVEVEVGKPQVAYRESITKVINDSYTHKKQSGGSGQFGRID
                     YTVEPGEPGSGFQFESKVTGGNVPREFWPAVQKGFQASIVKGVLAGFPCVDLKVTLTD
                     GAFHAVDSSAIAFEIAARAGYRQSIPKAGPQLLEPIMNIDVFTPEDHMGDVIGDLNRR
                     RGMIKSQSTNPMGVRIKAEAPLSEMFGYIGDLRTMTSGRGQFSMEFSHYAPCPKNVAD
                     EVIKETKERELAAAK"
     CDS             14349..14465
                     /codon_start=1
                     /locus_tag="GM3709_13"
                     /product="hypothetical protein"
                     /protein_id="BAQ63248.1"
                     /transl_table=11
                     /translation="MIVTKCERGNLTIPDRAIKFMGEGRDQLLGISLFSIKE"
     CDS             complement(14683..16263)
                     /codon_start=1
                     /locus_tag="GM3709_14"
                     /product="2-isopropylmalate synthase"
                     /protein_id="BAQ63249.1"
                     /transl_table=11
                     /translation="MTNQPDRIIIFDTTLRDGEQSPGASLNVDEKLTIARALAKLGVD
                     VIEAGFPHASQGDFSAVQRIADTVGTEKGPTICGLARATKPDIKSAGEALQPAFKRRI
                     HTFLATSDIHLEYKLKKTRADVLAIVPEMVAYAKTFTDDVEFSPEDAGRSDPEFLYQV
                     LELAIKAGATTVNIPDTVGYTTPAEYGAIIKGIKDNVPNIDKAIISVHGHNDLGLAVA
                     NFLEAIKNGARQLECTINGIGERAGNAALEELVMALHVRRQYFNPFLGRDVNSVQPLT
                     NIDTKQIYKTSRLVSNLTGMLVQPNKAIVGANAFAHESGIHQDGVLKNRLTYEIMDAE
                     SIGLTTNQIVLGKLSGRNAFRTRLVELGFELSEDDLNKAFLRFKEVADKKREITDWDL
                     EAIVNDEIQQPPELFRLELVQVSCGDHSSPTATITLRTPDGQELSDAAIGTGPVDAVY
                     KAINRVVNIPNELTEYSVKSVTAGIDAMGEVTIRLKHEGKTYSGYAANTDVIVASARA
                     YISALNRLYATIESVRLV"
     CDS             16345..17946
                     /codon_start=1
                     /locus_tag="GM3709_15"
                     /product="motif=tubulin-beta mRNA autoregulation signal"
                     /protein_id="BAQ63250.1"
                     /transl_table=11
                     /translation="MQNQIKKTEIHSIIIVSGLFLIITLFLGLNRYYSFFASYDQGIF
                     NQIFWNNLHFNFYHSSLASGISTHVTSGEELPRVYDSYLGHHFSPNLLLWLPVYYLFP
                     SGATLVTIQILLITGAGVVLYFLAREYIEHFIALLIVISFYGSIAVLIPTLSNFDNIS
                     QLPILVFSLLLSLEKRNWWLFTLFALLILGVRQEAGLNLFGVGIYLIVSKRYPRQGLL
                     ICLISFVYMIVITNIVMPQFTEDVGKRLMVDKFGQYIKGDNPSTLAVIWGMITQPWLV
                     IWELISPIGKTLEYLIGQWLSLALIPAVSPTAWIISIFPLLTPLLGQGKSVLSLNIRY
                     AMMVVPGLFYGAILWWGGQSFYNFQQNINKLNPRKLTVKFKRFWITCISISLLLGFTS
                     STTELSRAFYFILPDSFQPWVYVSLPRQWQHSANIYKLLAQIPNSASVSSTNNIIAHL
                     SSRRAVIRLPMIEFRSDNQEVEKVDYIIADLWELERYGIVFKKEQGWLEAINYLIDDV
                     TTKKEYDIIDRKDNVILLRNEGLIK"
     CDS             18416..22783
                     /codon_start=1
                     /locus_tag="GM3709_16"
                     /product="alkaline phosphatase"
                     /protein_id="BAQ63251.1"
                     /transl_table=11
                     /translation="MTQLSQAIVQAEALLLKASLNPSLEENLITAFGDNYNVTIANNI
                     LSSWRNGNFSNLPKIEVLSPSAMNGAQGAYSALNNTIYLSSFLVESKSLTAIRDVLIE
                     EYGHFIDAQINDIDSQGDEGEIWRNLVLNQPMTEAELKTFRNENDWNTVIVNGQILKV
                     ENNTITQLTNNITDDFYYQISGNNVVWLRHNSYNFYRDYEIYFYNGVAITHLTNNTTS
                     PSSPQISGSNVVWDAYDGNDYEIYFYNGTTVTQLTNNVKHDSDPKISGNNVVWSEYDG
                     NDYEIYFYNGVTVTQLTNNTTDDSALGVSGDHLMWSGYDGNSPKIYLYNSATQLTDNI
                     IGGLNPQISGNNVVWSGYDGNDYEIYFYNGVTVTQLTNNTTKDYTPKISGNKIVWDGY
                     DGNDNEIYFYNGATVIQLTNNTTNDYHPDISENNVVWSGYDGNDYELYFYNGAISTQL
                     TNNNINDYGPKISGNNVVFSRTHISDAEIYTYRINYSLLNLAINDVTITEGNSGTKNA
                     VFTVTRTGTATNAITVNYSTANGTAKAGSDYVAKTGTLTFAPNETSKTISIVINGDTT
                     GEDNETFFINLTNAVGDMSSFAVDDTSSFNLSNTVGDSITDNQGQGTISNDDTSLIVG
                     NDNNNNLVGGTSNDTLQGLGGNDTLRGGTGSDRLEGGTGNDIYYLDSTGDRIIEVLNE
                     GNDTVRSTFTYTLGANVENLVLEGTGNLNGTGNNLKNSITGNNINNLLNGEERNDTLN
                     GRDDDDTLIGGSGNDSMIGGAGNDTFYVDSSADRVVELFYEPWWGYDIDTVRSTVTYT
                     LSANVENLVLEGTGNLNGTGNTLSNHITGNNFSNTINGSEGNDTLIGRGGNDTLIGGT
                     GKGKMIGGTGNDIYYIDGGAQIIELFNEGTDTVLSTSFTYTLGANVENLVLGGTGNIN
                     GTGNILNNSITGNNFKNLINGGSGNDTLNGRGGSDTLTGGIGNDSMIGDTGNDTFYVD
                     STGDRVLELSDEGNDTVLATITYTLGANVENLVLEGTENINGTGNTLNNSLIGNNLSN
                     ILNGEDGNDTLVGGNDNDSMIGGNGNDTFYVDAIEDVIVELSNEGIDAVRSMVNYTLS
                     ANVENLILQGTENIDSTGNILNNSITGNNRNNLLNGGSGNDTLNGRGGNDTLTGGIGN
                     DSMIGGTGNDTFYVDSTSDRVIESASQGIDAVRSTITYTLVANVENLILQGTENIDGI
                     GNTLHNNITGNNLNNILNGGDGNDTLVGDSGNDRLNGSTGIDRMLGGLDNDAYSVDHI
                     QDEVIEFFNQGTDIVFSTITYTLPNNIENLNLSDTVNIDINGTGNSLSNRLTGNNQNN
                     QLHDGEGNDTLNGRDGNDTLTGGEGNDSLIGGNGDDSFRFTTVNEGIDTITDFNVSDD
                     TILVRRNGFSGGLSLGTLAVNQFRVGSSATVSTDRFIYNSSNGAFFFDSDGNGATGAI
                     QIATFSTGLGMTNQDIVIV"
     CDS             complement(22917..23858)
                     /codon_start=1
                     /locus_tag="GM3709_17"
                     /product="mobile element protein"
                     /protein_id="BAQ63252.1"
                     /transl_table=11
                     /translation="MKQKYHLRNWSEYDRGLKQRGSLTFWLSEEVLSNWILTEKSGTR
                     GADNYFSDQAILTFVMVKSLFSLAGRQTEGFLESLFVLMGIDLPMPDHTTVSRRAKNL
                     DVVLPVNKRDEPRHVVVDSTGVKVYGEGEWKTRQHGVSKRRTWRKLHLAVDEKTGKIL
                     VAEVTTNNCHDGDVLESLLEAVEGEIEQVSGDGAYDRAAPELRSDQRKCYRAIAKRGA
                     MATILPQNNAQKWSDIDGDRNRNIEKIEEIGRKEWKEESGYNRRSISETTMFRLKTIF
                     GGKLSSRDFDNQAVELFVKCLLLNKMIQIAKPDSYIV"
     CDS             complement(24024..25364)
                     /codon_start=1
                     /locus_tag="GM3709_18"
                     /product="replicative DNA helicase"
                     /protein_id="BAQ63253.1"
                     /transl_table=11
                     /translation="MNDFTPDLAASSLPPQNIEAEEIILGSLLFDPNAMGKIIDILPL
                     EAFYVNAHRHIYEAARNLYFQGQPIDLMTVSTWLNDHNLLDKIGGTPKIISLLDRTVS
                     SANIERYVPLITDKYIRRLLITTAKEISELGYDTTQDLDIILDEAEQKIFKLTQARIQ
                     QGLVPISETLIDTFTEIQNFQEKIALPGISTEFYDLDALTGGFQRSDLIIIAGRPAMG
                     KTSFALNIAANIAKHHNLAVAIFSLEMSREQLAMRLLSGEGKLESSRLKSGRITEQEM
                     EPLMTAMGSLSELPIYIDDSGYLTVMQMRSEVRRLQAEKKGKLGLVLIDYLQLMQGSS
                     DNRVQELSRITRSLKSLAREINAPIIALSQLSRAVEQRTNKRPMLSDLRESGSIEQDA
                     DLVIMLYRDEYYHPDTVDQGVAEIIVAKHRNGPTGQVKLIFRSELTQFLNMKRH"
     CDS             25550..28099
                     /codon_start=1
                     /locus_tag="GM3709_19"
                     /product="diguanylate cyclase/phosphodiesterase with
                     PAS/PAC sensor"
                     /protein_id="BAQ63254.1"
                     /transl_table=11
                     /translation="MFTVFGIGVYYWFYRFTTDKTLQRLKDDLRISAIASSQQIDVDE
                     FVTLSQTGKANQEGGSDDPLYQKQLEWLYNLHQINPKIFIFTFIKDDSQTQEKQQIRY
                     LVDVWMNIDASKSARFLESAIATPYHINTLTNGTVEFRDFYQDKWGKWMTYYAPIRDK
                     SGKIVGAIGADMQIDEITQLQKEIQRQFLVSFGISYPFFLTLIYILTTLLTRRFQAMQ
                     KYAQAVGEGNYQPNISLSSEFKFSFFNDERIILSKALEEMTGKIRQREELLNAIFNQV
                     AVGIGIHTLDHKIKIVNQTFCRLIGYSEEELIDRHCCDITHPEDIELSKKYIHEMIHS
                     KVFPPSTHEKRCICKNGEIIWIEMAITIIEDNHKNPKYFISVIQDITRRRFAEKKLIE
                     AANTDFLTKLPNRGYFIECLDDLLSQANDYLHNLFALLLVDLDNFKTINDSLGHLAGD
                     QFLVNIANHLSDCVTDKDIVARLGGDEFAILLTSIQSIEDAIVVANKIQTEISIPFYI
                     HGQEFVTSASIGIVLSRNLASQTKYLVASDLLRDADIAMYQVKNKGKNNYAIFGQEMY
                     ENFIHQLKLENDLRKAIGEGSLSLYYQPIIDLKTGELYSLESLVRWFHPELGFLTPNK
                     FLPIAEQSGLIVELGNWGLKTACHQLHQWHEEKLISENISVNVNIAGKQFDGKDLLTQ
                     IVKTLSETKLSPSHLHIEVTETIISHNTVNVTKTLKKIKDLGVKIAIDDFGTGYSSLA
                     RLRNFPVNEIKIDKAFVQPLNTHPRNVKFLQGIITLCQNLELKVVCEGIETEAQNNIL
                     SDLHCNYGQGYLFAKPMSVSDFELWIKNKTKRDEERKKNQNSESNFIKGEL"
     CDS             28300..30234
                     /codon_start=1
                     /locus_tag="GM3709_20"
                     /product="ferredoxin--sulfite reductase"
                     /protein_id="BAQ63255.1"
                     /transl_table=11
                     /translation="MTASVTIPKKPSKVENLKERSNFLREPIATELQQDTTHFTEDGI
                     QILKFHGSYQQDNRDNRVKGQEKDYQFMLRTRNPGGFIPPQLYLTLENLSEQYGNHTL
                     RVTTRQGYQIHGILKKNLKTVISNIVKSMGSTLGACGDLNRNVMAPPAPYKNRADYQY
                     AWEYAEKIADLLTPQTGAYYEIWLDGEKAITAEEAPEVKAYRQKNLNGTNFTDSEEPI
                     YGTQYMPRKFKCSVTVPGDNSIDVYTHDLSLVVIVDEKGELEGFNILAGGGLGRTHRK
                     EETFARSADEIGYVKKDDVFDLVKAVVATQRDYGDRVNRRHARMKYLINDWGVEKFTA
                     KLEEYFGKKLEPFKQLPEWKYEDYLGWHEQGDGKLFIGISVENGRVKNEGEFQLKEAL
                     KKVIEKYELPTRLTANHNIILYEIDPQWQEDISKILVNHGVEINPENVNHLTRYSMAC
                     PALPTCGLATTESERILPSILERIDSLLGKLGMEEENIVIRMTGCPNGCARPYMAELG
                     FVGDSPNVYQIWLGGCPNQTRLAQVYVDKLNVNELEKFLEPLLVFFRDNKENNETFGQ
                     FCYRVGFDALRTFADKYKSSKKKIMTQTEKKSRKKRNEHRISVNEEWYQKLKTTSSEQ
                     KKGMNQIVSEALEAYFSSQK"
     CDS             complement(30478..31332)
                     /codon_start=1
                     /locus_tag="GM3709_21"
                     /product="flavodoxin reductases (ferredoxin-NADPH
                     reductases) family 1"
                     /protein_id="BAQ63256.1"
                     /transl_table=11
                     /translation="MKIINLFIYPIKSCQGISLTKAEITPKGLRDFFQPTFYDRQFML
                     VDKNGKFLTQRQHPQLATIRVTINENKLYLRTENVNISEFELIPDDNKKEIEVNIWRD
                     STIAIDQGDEVANWFTEALKIDKSCRLVQQSNKHIRPINRQYSTQENQPVSFSDGFPF
                     LLTNTGSLDELNRHLQTKYPANQLVIKMECFRPNIVVETSDPFIEDTWQKIQIGNVNF
                     DIVKPCSRCIVTTTDQKTGQVDRTKEPLLTLSSFRNTPDGIMFGQNMIAQNEGIVNIG
                     DNLTVQNS"
     CDS             complement(31347..32267)
                     /codon_start=1
                     /locus_tag="GM3709_22"
                     /product="methyl-directed repair DNA adenine methylase"
                     /protein_id="BAQ63257.1"
                     /transl_table=11
                     /translation="MKNQDKLVKPFLKWAGGKTKILNQICDRFPQELINGQINKYIEG
                     FVGGGAVFLYIAQHYDIQKFLLYDVNPELVLAYQTIKINVDDLIDILDKLETKYLRFN
                     DIEKTQYFYKIRDKFNQEKQIINYKNYDKQWLIRTAELIFLNKTCFNGLFRVNRKGLF
                     NVPFGKHKNPHIFDQSNLINLSKILQKTDIRQGDFQDCKKEVNEQTFVYFDPPYRPLN
                     KTSNFNSYNNNNFDDNEQLRLAQFFKILDKKGAKLMLSNSDPTNEDMLDQFFDEAYSN
                     YNIKRIKAPRFINSKAEKRGEINEILITNY"
     CDS             complement(32272..32811)
                     /codon_start=1
                     /locus_tag="GM3709_23"
                     /product="hypothetical protein"
                     /protein_id="BAQ63258.1"
                     /transl_table=11
                     /translation="MKLTIEDVDKIQQQNPNFKYELKEGEIIIMSPSDFFSEEVGTNF
                     SSNLRNWVNSRKLGRVTGSSAGFIMPNGDLLAPDVAFVKAEKLKISPRSYAQVIPDLV
                     VEIKSFDRISKLENKLKNFLDFGVKVAILIDPDEHIIKIFRVNKEVEILTDQDTLTIP
                     ELLPQWQLKIVDLWPEIFE"
     CDS             complement(32862..34649)
                     /codon_start=1
                     /locus_tag="GM3709_24"
                     /product="cell division protein FtsH"
                     /protein_id="BAQ63259.1"
                     /transl_table=11
                     /translation="MLQTLFVGNIALAQQKKESFNYSDLLRSIETGEVRKITIDPATN
                     IANVYLKKETDNKAEQVKLFNQNPELIAKIRSKKIDFAVESSAASSAAVINLMQIGLL
                     LLLIFGLFLLIKRSASTAAGAMNFGKSRARFQMEAATGVEFKDVAGIEEAKEELQEVV
                     IFLKTPDKFTAVGAKIPRGVLLVGPPGTGKTLLAKAIAGEAQVPFFSISGSEFVEMFV
                     GVGASRVRDLFRKAKENAPCLVFIDEIDAVGRQRGAGIGGGNDEREQTLNQLLTEMDG
                     FEGNTGIIVIAATNRPDVLDSALLRPGRFDRQVIVDYPDMKGRLGILEVHGANKKIDP
                     QVSLETIAQRTPGFSGADLANLLNEAAILTVRRRKEAITMAEIDAAIDRVIAGMEGTP
                     LVDGKSKRLIAYHEIGHGIVGTLTKGHDPVEKVTLIPRGQARGLTWFTPDEEQGLVSR
                     TQLFARITGLLGGRAAEDVIFGEAEITTGAGNDIERVTSLTRQMVTKFGMSDLGPIAL
                     EDDNQPIFLGNDSVNRSDYSQEIAEKIDKQIRSIVFQCYQNAKQIIQENRPVIDMLVD
                     LLIEKETIDGDSFREIVNNYTSKSLEIAR"
     CDS             complement(34801..36000)
                     /codon_start=1
                     /locus_tag="GM3709_25"
                     /product="hypothetical protein"
                     /protein_id="BAQ63260.1"
                     /transl_table=11
                     /translation="MKILHVIPSVSFVRGGPSKAVLEMVKALQDNEIEVEIVTTNDHG
                     DNLLDVPLKQKVIYKKVPVIFFHRFSPNINFIREFAFSLDLTIWLFENINKYDLIHVH
                     AIFSYTSTIAMIIARLKKIPYIVRPLGQLCSWSLTQKAKKKQIYFDLVEKTNLEGSNF
                     VHCTAFQEQQEVKNLGLKINSFVIPLGINSTNLILFAQKKLRQKFNISDNTSIILFLS
                     RIHEKKGLEFLISALAKIDYDYRFIIAGVGDIEYEKKIKLLIEKENINDKTYWVGFVE
                     GEFKNLLLQGSDLFALTSYSENFGIAVLEALEAGLSVIITPEVALSEVIKENNLGYVT
                     DLDIDKIAITIEKALKNQDSLRLIDDREITLSRDRARKFILENYTWDHIAKQLIEVYQ
                     QIINTDL"
     CDS             complement(36218..38002)
                     /codon_start=1
                     /locus_tag="GM3709_26"
                     /product="asparagine synthetase [glutamine-hydrolyzing]"
                     /protein_id="BAQ63261.1"
                     /transl_table=11
                     /translation="MCGIGGILTEYTLSRSIENLITKVRSSLIHRGPDDQGIYISPEK
                     NVALAHTRLSILDLSSAGHQPMTMENQRYWITFNGEIYNFQELRSQLQKQGETFKSHT
                     DTEVILKLYKNKGKDCLHYLRGMFAFAIWDNQEKTCFIARDPLGIKPLYYWQDGSNLI
                     FASELKAILGTKLPSKNISVEGIYSYLTRGSVAEPYTMIEGIKCLEAGHWLQWRSGNL
                     HKESYWNIEFKSEITSPSEAQEIVRQALIDSIKHHFVSDVPVGIFLSGGIDSTSLLAL
                     ARTIQTGTINTYSIAFTEEEYNEGDLASKIAQKFDSKHHEYKITSSIAKKILPNFLQA
                     IDQPTIDGFNTFCVSQVANNDRTKVVLSGLGGDELFGGYSSFQKIPQMIKIGQKIDKL
                     SYLKRLSAYILSNFKDPRYLRLGDFLGSNSSTFSAYQCFRGIFAHQEAITILNYYLGN
                     DRVIEREKPSLISQATLEDEVSYLEITRYMRNQLLRDSDVMSMAHGLELRVPLVDRVL
                     LEKISNITSNLRLAQKKQLLINAIPELPQWVVNRPKRGFTFPFQRWIDNEWKDYFSSL
                     NLPKDINLKLWYRRWSLMILDHWLQQIN"
     CDS             complement(38012..39145)
                     /codon_start=1
                     /locus_tag="GM3709_27"
                     /product="methyltransferase type 11"
                     /protein_id="BAQ63262.1"
                     /transl_table=11
                     /translation="MLSGEYKIENLLGNIIYLRSTVIQLKTSDKMLENWYLENLVCPQ
                     DKTELRYSNNCLVSKSGHHYPIINGIPIMLLDNVKQTIELAHHSLKSFNNNEDEDPYF
                     INTLGISDQEKERLRQHIGSKKELKDFVVDPIVQFLIAATNGILYKDSIGTLTHYPIP
                     NLRLPKVDGEQKQLLDIGCSWGRWCISGSQKKYICIGIDPSLGAVLAGQRIAQKLGLN
                     IKFVVGDARYLPFKESIFDQVFCYSVIQHFSKNDAKQTLTEINRVLKVNGQSLIQMPN
                     RWGIRSLQHQIKRGFKEGESFDVRYWGIKELNDCFTKEIGESQIDIDGFFGLGIQKSD
                     LNLLHQKYRIVVRISETLRSLSQVIPSLKYIADSVYIKSIKQS"
     CDS             complement(39232..40587)
                     /codon_start=1
                     /locus_tag="GM3709_28"
                     /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
                     /protein_id="BAQ63263.1"
                     /transl_table=11
                     /translation="MGKVNIIGLGKSGIAAARVLKQENNHVTIYDCSKSESLEKIKDN
                     LAQENIIVKLGENLPLNNENKPDLIVVSPGVPWDIPLLVTARQQGIKTIGEMELAWQY
                     LKSSPWIGITGTNGKTTTTALIEAMLKAGGIKTSACGNIGYAACELALSAFKNPPEWV
                     VAEISSYQIESSIDLSPKIGVWTTFTPDHLARHKTLENYHAIKASLLQRSQSKILNGD
                     DPYLYNFGLNLDWKNTYWTSVRGKDYLLGNIEKGVYLEDSWIVAFKELIAPISLFKMV
                     GKHNLQNVLMATAAARLAGVSKSAIAETISSFTGVVHRLELITTINGVAYINDSKATN
                     YDAAEVGLDSVESPVILIAGGEAKEGDDTAWITKIKEKCASVLLIGDAASLFAEKLKI
                     QGFKDYEIVNDMEKAVFRGKQLAQEKKAKVVLLSPACASFDQYRSFEHRGDHFRELCL
                     S"
     CDS             complement(40640..41191)
                     /codon_start=1
                     /locus_tag="GM3709_29"
                     /product="hypothetical protein"
                     /protein_id="BAQ63264.1"
                     /transl_table=11
                     /translation="MYSEETLFRRSPKAPFDRRAYAFLIDFVVVWVISSLVTNIFLEF
                     IVFSLLWLILRVIVVDKNKGQSLGRWAMDLKITDVRFNRLPLLLSLAKREGIIAVVAF
                     LTMIGLKVNFADFLLMVLFCTPLMIDGFTAFTDDEYNQAFHDRVSGTMIIQTKRGFSL
                     DLRVKKWYKEMRKTWDKNRKKDR"
     CDS             41274..41543
                     /codon_start=1
                     /locus_tag="GM3709_30"
                     /product="hypothetical protein"
                     /protein_id="BAQ63265.1"
                     /transl_table=11
                     /translation="MPRLKRWESPRREGRNDKGKGGTAKKKQWQKRLKMLKNKLKNTK
                     EGEVKYFSFFMFINCLDNVKKPERAIKFMSENGDSLLAFFQLKNK"
     CDS             complement(41724..42413)
                     /codon_start=1
                     /locus_tag="GM3709_31"
                     /product="uroporphyrinogen-III methyltransferase"
                     /protein_id="BAQ63266.1"
                     /transl_table=11
                     /translation="MTVYFIGAGIGGIDYLTVKAHKIISQAEVIIYDALVDKEILEIA
                     SSECIKICVGKRGGEISTSQTSINHLLVQYAQEYNAVIRLKCGDPAIFGRINPELAVL
                     RKINIDVELIPGISSALAVPFLANIMLTEKDNSRCLTIITGHDPNILNWSILSQVDTL
                     VILMGGKNLSVITQKLQKYGRSSDFPIAIIKNGGNPKQIQWKGTLKNIVEKTVNISLS
                     PCVIVIGKVVN"
     CDS             complement(42438..43301)
                     /codon_start=1
                     /locus_tag="GM3709_32"
                     /product="galactose mutarotase and related enzymes"
                     /protein_id="BAQ63267.1"
                     /transl_table=11
                     /translation="MYNIAIKQEEYLTYILKDLDSNCRLEIVPERGGIVTDWTIQGQK
                     ILYLDKDRFKNPQLSVRGGIPVLFPICGNLPDNIFSYQEKTYILKQHGFARDLPWKVI
                     NQSTDKSASLTLSLTSDLETLKVYPFEFELNFTYKLLGNKLIIEQLYKNKSKEKMPFS
                     IGFHPYFYCGDKTKLKLEIPGEEYWNKSDDKTYSFNGELDYNLEEIDIAFTQLQGQKT
                     SFIDSKRNLTVEITYSDLFSTLVFWTLKGKDYICVEPWSSPRNAINTEEQLNYLQPNE
                     VYSASVSIEVK"
     CDS             complement(43571..44251)
                     /codon_start=1
                     /locus_tag="GM3709_33"
                     /product="phytol kinase"
                     /protein_id="BAQ63268.1"
                     /transl_table=11
                     /translation="MSTDLTAPFTLILQNPSHFAIVILYLGILLLIAEILSRYHKTDS
                     ELTRKIVHIGTGNVILLAWWLNISKDVILLASVVASFIAIMSYFLPILPSVNGVGRNS
                     LGTLFYAISIGILTALFWQNGQRQFTAIGILIMSYGDGMAALIGQKWGKHKYQILGNQ
                     KSWEGSLTMTGVSILVTVIILGFTWQNLLIASIVGIFATILETFSSIGIDNLTVPVAS
                     GIIVYYLS"
     CDS             complement(44241..45617)
                     /codon_start=1
                     /locus_tag="GM3709_34"
                     /product="possible bicarbonate transporter"
                     /protein_id="BAQ63269.1"
                     /transl_table=11
                     /translation="MNQVTLEEEKTSLLNWRKTSLLGKMVGIISPWQSSSYLLSYSDV
                     IASILICLVIIAAPFTNNTLVGIILMASGGFWALLTLAEVKQNQITSIHLWIFAYWLI
                     CIVATAFSPLKIEALSGLFKFTLYLLFFALASRIFRHPKLLSWVIGVYLLVSLIVSSY
                     GIRQQFTGVKQLATWTDPTSPLADTTRVYSYLGNPNLLGSYLIPAVAFSVVGIIIWKS
                     LPLKVFGGFSLTIHTACIYFTGSRGAWLALIVSGVVFLLAFKFWWSEYLTPFWRKWLI
                     PIAIGSFMGFVFISALLSEPLRIRILSLFSWRGDSSNNFRINVWTSALKMLQDYSLTG
                     IGLGNKVFNKIYPTYMQTKFTALSTYCVFLEIAIESGLIGLIAFLGIIGSTFQRGMQL
                     IKMMKPQNDLQAMGVIASLSAIAGLATQGLFDTVWFRPQVNTLWWLCIAVVASFPFVN
                     SSKNKDVN"
     CDS             45919..46860
                     /codon_start=1
                     /locus_tag="GM3709_35"
                     /product="cysteine synthase"
                     /protein_id="BAQ63270.1"
                     /transl_table=11
                     /translation="MNIAQNITELVGKTPLVKLNRIPQEEGCVAQIIVKLEGMNPAAS
                     VKDRIGVNMIEMAEKAGLIHAGKTILVEPTSGNTGIALAMAAAAKGYELILTMPETMS
                     LERRAMLRAYGAKLELTPGSEGMKGCIQRAQEILDTTPNAYMLQQFQNPANPEIHHRT
                     TAEEIWKDTDGKIDFLVAGVGTGGTITGIAEVIKKRKSSFKAIAIEPENSPVLSGGKP
                     GPHKIQGIGAGFIPEVLRVELIDEIITVSDSEAIDYGRRLAREEGILSGISTGAALAG
                     AIKLAQRKENEDKLIVMIQPSFGERYLSTVLFQDLIN"
     CDS             46864..47553
                     /codon_start=1
                     /locus_tag="GM3709_36"
                     /product="chaperone protein DnaJ"
                     /protein_id="BAQ63271.1"
                     /transl_table=11
                     /translation="MNYYEILHIQSNATSLEIKQAYRKLVKEFHPDSQHKNSNHDHII
                     KLNAAYEVLSDEKNRHIYDQKLRQKFVNSVNDRQDKSYNASQYYQQNRRQQKQDEFSQ
                     FRWLKEVYFPVYNLINGIISPLEMEIEDLSADLFDDHLMSVFTNYLDDSRKSLEKAKI
                     ILTSQPNPSLYAGIAANLYYGLNHIIDGIEELERFTQTYDDYYLHTGRELFNLAEEIS
                     HSAAEMAEKFN"
     CDS             complement(47695..48141)
                     /codon_start=1
                     /locus_tag="GM3709_37"
                     /product="hypothetical protein"
                     /protein_id="BAQ63272.1"
                     /transl_table=11
                     /translation="MKSYNLSDNLEKKFFIPSKKIEIKQIIVSILWFIFWMGMYAITA
                     FIQAEFIFVPMIFNLPLASFFCTGIILETLFVYYFNIDPSYDLLGKIIVLLFTYALNY
                     GYRQFIYKEIKPFQRKLKSRVKEFFIWIIPWLIIVFILGALSAKIQ"
     CDS             complement(48138..49820)
                     /codon_start=1
                     /locus_tag="GM3709_38"
                     /product="4-amino-4-deoxy-L-arabinose transferase and
                     related glycosyltransferases of PMT family"
                     /protein_id="BAQ63273.1"
                     /transl_table=11
                     /translation="MNRSTSTWEIPRFHVKSNDRWWEFFSFSSLFFLAIILYTFHLGT
                     LPLRDWDEATFAQVAKEISESSFQDWRWLFPTIWGEPYLNKPPLIHSLTALVYTFFGI
                     SEFSTRIIGASLTALSVPLLYSLARELFLPRYYAFFSALIYLTTMPVVRHGRLAMLDG
                     AVLCFQILMMLFILRARRDLRWSLPAGIAFALICLSKGWMLGFLFGTIAFIFLIWDTP
                     RLISSIYLWLGFLLGLFPVMAWQIAQYLYYGDQFINTSIKDQSLDRVFTAVEGNQGPI
                     WYYLLELLKYPHPWIFIAVAGIFIAWQNRNWSWAKFILVWSITYLIIVSIMGTKLPWY
                     IMPIYPPLSIAAGVTLAQIKSLPSFLSYPRWWIVLFSFLALVTSGGFFYFLLTQPDNE
                     NLLTLLVLLSTTFLVTAILMVKKDIQFTGVLFWGMYVSLMVFFSSNYWLWELNEAYQV
                     KPIAEVIKEEIPLSEPVYISFNYDRPSMNFYSERQVKPVNVEEIKELMKSPSYLLVNP
                     EILSQLDLIREKNHYCREKDNVHSLMDTRSNSDCWENIGIPESPFTLLKPIQ"
     CDS             49992..51875
                     /codon_start=1
                     /locus_tag="GM3709_39"
                     /product="trkA-N:Sodium/hydrogen exchanger"
                     /protein_id="BAQ63274.1"
                     /transl_table=11
                     /translation="MDGSFALTLQIVITVFAGISAQVLGEYLKIPSIVFLLIFGIALG
                     RDGTEILHPELLGSGLEVLVALAVAIILFEGGLNLELNALGQVSGSIRNLVTIGTLIT
                     FLGGGMAAHWLAEFPWQIAFLYASLVVVTGPTVVGPLLKQVAVDKRVATLLEGEGVLI
                     DPVGAILAVVVLDTIVNPSTDSLEIISGLLFRLGVGAIIGGVSGWLLGTFQKKANFVS
                     DDLKNLVVLAGIWGSFGLAQSIISESGLMATVTAGIVLKAFSLPEERLLLRFKGQLTV
                     LGVSVLFILLAADLSIASIFALGWGSVLTVLVLMLLVRPLSILICTWGNGMNWRQKCF
                     LGWIAPRGIVSASVASLFSILLTQNGINGGDSIKGLVFLTIMMTVFIQGLSAGWVANL
                     LKITSAQATGAMIVGCNPLGRLIANLFLTQGESVILIDTDKEACEKARKENLPVIESS
                     GLDHQTLEEAGIQGVGTVITLTNNSDVNLMIAQRALEEFSLSKVLAVFPNHEDNKIKM
                     NKQKITQAFIPELFIKKWNQYLTEGQYKLGKTIIKSGSIELQQGHLQTMINKGELLPL
                     LIKRNGKLQILAVGEEWKIDDEIIYLLHDARSDLLKRLSGNIQSSRFVLDKLPEVEEI
                     PII"
     CDS             complement(51913..53346)
                     /codon_start=1
                     /locus_tag="GM3709_40"
                     /product="tldD family protein"
                     /protein_id="BAQ63275.1"
                     /transl_table=11
                     /translation="MTFDLEKALNNLKISADWIGLRQVCETTTTKIFRDGKPQSNGRK
                     YTNGVMVEVMVNGQIGYCATNRLDQQSIQSAIEIAQKQAKSALNWGIFSFDTSIRPPA
                     QGNYRSALKNDNIFNDRELNDLLIQTCHNLKVSEKIVKATAIAQISDIQYHFVSTNGA
                     NIKQEFSLVATDYEATAQSGNIVQKRTDNGMMARCYQGGKEILNPEINFSRAKQIGEE
                     AVELLFSEECPDMMTTLVLAPDQMMLQIHESIGHPLELDRILGDERNYAGSSFVKLSD
                     FGTLAYGSSLMNITFDPTVEGELASYGFDDAGLKAQKEYLIKDGILLRGLGSLESQAR
                     ANVPGVANFRSSSWNRAPIDRMANLNLESGNSSFNEIISLIEHGVYMQSNRSWSIDDY
                     RNKFQFGCEYAQLIENGKITKTLRNPNYRGVTQHFWHNLAYVGDDSTRECYGTPYCGK
                     GEPNQSIRVGHASPVCAFNNIQVFGGG"
     CDS             53756..54565
                     /codon_start=1
                     /locus_tag="GM3709_41"
                     /product="inactivated Zn-dependent hydrolase of the
                     beta-lactamase fold"
                     /protein_id="BAQ63276.1"
                     /transl_table=11
                     /translation="MPFIFMINRRNWIRLTGTGVLTSLLTAKYSYSQKAIASSQGVSI
                     EWFGHSCFLFSNDQGKILVNPFTPLGCTAKYKPPRPIVDLVMISSRLLDEGSAAGLPN
                     NPQLMVEPGVYNVKNIEFQGIKTFHDREKGRRFGENVVWKWNQGGVNILHLGGIASPI
                     SIEQKILMGTPDIAFIPVGGGPKAYDAEEAMKAIAMLNPRMVIPTQYLTNATEANVCE
                     LQGVQRFVDLAKEADLNINIIKGNRITVRPQDLPSEGTLVRVFDGSNLITN"
     CDS             54577..55443
                     /codon_start=1
                     /locus_tag="GM3709_42"
                     /product="inositol transport system permease protein"
                     /protein_id="BAQ63277.1"
                     /transl_table=11
                     /translation="MKITRNLTPYLFLLPALIVLSIIVFYPAIQAFSLSFTRFEYDLT
                     KTPEWVGFENFQRLWEDKLFRQTVINTLIYLLGVVPPLVIFSLLLAILVNQKLKGINW
                     FRTAYYTPVVVSMVVAGLAWKAIYWSNGILNQFWFSLGFKDGIPWLTSANWAIWSVMV
                     VTIWKGLGYYMVIYLAGLQSISPELYEAASIEGSDGWRKHWDITIPLMKPYIFLVAVI
                     SALSATKVFEEVYLLTQGGPRNATKTVVYYLYEKAFKDLDFSYASTMGLVLFVFILIL
                     SIVNLSLSNKLE"
     CDS             55789..68070
                     /codon_start=1
                     /locus_tag="GM3709_43"
                     /product="alkaline phosphatase"
                     /protein_id="BAQ63278.1"
                     /transl_table=11
                     /translation="MSVNLASRASAVTTDSQGKTHVVWAEGSFLWYAEYDNNSGTWKN
                     AQAITTLENQDISNISFLYDDNLIQEDTTNNNSQPGFVVTWQQGSENDSDFYYTAGKY
                     DENQQLQWLANPQAITTDQVGDLEPSAIVYNGDVLLVGSKVNVENANNQQIREDSDLY
                     YQQFKVNDSLFTTTTTTPPNASYSPQISQDGVINGLIPIDTDNSTNTVNTLSSNTKLG
                     INSELTSTTDETPPPISTGANFTWGGGITFSTSLLNVINAEETVPPGIVRKIISPFLN
                     GFEITGMMTGGQSASDIRGASGDNLNPYLDVNATTSFSGKLAKKVAVLVVAPEVEGEE
                     LAEQKAQQETDKATEDKNKENSGSQSGFNVSLALDSKWTFDRETLLLDQIKDTATLSF
                     GLTFGVDNKLYEFQVYANLGASFIVQAEPLPNGDYDPTIEAILATFGSEIGASILLGS
                     IVGAGISLGGGDSKSALAGAIVAAVASSVFSTIADAIAISNDSEGLYYQTAIAFPVIT
                     AGGKFRLGLKFLNFSGQLGIGAGMIWGLENTPNVQYLQFPISAGVNLGPIYLGISLTP
                     GWQWEAFNSDSSENTTSDVASSLANFSSESTNAIVQGSLLTINWGENLNTDNIPDSSQ
                     FTVTVTDNLGNITTIPVFQVSIESNTIQLRLSEVIPLSANYDYTTSNNPTPQPNLIQV
                     SYTTSDNQSQNLQDSQGEEIDNFNLSVTNNSPDSFSATYNPTTGNSQNYSILNNELIL
                     SFNTPLNTNILPDVRRFTVEGATIDSLTVESNAIVLVLKLNDNVVADATVTYSNQQGL
                     GNLLETVDNESIASFTIDSDITISQSQFVIGVQFTNTLNSNLIPNINQFLVQTIDNNG
                     NVINTVTVNQVDIVNGNIVNLYLSQAIEENQTYRITYTPANNIATDLEYQDGTEVEGF
                     TVVSNQENSQGITTNELTAILVQNLDSNVSFSNSINNYNVTLTDEVGNIQDSVTVQSL
                     RVKSQGVELIINDNLTDNENVVIDYQNNGNEIKINSLVTGIEPPPFDTQSVIGNIEAD
                     LGQDSTPTLSLTKTGEILMAWVAEVAPIQPIAGFVNGDIIILNFVENLQNDSIPQPSQ
                     FTVTDTQGNIYNVDGAPSLLGNSLTLILDETIPESAQIKISYSFSPTKNNGNLYLTDA
                     TNTRLWINEFSNFNLTNNTNKNNSPTLLGAGSIVANVSGQNVNRITLVFDQTLTGNPI
                     ESQFSIENNGINYQLLNNPTVNGNTVTLNVIPPSGSGLIGAGDLVTVDYSNNINGNPV
                     STQQQLTSNNGIVAEFNNQPVITSPTTPTTVIKYGFTPSGDALLSTPSSIIGSKGLNF
                     NPVAELDQKGNNVVMWVNADMSDIPTSLTPGEFYSDNQTNLINESLSQSDIYYSIYNA
                     KTQEWSIASPLVSQEGSEGKIVLGMGENNQLIATWLNYTDEETNIYWSSLAYDSQDNG
                     IWSEPQLLYQDASPDPLTELEIASINGKTAIFWTETQQVSYSQLTIEGSPILYFRLAE
                     NSGTVANNSGTWGAGGNGIYNGTVNYHQTGALENTTTNKGDKNPAVLFNNGSSLTLAE
                     DLGLISGNSFTIELWFKIPNNLNETINIASMEGLFSLSVSQSLELTLNIDNQNISPDS
                     PIDTDTWNYVVATYDGQSDTVILYLNGQPVVTRNNVDFTFPSTTNLTLAGGNDNLYLD
                     EVAFYNKTLDYSDFIPSDLNSGNVSSLTGEQLISILSGDGTDIGSKYSAQYIAPLPPG
                     ANTYYAFIDDDIDTPSQIIPEYQVIATQLSDANKPQWDIVSNVSANSNSYIYPNGIPD
                     IYLPLNLQNQQTGTKISSIEITAQDSNRNTFTWSVGNTQGNQLGVVQGETLLNPINPE
                     GEFDYTILSPNVNLDLFIDGSNSNLSNFQYSINGSDPQNINTADVTSEPTTVNSNQVL
                     GIATVTEANDSSLALIDSGFIINTDNASIGYILSNGDLDGDGKTDVIVGNRGYTDSDG
                     NLLNNGTIQILLGGGDVLGNSENNPLTTTDLLGNPNGIFIKGIIDGGQANSDFPMSLA
                     MGDVDGDGKDDLIIGAPNVNNGDGIVYVIKGSYLANNKGKTITINSDNSFSDGSNNSS
                     NIGYVINPTVEGGYFGLAVAVGNFNGTGNADIAIGTPGANNGDGLVSIAYDGDTTATT
                     FYTGTGKENLGYALTVSKAKGGQSFSKNTLVDDLIVGAPSFQASVANQWVGVDSFPQD
                     NQNLFSSNTSAAVGKVYVFANNNINPLYSFTGSILPSSNGTAENSFTGSALASDDWDG
                     DGIKDLAISAPGSDTNDGLVYVLKGGSVTSGDLDYISNLIILGGLQFGEAGSVITSAG
                     DVNGDKYEDFLITAPQGAMGAGQGYVLFGPLNLEDVGTLFDLNVTATDNKKTFLLNSD
                     RSYQSVGSSASSIGDVNNDGVDDLMITAPNAQQLYAVYGHQWLADDGSIKLADISGDN
                     GFVIDGDLYNANSKSLNGNGNNVLILGDINGDGFADVLSGGSEYGAVVIFGSSTKNLL
                     DASVGSNDLIVTVANHALKDVIALGDYNGDGLQDFGVLDTNNNFYLQLGSSNLSSLRN
                     LSLSTPSVTSITSSIELGDYNGDGYDDILLNTSTYSTIYLGNKEGNFQNYIIFNPVDI
                     DNMSIDNYTFGSIGDMNGDGYNDIGTGLPNTNSVIPEGNNGQFITYLGGNGTPISSLS
                     LYNTGVDSNRVPLPNNSTDDPHYDLVSIPSGSDSDILVINSGDGISGWISPNNNNSNI
                     APPGNYIYRTTFTLPEGINPNNFTINGLWHTDDMGTMITLNNRAQYLSSFPNYNTDWI
                     PFTINNGFVTGENTLEFTVNNAGSANNPTTLRVKFDTLLSINPVTNIVQPPNTNSLSS
                     SLNNSEWSSFYIQAQQSPLPPGFAVYNGYLYMAYKGNDNNNIYVQRSTNGYNWEDLTE
                     LSLTTQEQPSLAVFNDTLYLAYNNDSTIYLSEFRGNSESISFSGGNFVVEGVNSSPSL
                     LEYDNQLYIFSLSGDDIFYFTSENPDNLTWDVNFVEGQQSKDKLGVTVIPGSANNGAG
                     NILMTYKDSKGDSIYTTLFNGSSWTGAKTIPNQETTDAPSPVTVNNTVYLFYEATKPN
                     SLNYVTSTDGGNSWSSSQEIPNQLLNLGPSAVFYKENIYVGFSSQDESNNPIYVSVSN
                     PIYNTNQTQQLGEQLHSIGDFNGDGITDFAVLASGYVANLGIIENNVLKNNTGAILIY
                     YGNANGMSNSAQPDVVLVNPPVTDSNSPFYEINNFTSIGDINGDGFDDMAIASPTTNN
                     NEGVVFVVFGGGEWKQYSTNNPFNLGSLSNNQSNGSNPNGFVIDGLPSSQAGISMSGG
                     EDVNGDGLSDFTIGAPGNNDNLTYVIFGSDFNNTVNQTGTIGNDRMIGTVTGESFLGG
                     EGNDKIYTNGGIDVVYASQGDDFVTVHDTYFRRLDGGTGTNTLKFTGYNGQDWDLTTL
                     SPGSRLRNFEILDIENYGTNTLTLNSLTVTQLSSTNTITVLMDENDIVNLSDDFSYND
                     TIYQDNQKFNQYISNTSGATILINSNVVDSTLLSPISLSLYNTGVDDSGVTLPTNDTN
                     DPHYELISFPNGSSSNILVVNSGDGISGWIAPDNNNSQSGPAGDYIYRTNFTLPDTID
                     LDKFSIIGQWRSDDEGTTIKLNGVEQYLSSNPNYNLDFIPFTISEGFITGNNTLEFTV
                     NNAGTTINPTALRVKFDNALESNIQFWAPSTNTPQSILNPETISQVSSENSTLFAIDD
                     SGNITAVSSTLSSSNNINNAPTRLFVSNPIANEADGKVEFKIDRTGNLDKYVKVHYIT
                     QDARGKAGSDYHPVLGRAVFQPGESSKIISVPLPLDDVYTGTREFGLLVTNEKESHTL
                     LTDEFNLYVDPTDGQIRNWNHIIDDQPHSVMGGKLEFRLTTTEGKGEVKLYFEGNGDF
                     NNYYAFNNETQKYEPFNFDGNIGAQFFDEDGDEKYEGAILHLQDGSKHDLDGVENGLM
                     LTRGFFSDGETPEILLDTAMYRFRSLDTQGSYLYVGEEEKQSILANYSNNFIEEGLAF
                     YVSDTLDDNLIAFNRFRNSSLPGAYIYAGEEETESIRSNYPQFIDEGIAFYAYDVGSQ
                     MTDNIDRFQNSTGGAYLYTAQPETQNVINNYSNSFNLEGMAFESLLV"
     CDS             68238..69251
                     /codon_start=1
                     /locus_tag="GM3709_44"
                     /product="hypothetical protein"
                     /protein_id="BAQ63279.1"
                     /transl_table=11
                     /translation="MVFAVDLTESVSLDAQGKLRLKQIVQDSLHKGDRVYIVPFSSQV
                     NPTNLNTNPISLSSSIVFKNPKEDIDKIIEQIPLQANINEKNTDIQQAEHFIYRNLAN
                     INQQRLCDSQPIKFQSVVWLTDAPLKTEAGITSDVWVETPANSPYRNSTSKESLDRVH
                     WLNNLPINLRSLNIDNYQLSVADIKPTVQEFCTPAPGGKETCLVNSYIASQLWLPSTI
                     LSVIIISLLGGGIFVIRYYLSLQESWKLEILFPNDEDKITRYLKNKSSLSIGEDIECK
                     GGEIRGYLKREGNKIFIEPTQILPIMYKGKELKQKQLIKDNIIRLNLPYNDQEFEITI
                     KRT"
     CDS             69932..73297
                     /codon_start=1
                     /locus_tag="GM3709_45"
                     /product="hypothetical protein"
                     /protein_id="BAQ63280.1"
                     /transl_table=11
                     /translation="MPNNQATETKTLNIKRTICIGLGGTGRDILMQIRRLIVDRYGKL
                     NELPVVSFVHIDTDKGASQVTGLKTGDTYHGENILFKPSETVTATMNKQEIDDLTKGL
                     ERRSEYERQSPYDHIGSWFPKQTLKDVKSIENGAGAIRPVGRLAFFHNYTKIQSSIDT
                     AENTTVGHGQKLLTKNIVVESGTNIIIVGSLCGGTGSGTFIDMAYSLRQKYGYEIDSE
                     ITGYLIIAPELYGNTPSVKANTYAALKELNYYTAQGTTFNANYDPVNLFSVTENRPPF
                     DFVYLVGNRTNSGHKIVKKEKLCQVIAHKIFADFAEEISGNIKGHRDNVKKYFSVYDE
                     HPRPNAQRYLTFGLSKIYFPRDLTIAICLNKVKIKLINFWLYGEGQSPDSAELLDKFL
                     LNWQSQNETNPNIFKAKLEAITVENDKTFKQVLKNWLNRNQGEIENCKNADDRQRFID
                     KMRSELKSQFKKVQFGETENIRGVWLTQLQKNSLKLEKQFSQDIIDYLAKLLEPANPH
                     FALDNSRGWLEAILTKLNEYVNELEEEKQKTSAFVTIENIEKKWQDSCQRFEDIETDK
                     KGLLGFGGKSNNTKNKEFQETANQSIQEINKLIKRNFDLTLTEESLKIVTNLRYLVQQ
                     LKTQASNFYNLLQDLETFYNRKGEDLSHIDDDEINGEAVFEADDNDQYYQTLLPDRER
                     RNLLVEVSHKINESATLPPSLLYFFTAERVIDNKELTQTIDRNIEAKFGDKTFDLTES
                     VVNRFVQKYPFSDGQIRLKQIIDEADVLLPLNSNAPYFVNDADKTKQIIGFKQTDDRE
                     NQQFRDLITKGIGINSDVIIPLQTKNEIVIIKEFAGFPLRIVNGLRELREQYDRQKRL
                     YDGYNLHNDSQVFFLDIIPPEGREMELLQDNFYTCLAFGKIQKTGDNKNYYLELEDKL
                     RGEFYQVEISSIWEESLETITQNDTIKNYLIDTVKNIEEEVKENPNSFQEIYYPNLIK
                     FVDELEKLTEYDINYNQKKLVLGERPDRTSLGKDGILKRIYDRFVKIVNNAQQRQNVK
                     EKQQLLAQKINEKQKLLTAENNINNVKNKEVLEVDIIADTGDNSIQITEEIDKEFITR
                     WEGVNIVQLMQWYEKGMLNDDEFEKAKKIIGGL"
     CDS             73456..75078
                     /codon_start=1
                     /locus_tag="GM3709_46"
                     /product="hypothetical protein"
                     /protein_id="BAQ63281.1"
                     /transl_table=11
                     /translation="MLEVLKLFPSYLVIITFLLVILPTFIIASMRISLYQHLRDLEKK
                     TRRLVKGDSEGIQPRFINVLQQRFAKTSQQIENVNTIALIDGIYHQETFTSFRFNIRC
                     EEGEYITKTLPNLLLAFGLLGTFLGITTNLYSISQIINQGSGDIGDLTSKLESPLQSM
                     GIAFITSLIALICSSILTVNNLKHNINLEKNSLLNNLEDYLDNIYKPLVEGDTRLDKA
                     VNKMVNQQHEFLERFHEKVGKVLEGTFKQAADKIANENQKSQQLAYQVYQSLLDASGA
                     IHSGANIFKDSIVKLENEVQNLQNIMPIFRQNIESFDKSSNLILTASRNIKESKFSEN
                     LEKITVDLAGTQSKFTEATKLLANCTLAMANHNEKATNLAQQVYEEFKASTATLATSS
                     IEFVYSAKIIRDSKFNENLAKSTDNLATIQKLFLETIKTLNEVVKPIAINVKTLEVST
                     DKMVKLAQNVNQIQSNMNTINDRYLEMKNTSREVLLKVGENSVKNITNYSELFNNLKK
                     INQQLEERLKLLENNEKLLLTILQKMFEKFDN"
     CDS             75140..75817
                     /codon_start=1
                     /locus_tag="GM3709_47"
                     /product="hypothetical protein"
                     /protein_id="BAQ63282.1"
                     /transl_table=11
                     /translation="MREILLITILKFYHKNMRTLRSRSRNTTENQELDVFPSFTDLMS
                     NAFMIMSLLLLLALFQSLELNRRLQSATPIIIDEKSGNFKFKSGSAELNLYFKEYLNK
                     QIIPQIEQIIQERDIDFIQVIGHTDGQVLGLTGNLDQNLEKTAQNQLKVNQLNAGSNA
                     DLALMRALAVVQELQLNQDLKNVKFRAYSAAQLYLPSGELAPLNRQADETRRRIEIRF
                     IPPGKNN"
     CDS             76214..79300
                     /codon_start=1
                     /locus_tag="GM3709_48"
                     /product="alkaline phosphatase"
                     /protein_id="BAQ63283.1"
                     /transl_table=11
                     /translation="MTSTNTVQLIRDDLEYRPPYQNINPENFNLEQLILAGAIIREID
                     DGRPRNPAEFSIDPNQFDKYPFNRPAFDNARFDLRNIKYLFPTVPPKFIDDNGDLDRT
                     RITIQQVAITSRTITNSSDTPIEQTIQTSFTAEEQRAYTQTYGWKVGANVGLTGKVPV
                     PKIAGSEIGGSVGLDFSYSSEVTDNKEEKTSRTEQYTKNFQIPPRKTYRIIAISETGH
                     FQTKFEPVMITGNIAITKETAERWRDTGQKVAEFFSGGLHIPSNARTLATNITKNYTI
                     GDIAFNLDRHTRLDLTLQKFRPQTDWSYGADALFIPGRSATEYYDNPNLRLKVSTDEG
                     LKMQAATRFTTGIRSRKVVDTWAGSLKYDGMADGKLNSPLAYFDSGLHVKIISFSNVD
                     ERIIDLQSGILGDDGFFFLPNVEPDVLEDGTEVMLGMEGTSEDDLMRGDQEDNYFAGE
                     NGNDSIEAETGNDLIFGGNGNDSLYGGDGNDLIQGDDGDDLIQGDDGNDNLYGAEGNN
                     VVEGGDGDDFIRGGDDDDILDGQGENDVIEGVEGNDFINGGDGDDILDGGAGNDSIYG
                     DEGNDYITVTEGNNYLDGGTGDDVILAGSGNDTILGGEGNDLIDGGNGDDVLMGVSGE
                     NILRGGEGNDTIYGGSGKDEIYGGAGNDVIVLQNVWSGFDRFLGGGEGFDTIRLVNPS
                     STVWDLTEDTFIRENIEQIDLSESNIQLKLGVPNILNSVGFVGADNSLERITGNELSN
                     VTLYGSQWQKSENSIDIGDQTFFSYLHPSISESLLIESEINVNFENTEPVAFDDIALY
                     SQGESINVLENDGDVDIDTLSVQEVTNGQYGTVSINDDGTIRYTANDDFNFDRADSFT
                     YTVSDGIDTSTATVNMYLKAPEEPEISSIYRFRNNDGGYLYTGIEERQVVLENFPNFT
                     EEGIAFSMVMEYEDYLNPIYRFQNLNHLGSYLYVGEQERDSILQNYPNFREEGIAFYT
                     FDSVANVSESIYRFQNADLPGTYIYVGSEERENILENYPNFREEGIAFQSLPFSSL"
     CDS             complement(79613..80593)
                     /codon_start=1
                     /locus_tag="GM3709_49"
                     /product="retron-type RNA-directed DNA polymerase"
                     /protein_id="BAQ63284.1"
                     /transl_table=11
                     /translation="MFCLSTDIEKCFDRISHKAILNNLIAPQCVKQGIQRCLIAGVNP
                     EFPEQGTPQGGVVSPLLANIALDGIESIHPSVRYADDMVFFLKPNDNAELILGKVEDF
                     LAERGMRVSQEKTKVTTTQNGFDFLGWTFIVQRNNGKFRCYPSKDNYKAVKKKIKEVV
                     NNSNYGAKEKAKRLAPIVRGWKNYHKHCKMDGYNLFQTERRTWKVFNKETKLNRYQTD
                     KLIKQAFPDVSYSENKFVMVAGDKSPYNGDTVYWSKRNSKMYDGTTAKILDKQHHSCG
                     HCGLKFINEERVHLHHIDRNHQNWKHSNLIAVHESCHDYIHMNKRESSPN"
     CDS             80643..81065
                     /codon_start=1
                     /locus_tag="GM3709_50"
                     /product="mobile element protein"
                     /protein_id="BAQ63285.1"
                     /transl_table=11
                     /translation="MKEITSSSMPPCFERWCQKIDPVLKTKAQKREFRNYLGGLLGDS
                     QRKNLTQIAHNNLDITYHKLHHFLTESTWNYDEVNNKRLEIIASCRQTKISRSFSLII
                     DDSGHRKSGNFTDCVGRQYIGEIGKTDNGNIRSHHPHL"
     CDS             81031..81909
                     /codon_start=1
                     /locus_tag="GM3709_51"
                     /product="mobile element protein"
                     /protein_id="BAQ63286.1"
                     /transl_table=11
                     /translation="MVISAVTTHIYDGVRSFPLDVELYEKAENFPLGKDDPQFQKKPD
                     IAFNLIEKCLNRNYHPQIILMDGGYGNNTNLLEKLEQKNLKYIGIIAKNRLVQVVKED
                     LRESEKRIDEIAKLLPQESFEEIKTGKNREKTLWVATIKIKLSALSGIKTVAIVMNAP
                     SFEKSTDIDYLMTNETGEKVCANWIVETYTSRNWIEVFYREIKGWLGLSEYQVRNKRS
                     LMRHFILVFCAYTFIQWHRLTGGLRRQWGNKPLNTFAEALEAFRTAVSFRFFQWLKDN
                     VEVFSLYKASLGFIWA"
     CDS             complement(83103..85427)
                     /codon_start=1
                     /locus_tag="GM3709_52"
                     /product="ATP-dependent DNA helicase UvrD/PcrA"
                     /protein_id="BAQ63287.1"
                     /transl_table=11
                     /translation="MNSNLDFLHHLNLCQRQAVEHFCGPLLVVAGAGSGKTRALTYRI
                     ANLILTHKVAPENILAVTFTNKAAREMKERIEKIFAQKIAEEKHGQRWDLLSELEQKT
                     IQSKVYRNTIKPLWIGTFHSLCARILRYDINKYQDDKGRVWQKNFTILDESDVQSLVK
                     QIVTKKLNLDDKKFEPRKMRYAISNIKNLGLTPQQYAFENPDYKGRVIAEIYEEYQNQ
                     LAGNNSLDFDDLLLIPVRIFQQNESVLGYWHQKFQHILVDEYQDTNQIQYELIRLLST
                     NNEPHKKHWNWQNRSIFVVGDADQSIYSFRMADFTILLNFQEDFGDNLADNFTKTMIK
                     LEENYRSRENILQAANHLIEKNSQRIDKVLKATRGEGETIYTYRGDNEREEASFVCRK
                     IQQLIKENPELNWGDCAILYRINSQSRPFEDELISKGIPYNIVGGLKFYERKEIKDAL
                     AYLRLVVNPADTVSLLRIINTPRRGIGKTTVDNLMTASQELNIPLWEIINDQTSVNTI
                     AGKAAKKVNQFAEIIADCQEKIQEDSASDILKHILNISGYLDDLKQQNTDEAENREEN
                     LNELINAMLQFQEDNEDATLEGFLSNASLASDLDNLEEGEKAVSLMTLHSAKGLEFNI
                     VFLVGFEQGLLPHNRSLRDEMELEEERRLCYVGITRAKEQLFITYARERYSWGNVDYC
                     TPSQFLDELPADLLSSNLHSRQTISKKAKSEATITSASTDSWEEGDRVYHPIFGNGIV
                     TNLLGLGKKNTLVVQFDSAKKIINPSHTKLEKIS"
     CDS             85766..86134
                     /codon_start=1
                     /locus_tag="GM3709_53"
                     /product="soluble [2Fe-2S] ferredoxin"
                     /protein_id="BAQ63288.1"
                     /transl_table=11
                     /translation="MIKTYQVTIHNRQNKTTEIVTVPENKYILTTAEHQEVEPPFSCR
                     NGACTTCAVKIIEGEVYQPEAMGLSPDLQKKGYALLCVSYPRSNLVVETQDEDEVYEL
                     QFGRYFGRGKVRFGFPIEDD"
     CDS             86226..86768
                     /codon_start=1
                     /locus_tag="GM3709_54"
                     /product="Staphylococcus nuclease (SNase) domain"
                     /protein_id="BAQ63289.1"
                     /transl_table=11
                     /translation="MLNHKLLTSGLLIIFFCLCFGVTGCQNKPIINGIEGKIKRVVSA
                     QTIEVIIENKSYQLRLAGLDIPSTQPQVKETQEAKQFLINFFTLNNTIPLNTSIVMLE
                     TDLQVKDKFDRLSGYVWYNDRLVNQELLTEGYAIVNLTYTDGKYDRVLIDAQHYARIM
                     EKGIWNVELSMNNREKTINF"
     CDS             86782..87612
                     /codon_start=1
                     /locus_tag="GM3709_55"
                     /product="inositol-1-monophosphatase"
                     /protein_id="BAQ63290.1"
                     /transl_table=11
                     /translation="MNYQTEISKLLDVALLAAQAGGNVLQSYWGRQLNIRQKGRAGDL
                     ITEVDQKAEKEILTVIDRHFPDHSILAEESGILGTSDSEYLWVIDPLDGTTNYAHGYP
                     QASVSIGLLVSGIPKVGVVYNPMHNELWSAAQGLGATLNHIPIKVSTTDNLADSLLVT
                     GFAYDRREVEDNNYAEFCYLTHLTQGVRRGGSASLDLCHVAGGRLDGYWERGLKPWDL
                     LAGVVILQEAGGQISAYNDTQFDLYSGRILATNGHIHSALSKALLNTPHSSKFSFLEY
                     "
     CDS             87716..88735
                     /codon_start=1
                     /locus_tag="GM3709_56"
                     /product="hypothetical protein"
                     /protein_id="BAQ63291.1"
                     /transl_table=11
                     /translation="MISDLKHGLFKYDVKDYYAILGVPISASPKDVRLRYLKIAYQLH
                     PDTNRAETEAEKQKASMILSKLVNPAYENLYKDNLRKECQLIFSEIGRRLASDQYKIT
                     IGSDTAKKLLQEERNLDKVYLETLEKLAPEQYHDLDKLSIKIALISELNMVYLMRQKN
                     PNFKSASSQPQIVVSEAGISQSSGKNVPVMNTNNPPVSDNPPPKATVSRIDKLIASAK
                     QHLENGNYEQGILDLREAVKIDASSSTVHALLGSLYMKQNNLVYARIHINKAIALNSN
                     DSIALQAQKELKEIEKKEKSAPESTVKSTKEVKGSKPTDKGKEKSKDGKGKKEPPKIF
                     GIPLW"
     CDS             88781..89995
                     /codon_start=1
                     /locus_tag="GM3709_57"
                     /product="ATP phosphoribosyltransferase regulatory
                     subunit"
                     /protein_id="BAQ63292.1"
                     /transl_table=11
                     /translation="MIHQAPAGARDLLPLEVAQKSWINDCLQQVFQRWGYKRIVTSTI
                     EWVDTLMAGGAIDPSTVIQLQNTTEGRLGLRPELTASIARAAVNRLTNHTIQRLCYRA
                     NVFRNPPEGHHGRQLEFYQAGIELLFTDGVLADAEILLLLADCLQCLGIQSWQLLLGD
                     AGLTRSLLQIFPDNLQPEILKCIANLDRVTLENLPLSPDLKSKALQIFDLRGNPLEVL
                     EKVTELDLDEKGFFAVNHLKSLIDLVNYNSEQKLPIILDLSLIQTFDYYTGITFSAIS
                     LKQNKPYVLGQGGRYNQLLSLYHPEKQSSPGIGFSFNIEDLHSCLLNTPNLPQKTPPS
                     DWLIIPENPSCVKQAFSYAQKLRNSKNLTRVEIDLEFRSKEDIRKYTQNEGILNVAWI
                     DENGNDSIELGF"
     CDS             complement(90259..92025)
                     /codon_start=1
                     /locus_tag="GM3709_58"
                     /product="hypothetical protein"
                     /protein_id="BAQ63293.1"
                     /transl_table=11
                     /translation="MKFQYLLLSNLIVGVSFFVDTPAFADDISDSWVVKSPITADSLS
                     PSSSSQVLFSQENITPESPTTIENTPKPIESVEYSLTPLQIKPFEPMTVETANVLPQG
                     AIYTSYGANLFSKGSEGGGIGLQTYNASIEYGINDKLQIGAGLSFFDDVLGSRFNGKA
                     TDFGFLSLAPNFKYQFINQDNYNVAVVGSLEFIKITGENGLFTPTNRSDSSTTVGGTI
                     QVPFTYTSSNTYQWHVVGGLTVLPDSINGGGDFYGTFFNIGTGISFKFDERFGFFGDI
                     NVPLGPGGNSVNTRGDITKSVVWSAGLNYLHSPNVGIDLSITNRLGSTPATKLLSFLP
                     DGGPVGVGLNVRYTPDIGQNYQVSFDTRPIQPFSSRDKQLLFDGIILSSPNTIRQGMF
                     SFDGGIGPSVNFQVGYGMSNNAQLEFIGQQLGESDEDIGNSVKLGGATKLRFLNQSQG
                     DPFSFGLRGAFQEATTTDDGVGSFTAEAAFSYEVNDKIALMFNPKAGIYGGNNILGAG
                     LGLNVQPFPGFQIIGEVTPMLSNDATVWAAGARYMPPQTNVGLGVYTTNATGTTDIGS
                     VVSQSDGNVSVGFNIMWLLGNN"
     CDS             complement(92517..92684)
                     /codon_start=1
                     /locus_tag="GM3709_59"
                     /product="hypothetical protein"
                     /protein_id="BAQ63294.1"
                     /transl_table=11
                     /translation="MHTKILLLPLYRNGLAGAPIFSSKISAYSSSNFAKCIKPVKTID
                     FHHFMTPNSKP"
     CDS             complement(92939..94081)
                     /codon_start=1
                     /locus_tag="GM3709_60"
                     /product="hypothetical protein"
                     /protein_id="BAQ63295.1"
                     /transl_table=11
                     /translation="MFDLNDRTLLLAITGSNAYGLAVEGVSDIDYKGIFIAPKSYYLG
                     LKQIEQIEGKGKEGIFSNNQDNKGLTKIDINYQKFNFLKGNDFVIYELKKYLNLLKNA
                     NPNIQELLWLNDYIYLNPLAKILINNREQFLTKKVKFSYIGYANAQLKKVEVHRRWLL
                     NPPKKEPKPEDFNFTELYKPLSLSEINAFMNFLWIVVRDCIEYLQPAEELRLILQEKI
                     DYKQIFLEHKFPENIEKQIQEYTNASDDFMRLTFASRNYLSAKKEWKSYQNWSKNRNA
                     KRQLLETKCGYDSKHASHALRLLYTGREIIKQKKLIVNRTQSGDANYLLNVKLGNISY
                     EEVMQECNQVFNEIKNIPEKNIDLPDEINDDFLNNLAMEIVEKIGF"
     CDS             94537..94992
                     /codon_start=1
                     /locus_tag="GM3709_61"
                     /product="large-conductance mechanosensitive channel"
                     /protein_id="BAQ63296.1"
                     /transl_table=11
                     /translation="MVANRSRTFFADFRDFIMRGNVIDLAVAVILGGAFNGIINSLVE
                     DIITPAILSPAIKAAGVDKLSDLSISGIKYGLFLSAIINFLVIAFCLFLIIRSFETLK
                     RKLIRQEEIVAAEEAAIQSEEIKPEIVVQENLTKAIETLTETIKQQNNS"
     CDS             complement(95063..96172)
                     /codon_start=1
                     /locus_tag="GM3709_62"
                     /product="S-(hydroxymethyl)glutathione dehydrogenase"
                     /protein_id="BAQ63297.1"
                     /transl_table=11
                     /translation="MKVKAAVALSAGKPLTIETIDLQPPQTGEVLVEIKATGVCHTDA
                     YTLSGNDPEGLFPSILGHEGAGVVVEVGKDVKSLKPGDHVIPLYVPECRECEYCLSFK
                     TNLCQAIRVTQGKGLMPNGSSRFSLDGKPLYHYMGTSTFSNYTVVPEIALAKIREDVP
                     FEKVCYIGCGVTTGIGAVINTAKVEVGANVVVFGLGGIGLNVIQACRMVGANMIIGVD
                     INPSKKLIAEKFGMTHFVNPKEVEGDLVPYLVDLTKGGADYSFECIGNTKVMRQALEC
                     CHKGWGVSTIIGVAGAGQEISTRPFQLVTGRIWKGSAFGGAKGRTDVPKIVDWYKEGK
                     INIDDLITHVMPLEEINTAFDLMHKGESIRSVITF"
     CDS             complement(96381..97016)
                     /codon_start=1
                     /locus_tag="GM3709_63"
                     /product="ribonuclease D related protein"
                     /protein_id="BAQ63298.1"
                     /transl_table=11
                     /translation="MSLDKFQVCEQDLPQDIFNQYLKAESLAIDTETMGLIPQRDRLC
                     LVQICDAEGYVTAIRIAKGQTTAPNLTKLLESVNITKIFHYARFDVAQFKHTFGVETT
                     SIFCTKIASKIARTYTQSHGLKSLVQELEGIELDKKAQSSDWGNVNSLSPEQLSYAAN
                     DVRYLIPVREKLITMLKREDRWELTQRCFDTISLFVDLDLMYYGNVFEHQG"
     CDS             complement(97072..97353)
                     /codon_start=1
                     /locus_tag="GM3709_64"
                     /product="hypothetical protein"
                     /protein_id="BAQ63299.1"
                     /transl_table=11
                     /translation="MYKEGCDVSVFLRDQQRWIEDAQIIGIEGDIVVIRYEMEEDYEN
                     SSWEEFVRLESIGAVSRKLASVPRGYGEIQVSDDCPEAEQIYPRHHDTE"
     CDS             complement(97623..98531)
                     /codon_start=1
                     /locus_tag="GM3709_65"
                     /product="possible alpha/beta hydrolase superfamily"
                     /protein_id="BAQ63300.1"
                     /transl_table=11
                     /translation="MNKINIRGVDHFYEFTKSTSPDISSPVLVFIHGWLLSHQYWTPL
                     IDRLKHKYSCLTYDLKGFGASQLPSLENKFPNSELSFCFDLHSYAQDLKELLEKLEIK
                     KAWLIGHSLGGSIALWGADICNDMIEGVICINAGGGIYLKEEFERFRKAGENLVKFRP
                     SWLLHLPFFDFIFSRMMVKRPLNLQWGKCRLQDFICANEQAAIGSLLDSTTENEVHYL
                     PQIVARLSQPVYFIAGKQDQIMEPQYVKHLASFHHLFQCHQDNVYEIEECGHFAMLEQ
                     TDLVTNYTKKIIQQYHTNICQDKMLR"
     CDS             complement(98658..99134)
                     /codon_start=1
                     /locus_tag="GM3709_66"
                     /product="hypothetical protein"
                     /protein_id="BAQ63301.1"
                     /transl_table=11
                     /translation="MTLLLSSCSNYPRLLTFPFSDNTRSFNSRSSELSPYIAGQYITF
                     VSDRNGSQDVYLFDAKNRRLIDLPGLNSINEVALNPSISEDGRYLVFAIVSQGKSGLY
                     LYDRTTQQKRPLITQQTREIRNPMISSNGEKITFEVANNGQWDIVVTDIRGNPINN"
     CDS             99537..100667
                     /codon_start=1
                     /locus_tag="GM3709_67"
                     /product="PatA subfamily"
                     /protein_id="BAQ63302.1"
                     /transl_table=11
                     /translation="MTNAMVENSITSSNKQIVAIPHKVLQGLLGKKISGKLIIQDPID
                     REIQWIIYLGKGKIHFATNTSRKRERVNYLLSHNFSEYNFYIPQDLEDDYQFIYYQWQ
                     EKHLNSQQVREILFGMTQEAMIFCLALPRAEVKYEKIVSLDPLILSKSAKSLVEPVKS
                     QIRGWAQIRGDISSPFVRFVNSDWHSLRSYFADDLPQWQRLEKLKPYLDDQCSLYEIG
                     TYSGESVLDLGLFFQPLVSLNLLNVKSVESIVTIEKPLIACIDDSQAIQRVVKMTLLA
                     GGFDVISITEPAKAISVFVTQKPDLILMDINMPDIDGYKLAYMMRQSELLKDIPILML
                     TGRDGVLDRVKAKMVGAIGYICKPFNPQELVQSVNDNIQKEV"
     CDS             100675..101037
                     /codon_start=1
                     /locus_tag="GM3709_68"
                     /product="two-component response regulator"
                     /protein_id="BAQ63303.1"
                     /transl_table=11
                     /translation="MKKVLVVDDSKSQQKLVNGLLQSMGVEVTLVDSGESALQWLENN
                     GQPDLILMDIVMPDMSGLDVCRHIRKEMNYKIVPIIFVTTKDEDFDKFWALRQGGNAY
                     ITKPYSPTDLINTVKSYL"
     CDS             101099..101551
                     /codon_start=1
                     /locus_tag="GM3709_69"
                     /product="hypothetical protein"
                     /protein_id="BAQ63304.1"
                     /transl_table=11
                     /translation="MDYFIVELVGRKKVAIPLNQVQEVININCSDICPIPGVNNSLVG
                     VTNHRGNFLWIVELSQFLFQQSLQNIGLNSLTILLTKIHHNNLGLLVQKLGEIKTFYD
                     VDKSFNDDSLNICHDYCQGIISDTENIPIINLGNVKNSLNQTNLSLSR"
     CDS             101945..104512
                     /codon_start=1
                     /locus_tag="GM3709_70"
                     /product="methyl-accepting chemotaxis protein (MCP)
                     homologue"
                     /protein_id="BAQ63305.1"
                     /transl_table=11
                     /translation="MNQLQQETANSSFSDEIKFLQNNVTANPKDLTAKLSLATVLEQE
                     QYYHEAIEVYRSIIEQDTDKVFTDTANKAIEEINKKYLLSEEDDESKINKNREKTTVI
                     KNINLWQQFKDLPIAYKQFIALLIASLVSTVGVIIAGRVITTILGKNQLEKRAISELN
                     ITSIDYNSNLENITSGFRGKADNIGIIETAKTYKAQGKIDPILKNMVRTILNNEIKAR
                     GIEYATLVGLNGRIIVNANKDRFGQSFILENLVSQVIKTREVLETNVIIPRKEIIAEN
                     PSFASKINSENVLMNVSLTPVNDFQSQQMIGVLMAGELVNDNSILLEDIISAMGGGYN
                     AIYMFKNDDFHLVTSIFQPLNSEEFKANIPLLDISLLEKLKKENNDIILGRMTIENQS
                     HTIAIKPLPDFEGENIAFLVRGTPEASLQQIFNQSVTYQIIVGFLSLIVALFLASYFS
                     KILTQPIEKLQISAEKIGSGDRSVRAKVTSRDEVGKLAQTFNEMAEKIDTYTKEIEEI
                     AQKREKEVEIQRQQRENLQENVINLLLDIEKASKGNLSIQAEVVSGEVGSIADAFNAT
                     MRSLEGLVKQVVVSTNQLNETALSNGESVNHLAQNSYKQDNSIQIISTSIQEITNSIE
                     KISESAQNAAVIASKSRFTAQEGQSIINETVNNIYQIRHTVADTAKKAKRLADSSQEI
                     SKIVNIISGISEKTNLLAFNASIEAARAGENGQGFRVVADEVRRLAEQVTFSTQEIEQ
                     LVEGIQEETSEMMTMMEQSSTQVVSGTKLVQNTKETLQKLSVISNEIDTLLQSISEST
                     INQKLISQKVNKKMEEVAIVTKEIAEESNTVSQSLQELVTVAMEMQKSASRFQVSQS"
     CDS             104624..107314
                     /codon_start=1
                     /locus_tag="GM3709_71"
                     /product="signal transduction histidine kinase CheA"
                     /protein_id="BAQ63306.1"
                     /transl_table=11
                     /translation="MLDAASLAAIAEEARICFLEEDAPEYLDILTKGIDDLKQSFQEN
                     NDTQKLEFLYKELGRAAHSIKGGAGMAEMPVVSKLAHKVEDIFEALQQDRISDFNTTF
                     ELLSLAIDDLENLINLEKSSSISDDNSSDLLTVLDEFLATLNPQNDVVDIGFADDSFI
                     TMALNQDLSACIERVKEIVDNPSLANPKNITNSLNILLEECQLLGQALNCNWLVKLSQ
                     VIRDLQANNQDSPDNFTRKSIEEIENHKQQFLAGNKNPIFSSYFQPETTIEKSENKEL
                     ESKKIDNNEILSPSANVRNLRIPLDKITNLSNIVGQLLTNYESLKLYENQLKQASVNL
                     KKKTKSLAPVKEQIESMYDQLTISQSSFLANNIKELNHQLSEFDTLEFDEYNQVHTSL
                     QNLTELIIQVQEVREDFDLVNREFQETLIEMQKSLNILDQELRKVRLVPFISLAGGFF
                     KPLEKLNKTYGKSVELVVEGKDILIDQNIIEILRTPFNHLIRNAFDHGIESPEMRKKL
                     GKSLPAIIKLTAKIEGNSVILTIKDDGGGININKVYEKALSLGLFAKNISFADLTQEE
                     ILRTIFSPGFSTASQVSDLSGRGMGMDIVKAEIEKLRGTIQVNTNIGKGTEFKLKIPL
                     GLNIISLLLVKISKQVIAIPSENVFKVISLSNHDINDNQMLWEGKKIPVYNLSQILPY
                     NENLAMDISQGYIGLLLNINGEEIIMRVEGIVEEKPLVAKSFDDTVAIPPYIGGGTIL
                     GNGSFVPILIPDYLTPLLTNKQVVEDDISIPKEELSVMVIDDSVTVRRSLNRVLSQVG
                     YNVTQCRDGKEAWNTLQSTTQSFNIAICDLEMPGVDGYKFLQMVRVSEKWQHLPIIIL
                     TSRNNDLHRQKAFDLGANAYMTKPFNPLKIIDSIEELAIK"
     tRNA            complement(107454..107540)
                     /locus_tag="GM3709_t1"
                     /product="tRNA-Ser"
     CDS             complement(107896..110136)
                     /codon_start=1
                     /locus_tag="GM3709_72"
                     /product="3'-to-5' exoribonuclease RNase R"
                     /protein_id="BAQ63307.1"
                     /transl_table=11
                     /translation="MIKPRKFASAQIKQASAINLADYYSNRLPVFGITIDDDTTVDRD
                     DGIWLVELNNGNFELQVSITDVSTITPKNSSIDEEALLRVITLYHTSPPTPMLPSHIS
                     TNLGSLEEEERRLALTIFFQIDSSGNVNSFRIKETIFTNKNAFSYEEVEKILMNPQDI
                     AEHKLLVKMQKVAQLIGKKRGGNSGILTVDGYLDEDGNLIQENVNTYQLIAELMILTN
                     TTIANFLAENNVSALYRTQDVGTTDFETVKKTMGHCLVPANYHPWAKPHVGLGLMAYT
                     HFTSPLRRYVDLVNHRIVKAILRQESSPYTISELENLCTHINNFNQQLKIDRNNYIKQ
                     KKQEDIERKFNNIDKLNIEKLSGDEFSDLLQYAVFNNVIDKIFPYIEFRLDKLQPKDF
                     YFLWFIAKINKFFDFENVNSPSILLIKTQLDSSVIEYKSQYSTVNKNYYVHCYIDGLT
                     TENPAEDIKKNKAKQKAALAVIKGYVCDELISNPSPIEGLSLVDEENPLESDLSSLND
                     KDFSKILDYCIKTNFDEKTIEEITNRINNLLPKDLYKIWFQGKINRFFDKENLDTISV
                     LLIHSQLTTCQVEYKIDYLSQSKKYVAYCYVDNLTHPQPQVDTKKTKAKQKASLAYIE
                     SYLNEKLTDQPDLYIEEEEKIDYDILTENSIQSNLVENQEKNIIEDNDWVSKLHSFCQ
                     LNHLEFPEYEFRNIDSFFTCKIKINYGDKTLISHGYGRSKKDAKKSASYILVIQHNLN
                     LSKLVI"
     CDS             110260..110460
                     /codon_start=1
                     /locus_tag="GM3709_73"
                     /product="hypothetical protein"
                     /protein_id="BAQ63308.1"
                     /transl_table=11
                     /translation="MNEEIFINNKSQKSLLIPILIGIFCGVLLGGFLPIWGKGIYFLG
                     ELFINALLMLVIPLVITSIITV"
     CDS             complement(110966..112762)
                     /codon_start=1
                     /locus_tag="GM3709_74"
                     /product="cell division protein FtsI"
                     /protein_id="BAQ63309.1"
                     /transl_table=11
                     /translation="MGLANLVKKPIRKTTTKVYEPKKVWLTVGQKDQPIFIMVVISLF
                     LFGAIGLRLGYLQIVEGDKYSLKADSNRTKIIPKPPVRGNLFDRKGRILGATKLSHSA
                     YLWPVVQKKENWLQIRTMLANILNIPEDKLQELLEKEGYDSPTLVRIARNLTPQQITA
                     IEENRDILSEVEVDTDTVRYYPQGKVGSHILGYTREINGEELKARQNEGYRMGDVIGK
                     MGAEAGFESELRGEWGGILMERDGSGKVIRKLGIKEAKAGNDVTLTLDLELQKVAEKA
                     LGDRKGAVVALDPRDGAVLSMVSYPAFDPNIFSGRITEQIWQEVQGKGNPFINRALVG
                     FPPASTFKIVTATAGMESGKYSPSTVLPTYAYLRVGGTAFGEWNRSGFGPMGFVSALA
                     WSSNTFFGQIGNGVGGETLIKWSRNYGFGSKTGIEIPEESGGLIADQEWKQKRFNWDW
                     TVGDTVNMSIGQGFTLATPLQVAVMFAVPANGGYKVIPHLYQDKATYLKKRESLNLKP
                     QTVNTLREGLRAVITRGTGGKVALSGVAVAGKSGTAEAPPGKSHAWFGGYAPYDKPEI
                     VVVAFVEHSGGGGGSTAGPIVRQVLEAYFQNK"
     CDS             112796..113203
                     /codon_start=1
                     /locus_tag="GM3709_75"
                     /product="hypothetical protein"
                     /protein_id="BAQ63310.1"
                     /transl_table=11
                     /translation="MIQNSLSSLLLELESHCNSTAIVTFLDSDGEVFVVDLIRKNNQV
                     NYGYQKGIKEKFMLRLMRGVQTQASIILRSFTDEIDQYTNLPIKELRGYILRKNSDRI
                     EFNKISPKMMFACHNTDAQTGEPRPLEQSVRYC"
     CDS             complement(113263..113697)
                     /codon_start=1
                     /locus_tag="GM3709_76"
                     /product="alkyl hydroperoxide reductase subunit C-like
                     protein"
                     /protein_id="BAQ63311.1"
                     /transl_table=11
                     /translation="MALTVGTKAPVFTTTNDQGNTVSLSDFVGKVVILYFYPKDDTPG
                     CTKEAQSFRDNYQEYQDKDIVVLGVSNDDEASHTMFKEKYGLPFQLLADTDRSITKAY
                     DVDGGGYPKRVTYIINGEGVITHVDANVNTSTHAQDILASIS"
     CDS             113762..114472
                     /codon_start=1
                     /locus_tag="GM3709_77"
                     /product="hypothetical protein"
                     /protein_id="BAQ63312.1"
                     /transl_table=11
                     /translation="MKIPLPKNFEPQQPLKISDYQDMMVTLFCPQIHPCQFNLEKLKE
                     TKTIPFDWQLSKPILKKPNLLQLIFDKGITINIEIHKISFFSKINQNIQYLSEVVKNF
                     LIKFINYNWQKLQLSLRRFISLPGNSENGAKFIQETLLKNSNQWNVLGHKLIKAQINL
                     CYNLIKSNLIIQINDLKINNKNKQKFKNGLLFRGIFSYNLAQKGNIEKINYLISIVTN
                     YQNNIKVFNQIINEQILT"
     CDS             complement(114697..115410)
                     /codon_start=1
                     /locus_tag="GM3709_78"
                     /product="hypothetical protein"
                     /protein_id="BAQ63313.1"
                     /transl_table=11
                     /translation="MTDSNIPSKEETLRNNPITESELEISSQDPVVFQTHFGGIMEMY
                     SDLDTVANYLNDHQGWFVRCAMPMKAEPFGENGYTLIIGCYGAFGYNVEPQMTVILEP
                     PQANFYYMYSVPNPEFSHEGYEVDYHSKMYIESIPFPSASKGIIEVYNKQKQQTPSEI
                     TKVNWQLNLQVKVRFPRFIYKLPLSLLQDTGDRLLSQIVKQVSPRLSYKVQKDFHSRF
                     NLPIPPKTSRTCHQIANND"
     CDS             complement(115516..115671)
                     /codon_start=1
                     /locus_tag="GM3709_79"
                     /product="hypothetical protein"
                     /protein_id="BAQ63314.1"
                     /transl_table=11
                     /translation="MNKRDIWFFNYRRHEEKIDKVITASIKSMVYPLKNCYKFRNLIF
                     LMTGESP"
     CDS             115749..118448
                     /codon_start=1
                     /locus_tag="GM3709_80"
                     /product="cobalt-zinc-cadmium resistance protein CzcA"
                     /protein_id="BAQ63315.1"
                     /transl_table=11
                     /translation="MSLSFRQRFNISRFAIHHPWLTINFWIAVSVAGLLAFSSLKYTL
                     FPDVTFPVIIIRASGNFETVVETETNLTSPIENSIITLDSIESVASSTFPNETVITSL
                     FFAGDTLDNAQKTIEKAIKTVKLPTYSKLEIIPYNLNESSAISYVLTSETKTIEDIAE
                     VVKTKIIPPLESLDGILKVNVLGLESPVNKDISPSLIRFNGKEGLGIQIVKRGDGNTL
                     EVVKAVETTMTKLLPSLADMDIKANIAQTEATYIQEATQSTIDTLILAIILAVLIIFP
                     FLANFKATFITALAIPISLFGTFIVMAIGNFNLETITLLALALVIGIVVDDAIVDVEN
                     IMRHIEEGDNPKEAAIKGTDEIGLTVTASTLSIVAVFLPIALTTGNLGQFFKPFGLTV
                     SAAVIISLLVARTLSPVLAMLWLRKEKEEDTGREEDKRKGRFSVYYQLFIDRVLQKYR
                     NLLIWSLSHRKIVLVIALVSFILGIILIPFIPQGFIPQLDRGEFNVIYTSELPKIPAS
                     WNLNQNAGKDTSVNDNSSFGWLGEIKQNPNGFLLRRSRRVGDEIEASVLQIPEVESTF
                     NIVGFRGQPNRGKIYVKLRKNRKFSTAQVQNKIRENLPVIKGVSVSVEDIKFVDTGDD
                     KPFSFALQGENLTSLFDSATKVKSSLNNLSGLTDLTVSPPLPENTDNILTIEHFNGVR
                     SITFSANIAEGFVLGDLTQEVVNQIQPLLPFDVNIFLGGDYGRMEVVLKQFTIIFILS
                     IVFMLSLLGVLFGSLLEPLVVAFTLPLSIVGAMVALLITQSDFGMISLIGVIFLLGLL
                     DKNALLLIDYAKQQRKKGMARQDAIILTGMTRLRPILMTTFSTILGMLPIALGWGVGA
                     ELRQPMAVAIIGGLITSTLLSLIIVPVFYTFIEDFWLKIIKRN"
     CDS             complement(118696..119307)
                     /codon_start=1
                     /locus_tag="GM3709_81"
                     /product="hypothetical protein"
                     /protein_id="BAQ63316.1"
                     /transl_table=11
                     /translation="MKLLLLKDLVEQGISPTEVQQSLTLTCFTKTFRRQSDLPKKFKE
                     KAVNLCKEMNQLGKETFILETNYSYTVWVEEQGIKEKKKSQDSSSQANQNLSVSSSVE
                     NNTELEVYTLPIEEKVIDSKQTFTMTEYNLFDIASSNNFERNRRQNQEEKQMSSASKE
                     ITDEVKTYRGVVLNQSVKTQPVIEETSPLKQKVKPRTYRGITY"
     CDS             complement(119418..119843)
                     /codon_start=1
                     /locus_tag="GM3709_82"
                     /product="Slr0243 protein"
                     /protein_id="BAQ63317.1"
                     /transl_table=11
                     /translation="MSGIKRKLIIYMSILLLCVACGREKPPLEFAPSPSIIEKALIFK
                     LEYQQESLSRQLRLKKPNFIIKKINVTKIEPTIVFNLPTYHLEGTYKVKIKQNTLKNV
                     LIDNTFNLDLQRQSRGKTWRILLKLEGKKPLEYLSYLIH"
     CDS             119893..120879
                     /codon_start=1
                     /locus_tag="GM3709_83"
                     /product="DNA segregation ATPase FtsK/SpoIIIE and related
                     proteins"
                     /protein_id="BAQ63318.1"
                     /transl_table=11
                     /translation="MDNTSENINPNFSIELKKSLKRTIIQLQKAIDIINSNNIKDLPN
                     LTIVNNLVESSNALVDYLRLKNYDNKEIDESNNEEQFLSELQEENTLNNINKERDIKR
                     KKKTNFNINLFLLISLIISLFFNTFTWLYQPNINKVLPENNIQNNSNSLEKIENIPTK
                     SEDIDILKDDKISIIQQKDQDIKTNDNINSVDDIDNKEEKINENKTQENLEDLSNDSF
                     SEISKLPLTPEQYLLKNIKDQIDEITNKYGKKLILRLEANLSQNILLITVTDDWYKLS
                     YNEQNNLVSDIFNKGKNLDFYKFNIIDNTGKLLARNAVIGNEFILTNRNMKN"
     CDS             complement(121125..121862)
                     /codon_start=1
                     /locus_tag="GM3709_84"
                     /product="phycocyanobilin:ferredoxin oxidoreductase PcyA"
                     /protein_id="BAQ63319.1"
                     /transl_table=11
                     /translation="MVISSSDLKSRLHPLINQLADAIITTWQENLTLFPYQLPEGLGY
                     VEGKLQGEKLIIQNSCYQSKQFRKMHLELAKVGNNLDILHCVMFPYPQYPLAMFGCDI
                     VAGKVGISAAIVDLSPTNADKTLSPDYQLLLSNLENPTFQDKRDLPTWGDIFSPFCLF
                     IRPSNAEEEVLFLKRVKDFLTIHCQLAIKSSELSETEKLVYLEGQKNYCIQQQQNDKT
                     RRVLEKAFGIEWAENYMNSVLFDIPSS"
     CDS             complement(121971..122918)
                     /codon_start=1
                     /locus_tag="GM3709_85"
                     /product="undecaprenyl-diphosphatase"
                     /protein_id="BAQ63320.1"
                     /transl_table=11
                     /translation="MSKSNHHLFNTISGVSGGILFVFLAHSVVLSQQVNPSTVNNFSQ
                     VNTFQAFILGMIQGLTEFIPISSTAHLKVIPLALGWNDPGVSFTAIIQLGSIVAVLWY
                     FRRDLIDLTTGILNAIKKKDYQAQDFKIGLGIFIGTIPIVVSGLALKILVPDLDNAGF
                     RSVKTIALASIVMAILLGIAEKISDHKRNFDQLSTKDGILMGLAEALALIPGVSRSGS
                     TITAGLFMNLERATAARFSFLLGIPAITLAGLVELKDVFDRTLTFDYLIPLTIGLISS
                     WIFSYLSIAWLIRFLQKQNTWVFVWYRLIFGIVIFLTMK"
     CDS             complement(123105..125267)
                     /codon_start=1
                     /locus_tag="GM3709_86"
                     /product="TPR domain protein"
                     /protein_id="BAQ63321.1"
                     /transl_table=11
                     /translation="MTEIEQKINTAIKGLTRRINLKIEHILMIENALGNPEVDNQIWE
                     KYLNGNNTQMALEKNIYTSEMIKLLTLRAIILPKMLSSFLRWMLKKQNKNKEHFQISL
                     DFQYFFYNNLSSQTPLLKQKIIQGIVYIFPNLIDQPDVLDGVIWLLKSNRNPVNKQNN
                     NINWSLIYFIGLWESFYKDDIQYFINNALIGQYISNDQIRKLIKEDHDWQTIQKDIKQ
                     LWNKNHISLMPQYLVFAKLFYHLNNYYLSAFFYQVSQGNVPSQIFNAIPIHADIKLIK
                     SNIIRLYGIQIYKQPLLLFRNVNTKNLLLIIFIIFAILLISPLTISSERLYKRGLNYA
                     QNQQFDQAIEFYNKAIEKGLISEDILYQRALAYQRKKDYNRAIEDYRKVININNKNYN
                     AYLNRGNIYQKIKEYDKAIYDYNQAIKINHKFIKAYINRASIYRILNQNYNAIDDYTT
                     IINIDNQFLDAYKKRGDIYLKINQYNQAIFDYTIAIKLGDYDVHNYKNRGNAHYKLKQ
                     YKKAIDDYTKVIENNKNLSDIYFKRAYSYAQLGNHKKSIEDYKQVVLLEPNNNLAYNN
                     RGISYQKLGKYQEALKDFDTAINLNNQHPYAYENRGDLYYYNLTQYNKAIYDYTQAIR
                     VNNKNKSAYNSRGNVYHSLGQIQKAIYDYTQAIKIDNNYAQPYYNRASTHLKNNNKSQ
                     ALNDFNRAAQLYQKQGKKEWYQLSIEKIESLKNILENE"
     CDS             125848..127092
                     /codon_start=1
                     /locus_tag="GM3709_87"
                     /product="cobalt-precorrin-6y C5-methyltransferase"
                     /protein_id="BAQ63322.1"
                     /transl_table=11
                     /translation="MIIKVVGIGLEGINSLNNSALNIVNQATVLIGGDRHLKYFDNHP
                     AIKVKINNLENIIDKIKEYQKQEENIVILASGDPLFFGIGRILVNNFLLKELEFYPHH
                     SCIQLGFNRLKIPWQDAQFISLHGRNIDLLIQGFKKSYEKMGILTDETNNPLIIWQLY
                     QQLKAGVKYYFWLCENLGSKEEKITLIEKEKDIKLELISPLNIVILLKKNELDREFLE
                     LDKLPIMGLPDNVFKTFPDQPGLMTKKEVRLIILGVLALQPEQIIWDIGAGTGSVSIE
                     IARLVNNSQIYAIEKTAIGINLITENCRKFKIKNVQIIHNKAEKVIQDLPKPHRIFIG
                     GSGGNLTSLLDIINGKINPDGKIVIAIATIENLNEAIEWFKKNSWNYEIINLQISKSL
                     AIGKNTRFNPLNPVNVISANPN"
     CDS             complement(127568..128092)
                     /codon_start=1
                     /locus_tag="GM3709_88"
                     /product="hypothetical protein"
                     /protein_id="BAQ63323.1"
                     /transl_table=11
                     /translation="MANSENNDLESIKVDRQKLIKFQEWCAKNEINYLVIIDKLIDFC
                     LANNQVIIQSLISNKDNISWEEKINLIINKSLKPLMVRIEKLESKLMEKNHNFQNNDT
                     LISSPSLSDLPEKNFSKRVYLSRQEVWQILKKTDYIKYSGYDSFLKVKGDQLVQYGIF
                     FEERKKRFYIVNDD"
     CDS             complement(128098..128601)
                     /codon_start=1
                     /locus_tag="GM3709_89"
                     /product="molybdenum cofactor biosynthesis protein MoaB"
                     /protein_id="BAQ63324.1"
                     /transl_table=11
                     /translation="MTIPHQNFNIKSVNCAVITVSDTRTFDTDISGKIIQEMLINASH
                     KIIHYEIIKDEPQDLKCLLVNLASKEQLNCIIFSGGTGISLRDNTYDIVSQMLEKTLS
                     GFGEIFRYLSYQEIGSRSIASRATAGLYNGKIVFSLPGSENAVRLGLEKLIIPELIHL
                     VDQISKG"
     CDS             complement(128830..129165)
                     /codon_start=1
                     /locus_tag="GM3709_90"
                     /product="photosystem II 13 kDa protein Psb28"
                     /protein_id="BAQ63325.1"
                     /transl_table=11
                     /translation="MAQIEFARGIIEESIPDVKLTRSRDGSNGTATFRFEGSKVLQSG
                     NTQEITGMYLVDEEGELVTREVKCKFINGEPKAIEAIYLIKSPQEWDRFMRFMERYAQ
                     ENDLGFTKS"
     CDS             129378..130802
                     /codon_start=1
                     /locus_tag="GM3709_91"
                     /product="hypothetical protein"
                     /protein_id="BAQ63326.1"
                     /transl_table=11
                     /translation="MARMVARGLRLKRSTIIQTGVNYQQYYPSYLTPALLSSSSVIIV
                     AEKEIQQQLVKEKIPRLQQWLNTHKIIATNYKQDLINNSTLYVINHHDWLDLIINHLL
                     DNDIVTIIEEAENLPDIITKYLSQEITSQDWYNLGLFFPHHQNFIRENLAKLTKLIYT
                     HPINPYNSYLLEEEETIILRQLCNLVENEKNHQKVLAKFIHFQKALSENKKYINYFTV
                     NRSQGTFTINSSPLELRFSINHIWKNVPLILLSNYLESQKYPINYGECLGLNVDNFTC
                     LKFSPDGESQNLNLYFPHNFPFPNNPEFQNRVTQEILALVSSLKINHHPIIIIIDDVP
                     LQAQITSNLAAYFGSRVQLNSLNIGENSILVCDIKFWLNYQSELLTPILLIFATLPIP
                     SLENPLIGAQVAHYKNQKKDWFRLYLLPLAIKILQQSTMSIRKNQGVIALLDNRVNYR
                     SYGVNILRSLEPYAKINYVDLYWQ"
     CDS             131094..132026
                     /codon_start=1
                     /locus_tag="GM3709_92"
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="BAQ63327.1"
                     /transl_table=11
                     /translation="MKILITGGAGYIGSVLTPILLSKGHEVTIVDNFMFRQNSLAECC
                     QYDTFNVVRGDCRDESLMKDLIKEADVIIPLAALVGAPLCNRDKIATETTNRDAIQML
                     CRLASKEQRFLVPITNSGYGIGEKGKFCTEESPLRPISAYGVTKVEAEKAILERENSI
                     SFRLATVFGMSPRMRVDLLVNDFVYRAVTDRTVVVFEGNFKRNYIHIRDVVKVFLHGL
                     DNFETMKGKPYNVGLEDANLSKLELCAEIQKQIPNFYYIEAPIGEDPDKRDYIVSNAR
                     ILSTGFTPDWTLARGIKELVKGYTIFRNSIYSNI"
     CDS             132220..133188
                     /codon_start=1
                     /locus_tag="GM3709_93"
                     /product="hypothetical protein"
                     /protein_id="BAQ63328.1"
                     /transl_table=11
                     /translation="MNINSGGHIAQLKFMSIAQSLLNAQPVTYKKKEKDVLFLDDLIK
                     NIREDNNIYIIHWGPDIPQLLTKLKNKNVVYFAHSTGYKFKIPVKVPIITVSKHSQAY
                     WGRFAPNNLIFSLPNEISNKYHNQHLDHEVALDDRSIDVLVQKRKSSKYLIEELVPAL
                     NPHCNLTLIDYWIDDLATIFNQTKVYLYDSTEYWIQAKASEGFGLPPLEAMACGCTIF
                     SSINDALSDYLDPSFNCHKLRVYSKEYDVQRILSAVENWQLNSSNLDIINNYRLPLIK
                     KRFEHIFKEINLFFDHQQSYPANIPAIIQNKPFSINKIINKLKSFF"
     CDS             complement(133228..133641)
                     /codon_start=1
                     /locus_tag="GM3709_94"
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase domain"
                     /protein_id="BAQ63329.1"
                     /transl_table=11
                     /translation="MTDLGLTHIALEVTDIEKSVEFYKKYAQMIVVHRRKDETINSDV
                     AWISDLTRPFVIVLIKMPKIVGKLMPQSHLGVAVNSKEKVDEICLLASTEGILLSGPN
                     DWESPVGYWAYIQDPDGHTLEISFGQKIHFTLENF"
     CDS             133775..134536
                     /codon_start=1
                     /locus_tag="GM3709_95"
                     /product="D-glycero-D-manno-heptose 1-phosphate
                     guanosyltransferase"
                     /protein_id="BAQ63330.1"
                     /transl_table=11
                     /translation="MINYQIKNSIAVILAGGFGTRVKHLLPNIPKPMATVANKPFIEW
                     VIKYLRQQSINNFILSTGYLGEIIESYFNKNNIDNIIINCYQENQPLGTAGGFINAVN
                     LSNKQPFSWLITNGDSLIFTDLKPLFNYLENDDVEGVILGLSLSDASRYGSLKYDRDY
                     NLISFAEKQQGKSVINAGVYLFKHSTLNKFSTQKPLSFEYDVFPQLLNQGCKIKVHIT
                     EAPFLDIGTPETLAQAENFILDNRTIFNEELEITN"
     CDS             134610..135584
                     /codon_start=1
                     /locus_tag="GM3709_96"
                     /product="folate-dependent protein for Fe/S cluster
                     synthesis/repair in oxidative stress"
                     /protein_id="BAQ63331.1"
                     /transl_table=11
                     /translation="MIDLNIINNSVALIDRSNHGLLCVTGDDRLRFLHNQSTNNIQSL
                     KVGEGCDTVFVNSTGRNIDLVSAYIKENEVLLLVSPGQNKKLYDWLDRYIFPFDKVVI
                     KDVTTQYKIFSLIGKKSLDLLSEWVDNNFLNAKEFSHKNITIDDIELTITIGCNLKLT
                     GFNLIIPEKNAEKIWQKLTAKNPILMEIKDYDTLRILQGRPTPNQELTEEYNPLESGL
                     WDAISFNKGCYIGQETIARLNTYKGVKQKLWGIKLDRSINLEKDNIIMIEGEKVGKIT
                     SYLETESENFALGYIRTKAGDIGLKVNVGEATGEVVKVPFIHHEYYQP"
     CDS             135696..136433
                     /codon_start=1
                     /locus_tag="GM3709_97"
                     /product="biotin carboxyl carrier protein"
                     /protein_id="BAQ63332.1"
                     /transl_table=11
                     /translation="MEILISDLHKYLDFIHQEIDIPNYLPVQGNHYLEVLTKFHQFFN
                     PKTYVEIGVNYGDSLRLANCKAIGIDPDPKIHDNNKYLIYGKTSDLFFQEDAKNLFQI
                     DKIDLAFIDGMHLFEFALRDFINIEKYAHTNSYILIHDILPRCFSEASRGMVTSAWTG
                     DVWRLMIGLKKYRSDLNITVLDSSPTGLGVITNLNPHSTVLIENYQKIIKELSGMNTL
                     SFIQTRDLIMNTFSTELYFKNFPNKIN"
     CDS             complement(136459..137298)
                     /codon_start=1
                     /locus_tag="GM3709_98"
                     /product="pentapeptide repeat family protein"
                     /protein_id="BAQ63333.1"
                     /transl_table=11
                     /translation="MPEENKPSESFLLRLLKGFQKTLSSFINAIAETITSSVHIPEIA
                     IGPIVGALISATTTLIIGFLTISNIFSEQFLYRPLQIQDNNANYTLELERYRQTILTD
                     YLTQITQLTLDNPLWKLQQNPYLLRAMTQTVLDEIDGERKRYIIMFLQDTNLLTFNNQ
                     ITSPPLLQNANLTEAKLNNLDLSHANFSGADLTKANLSQANLHKANFSDTKLTNASLT
                     NADLRGTIFTNIDLTTINLTNACYDQFTIFNSDFDRAKAKMRLISSFDNCIFIPIEKE
                     IKK"
     CDS             137428..138273
                     /codon_start=1
                     /locus_tag="GM3709_99"
                     /product="photosystem I biogenesis protein BtpA"
                     /protein_id="BAQ63334.1"
                     /transl_table=11
                     /translation="MITEKIFGKKNPVIGVVHLLPLPTSARWGGNLKAVMERAEQEAT
                     ALAAGGVDGIIIENFFDAPFTKDNVDPATISAMTLIVDRIMSLIMLPIGLNILRNDAK
                     AGLAIASCVGASFIRVNVYTGVMATDQGLIEGKAHEIQRYRRELGEDIAIFADVLVKH
                     ARPLGTPNLTTAVQDTIQRGLADAVILSGWATGLPPSREDLELAQSAAKGTPVLIGSG
                     ATLDNISDLMSFADGVIVASSLKRHGKIDETIDPTRVSQFIEAMQTPIISSSKSSSKP
                     VNQAS"
     CDS             138323..139330
                     /codon_start=1
                     /locus_tag="GM3709_100"
                     /product="hypothetical protein"
                     /protein_id="BAQ63335.1"
                     /transl_table=11
                     /translation="MIRRRRNLPWIQRQSRFIIGAIAIVGLILTMYLTISKLGGGEIA
                     CTANGAGGCNSVLDSAYAYPFDPQGKTGPPLSIFGSLAYFTMAIFALTPLFINPEKDK
                     ELRQKLEKWTWWLMLVGSFAMAAFSSYLMYVLAFKIQAVCPYCIGSALFSLSLLTLTI
                     IGNDWQDMGQIFFTGIAVALITFVGAIGVYANVNTIAIEDPNIEVVAGQKIPIPQPET
                     APQPPLGWEITTTSTEAEISLAKHLAQNGAVMYSAYWCPHCFDQKLLFGKEAFKELPK
                     VECDPKGVAPAPQKCIDAKVRAFPTWVIDGKTYEGVQTLEKLAELTSYTGSTKFKYGM
                     R"
     CDS             139732..140454
                     /codon_start=1
                     /locus_tag="GM3709_101"
                     /product="uridine monophosphate kinase"
                     /protein_id="BAQ63336.1"
                     /transl_table=11
                     /translation="MTYQRVLLKLSGEALMGDLGYGIDPKVVADIAEDIAEVVNLNIQ
                     VAIVVGGGNIFRGVKASADGMDRATADYVGMIATVMNAMTLQDALERRNVPTRVQTAI
                     AMQEVAEPYIRRKAIRHLELGRVVIFGAGSGNPFFTTDTTAALRAAEIDAQVIFKATK
                     VDGVYDSDPMKNPDARRYETLNYNHVLTQDLRVMDGTAIALCKENNIPIIVFNLFDRG
                     NIIRAVKGEKVGTIVGGFCEVN"
     CDS             140471..140992
                     /codon_start=1
                     /locus_tag="GM3709_102"
                     /product="ribosome recycling factor"
                     /protein_id="BAQ63337.1"
                     /transl_table=11
                     /translation="MQKSVEKTQQDFNTIRTGRANSSLLDKVMVDYYGAETPLKSLAN
                     ISTPDSTTILVQPFDKGSMNQLQKAISMSDLGLTPNNDGQVIRLNIPPLTTERRQEFV
                     KLAGKYAEEGKVAIRNVRRDAIDKIRKQEKSSEISEDESRDLQDQIQKITDKFTAKID
                     EILAVKEKELTNI"
     CDS             141094..141255
                     /codon_start=1
                     /locus_tag="GM3709_103"
                     /product="hypothetical protein"
                     /protein_id="BAQ63338.1"
                     /transl_table=11
                     /translation="MERKKLVAIITGIISVLLGVVYLLLVQLLDSRGAMIPAPITDLS
                     TTVIQSFIG"
     CDS             141298..141717
                     /codon_start=1
                     /locus_tag="GM3709_104"
                     /product="aspartate 1-decarboxylase"
                     /protein_id="BAQ63339.1"
                     /transl_table=11
                     /translation="MKIIRLMHGKLHRVKVTSANVDYIGSISIDPELMEKVGILPLEE
                     VDIVNLNNAQRWSTYAIPGVRGSREICPNGGAALLCKTGDILIIYAYEQLDRQDIMIN
                     GHKAKVLVADENNNIADFFEQTLTPHNGEIDFNERIL"
     CDS             complement(141817..142044)
                     /codon_start=1
                     /locus_tag="GM3709_105"
                     /product="alkaline phosphatase"
                     /protein_id="BAQ63340.1"
                     /transl_table=11
                     /translation="MVRRNGFSGGLSLGTLAVNQFRVGSSATTSSQRFIYNSSNGAFF
                     FDSDGNGTTGAIQIATLSTGLGMTHQDIVVV"
     CDS             complement(142400..142537)
                     /codon_start=1
                     /locus_tag="GM3709_106"
                     /product="hypothetical protein"
                     /protein_id="BAQ63341.1"
                     /transl_table=11
                     /translation="MLIFCLILSSFYVHYNFARDLLNEGGLVINWSKKFKNKGELINV
                     S"
     CDS             complement(142681..143520)
                     /codon_start=1
                     /locus_tag="GM3709_107"
                     /product="mobile element protein"
                     /protein_id="BAQ63342.1"
                     /transl_table=11
                     /translation="MKLERIKKLKPEKFKRRFGVKKETYNLLVEIVKKEQNNHKRGRK
                     SKLTVSEQILVTLEYLREYRTYFHISEYWNISESTVCRTVHKIEKILLKSGYFSLGGK
                     KELIKKENEIKAVLIDVTEIAIERPKKRQKIYYSGKKKEHTFKAQLVVNKDTLEIICY
                     VNGRGREHDFKIFKNSRLPLSEKIKCLVDKGYQGIEKIHKLSEIPKKKTKKRKLTQEE
                     KRKNRELNRQRIVIEHVNRKLKIFRILSEKYRNKRKRFGLRFNLIAGIYNYEIVKKDI
                     AII"
     CDS             complement(143583..143804)
                     /codon_start=1
                     /locus_tag="GM3709_108"
                     /product="hypothetical protein"
                     /protein_id="BAQ63343.1"
                     /transl_table=11
                     /translation="MKVKAIIHKAEEGGYWAEVPIFQGCYTQGETIEEVLENLKEVIS
                     LYAEDEPENLSPSDKVVELIRPLAKLNTR"
     CDS             144167..145135
                     /codon_start=1
                     /locus_tag="GM3709_109"
                     /product="light-dependent protochlorophyllide reductase"
                     /protein_id="BAQ63344.1"
                     /transl_table=11
                     /translation="MTTDNKPTVIITGASSGVGLQGARALAEKGWFVIMACRNLEKTH
                     KAAKEVGIATQNYQAIHLDLASFSSVRKFVQDFRASARKLDALVCNAAVYYPLLKEPM
                     RNEDGYEISVATNHLGHFLLCNLMLEDLQKSGNPEPRLVILGTVTANPKELGGKIPIP
                     APPDLGDLEGFKQGFKPPISMIDGKKFKSGKAYKDSKLCNMLTMRELHRRYHQSTRIV
                     FSALYPGCVATTALFRNHFSLFQKIFPLFQKNITGGYVSEELAGDRLGMVVADPEFNV
                     SGVYWSWGNRQKEGRKSFVQEVSDEASDQNKAQLMWDLSKQLVGLN"
     CDS             complement(145314..146768)
                     /codon_start=1
                     /locus_tag="GM3709_110"
                     /product="lysine decarboxylase"
                     /protein_id="BAQ63345.1"
                     /transl_table=11
                     /translation="MKNPQKKIPLLTILKALAKKKDAPFYTPGHKKGQGINKFLTELM
                     GDMVFRADLPELPELDNLFAPEGVIKEAQNLAASAFGALETWFLVNGSTSGIIASILA
                     TCGEGDKIILPRNIHQSAIFGLILSGATPIFINPEYNSDFDFFYTISPSQITDVLENN
                     NNIKAVMVVSPTYHGICANLTEIAHITHNFNIPLLVDEAHGAHFSFHSQLPRSSLQSG
                     ADIAIQSTHKVLGAMTQASMIHLQGNLVDRNRLSLALQLVQSSSPSYLLLASLDGARQ
                     QMALDGEDLLTHTINLANIARKEINKLEYLSLLELVKPTDFFADLDITRLTINVSKLG
                     LTGYEVDEILHEEFGVTCELPSLNNLTFIISIGNTLPDIERLIESLKALKKYHNNKKL
                     NPKINNNKLPLIISEITPRQAYWAEKKVVLKELAIDRISGENICPYPPGIPLIMAGEI
                     ITKEALNYLEDINNSGGIITGISDKTLNTFKIIS"
     CDS             complement(146857..147630)
                     /codon_start=1
                     /locus_tag="GM3709_111"
                     /product="teichoic acid export ATP-binding protein TagH"
                     /protein_id="BAQ63346.1"
                     /transl_table=11
                     /translation="MTHEAIRLDNVSLWRRTQEEFSYDLKRTVLSLLQGKYRKPAKKQ
                     ILKDLNFAIESGEKIGIIGSNGAGKSTLLKVICGILEPTNGIVRVRGNIAPLIELGAG
                     FNVEMSVKDNIILYGVLLGYSKEEMITRTQEILEFAELEEYGEIPVKALSSGMKARLG
                     FAVATDVKPDILILDEVLSVGDARFTQKSRRRIENLWENSSTILFVSHSLEYVQDLCD
                     RTIWLDRGTIAYHGNTKEAIKLYLDSVGVQEYTRPPSAL"
     CDS             complement(147685..148512)
                     /codon_start=1
                     /locus_tag="GM3709_112"
                     /product="O-antigen export system"
                     /protein_id="BAQ63347.1"
                     /transl_table=11
                     /translation="MILTRKKTLNFIDKLPSGNSIKRYWELLSVLIPQSLNARYRGSF
                     LGVYWSLLNPLIMTGLYTTIFGATFASYFGDSIVNYMFAAFTGLLVINFYNSSTTQAL
                     SSVVINGDLLNKIKLPVPVFPLAMIGANIFQFIVGSFPLLAIVTLIKTHNPLNIIFLL
                     FPFIALVLVCTGVGFFVSALFVFFRDLGYFYEIATFIVWITSPVFYPAEIVPARVQPV
                     LYLNPLVPIIESLRQISLDGTLPELIYLLRGFLSGIIILTLGWLFFRKVQSSFMDLL"
     CDS             148898..149962
                     /codon_start=1
                     /locus_tag="GM3709_113"
                     /product="GDP-D-mannose dehydratase"
                     /protein_id="BAQ63348.1"
                     /transl_table=11
                     /translation="MTNHKTALITGITGQDGSYLSELLLSKGYKVHGIIRRTSTFNTD
                     RIDHIYEDPHQEDAKFFLHYGDLTDGTTLRRILEEVQPDEVYNLGAQSHVRVSFDAPE
                     FTVDSVAMGTLRLLEAVRDYQQRTSANIRYYQAGSSEMFGKVMEIPQKETTPFYPRSP
                     YACGKVYAHWQTINHRESYDMFACNGILFNHESPRRGETFVTRKITRAIARIVAGQQE
                     KLYLGNIDSKRDWGYAKDYVVAMWLMLQQEQPDDYVVATGETHSVKEFLDLAFSHVNL
                     NWEDYVAFDQRYLRPAEVDLLIGDPSKAKEKLGWQPSVTFPELVNLMVDADLEALGIT
                     NGDKVKDIAYIRQNMLHNVN"
     CDS             150088..151023
                     /codon_start=1
                     /locus_tag="GM3709_114"
                     /product="nucleoside-diphosphate-sugar epimerases"
                     /protein_id="BAQ63349.1"
                     /transl_table=11
                     /translation="MLDLSTKKILVTGGSGFLGKQVVSELLKAGANPDKITIPRSKDC
                     DLTIWENCQKAVVNQDVIIHLAAHVGGIGLNREKPAELFYDNLMMGTQLIHAAYQAGV
                     EKFTCVGTICAYPKFTPVPFKEEDIWNGYPEETNAPYGIAKKALLVQLQSYRLQYGFN
                     GIYLLPVNLYGPEDNFDPRSSHVIPALIRKVHEAQQRGDKVIPVWGDGSPTREFLYSN
                     DAARGIVMGTQLYDSSEPVNLGTNFEITIKDLTELICELMGFEGELAWETDKPNGQPR
                     RCLDTSKAKEAFGFTANMDLKEGLKNTIEWYRQNS"
     CDS             151323..152315
                     /codon_start=1
                     /locus_tag="GM3709_115"
                     /product="thioredoxin reductase"
                     /protein_id="BAQ63350.1"
                     /transl_table=11
                     /translation="MKLSSKNFDTRLDIVYDAIVVGGGMGGLSAAIYLARYGLKCLVI
                     EKGKGRSLWMQDLRNYLGIDPHAPGRDILNHGTKQAIDWGADHLRGYVEDVTDDGDTF
                     AVKVKIGKKDSVYPVFRSRYLIAASGIIDVLPELEDMQNVYDYAGYTLHVCMICDGFD
                     MWDQKSVLIVGKESQINAAFVLNWFTPYITVLTHGLCTVGDEMKQKLADHGYPLYEST
                     IERFVGEDHKMQGVQLTDGTFIEATTGLINMGSIYHNHYLKGIKGLEWDGENLITNDM
                     TQTTHDRIFALGDLKRGINQVSIAVADGTLAATQIWRNIRRQSPPRKWEENINN"
     CDS             complement(152347..153114)
                     /codon_start=1
                     /locus_tag="GM3709_116"
                     /product="hypothetical protein"
                     /protein_id="BAQ63351.1"
                     /transl_table=11
                     /translation="MTMIKSQYHNLFTSIFPHQSECPSLIIKFLLVLEIEQLIPLFKI
                     HENYEKNSAISAFVTTKDHQNISVASIISESMEEDEDLLFFGSNFEVLLGQKLGNKKV
                     ETETIKTFLIFTRQGLILENDDISYDLNRNKYQFIEWDCWQDIFISFDQNEPKCSLIF
                     IDRQGYFLEINTIINNSSEVEKIEKQLPIIFCYFILKRFWKYVEKLNHNNFVYFNPQD
                     FLYLDQERLSYFSENILSNINVTEEDLYNLVGKIDHY"
     CDS             153088..153291
                     /codon_start=1
                     /locus_tag="GM3709_117"
                     /product="hypothetical protein"
                     /protein_id="BAQ63352.1"
                     /transl_table=11
                     /translation="MVLRLNHCHNWFPLIVSIGLSSWLLGFMQSIEKNISIENSLSII
                     NVIFPQIPNHVTTTTSKDKIRRQ"
     CDS             153248..153892
                     /codon_start=1
                     /locus_tag="GM3709_118"
                     /product="biotin synthesis protein BioC"
                     /protein_id="BAQ63353.1"
                     /transl_table=11
                     /translation="MLLQPHQRTKLDDSEDTLFYSFPRFVNHVDDHFIRQLTELYRQQ
                     LQPNTKILDLMSSWVSHLPPEIEYSHIEGHGMNEEELKRNPRLNHYFIQNLNKNPQFP
                     LEDQDFDGVLCAVSVQYLQYPEAVFSEIARILKPNGVAIFSFSNRMFYQKAISVWRDA
                     TDRQRLHLVRSYFQSIADFNEVQIVATQPELPAILQMLGIGGKDPFYAVFARKK"
     CDS             153994..154260
                     /codon_start=1
                     /locus_tag="GM3709_119"
                     /product="transcriptional regulator"
                     /protein_id="BAQ63354.1"
                     /transl_table=11
                     /translation="MNSGKTSESTTLSERELEILELVATGLTNNDIAEKLEISKRTVD
                     NHISNILTKTKTDNRVELVRWALQWGKICLDEVNCCILPNVVDK"
     CDS             complement(154291..155217)
                     /codon_start=1
                     /locus_tag="GM3709_120"
                     /product="tRNA dimethylallyltransferase"
                     /protein_id="BAQ63355.1"
                     /transl_table=11
                     /translation="MVWLKVEYVMKKGLIVICGATASGKSSLGLKLAQRLNTFIISAD
                     SRQVYQEFDIGTAKPTIEEQNLVHHYLIDICHPTETLTLADYQEKAQTIINSTSSIPL
                     LVGGTGLYINSITKGLKIPRVAPCSLLRSQLESYSQPERYSFLQQIDSKSCEKIHFND
                     EIRTIRALEVYYVTGKPISEQQGENPPSYPVLLIGLHCDRDAIEERIKQRTKIMIEQG
                     LVRETENLIRKYGLDLPLLNTLGYAEIKQYLTGEINLNQAEELIVIHTRQFAKRQRTW
                     FNANKKIKWFNPDSSSLLEEVWEIINNNQFIK"
     CDS             155449..155712
                     /codon_start=1
                     /locus_tag="GM3709_121"
                     /product="photosystem I subunit X (PsaK"
                     /protein_id="BAQ63356.1"
                     /transl_table=11
                     /translation="MLFLNTLFATVPTTLEWSPTVGLTMIICNIIAIAFAKFTVKYPS
                     ADPQLPSGEFFGGFGLPGLLATTSFGHLLGAGVILGLSNLGAL"
     CDS             complement(155862..156389)
                     /codon_start=1
                     /locus_tag="GM3709_122"
                     /product="photosystem I assembly related protein Ycf37"
                     /protein_id="BAQ63357.1"
                     /transl_table=11
                     /translation="MYDNLPVVYISILLGLLGIVAIVLLRQIIKTRKVESRFSKLQNK
                     LTNQKGTAQEYYELAGIYLDKKLFVQAVQLLQRGLKADNKIEPENKALMYNALGFAYF
                     SQEQYDIAIKNYKEAIKLYPEYTIALNNLGNVYEKKLLVPQALESYKQTLELDPKNSI
                     ALKRVESLEKRLVKN"
     CDS             156714..157613
                     /codon_start=1
                     /locus_tag="GM3709_123"
                     /product="metallophosphoesterase"
                     /protein_id="BAQ63358.1"
                     /transl_table=11
                     /translation="MRKTSIKIAVIGDVHENWNDYDSEALEFLAVDLALFVGDFGNES
                     IKVVENIANLTIPKAIILGNHDAWFTATEWGRKKCPYDQTLEDRVQKQLDLLGITHVG
                     YSSLDFPPLELSVVGSRPFTWGGSKWKYSDFYQHRYGVNSFEESTAKIVDGVRKTSFD
                     HIIFIGHNGPFGLGSNPEDTCGRDWNPLGGDYGDPDFQSAIEISRNLGKKVSLVTFGH
                     MHHALRHTKERLRTIVNRDKHDTIYLNAASTPRIQEINGKKVHKFSLVTLNQEKIMKI
                     SLISIDETMKIVENQIILESPDF"
     CDS             complement(157631..158209)
                     /codon_start=1
                     /locus_tag="GM3709_124"
                     /product="pentapeptide repeat family protein"
                     /protein_id="BAQ63359.1"
                     /transl_table=11
                     /translation="MSQIRNGEIQDLQGINLSGCNLSGANLQKADFSGSQLMGTNFTG
                     AKLQGAILRCNLRGADLTGADLTGADLRGADLRGAILLSAQVENISFAGAFLGGAILT
                     NLDLSDADLRGTDLRGVNLVGACLQKADLSNSNLSGADLSQADMEEANFTGAILEGAN
                     LCRGNLLCATIDPNALKHTFKEGTCIEGIFDN"
     CDS             complement(158432..159013)
                     /codon_start=1
                     /locus_tag="GM3709_125"
                     /product="hypothetical protein"
                     /protein_id="BAQ63360.1"
                     /transl_table=11
                     /translation="MSLLSCLYIICGGFHDSSLTTNFFTYLTTITKDISKENTIIFNL
                     DSSEKIYSVDRTLPYNGFSIYKCLKENQHKLIDCDLIFMGFSAGVIGAIIAGNLWEKN
                     GGKVKALFAFDSWGVPLIANFPCYRISHDYFTHLSYLGGETNSFYANPSISHLDLWQN
                     PENVQGCWEITLGIKKRSNLQEFLKHYLKENRE"
     CDS             complement(159124..160218)
                     /codon_start=1
                     /locus_tag="GM3709_126"
                     /product="hypothetical protein"
                     /protein_id="BAQ63361.1"
                     /transl_table=11
                     /translation="MIETDFFTDEEIKEIILESCTEKIQDVVQFDTKNIYFLCIKEGY
                     EGIFMKKKIKDSYYIPLLDIRNVIKEITIEQQKVKIVLQDEEFFTVAMPSEDIHLTFR
                     RFKLIYEGLEKTQKTKYSEEEIEKYNIALQEQTKKNKKLNFKKLFGTDKKINKPRLIF
                     LSCCTVILGSYALYNFIISRKSTELKYKITGLELNSFPYQNGNSIYNNGLKDEKKCES
                     FMNNKEKYLECLKSLTSNIYYYKRPIKNIKYDASSGIFSFDCNLSSANVSSSIRDIDI
                     KIDDYGGGGYRSVDGKISKVLSPEEAEIFKKRLIDNGQCSYILSGIKKSYFNTEEGSK
                     GKVVIPVNLDLYIWFNDDLSILYYQEESNY"
     CDS             160446..160949
                     /codon_start=1
                     /locus_tag="GM3709_127"
                     /product="type IV pilin PilA"
                     /protein_id="BAQ63362.1"
                     /transl_table=11
                     /translation="MILNLRRKLLYSLALILKKETKGFTLIELTVVFLFTSTLVAVAI
                     PTFLDQVGKARESETKLIMGTIARQQQVFHVEKKTFASNLNLLDIDFRQQYHVITVPT
                     ADQNIVKHQVIAINPTDDVRNYAVGVYFNNGLFDIAVCQSAVVNVPVDVGDTPASNCT
                     NNGVRIQ"
     CDS             complement(160958..162232)
                     /codon_start=1
                     /locus_tag="GM3709_128"
                     /product="phosphate regulon sensor protein PhoR"
                     /protein_id="BAQ63363.1"
                     /transl_table=11
                     /translation="MLYFLCGLSIGLVICLWKYYQINIQLTDILHSLSQFEPVTSLSK
                     IAQVRRNVNLLNNRYYYTQLELDLHRYLINKINLGYLRINEENCLIECNEEAKKLLHI
                     HRWNPEILRLFLELVRSYELDQLIQQTRKIQQNLVIEWQFFPTANYILEEENNLEIEN
                     YKPVFLKAYSYPLPAGQVSIFIENKQLIKELSIRRDEAYSDLSHELRTPLTSLSLLAE
                     TLLKYTDNKGKIWVQQMSQEINRLIDLVQNWLEISTLEQSPYEMLKFQNLDLKQLIFS
                     AWQSLKILADQEKISLEYKGEEKIIISADINRLTQVFVNLFDNSIKHGSPHSLISVNV
                     EIKYSDFNNQFLEINIIDSGSGFNTNDLPYIFDRLYRGDKSRVRNTRGGSGLGLSIVK
                     QIVEAHQGTIIANNHPETKGAWFKITLPMKIK"
     CDS             complement(162348..163100)
                     /codon_start=1
                     /locus_tag="GM3709_129"
                     /product="phosphate regulon transcriptional regulatory
                     protein PhoB"
                     /protein_id="BAQ63364.1"
                     /transl_table=11
                     /translation="MLSLDLPSIAVRERIHSSSRILLIEDEELIRNMIALNLEEEGYE
                     VVKTSNGREALNILDRQQLQSSEDNIDMVILDLMLPEVNGLDICRLLRYRGNMIPILI
                     LSAKAAETDRVLGLEVGADDYLTKPFSMRELVARCRALLRRNSLNNVTTESVRQFKEI
                     VLFSDECRVTVRGEEVNLSPKEFRLLELFMTYPKRVWDREQLIENIWGADFLGDTKTV
                     DVHIRWLREKLEKDPSNPQYLITVRGFGYRFG"
     CDS             163197..163310
                     /codon_start=1
                     /locus_tag="GM3709_130"
                     /product="hypothetical protein"
                     /protein_id="BAQ63365.1"
                     /transl_table=11
                     /translation="MNHKIIGKERQKGTGNTEKWTRIDFKTPKIDFSRFVS"
     CDS             complement(163505..166141)
                     /codon_start=1
                     /locus_tag="GM3709_131"
                     /product="DNA topoisomerase I"
                     /protein_id="BAQ63366.1"
                     /transl_table=11
                     /translation="MSTLVIVESPTKAKTIRNYLPKDYQVEASMGHIRDLPSSADEIP
                     AEYKQFEWARLGVNIDNNFEPIYVIPKGKNKTVQQLKKALQSADELILATDEDREGES
                     ISWHLLQLLKPKVPIKRMVFHEITKDAIQKALSNCRDIDENLVHAQETRRILDRLVGY
                     TLSPLLWKKIAAGLSAGRVQSVAVRLLVQRERERRAFKEANYWDLKALLNYAKTDFEA
                     RLTTLKGEKLANGSDFDPKTGKLVKNKKVIVLTEQEATELKARLTGKPWEVTDTEEKA
                     TIRKPSPPFTTSTLQQEANRKLGLGAKDTMRIAQSLYENGYITYMRTDSVHLSDQAIS
                     AARSCVESMYGKEYLSPKPRQYKTKAKGAQEAHEAIRPAGSTFRIPKETGLRDKELGL
                     YDLIWKRTVACQMADAQLTQISVNIAVEDAIFRSSGKRIDFAGFFRAYVEGSDDPEAA
                     LENQEVILPDLKVGDKPNCKQLDVIHHETQPPARYTEASLVKTLETEGVGRPSTYASI
                     IGTIVDRGYAQLRNKALIPTFTAFAVITLLEKNFAELVDTKFTSKMEQSLDDIASGNE
                     KWLPYLDKFYRGEKGLQNQVKVRETEIDPQSAKAIELENLDVTVKIGKFGAYFEANYG
                     DGVVKSSIPADLTPADLEPRQIETLLKQKVEGPPILGNHPETQEPIYLLIGTYGPYVQ
                     LGDTPQGKAKKPKTASFPKGVQPENITLDMAVGYLTLPRTLGEHPDTGKPIKTSLGRF
                     GAYVVHDQGTEGKDYRSLKKEDDVLTITLDRALELLAQPKTTKGRRGTTTKQPLKELG
                     LHPDDNEPVNIYQGPYGVYFKHGKTNIKLPEDETLETMNLDKALSLLQDKTPAKKTAT
                     KKTTTAKKTTTTRKTTAKKTAQ"
     CDS             166310..167656
                     /codon_start=1
                     /locus_tag="GM3709_132"
                     /product="N-acetylglucosamine-1-phosphate
                     uridyltransferase"
                     /protein_id="BAQ63367.1"
                     /transl_table=11
                     /translation="MLAVAILAAGKGTRMKSKLPKVLHPLGSKTLVERAIDSCNLVHL
                     DRTLVIIGYEGDKIENALNHLQGVEFVQQKEQLGTGHAIMQLVPYLEDFRGDLIVLNG
                     DVPLLRPETVEELVNTHQKNNNAATLLTANLPNPKGYGRVFCDGNNLVTQIVEDRDCN
                     SAQKQNHRINAGVYCFNWQELKAILPKLTTNNDQQEYYLTEVVDYLNPVMALDVHDHL
                     EISGINDRRQLAVAYDILQARVKEAWMMAGVTMIDPDSITIDETVKLGMDVTIEPQTH
                     LRGNTIIGSGCKIGPGCLIDNTIIEDNTTVLYSVITDSKVSANTRIGPYAHLRGGVEL
                     GENCRVGNFVEIKKSSIGQKTNIAHLSYIGDATLGNQVNIGAGTITANYDGVNKHPTI
                     IGDRTKTGSNSVFVAPVTIGEDVTVAAGSVITHDVPNDCLAIARGKQKTIEGWKKS"
     CDS             complement(167687..167800)
                     /codon_start=1
                     /locus_tag="GM3709_133"
                     /product="hypothetical protein"
                     /protein_id="BAQ63368.1"
                     /transl_table=11
                     /translation="MFLFRPFFQPLDCPRLLGVWVGVPICISNEIIDKATL"
     CDS             complement(167970..171755)
                     /codon_start=1
                     /locus_tag="GM3709_134"
                     /product="CobN component of cobalt chelatase"
                     /protein_id="BAQ63369.1"
                     /transl_table=11
                     /translation="MHRIQATPGGLHPDTEGVIIIQQNPAPIIFLTSADTDIQTIASS
                     RSYFPSDFPEIRVVNLLQLQQELTIDTYGDEILSQAKVIILRLLGGRSYWSYGLEVCK
                     DIVSQNNASLLVLPGDDRPDVELISHSNASLSQVNKFWEYLIEGGVDNFVNGFKFISD
                     SFFNTNFKPNQPRSIPRLGIYKTVNKELITNNIDVAIIFYRSHYLSENTKPIDALSTA
                     LKQQNLASISIYLSSLQETDIQEELIKLLQHHQVKLILNTTSFSVAKISDETNAKIWQ
                     TLNIPVLQIILSGSTKEYWKNSFQGLSPRDVAMNVALPEIDGRIITRAISFKSVETWH
                     PQLETDIVVYEPLLDRVNYTAKLAKKWVNLSKISNSEKKIALILANYPNKDGRIANGV
                     GLDTPASCINILKALQEKGYRINDIPANGDELIFKLIEGVTNDLEMQSNRKINQYLPL
                     EDYQNYFQTLPKKTQEEIINRWGNIDSFQPPLKNFDPSLIRCESFFPISGLQLDNIFI
                     GIQPSRGYDLDPSLNYHAPDLEPTHHYLAFYYWIREIFKADAIIHVGKHGNLEWLPGK
                     SLVLSENCYPEITLDTLPNFYPFIVNDPGEGSQAKRRANAVIIDHLTPPLTRAELYGE
                     LLELEALIDEYYQAQSLNPSRLKIIFDRISKLIDETKLNEDLGIKEVNQDTFSQFLTT
                     ADGYLCELKDAQIRDGLHIFGECPQGRQLRDLIISIARFTSYNNLGLIEAIKTDLEAN
                     QPPLEIDVTPPKSFLKSGTYFSQTLSLPSRVDGVKDNREYFENLANNLIEKLIVGENY
                     QEISLGKNTEKSLNWIANNLLPNLIKSDREIINLMRGLEGKFIPSGSSGAPSRGRADV
                     LPTGRNFYSVDIRAIPSETAWDVGRKAAETVIERYTQENGEYPKTLAISVWGTSTMRT
                     GGDDIAQIMALMGVKPVWDGVSRRVVDYEIIPIAVLGRPRIDVTVRVSGFFRDGFPNI
                     LDLLYKAIVHLSTLTEEKDQNPLALQVEKDTKYWLDKGLEETQARQRASYRLFGSKPG
                     AYGAGLQGLIESQNWENDADLARAYLNWSSYAYQGSKGISMPEVFEQRLKELQIVLHN
                     QDNREHDLLDSDDYYQFQGGLTVAVRHLKGENPVTYFGDNSQPNNPKVRELKEEIARV
                     YRSRVINPKWIAGVMRHGYKGAFEMSATVDYLFAYSATTKSVSNFMFEGVAQSYLFDE
                     KVKQFIQEKNPWALRDIAERLIEASQRNLWKNVSQEMLDKLRSIAHESEGSIEELSH"
     CDS             complement(171899..172153)
                     /codon_start=1
                     /locus_tag="GM3709_135"
                     /product="hypothetical protein"
                     /protein_id="BAQ63370.1"
                     /transl_table=11
                     /translation="MSLPETIVEVAITSQCWQKGQIEGQVKAGSYEWYFRWYFLQGKL
                     SVNPTLGRSLIQEPLSRFLERYDYQLEVGGDYQFYLRTKL"
     CDS             complement(172189..172971)
                     /codon_start=1
                     /locus_tag="GM3709_136"
                     /product="pentapeptide repeat family protein"
                     /protein_id="BAQ63371.1"
                     /transl_table=11
                     /translation="MNKSIIIISTFLTCLMFPSSVRSENIDHLNQLLKTKQCENCDLN
                     NVGLVMSDLSGANLRGANLVGANLSRSNLTGADLSGANLTGASFHGANLSGANLSGAI
                     VNSSDFRNAYVEGIILENTDISTAYIQGVTGIPATAGSAEQFYLWGISEDKKGNYQKA
                     INYYNRSIELNPDFAHAYLSRAVIKSRYGLTDTALEDAQKAEELFKQQENSDGYALSN
                     RFIQLVKARTEAEAQEEGNTGSPQFVQIFNSVVPLLFKLFIP"
     CDS             173214..176168
                     /codon_start=1
                     /locus_tag="GM3709_137"
                     /product="glycosyl transferase"
                     /protein_id="BAQ63372.1"
                     /transl_table=11
                     /translation="MKVLIADFDLFFKIGGGQTFYRQIIEKNPNIDFYYLIEQENINN
                     LRPKNAHGISYKPIYQVHDLNNYINVTPPRWAYRSFTFASNIANSVAGYEFDVVDAPD
                     YEQYTLFLRPALEYHGVKCNKIALSMHGKISTTLQLDWFGSTEVNIPLDLEEKMQFKT
                     ADIRYGISKSYIKEWLDLVNLETNYFNPLHFIDLPQSQKLQNHHQKPNLYFIGRTEKR
                     KGADIFIDLVWWLSPNNYHHASIIGPHSYSEFGDSSESLLRSMIDKRLININIEKPKN
                     RQELTQIFAQPAITFLPSRYDTLNLLALESLFSGCPTAIGSGAGVCQFLEENFPQLPW
                     IKIDVNNTYNCLPKLTEVLENYSDYREKLHQALLTININTNDPNLSQIYQTESNKDQD
                     VSTELKQWYSQLISYWRSRSENKNYLKTIPSKIINQVIKPPFKKIKGKLTRYAEDTRS
                     SQLIKSPFIASQYHKVFTLSEQTELEIEKKLHQVWNLAETFEPEAKGIKGKIQSAFRI
                     DRVRVWREIARLERMRNNDLVAATYYLRSMRALGSDKFNELPYVIKTLEEKGFKPEAK
                     TAEAMFKDIHQQTEKCLNILNETYQNNLKYYPEEYEFLDERRDNDNYLVSVIVSLYNA
                     SDKLPLFLQVLAEQTLIKKGQVEIILVDSGSPDREYQVFQQLQSELNLPIVYLRSHNR
                     ETIQKAWNRGILLARSRYITFLGVDETILPECLEVLAHELDENSDIDWVISHSLVTNV
                     DLQGNHVNDIMLYNRANYDQNLVYLDTCYLSLVGGLYRKNIHERFGYYDSSYRGAGDT
                     EFKNRVLPHIKTKMVNRVLGLFWNYPDARTTQSPMAEVEDIRAWYLHRTLGGIKYAFS
                     NKNPEEVEQFLYKTLAYRKSYCNHISSDLEYSYNLARFLKEIKPSLSLLQLKPSIDEL
                     FLAYQQLDWIEDLTTFSTGKVLWQTQKLGEKITNLHCQIASKLGSINFNPNYDIFHDN
                     RHEQHANLWKTE"
     CDS             complement(176443..177006)
                     /codon_start=1
                     /locus_tag="GM3709_138"
                     /product="hypothetical protein"
                     /protein_id="BAQ63373.1"
                     /transl_table=11
                     /translation="MNLITILLTSVGLAMDAFAVSIGGGISLKKITSKDAVIIASFFG
                     GFQFLMPLLGWFSALFFRDFIISFDHWIAFGLLGLIGGKMIYESFQDEEEEEGTDFRN
                     LSVLLTLALATSIDALAVGLTFSVIKTPIIEASVIIGIITFLICLFGVYVGNKFGHIF
                     EKQAEIIGGIILIGIGIKILIEHLIFL"
     CDS             complement(177024..177803)
                     /codon_start=1
                     /locus_tag="GM3709_139"
                     /product="hypothetical protein"
                     /protein_id="BAQ63374.1"
                     /transl_table=11
                     /translation="MLPRDELLKRVENREEIAKIIDKAEKAIKTWELVVTDFLSPPVL
                     AEIHQIFDCLTEVKIIPWGGYPQAERQRVGIHREEVFADNTQISLVALDIAGNFLFDT
                     ATHRDFLGAILGTGIIREKIGDIIVLGERGAQVIVVEEIANFLEINLVQVRSVPVKTN
                     RIELSELKIRPPKIKEMTTVEASLRLDAVASFGFGLSRGKMSEAISNGDVRVNWKDIT
                     QPSYNVKNGDLVSFRGKGRLEIGEIEVTKKERYRINLTRFV"
     CDS             complement(178119..179060)
                     /codon_start=1
                     /locus_tag="GM3709_140"
                     /product="mobile element protein"
                     /protein_id="BAQ63375.1"
                     /transl_table=11
                     /translation="MKQKYHLRNWSEYDRGLKQRGSLTFWLSEEVLSNWILTEKSGTR
                     GADNYFSDQAILTFVMVKSLFSLAGRQTEGFLESLFVLMGIDLPVPDHTTVSRRAKNL
                     DVVLPVNKRDEPRHVVVDSTGVKVYGEGEWKTRQHGVSKRRTWRKLHLAVDEKTGKIL
                     VAEVTTNNCHDGDVLESLLEAVEGEIEQVSGDGAYDRAAPELRSDQRKCYRAIAKRGA
                     MATILPQNNAQKWSDIDGDRNRNIEKIEEIGRKEWKEESGYNRRSISETTMFRLKTIF
                     GGKLSSRDFDNQAVELFVKCLLLNKMIQIAKPDSYIV"
     CDS             complement(179168..179356)
                     /codon_start=1
                     /locus_tag="GM3709_141"
                     /product="YcfA family protein"
                     /protein_id="BAQ63376.1"
                     /transl_table=11
                     /translation="MSVKRRDLIQYLESHGFYLLREGGNHSIYTNDEITIPVKRHNIF
                     DRITANQICKQAGLDKRF"
     CDS             complement(179356..179532)
                     /codon_start=1
                     /locus_tag="GM3709_142"
                     /product="hypothetical protein"
                     /protein_id="BAQ63377.1"
                     /transl_table=11
                     /translation="MGQIIEWQEVITEGKNLAECRFMLEDALKEMILAYQQLEKPIPL
                     NENDIIESLSIEVA"
     CDS             complement(180212..180979)
                     /codon_start=1
                     /locus_tag="GM3709_143"
                     /product="imidazole glycerol phosphate synthase cyclase
                     subunit"
                     /protein_id="BAQ63378.1"
                     /transl_table=11
                     /translation="MLAKRILPCLDVNAGRVVKGVNFVDLKDAGDPVELAKVYNDAGA
                     DELVFLDITATHEARNTIIDVVYRTAEQVFIPLTVGGGIQTLDHVKNLLRAGADKISI
                     NSTAVKNPDFINQSSDRFGSQCIVVAIDARRRNDPHNQGWDVYVRGGRENTGKDAILW
                     AEEVAKRGAGELLVTSMDADGTQAGYDLELTRTIAEKVEIPVIASGGAGNTHHIYEAL
                     TQGKAEAALLASLLHYGQLTVSEIKSYLFDRHITVRR"
     CDS             181089..182189
                     /codon_start=1
                     /locus_tag="GM3709_144"
                     /product="cobalt-precorrin-6 synthase"
                     /protein_id="BAQ63379.1"
                     /transl_table=11
                     /translation="MINSGYTLPVFATASAVSALQYLQGNYQNDQVEIDLIKPSKIVS
                     IKIEQIAKISDNQALAITRSDPGDNLDLTRNTPIWSIVTLTPNNETKLIIEGGEGIGK
                     IINLEKKSAIYSYAQKLLEKNLLDNIKITAIVEVKIILPEGKKLAQRTSNSAFGVIEG
                     LSLLGTTGISQPLTSKEQLELYQKELVEKAKKFDNLVFCIGENGLDLAVKIGFNSEQL
                     VKTANWLGSMLVTASIAKLKSIILLGYHGKLVKLAGNIFHTHHHLADGRLEILTAICA
                     YLELPNNIIKKIFIAQTTESALQILRDFDKENNSNFTDQIYQFIANRIEDNAQNYIKK
                     HSDHFIKVGTILFDRNRNIIATGNNGKLITKI"
     CDS             182490..184169
                     /codon_start=1
                     /locus_tag="GM3709_145"
                     /product="potassium channel protein"
                     /protein_id="BAQ63380.1"
                     /transl_table=11
                     /translation="MLDTFLVCGLGSLGQNCVIALKKFGVKIVVIEKNPPPDDEIRNL
                     LPLIDLLLTGDCSDRDILLQSNIEECRAALIVTTSESVNVATAIAIRQLNQKTRLVMR
                     SNKENLNHLLSNQLSNFIAYEPTELPANAYALSALGKEVLGFFTLDEQKIRISRVKIT
                     PSHPWCNYDSLHELNTRSRRILSHYQPSKSFSSTFNQWNPYTKILPQDTIICVETEDH
                     FRLTHDNFNQIINRQSLWLTLRYNFENIKPKLIKFWKLNRKEKIKGVGIFASIIVFIL
                     LIIGTFLFKHYAENATYISSFYVTAILLLGGYADLFGSIEPVQEIPQWLQLFSLTLTL
                     TGTAFVGVLYALLTETLLSSKFQFVTKRLPIPTENHIIIIGFGRIGQKIAYQLKELKQ
                     SLLAITFSKNIDPSLESNFPLIIGNLEDSLKLANLDKAKSVVIVTDDDITNLEVALMT
                     QNFNPHLNVVIRTNGDSFTDNLTKLLPTAHVFSAYQVAAEAFVGAAFGENILQLYRFE
                     QKTILLTEYEIEEGDTLNNLLLGEVAYGYGVIPVFYSGNGSFTPTLMPSGT"
     CDS             184228..185493
                     /codon_start=1
                     /locus_tag="GM3709_146"
                     /product="mobile element protein"
                     /protein_id="BAQ63381.1"
                     /transl_table=11
                     /translation="MKEITSSSMPPCFNRWCEKIDPVLKTKAQKREFRNYLGGLLGDS
                     QRKNITQIAHNNLDITYHKLHHFLTESTWNYDEVNDKRLEIIASCRQTKISRCFSLII
                     DDSGHRKSGNFTDCVGRQYIGEIGKTDNGNVIVTTHIYDGVRSFPLDVELYEKAENFP
                     EGKDAPQFQKKPDIAFNLIEKCLNRNYCPQIILMDGGYGNNTNLLGKLEKKNLKYIGI
                     IAKNRLVKLVKQDFIESEKTIAEIAKSLPQDSFEKIRIGKNREKTLWVATINIELSAL
                     SGIKTVAIVMNADTFENSTDIDYLMTNEIGEKVCGNWIVETYTQRNWIEVFYREIKGW
                     LGLSQYQVRNKRSLMRHFILVFCAYTFIQWHRLTGGLRRQWGNKPLNTFAEALEAFRN
                     AVSFRFFQWLKDNVEVFSLYKASLGFIWA"
     CDS             185528..185836
                     /codon_start=1
                     /locus_tag="GM3709_147"
                     /product="potassium channel protein"
                     /protein_id="BAQ63382.1"
                     /transl_table=11
                     /translation="MAKGDRLIVLATIEGLKSIETGKIKPKQWQIEIISAKSDMGIFE
                     GTNAIARITGCPLKVARETMENLPQVLPVNVYRHQGVRLINALQKNQVSSKLHHFQNY
                     "
     CDS             186031..186516
                     /codon_start=1
                     /locus_tag="GM3709_148"
                     /product="hypothetical protein"
                     /protein_id="BAQ63383.1"
                     /transl_table=11
                     /translation="MENIWQNSEIIAWTQIILNSYYQLLNTELIDRTVPLYDQKSDKL
                     TQSKNLFYLDRVVYSHNTDLDPIYNYSNKKGLELWEMDWQQLTNTPSRMTTQPLLREE
                     REKLLQETISKGYIQNYQGIRISRTGKKYLIKDITVWNLTDNEGKFCGQAATFSQWDL
                     L"
     CDS             186637..188799
                     /codon_start=1
                     /locus_tag="GM3709_149"
                     /product="soluble lytic murein transglycosylase precursor"
                     /protein_id="BAQ63384.1"
                     /transl_table=11
                     /translation="MKSKKSKTLVPIPTLLIILAGVVGATVLTPKLIGILDEIVITSK
                     PEPPEYRLDAPSEVLPLADISAKERQIPLETIANQEKPSLDRSRARFLLAGDILRDDF
                     DGAKALNYLKNLDQEYPILAPYILLREGRAYELTNDIEKAQEIWLKLVAEFPENLVSA
                     EAYYKLGNYDSNYWQEAIKRFPQYPRTHEIARQLLKKDPKQKDLLLLLATYDLSSQTK
                     ANLDQLVKEFGKELTPQEWDIIANNYWQNSHYLPSVKAYQKGTSTPENLYRIARGYQV
                     SNKKVEAKSFYLKLVNEFPDAPDTGLALRRLAAMTQGDEALSYLSKVDKRFLEEAPKA
                     LSQKATILTVMGRFDEATKARNELLQQFPNSEEAANYRWQVAQEFARGNNFVSAWQWA
                     QQISVNNPDSDVAPKAGFWVGKWAEKLGQPSEAQKAFQFVLDNYPHSYYAWRSAVRLG
                     KDVGDFTTIRSLPLKVETPNTRSIPPAGSNMFKELFLLGENQEAIDLFRGEIGDKREL
                     TVSEQFIQGLIEQIQGKNLQGINTIWNLKNRRDNSEDYREWQILRNSPEYWYGLFPFH
                     YEDLIVKWSTQRKLNPFLVVSLIRQESRFEKEIKSPVGATGLMQIMPDTGKWIAPQIN
                     VKEYSLTDPDDNIKMGTWYLDYTHETYNGNSLLAVASYNAGPGNVANWVKRYNLDDFD
                     EFVENIPFPETKGYIESVFANYWNYVELYDPQIQEKID"
     CDS             complement(188850..189044)
                     /codon_start=1
                     /locus_tag="GM3709_150"
                     /product="hypothetical protein"
                     /protein_id="BAQ63385.1"
                     /transl_table=11
                     /translation="MSRNLIKIQKNLRLLIIALIPITVILYLLRGLGFLGFLSGGILL
                     FLIIASFFSLVTFLIIQTYS"
     CDS             189213..190688
                     /codon_start=1
                     /locus_tag="GM3709_151"
                     /product="cytosol aminopeptidase PepA"
                     /protein_id="BAQ63386.1"
                     /transl_table=11
                     /translation="MEIKISNISKLEWNGDALAIGFFTDKVQLSEALTELDHKLDNTI
                     SELIVETEFKGKLGCTTIARIGGNNSLGKIILVGLGKEEDLTVDSFRQAGGYIARVAK
                     QAKIKTLAIAINHPDYDNDIVAQMISEGVILALHQDNRFKSDTEDQKISLETIDLLDL
                     PASNKAIETAQKITSGVILARELVNAPANVINPVTMTETVENLAHEYGLELTILEQED
                     CEKLGMGSFLGVAKASDLPPKFIHLIYKPENTPKRKLAIVGKGLTFDSGGLNIKVSGS
                     GIETMKMDMGGAAATFGAAKAIAQLKPDVEIHFISAVTENMISGKAMHPGDILTASNG
                     KTIEVNNTDAEGRLTLADALVYADKLGVDAIVDLATLTGACIVALGNDIAGLWTTDDD
                     LATQLKTSAQTAGEKFWQMPMENKYFDQMKSSIADMKNTGSRAGGSITAALFLQQFVK
                     DTPWAHLDIAGPVWAEKSTAIDNEGGTGFAVRTLVNWALND"
     CDS             190767..190979
                     /codon_start=1
                     /locus_tag="GM3709_152"
                     /product="hypothetical protein"
                     /protein_id="BAQ63387.1"
                     /transl_table=11
                     /translation="MGESKRRKETLGEDYGKEERFISWLPLTKKQAEDAYKFTTRGAW
                     VGIGLLATGWITIRFIGPAFGWWSVY"
     CDS             complement(190976..191098)
                     /codon_start=1
                     /locus_tag="GM3709_153"
                     /product="hypothetical protein"
                     /protein_id="BAQ63388.1"
                     /transl_table=11
                     /translation="MNYIKLSFITKKAFRIWKLEHLSDKILRADNDRSLIVMIP"
     CDS             191114..191440
                     /codon_start=1
                     /locus_tag="GM3709_154"
                     /product="hypothetical protein"
                     /protein_id="BAQ63389.1"
                     /transl_table=11
                     /translation="MTDNWENQPNDQSQGTSALKLANQSGLFYGNRPIEPSHLQIVNT
                     YTTVGSLRPITKSGLNIKGMLTLSGSRPIVSSNLKISQEFKIMGNRPVASNHIDDVLL
                     LMGYLD"
     CDS             complement(191682..192986)
                     /codon_start=1
                     /locus_tag="GM3709_155"
                     /product="histidinol dehydrogenase"
                     /protein_id="BAQ63390.1"
                     /transl_table=11
                     /translation="MLRIITDTFEARQELQRISDRTHNEQIETQSAIVKEIIATVRKR
                     GDEALLEYTQKFDGQTITKENLKVSGSEIDAAYQQISRELLSAIKLAAKKIEAFHRQR
                     VPKSWVQFDDDNVVLGRRYTPVDRAGLYVPGGRASYPSTVLMNAIPAKVAQVPKVVMV
                     TPPSQDGKINPAVLVAASEAGVTEIYRVGGAQAVAALAYGTQIIPKVDVITGPGNIYV
                     TLAKKEVYGMVGIDSLAGPSEVLIIADNHANPTHVAVDLLAQAEHDPMAASILITDSA
                     ILAEKVQTEVIRLLEDHPRRILTEKSIAHYGVIIITKNLTEAAELSNLFAPEHLELEV
                     ESPWELVENIRHAGAIFLGNSTPEAVGDYLAGPNHTLPTSGAARYASALGVETFMKYS
                     SLIEYSPVALQKVSKAIIDLATAEGLTSHGDSVKFRTKNTHS"
     CDS             193185..194495
                     /codon_start=1
                     /locus_tag="GM3709_156"
                     /product="membrane protein PxcA"
                     /protein_id="BAQ63391.1"
                     /transl_table=11
                     /translation="MLNRIFRSTKRWISNSSQNALEEAYQKALVIKKMEEEHFNGQKI
                     DLKNSTYGDRVFSYFEEELKSNLQIINIKINQFKTSKSVHHFLDNTLTSNNHNNIREI
                     DYQKDLILERLNFIDEIINKYNSNYYDTSLQLVKSEKPNHKSQKNPSITNKNNSPNNL
                     EPSIETVSDKASVLPRSFLRTLDRIKQEIDPKSAEIEQDVINKFRKSRYKTAISVKFL
                     LLLIIIPLLVHNLSKITLGTIFVDPYFAKHEQIVFINQDLEEEALIELKTFEENLNLR
                     SLIGLSPHLSEEEKEAKIKEKAEEIAHNYRNESSNAVKNIFADLLSFGSFTIILILSK
                     RELLILKSFIDETIYGLSDSAKAFLIILFTDMFVGFHSPHGWEVILESITRHFGLPEN
                     RDFNFLFIATFPVILDTVLKYWIFRYLNRISPSAVATYKNMNES"
     CDS             194609..196171
                     /codon_start=1
                     /locus_tag="GM3709_157"
                     /product="small GTP-binding protein domain"
                     /protein_id="BAQ63392.1"
                     /transl_table=11
                     /translation="MLWLISALSRLYSEIAWTSPFLANFLVFILIVLLICFIGIFIYY
                     LGIIPNRTGTKTKRRKNLPALPAEKNEIASKTIQAVKKQVAQIQDEVTQKALLAKSQQ
                     IEANLTTGILKVAVFGTGSAGKTSLVNALIGEMVGNVNASMGTTTEGITYSLKLPQAN
                     REILITDTPGILEMGAPGEIREKLARQLATEADLLLFVCDNDLRSSEFTPLEALASIG
                     KRSILIFNKIDLYSEEEQEIILNNLRERVKNFITGVDVLKACANPQPVQFSEDEMIQP
                     DIEITSVIKRLAAICRAEGDDLLADNILLQSQRLGEEARKLIRQQRSREADKIILRYQ
                     WIGAGVIACTPLPVLDMLATAAVNAQMVVEIGQVYGCDLNSETGRDLALSLGKTLVSL
                     GVVKGAVELIAKALQFTAATYVVGKVIQGISAAYLTRIAGKSFVEYFSHDQDWGDGGI
                     TEVVQRQFKLSRKDEFVKTFVQDAIARVIEPIKDTLDSEFNQGELEKSNEIYFDDGDE
                     WGGNGKSKDEWG"
     CDS             196162..197451
                     /codon_start=1
                     /locus_tag="GM3709_158"
                     /product="dihydrofolate synthase"
                     /protein_id="BAQ63393.1"
                     /transl_table=11
                     /translation="MGVNKMINNNLSKNLNTLLEPYQKFGISLGLERIKNLLEKLGNP
                     QNKVPIIHVAGTNGKGSVCAYLSSILTQAGYKTGRYTSPHLVNWNERICLNEQPISTE
                     KLRAIIKHISTVIDSLPECPTLFEVVTTAAWLYFAQSQVDVAVMEVGLGGRLDATNVC
                     DKNLASIIISISREHWQRLGNTLTEIATEKAGVMKSQCPVIVGNLPPEAIEVVKNRAK
                     ILDCPSIWVESAQKIEKNSDNWAKYQDIEYPLPLAGDIQLQNSAISIATIKILQQKGW
                     HIKLEDIQEGMRKAKWRGRIEWVVWQGQKMLIDGAHNVAAAQVLRQYIDTLHKPIIWV
                     MGMLSTKDHQGIFEALLRPQDQLHLVPVPDHSSTDTNFLSQVAQNVNPSLTKVNTYDD
                     LFIALEKVSSIVDNEKEIIVLCGSLYLLGYFLQYFSP"
     CDS             197685..199325
                     /codon_start=1
                     /locus_tag="GM3709_159"
                     /product="oligopeptide transport ATP-binding protein OppF"
                     /protein_id="BAQ63394.1"
                     /transl_table=11
                     /translation="MNSPLLEIKNLKVAYPVTNYGEDKKTWAVNDVSFNLDKGEIMAL
                     VGESGCGKSTLGRSVMRLLPHESTIEGSANFQGKDIFSFDSQAMRKFRGEAVALIFQD
                     PMTRLDPLMTIGDHCIETLKAHQPQLSTKEAKQKALSTLETVKILPERFNQYPHEFSG
                     GMRQRVAIALALLLEPKLIVADEPTTSLDVTIASEILAELTSFCRDREMALLLISHDL
                     AMVGKYCDRIGVMYQGEMVETGKVDDVMYSPHHEYSKSLLDAAFHLHHTTASQPPEAK
                     TTPLLQLKNLKQYYTLEANFIEQILGKKSQTIKAVDDLNLDIKQGEILGLVGESGCGK
                     STLSRTILQLIRATSGQVQFLDQDLTTLTEKEIRGLRKEIQMIFQDPHACLNPMMTIG
                     ESITEPLLIHQMGNKQENRERVEKMLNRVGLNPQEYYNRYPKELSGGQQQRVAIARAL
                     ITNPKLVICDEPVSMLDATVQAQVLDLILELKAEFNLTYLFITHDLSVAKFLCDRIAV
                     MNGGKIVELEETESIFKNPQHPYTKTLLASAFTLKMRS"
     CDS             complement(199303..201747)
                     /codon_start=1
                     /locus_tag="GM3709_160"
                     /product="recombination inhibitory protein MutS2"
                     /protein_id="BAQ63395.1"
                     /transl_table=11
                     /translation="MIEQETFRLLEWQRLCQHLSTFAATKLGAIASSNLAIPDNVLET
                     EYLLEQTKEVCQLETDINANWSFNGIHDIGNSVERAKIGGILSGEELLNLATTLAGVR
                     KLRRVIEDQENSPTLQELVNDLRTFPELEQEIHYCIDDRAEITERASPQLGEIRQKIK
                     ALRNKIQQTLQAIIQRNNNALQEPVVTQRGDRFVLPVKASHSGQIQGIVHDTSTSGST
                     LYLEPRVIIDLGNKLQTTRNQEKREEERILGQLTQKVAEVWEDLEKLLAIATALDLAT
                     AKARYSIWLNGHPPEFVDFQDGESISLRQVRHPLLVWQEKHEQGNSVVPIDVLINPET
                     RVVAITGPNTGGKTVTLKTIGIVALMAKVGLFIPAKYPAQIPWFRSVLADIGDEQSLE
                     QSLSTFSGHIRRIIRIIEALHGGFNPPHLSLITGESLVLLDEVGAGTDPNEGTAIAIA
                     ILKYLAEHSLLTIATTHYGELKSLKYDDSRFENASVEFDDVSLQPTYRLLWGIPGRSN
                     AITIAQRLGLPLNIVAEAQELVGGFSHDVNELISALENQRREQENKHKQAQDLLSKTE
                     LFYQQVEEKASSLQARERDLKLQQEQEVQKLLFDAKSQIAQVIKGLQKKGEPTAQDAH
                     QATDVLNKIGDRFLTPLKVKSSYKPKVGERVRILSIGQTAEVLTVDEDTEQLSARFGI
                     MKMVIPFTDIESLDGKRFEKINPIPEKTKATVNKQQSKQANLPKTESKPINVRTSQNT
                     LDIRGKRVHLAEPLLEKAIANATDMGSLWIIHGKGTGSLRTGVHEFLKNHPQVSNFEL
                     AKQNDGGAGVTIAFLK"
     CDS             complement(201878..202183)
                     /codon_start=1
                     /locus_tag="GM3709_161"
                     /product="hypothetical protein"
                     /protein_id="BAQ63396.1"
                     /transl_table=11
                     /translation="MNLQALAIVLEKRGYIASCYTCGTELTSASFMVSLGDNHLIRFL
                     VSDYGITWTEMQDDRELMKLEGAEAISQLEELANLVKYQIKSVDSKAPSYDHSLLVH"
     CDS             complement(202654..203739)
                     /codon_start=1
                     /locus_tag="GM3709_162"
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="BAQ63397.1"
                     /transl_table=11
                     /translation="MTKKYSITLLPGDGIGPEIMAVTVKVLETVAKQFDIEFQFQEAL
                     IGGSAIDATGNPLPPETVEMCKKSDSVLLAAIGGYKWDNLPREQRPETGLLGIRAALG
                     LFANLRPATILPQLIDASSLKREVVEGVDIMVVRELTGGIYFGQPKGIFTTETGEKRG
                     VNTMAYTESEIDRIAKVAFETAQKRQKKLCSVDKANVLDVSQLWRDRLIKMSEEYPDV
                     ELTHMYVDNAAMQLVRNPKQFDTIVTGNLFGDILSDAAAMLTGSIGMLPSASLGSDRP
                     GLFEPVHGSAPDIAGKDKANPLAQVLSAAMMLRYGLNEPLLADKIEKAVLKVLDLGYR
                     TGDIMSEGCISVGCKAMGNALLSVLNK"
     CDS             complement(203847..205232)
                     /codon_start=1
                     /locus_tag="GM3709_163"
                     /product="iron-sulfur cluster assembly protein SufD"
                     /protein_id="BAQ63398.1"
                     /transl_table=11
                     /translation="MPNSPNSIAMLKPDTFKVTKDAYLGGLLQLSENQPLNVSGKLET
                     LIQGIRQKGANQVVQSHLPTEKDEDWRFTDISDLQTEDWHLPIPTQLSIDVLNGFILR
                     EVSNSRLVFVNGCYAPNLSDISALPDTVYVGNLMDLDEDKINKISQYFNKNETATEVF
                     TALNTSGLTDAFVIWVKANANVEIPIHLLHLTARDNFSIFTQPRILVVAQANSNINFI
                     EYYGAVASGCSDSAKQKYYFTNVVTEITLEDNAQINHSRIQRESGDGFHIGNTFVSQS
                     KNSRYTINEISLGAKLYRHNLQINQEGEETETYLNALTMLQGKQMGDTHSQVNLTKPH
                     GTVNQLHKYIIDDSGRGVFNGKIHVPKLAQLTNATQLNRNLLLSNKARINTKPELQIT
                     ADNVKCAHGATVSQLETDEIFYLRSRGLNEYDAKHLLIDAFAGEIIEKIPYESLKKRL
                     TQCVACRTIDN"
     CDS             complement(205315..206085)
                     /codon_start=1
                     /locus_tag="GM3709_164"
                     /product="iron-sulfur cluster assembly ATPase protein
                     SufC"
                     /protein_id="BAQ63399.1"
                     /transl_table=11
                     /translation="MNQPILSVRNLTASVDGITILKGVNLEINQGEVHAIMGRNGSGK
                     STFSKVLTGHPEYEVTGGEIIYKGENLLEKEPEERALEGIFLAFQYPLEIPGVSNLDF
                     LRVAYNARCKHLGLEELDAFDFEDLVEQKLDIVKMNSAFLARSLNEGFSGGEKKRNEI
                     LQMALLEPTLGILDEIDSGLDIDALRIVAEGVNQLRKSDNAFLLITHYQRLLDYITPD
                     FVHVMYEGKIVMSGDKNLALELEAKGYDFLEEEKLATL"
     CDS             complement(206313..208331)
                     /codon_start=1
                     /locus_tag="GM3709_165"
                     /product="thiazole biosynthesis protein ThiG"
                     /protein_id="BAQ63400.1"
                     /transl_table=11
                     /translation="MKTSNEIIIIGGGIIGLSIAVELKLKGLGVTVLSRNFTQAATKA
                     AAGMLAPRAEQLPEGAMLDLALESLALYPEWARKLEQLSNEDIDYNPCGIIAPIYQQP
                     SQTNNNWLDRDTIQLYQPHLGDEVMGGYWYPEEGQVDPRKLGKVLLTVAKLLGVDVKE
                     GIEAIAFTRHQGRINNILTKSGIFSADTYILASGAWSSKLFPLPVRPVKGEMLSLKIP
                     LDNPLERVIFGENTYLVPKKDGRLIIGATSEDIGWKEGNTAEGINTLLNRAIRLYPPL
                     GTWQLDEIWYGFRPATADEMPILGYGDVDNLIFATGHYRNGILLAPITAKLISNLIID
                     HQADPLLQYFSYQRFNKSTLQIMTYPTPSQNNNINPNGSNLSSINSNLGDFSTKTQDS
                     RYLTPSNASEFFSNNPQDDDNLIIAGRKFNSRLMTGTGKYPNMESMQKSVIASGCEIV
                     TVAVRRVQTNAPGHEGLAEALDWGKIWMLPNTAGCTNAEEAVRVARLGREMAKLLGQE
                     DNNFIKLEVIPDSKYLLPDPIGTLQAAEQLVKEGFAVLPYVNADPLLCKRLEEVGCAT
                     VMPLGSPIGSGQGIQNLANIKIIIEQAKIPVVIDAGIGTPSEAALGMELGADALLINS
                     AIALAQNPVQMARAMGLATVAGRLGYQAGRIPVKEYASASSPLVGVVK"
     CDS             complement(208364..208534)
                     /codon_start=1
                     /locus_tag="GM3709_166"
                     /product="hypothetical protein"
                     /protein_id="BAQ63401.1"
                     /transl_table=11
                     /translation="MKEYETGNTENTIDLIKYLQKEDKERQEKNSNILRWNQLSILEY
                     SKVFYQSFVKRN"
     CDS             208778..216919
                     /codon_start=1
                     /locus_tag="GM3709_167"
                     /product="alkaline phosphatase"
                     /protein_id="BAQ63402.1"
                     /transl_table=11
                     /translation="MSTNEIASDGILTMGLDDNFPLLLKENLENNFSEFDFKNYILKL
                     SQDDQEKLEKIKGWEIPHYKLNNKTIPLNIYIVQDGLFHNNSFYSQQDHNIYLAKSFL
                     KNTTLNEIKSILVKSINNLPIFSSIPENASSISLSDNLESIISNVNPHTLICQCGSCS
                     LPYGQSSNQNQATTIIINAPTTLGNTFKLHSNPNANHTIYLDFDGHFMSSSLWEDGGS
                     LRLGSYDTDGNPNSFSNAELEEIQLMWQRAAEDFAPFNINVTTEEPTDLGDLINSGGG
                     DTRWGIRVVMTDNLNLDTGSEITNAGGGGTAYLESFNWNYDEVALTFNQGAYEGGETI
                     SHEVGHTLGLNHDGQLPGREYYEGHGSGETSWAPIMGAGFTDGDYDNVTQWSKASEYY
                     NGNQTEDDLAIITTNNGFGYRTDDHGNTNVTATVLDLNNLNNFGIIERNTDIDIFSFN
                     TIGNSTFYFNINPISRALISDGAGGFSTEYLESYGANLDIWARIYDNGGNLIAQSNPA
                     NTLSANFSNLFLSAGQYYLHIDGVGIGNPLSSNPTGYTDYGSLGQYYVSGTFNPNYIA
                     LAINATNANQFEGNSGTTSFTFTVTRSGITTNTDSVNWAITGSGANPSNGGDFVGGIL
                     PSGTVSFAPGETSKVITVNVQGDTAIEPNETFTVTLSNPTNGATFISSTAIGTIQNDD
                     GIVTLSNTTPILIDDVNVGGSTPYPSDINVSGLGGNISKISVTLNNLSHSWTGDIDIL
                     LVGPTGAKTILMSDIGENIATNGVTLTFDATAANFLNNSNITTSGNYKPNNLVGTSGV
                     EPDFFPSPAPADSYNMDLSVFNNTNPNGIWSLYVVDDDELENVGTIAGGWSLNIETDI
                     PTTPRINLIGNQTVVEGITNPQNVTYTVTLSQASTQTVTVQYATIDGTAIAGQDYTSS
                     SGTLTFSPGQTSQTITIPILNDSINEPNETFTLILSDPNNGTLDNTTAITTIIDTLST
                     SVTTTLPANVENLTLTGTANINGTGNTGDNILLGNSGNNILNGGAGNDRMIGSSGNDI
                     YYVDNIGDIVEETASQGIFDQVFASISYTLTENVESLTLIGTGNINGTGNNSINIITG
                     NTGNNTLIGNGGIDSLDGGAGNDTMIGGSGNDTYYVDSLGDVVVEEVNQGIDRVFVSI
                     SYTLGDNLENLFLDGTENINGTGNSLDNNITGNSGNDTLNGGDGDDTLDGGGGNDRMV
                     GGNGNDTYYIDSTADIVVENLNGGTDLVRVTASINYTLTSNVENLIFSSGGTFNGTGN
                     SLNNIITRFAGPGSLSGLDGNDTLNGAASGDSLFGGNGDDILDGGEGNDTLLGDADND
                     TLNGGDGNDSMAGGNGNDILNGNAGNDSLTGGNGNDILNGNNGNDSMVGGSGNDTYYV
                     DSDGDVVVENFNEGTDLVIASITYTLGANVENLTLSGTGNINGTGNGLNNIINGNNGN
                     NFLFGGSGNDSLTGGNSDDGLSGDLGNDTLNGGTGNDIMMGGFDNDTYYVDSVGDILT
                     ENLNEGIDVVIASISYALGSNLENLILDGTANINGTGNSSNNNITGNSGNNSLNGGDG
                     NDSLTGGSGNDNLLGSNGNDTLNGGAENDTLNGSVGNDSMVGGSGNDIYIVDALDYIV
                     SETSTTVTEIDTVQSSITYTLGANLEHLILTGTSAINGTGNNLPNNMTGNSGNNILNG
                     VAGNDSLTGDAGNDTLFGSSGNDTLDGGTGNDSMVGGSGNDIYIVDAVGDIVSETSTT
                     VTEIDTVQSSITYTLGANLEHLILTGTSAINGTGNNLPNNMTGNSGNNILDGVEGNDS
                     LTGGNGDDSLWGGADNDTLDGGEGNDTLNGGTGNDNMVGGTGNDVYIVDAMGDIVTET
                     STTVTEIEAVKSSITYTLGANLEHLILTDTSATNGTGNNLPNNMTGNSGNNILDGVEG
                     NDSLTGGNGDDNLWGGADNDTLDGGEGNDTLNGGTGNDNMVGGTGNDVYIVDAMGDIV
                     TETSTTVTEIEAVQSSITYTLGANLEHLILTGTSAINGTGNNLPNNMTGNSGNNILDG
                     VEGNDSLTGGNGDDNLWGDADNDTLDGGEGNDTLNGGTGNDTIRGDSTFDNLTGDDTI
                     DGGSGNDSILGGGANDFIYGGDGDDMILGQRGDDTLSGDNGNDFIDASNDNDFIYGGD
                     GADTINGGSGNDFIDGATENDSILGGLGDDTVNGGNGDDIIIGGAGHDSLYGENGDDT
                     INGLGENDTIDGGDGNDWILGGAGNDFIDGGVGEDTISASNDNDTILGGDGNDSIDGG
                     SGNDSIDGGNGNDILLGYTGHDTLDGGTGNDSLVGSSGNDLYIVDAVDDIVTETSTTA
                     TEIDTIQSSIICTLGANLENLILTGTSAINGTGNTLDNNITGNSGNNILNGGDGDDTL
                     NGGNGDDNLLGENGNNNLVGGEGNDTIDGGSGNDSILGGDANDTIDGGYGDDTILGQL
                     GNDTLLGDNGNDFIDASNDNDFIYGGDGADTINGGSGNDFIDGATENDSMLGGLGDDT
                     LFARDGDDIIIGGAGNDSLYGENGDDTINGFGENDTIDGGDGNDWILGGAGNDFIDGG
                     VGEDTISASNDNDTILGGDGNDSIDGGSGNDSIDGGNGNDILLGYTDHDTLDGGNDND
                     TIIGSYGNDTLTGGTGNDFFRFDSPLEGIDQIADFNITDDTIQVCASGFGGGLGIGVL
                     PSERFRVGSSPSTSDHRFFYNSSNGGLFFDVDGSDATSAVQIATLNTGLAMTNTDIVI
                     I"
     CDS             217316..219925
                     /codon_start=1
                     /locus_tag="GM3709_168"
                     /product="leucyl-tRNA synthetase"
                     /protein_id="BAQ63403.1"
                     /transl_table=11
                     /translation="MQSPYQPSDIESKWQKKWSETGLYNTEENTDKPKYYALSMFPYP
                     SGKLHMGHVRNYVITDVIARFKRMQGHRVLHPMGWDAFGLPAENAAIDRGIPPAKWTF
                     ENIAQMRSQLQELGLSIDWSREVATCSPEYYKWTQWLFLQFLEAGLAYQREAAVNWDP
                     IDQTVLANEQVDSEGYSWRSGAKVERKLLRQWFLKITDYAEQLLDDLQQLQGWPDRVK
                     TMQENWIGKSVGAYLEFPIMGKDEKIAVFTTRPDTVYGVTYVVLAPEHPLTQVVTTSE
                     RKEVVEAFIKEVSEESEIDRTADDKPKKGTMTGGKVINPFTGEEIPILIANYVLYEYG
                     TGAVMGVPAHDVRDFKFAKENDLPIKVVILPDDADNGDICLLEAYTEAGIMINSGGFN
                     GMNSIKGKEAVIRLAENNDYGKKRIQYRLRDWLISRQRYWGCPIPVIHCEDCGIVPVP
                     SEDLPVKLPENVEFSGRGASPLAKIEDWINVPCPKCGKPAKRETDTMDTFIDSSWYFF
                     RYTDATNQNEAFNLNTVNDWMAVDQYVGGIEHAILHLLYSRFFTKVVRDRGLVKVDEP
                     FKRLLTQGMVQGLTYKNPETGKYVIAENVYSVEETNDKGKTETVYYEKETNQKLSVFY
                     EKMSKSKYNGVDPEVVLSKYGADTARMFILFKAPPEKDLEWQDADVEGQYRFLNRVWL
                     LVNDFVENPNSAKNKTFDKAKLSKEEKDLRRAIHTAIKEISDDLNGDYQFNTAVSELM
                     KLSNALRDFSNKNSPIFREGIETLILLLAPFAPHISEELWKLSGNSNSESVHLQSWLT
                     LDNDALIVDEITLVIQIMGKTRGTISVPASANKEELEKFAKESDIAKKHIDNKTIKKV
                     IVVPNKLVNFVVS"
     CDS             complement(219991..221427)
                     /codon_start=1
                     /locus_tag="GM3709_169"
                     /product="two-component response regulator"
                     /protein_id="BAQ63404.1"
                     /transl_table=11
                     /translation="MINCDIKSLNKSINQLDLVSENNLIESILIVDDQPANLRVLSKM
                     LESKNYKVKKAPDGESAIIAAQSNPPDLILLDILMPNMDGYEVCEKLKSDTKTKDIPV
                     IFISALSDVFDKIKAFEVGGIDYITKPFQEEEVLARITSQLTIQTQRKLLEKERELLE
                     KEQDNLRKEIRQRKEAEAILYQSRALISSILNASLDGIAALEAVRDPKTGEIEDFRCI
                     VVNPVTAQIFNSQPENLTGKLVFKKFINKVKPQLFSSFIKVVETGKSLEQDIRYNYKN
                     TQKWFHFIAVKLGDGFSVTVRDITVRKKLELKLSKLATIDGLTGVYNRHFFDNTLAQE
                     WQRCDRGNEPLSLILCDVDYFKPYNDIYGHQAGDKCLIKVAQIMDNIVKRSSDFLARY
                     GGEEFAIILPNTPLEGAINIAEQIRKEIQDLKIPHKHSEISDYVTLSLGIASVIPSSQ
                     NSIESLIKMADNALYQAKENGRNQVKFS"
     CDS             complement(221512..224295)
                     /codon_start=1
                     /locus_tag="GM3709_170"
                     /product="ammonium transporter"
                     /protein_id="BAQ63405.1"
                     /transl_table=11
                     /translation="MTDLQWILICAGLVFLMQPGFMCLESGLTRSKNNINVAVKNLAD
                     FGISVALFWMFGYGLMFGLSKAGIIGTTGFFIDIGSDSELGAFFLFQAMFCSTSTTIV
                     SGAVAERLKFSSYIISSGIISGIIYPIFGHWAWNGMDNSHNGFTGWLGNLGFVDFAGC
                     TVVHSIGAWVSFALLIIIGPRHGRFSVQKINGSNLPLSVLGVMLLWIAWFGFNGGSIF
                     VFNDQVPRILVNTLMAGVAGMISGCIFGWQKYKMPEVEFLMNGTIAGLVSITASCHAV
                     STSEAVIIGAIGAYLMLFAKGQLEKHKIDDAVDAVAVHGMGGTWGILAVALFAQPELL
                     GTGLNSFEQLLVQLLGILVCFIWAFGLAWLLLNLTNRFFPLRVSLEDEDIGLNVSEHR
                     AKTEVYDLLTVMDEQIKTQDLSLRVPVEPFTEVGHIATRYNQVINSLEQSTAQLQAGN
                     IELAQAKEKAEIANQTKSVFLANMSHELRTPMNAILGFSQIMMRSNTLLQEHKDNINI
                     IHRSGNYLLNLINNVLDLSKIEAGKMTLNEKNFDLYTLLQEIEDLLQLKAEEKELQLN
                     FERDENVPRYIRTDETKLRQVLINLANNAIKFTEEGGVNVLVYLTPYQPKTEDKIYIT
                     FAVEDTGAGISQEDIGKVFEAFTQTEVGRNSQEGTGLGLPISRKFVQLMGGDINIKST
                     LGEGSIFSFEIVTQLIKPEEVEIEQRINSRHVVGLKSGQQRYRILVVDDRPMNRLLLI
                     KLLQPLGFELKEAGNGQEAIEIWDDWKPHLIWMDMRMPVMDGYEATQHIKGTIKGNAT
                     AIIALTASVLEEEKAVILSAGCDDFIRKPFKESVIFDAMAKHLGVEYIYEEENHTSIV
                     TTNQPLTVENLQIMPSSWIDKLYQASVDLDDDLILELIAQIPQEHHTLIEKLTNLVDN
                     FQLKKIRKLIEKQ"
     CDS             224394..225092
                     /codon_start=1
                     /locus_tag="GM3709_171"
                     /product="cytochrome c-type biogenesis protein CcdA"
                     /protein_id="BAQ63406.1"
                     /transl_table=11
                     /translation="MQQLANELVANQLNHLSFFSVAIILFTGLITSLTPCMLSMLPLT
                     IAYIGGYENKGKFSSFLQSIYFAFGLATTLAILGIFAALFGKVYGQIGIGLPILVSSI
                     AIIMGLNLLDIIPLKFPNWDTSNWIKDNLPNSLKSYLLGLTFGLIASPCSTPVLITLL
                     AYIANSKNLVFGAILLVSYAIGYVFPLILAGTFTGTLKNFLNLRIVTQWINPLSGAIL
                     LIFGIFSLASRFTI"
     CDS             complement(225823..226662)
                     /codon_start=1
                     /locus_tag="GM3709_172"
                     /product="mobile element protein"
                     /protein_id="BAQ63407.1"
                     /transl_table=11
                     /translation="MKLERIKKLKPEKFKRRFGVKKETYNLLVEIVKKEQNNHKRGRK
                     SKLTVSEQILVTLEYLREYRTYFHISEYWNISESTVCRTVHKIEKILLKSGYFSLGGK
                     KELIKKENEIKAVLIDVTEIAIERPKKRQKIYYSGKKKEHTFKAQLVVNKDTLEIICY
                     VNGRGREHDFKIFKNSRLPLSEKIKCLVDKGYQGIEKIHKLSEIPKKKTKKRKLTQEE
                     KRKNRELNRQRIVIEHVNRKLKIFRILSEKYRNKRKRFGLRFNLIAGIYNYEIVKKDI
                     AII"
     CDS             complement(226997..228874)
                     /codon_start=1
                     /locus_tag="GM3709_173"
                     /product="glucosamine--fructose-6-phosphate
                     aminotransferase [isomerizing]"
                     /protein_id="BAQ63408.1"
                     /transl_table=11
                     /translation="MCGIVGYIGTQIAIDILVSGLEKLEYRGYDSAGVATIVDNNIHS
                     TRAKGKLYNLRTKLEKETNTAKIGIGHTRWATHGKPEEYNAHPHQDNKGRFAVVQNGI
                     IENYQELKKELISKGHQFISDTDTEVIPHLIAEYYNPQSEDPFIDAVNKAITYLDGAF
                     AIAILCADYPDELIVARQSAPLTIGFGQGEFFCASDVTALVNHTNTVLSLENGEIARL
                     TPLGVEIYDFSGKRLRKTPRTLDWSPVTVEKQGFRHFMLKEIHEQPSVVRTCLEAYLN
                     PDWHSETNPDENPVTLNLKSELYQDLEHIQIVACGTSWHASLVGKYLLEQIAKIPTFV
                     QYASEFRYSPTPVMRNTITIGVTQSGETADTLAALEMERQRRSTLTTSYQPRILGITN
                     RPESTLGSMVDQVINTYAGIEIGVAATKTFVAQVIGFYILALDLAWRRKTVTPSRMDE
                     ILKGLLQLPTQIEQIIHTEEPKVRDLAHQFPDTRDFIFLGRGINFPIALEGALKLKEI
                     SYIHAEGYPAGEMKHGPIALLDAHVPVVAIAMGGSVYEKVISNAQEAKARDARLIGVL
                     PQNKQEDMFQDTLLVPEVEEILSPILAVIPLQLLSYYIASMRGLDVDQPRNLAKSVTV
                     E"
     CDS             complement(229128..230087)
                     /codon_start=1
                     /locus_tag="GM3709_174"
                     /product="pentapeptide repeat family protein"
                     /protein_id="BAQ63409.1"
                     /transl_table=11
                     /translation="MNADEVLRLYDQGQRDFSQIDLSKEDLIQENLTQINLSRVDLNW
                     ANLSGSDFSGANLSRSDLVHTRIISAKLIGANLSYADLTYADLSWANLNGANLSRVDL
                     SYGNLNKSSLANANFSYAKLNNCNLTGANFAGANFTRADLSGADLSGVNLTGADLTRA
                     DLSGANLLGCDLTETNFRRADLSGSQLRNADLSEAILQGVNLEKANLRGANFTGAILR
                     NTHINQVKLSELNLKLPSKTKVIFFGANLRESNLERAILKNSILSYAILEKANLEETC
                     LHRSNMIEAYLTSADLRGANLRNSALNGVNLTGTTMADGSIHP"
     CDS             complement(230143..230454)
                     /codon_start=1
                     /locus_tag="GM3709_175"
                     /product="glutaredoxin 3"
                     /protein_id="BAQ63410.1"
                     /transl_table=11
                     /translation="MLNLISKIFGNQFSYIQAKVEIYTWQTCPYCIKAKWLLWLKGCD
                     FQEYKIDGDNTARKLMIDRANGKKTLPQIFINNISIGGCDNLYRLDQEKKLDILLSES
                     L"
     CDS             complement(230501..231508)
                     /codon_start=1
                     /locus_tag="GM3709_176"
                     /product="permease of the drug/metabolite transporter
                     (DMT) superfamily"
                     /protein_id="BAQ63411.1"
                     /transl_table=11
                     /translation="MQLKPDYNSSFLTSLILIAPFFLWGTAMVAMKGVIPQTTPLFMA
                     GIRIFPAGFLVLLVAIALGKSQPKTWQGWGWISLFALVDGCMFQGFIGEGLMRTTAGL
                     GSVMIDSQPLAVAIMSRWLFKEIIGFWGWLGLTIGILGISLIGLPDEWIINWLQGNFT
                     NLDFNWQNLFNNGEWLMLLASLSMAVGTIMIPYVSRHVDAVVATGWHLVLGGLVLFIF
                     SFQFETSQWVNLDLSAWLSLSYATIFGSAIAYGLFFFLASKGNLTSLSALTFLTPIFA
                     LTFGNLILGETLSTLQLQGVFLTLVSIYLINQREQINQFITPKYVKFKIAIKNQLRIN
                     N"
     CDS             231565..232104
                     /codon_start=1
                     /locus_tag="GM3709_177"
                     /product="tmRNA-binding protein SmpB"
                     /protein_id="BAQ63412.1"
                     /transl_table=11
                     /translation="MEIPPLNQKLWRFVILKLSAKNNHSMTEKVTVKIISDNRQARYL
                     YEILETYEAGIELAGTEVKSIRMGRVNLRDGYALIRNGEAWLSNVHISPYETTGRYFN
                     HEPRRNRKLLLHKKEINKLIGLLEQKGLTLIPLKMYFKGEWIKVSLGVGKGKKLHDKR
                     ETVKRREDEREMARALKRF"
     CDS             232195..232692
                     /codon_start=1
                     /locus_tag="GM3709_178"
                     /product="peptide methionine sulfoxide reductase MsrB"
                     /protein_id="BAQ63413.1"
                     /transl_table=11
                     /translation="MMKRRTFLTFAFSAFPLTFAVDQTISANQTKSTNKPEKITLSDK
                     EWKKKLTPQQYHILRQEGTEKPFSSPLNNEKRKGIYACAGCNLPLFNSSTKYNSGTGW
                     PSFYDSIENSLGTKRDLKLFIPRTEYHCARCGGHQGHVFGDGPNPTGKRYCNNGLALK
                     FIPQA"
     CDS             232694..233281
                     /codon_start=1
                     /locus_tag="GM3709_179"
                     /product="peptide methionine sulfoxide reductase MsrA"
                     /protein_id="BAQ63414.1"
                     /transl_table=11
                     /translation="MNKINKTIVIILFTFLILTPLANAKTEKATFAGGCFWCMEQPFD
                     VIKGVFSTTSGYTGGDLKNPTYKRVTGGQTGHAESVQVQYDDNLVTYQKLLDIFWKNI
                     DPTVQNRQFCDVGTQYRSAIFYHNEQQKKLALESKEKVAKKLKKPIFTEIKPLKEFYA
                     AEDYHQDYYKKNPLLYKYYRYRCGRDQRLTEIWGN"
     CDS             complement(233661..234605)
                     /codon_start=1
                     /locus_tag="GM3709_180"
                     /product="glycosyl transferase"
                     /protein_id="BAQ63415.1"
                     /transl_table=11
                     /translation="MDLSLVIPIYNEAENIPLLISAITNSLKDTPLTYEIICVDDGSE
                     DASIEVLKNLASNTNCLKAIILRRNYGQTPAMAAGFENSTGKVIITLDGDLQNDPADI
                     PLLLSKLEEGYDLVSGWRKNRQDDALTRLLPSKIANFIIGKITGVNLHDYGCSLKAYR
                     TELIADLNLYGELHRFLPALAYIEGAKIAEIPVNHHARRFGKSKYGLGRTFRVIMDLL
                     TVFFIKKFLTRPMHVFGFFGLLFMVLGVIIGVYLTFIKLGLHKSIGDRPLLILCVLLI
                     LTGVQLFSFGLLGELLMRTYHESQQRPIYRIREIVDSE"
     CDS             complement(234728..235213)
                     /codon_start=1
                     /locus_tag="GM3709_181"
                     /product="metal-binding"
                     /protein_id="BAQ63416.1"
                     /transl_table=11
                     /translation="MEKIYIPRLLKMPEQKEEIILNHQIAGLNSLTPVRGIFQICHRG
                     NFLELQLQADTILTLTCDRCLQTFNHRLEVDTSEIILLKQQETDLNYPLEREILTEDL
                     SETLPPDGEFIVDEWIYEQLSLGMPLRNLCGNDCQPPAIEAQEDTTIKDNRWSALSRL
                     K"
     CDS             235404..236906
                     /codon_start=1
                     /locus_tag="GM3709_182"
                     /product="serine/threonine protein kinase"
                     /protein_id="BAQ63417.1"
                     /transl_table=11
                     /translation="MSQGDLSRENLLVQRYQLKEIIGQGAMGIVYRAEDTVSKRQNVA
                     VKILSRALDDMKMIKRFQREATVSALLSERSDNIVRVTDYGVDEKKVPFYVMEYLNGE
                     NLDDFIDIHEISIPIFLDFASQICRAMETAHNGIFFEGQICPVIHRDLKPSNVFLIED
                     LTGKQIIKVLDFGIAKLVKNEKGETEAFMGTPRYCSPEQIQGKDLDNRSDIYSLGMVM
                     YFMLAKKYPWDLEINSVSAWYKAHTELTPSPFSSSLKIPPELEKLVLRCLEKSPNYRP
                     QSIGEIIQILEAIARNINNQSHLRNQSSYSNIHDNKKSPLETFLLTSKWPQNKPQQKI
                     VFPRIFPFEKEVFPTICTMLESEDINKRKNNIRYNQFLFQSYPHPMILWLTVLYSPED
                     GARWLPCYLDLKTKIGQQVVNLLSDSKKYFLLFYPLDNPNKCQNILSFKVMLKQRTSL
                     KQWASVSNMLNINHNEEAVISRKKLKEDLERLKPKIILDIEKTQTQEVHG"
     CDS             236911..237294
                     /codon_start=1
                     /locus_tag="GM3709_183"
                     /product="hypothetical protein"
                     /protein_id="BAQ63418.1"
                     /transl_table=11
                     /translation="MNLIEIIREDYRKFPQDQTYNIYAENVYFKDPIYDFYGIKKYQN
                     MISFLRKWFKNLHLELHEITENENQIDTRWTMSWNSPLPWQPFVSVSGRSELKLKDNL
                     IIGHYDYWDCSVWDLIKQHFKIINS"
     CDS             237323..237595
                     /codon_start=1
                     /locus_tag="GM3709_184"
                     /product="hypothetical protein"
                     /protein_id="BAQ63419.1"
                     /transl_table=11
                     /translation="MNNLPKNNQKNGINKEKYAYLKAEAEKPYKGFRKFIYFGLGASG
                     AIGAFIFFIQIIAGKNVSDNIPNLLIQIAVISLMIFLFRWENRDNN"
     CDS             complement(237786..239216)
                     /codon_start=1
                     /locus_tag="GM3709_185"
                     /product="glycosyl transferase"
                     /protein_id="BAQ63420.1"
                     /transl_table=11
                     /translation="MPEKDKFNNPDVNTELDPITSLIAEFSDPEIEEEEFRNDFFRGL
                     SGRRKKAAFTLSIIWLVTIALHLVSWSIWFVLILGCFVTVQALRLMFANPTPMIASEN
                     TENFPKVSLMVSAKNEEAVVGKLVKMLLSFDYPQDLYEFWVINDNSSDQTGIILDELA
                     QKYPQLKVLHRDGTAKGGKSGALNQAFALTTGDIIGVFDADAIASPNLLKKVVSLFTL
                     NQGAIQVRKSISNADENFWTLGQSTEMALDSYFQQQRIACGGMGELRGNGQFVRRQAL
                     ESCGGWNEETITDDLDLTIRLHLDHWDIGILEHPAVQEEGVKTSIALWHQRSRWAEGG
                     YQRYFDYWRFILSNRLNWSKKFDLLYFFLVQYIFPTAAIPDLVMVIIRHDIPLIAPLT
                     SLTFLLAFWGMFTGLKRTKSENISITDTFNMLTQSLLGMIYMTHWFLVMPVTTTRMSI
                     RQKQLKWVKTVHEGSSDDLELGLNEI"
     CDS             239399..240115
                     /codon_start=1
                     /locus_tag="GM3709_186"
                     /product="D-alanyl-D-alanine dipeptidase"
                     /protein_id="BAQ63421.1"
                     /transl_table=11
                     /translation="MKPYQTIPIIECHEPLVPIPDDRFILENPPPYVKLGADYQGKSP
                     YYLRKEVLSRLLMAKTKLGEIKPHWHIKIFDAYRPVSVQQFMVDYTFTSICNDRNLEA
                     NMLTSWEKASIYDEVYQIWAIPNDNPLTPPPHSTGSAIDLTLVDDNGIDVNMGGQIDE
                     LSPRSNPDYYKNSTDSQDVVFHKNREILLEIMIYGGFRRHQGEWWHFSYGDQMWAWLQ
                     NLDHPSLNTIAKYGRIVDIN"
     CDS             240540..240680
                     /codon_start=1
                     /locus_tag="GM3709_187"
                     /product="Sgl0002 protein"
                     /protein_id="BAQ63422.1"
                     /transl_table=11
                     /translation="MESSPVLLNTLFIIAIALLIFVSGAILYLTTLEWRDRRRRDQDK
                     KI"
     CDS             240817..242241
                     /codon_start=1
                     /locus_tag="GM3709_188"
                     /product="HlyD family secretion protein"
                     /protein_id="BAQ63423.1"
                     /transl_table=11
                     /translation="MTVSNLEKQNNPLPWIFGIMGGGIILIAIMSYVITNRTNSPTKI
                     DEYTVPITQQTINLEISANGTVEPIQSVNISPKNPGRIVKLLVDQGAIVKKGQPIAVM
                     DNKELYAQGIQAEARLRESQASLQEAQIKLQGDIQVYSSQINQALARLEESKRRIPSQ
                     IDQVRAQLAEAESRLKLAESQLKRNENLLKEGVISKDQFDQLGNEYIVAGANIQQLIR
                     RMEELKTTEDPEIKRLEGAVAEIKISMEERKVSGKVEMERLKANIQAIQADLEIAKIQ
                     YEDTYVLAPFDGIVTQRFATEGAFVTPTTSASNTVSATSSSIVALARGLEIVAKVPEI
                     DLNQIKLGQPVKIIADAFPDQVFEGVVRSVAPEAIVEQNVTSFEVKVAIVSGQEKLLS
                     KMNVEVNFLGDKLSNALVVPTVAIVTEEGETGVMIPDENNDPKFKPITIGVSVDDKTE
                     VLSGLLPGDRVFIDLPKDKRKNPQ"
     CDS             complement(242261..244000)
                     /codon_start=1
                     /locus_tag="GM3709_189"
                     /product="putative regulatory protein"
                     /protein_id="BAQ63424.1"
                     /transl_table=11
                     /translation="MEEKLPQHRMQITDDLDKLLQILPFTIRQSVEQHPQKSSLIEIV
                     LDLGRKPEARFSGHSSYLSDNLVSREDLEHCVTRVGHFSADNRAGIECTLHRISAIRN
                     RQGNIIGLTCRIGRAVFGTILMIRELVESGQSILLLGRPGVGKTTALREIARVLADEL
                     DKRVVIIDTSNEIAGDGDVPHPAIGRARRMQVSRPELQHQVMIEAVENHMPEVIIIDE
                     IGTELEAQAARTIAERGVQLVGTAHGNHLENLIKNPTLSDLIGGIQSVTLGDEEARRR
                     GSQKTVLERKAPPTFQIAVEMWERQKWVVHEEVAQTVDHLLRGKQPIPQLRQVNDAGE
                     VSITRDPSIAPQTELTTVQNLVEIPIKPSGLRASGKMIPLSLTHQQPNLDFEKMLANS
                     WYQAEETTEKVRIPGPNGEDFPIYVYPYGIGRSQLEQVIGVLKMPIVLTKDLDDADAV
                     LALRSQVKNHSKLMQLAKDRQVPIHSIKSNSIPQITRTLRQLVNMDNPETNEAADLRL
                     FTKAGNDDEIEALEEARLAVEQIVIPQGQPVELLPRNPKVRKMQHELIEHYRLRSDSF
                     GDEPNRRLRIYPA"
     CDS             244273..244845
                     /codon_start=1
                     /locus_tag="GM3709_190"
                     /product="hypothetical protein"
                     /protein_id="BAQ63425.1"
                     /transl_table=11
                     /translation="MLLLSSKKAFTNCFGIVFSLGVLSFTPTTFAQSTTDGQNNDVSE
                     ENIVTPINQTESLLSIDGGQKLMKEAEEAINAQNYDLAATKLQQARRVFNQLSNFYLQ
                     LAESFSGIEPRLAEGQRSGALRTATLRDESTYQLALVHRAQNKPELAVPLLIQIIRSQ
                     NPTSELGKKSYQQLYEIGFVETPFETGSNN"
     CDS             244993..245247
                     /codon_start=1
                     /locus_tag="GM3709_191"
                     /product="YrbA protein"
                     /protein_id="BAQ63426.1"
                     /transl_table=11
                     /translation="MVSLEQVKKTIQQEISDAQVFVKDLTGGGDHLEAIVISSQFEGK
                     TKVKQHQLVYGALQGELKSEAIHALALKTYTPDTWLTLQN"
     CDS             245390..245632
                     /codon_start=1
                     /locus_tag="GM3709_192"
                     /product="uncharacterized monothiol glutaredoxin
                     ycf64-like"
                     /protein_id="BAQ63427.1"
                     /transl_table=11
                     /translation="MPQCGFSNNVVQILNTLGIPFETVDVLADYDIRQGIKEYSNWPT
                     IPQVYVNGEFIGGSDILIELYQTGELQQMIEVALAS"
     CDS             245868..246035
                     /codon_start=1
                     /locus_tag="GM3709_193"
                     /product="hypothetical protein"
                     /protein_id="BAQ63428.1"
                     /transl_table=11
                     /translation="MTTAIINRINSIAIKRKLLVKLLEKPDLGGLRLDVNQAIEELDE
                     LIEELNKTFPN"
     CDS             246115..246702
                     /codon_start=1
                     /locus_tag="GM3709_194"
                     /product="hypothetical protein"
                     /protein_id="BAQ63429.1"
                     /transl_table=11
                     /translation="MADSNQPELETLNRIQILGFMGVTALILLVIAQLWRYLGSIQII
                     PVIFNLQAIGLGIIIAIGIISGSLLLSQIWGDYKNSAEKYLNLIITPLVFPDLIWVGL
                     LPGLSEELLFRGVMIPAFGYDLVAIVISSLLFGFLHLSDRENWHYAMWATIIGFLLGY
                     TAYITGNLLIPIIAHSLTNTASSIIWKIKKKSQKK"
     CDS             246998..247216
                     /codon_start=1
                     /locus_tag="GM3709_195"
                     /product="hypothetical protein"
                     /protein_id="BAQ63430.1"
                     /transl_table=11
                     /translation="MNVKSSIFSGIMTSLIVAMIALAVNHISQREHRRIVVVTGGAIL
                     GFVIGCAFQGIKDQKNTRYEDEQINKNE"
     CDS             complement(247254..248345)
                     /codon_start=1
                     /locus_tag="GM3709_196"
                     /product="cyanobacteria-specific RpoD-like sigma factor"
                     /protein_id="BAQ63431.1"
                     /transl_table=11
                     /translation="MNQLSSQIDYDHNLIETDIEQELSQVVAQFSVSDDENGKKSRGN
                     KSKVEDSVGAFFKEMARYPLLTPEEEIDLAYAVKFLSDCEEKQQELHRNLERTPSKIE
                     LAKAMGLENERQLDNRLYKGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAI
                     GLNRAAEKFDPDKGYKFSTYAYWWIRQAITRTIANDSRTIRLPIHIVEKLNKLKKAQR
                     VLKQTLQRQPTEMELADEMGITRQGLHQLLQLKRQSLSLNHRVGKGEDTELMELLEDS
                     NLLLPEEKMNETMMHQEIVSVLSDVLSEREKEVIVLRYGLASSKAHTLEEVGKIFELS
                     RERVRQIQTKAMRKLRRPQVARRLKGWLN"
     CDS             complement(248884..249963)
                     /codon_start=1
                     /locus_tag="GM3709_197"
                     /product="fructose-bisphosphate aldolase class II"
                     /protein_id="BAQ63432.1"
                     /transl_table=11
                     /translation="MALVPMRLLLDHAAENGYGIPAFNVNNLEQILSIMQAANETDSP
                     VILQASRGARSYAGENFLRHLILAAAETYPHIPIAMHQDHGNSPATCYSAIRNGFTSV
                     MMDGSLQADAKTPATFEYNVDVTAEVVKVAHSVGASVEGELGCLGSLETGMGEAEDGH
                     GFEGKLDHSQLLTDPDEAVEFVERTQVDALAVAIGTSHGAYKFTRKPTGEILAISRIE
                     EIHAKLPNTHLVMHGSSSVPQEWLDMINQYGGNIPETYGVPVEEIQKGIKSGVRKVNI
                     DTDNRLAITAAIREAAMKDPSNFDPRHFLKPSIKYMKQVCLERYQQFWCAGNASKIKQ
                     ISLDDFAAKYAKGELNATVKKTVAV"
     CDS             complement(250180..250554)
                     /codon_start=1
                     /locus_tag="GM3709_198"
                     /product="hypothetical protein"
                     /protein_id="BAQ63433.1"
                     /transl_table=11
                     /translation="MKTNQIFKFCLLSAPIVLTSLFFSVWQSQRVEASETQTINLNVI
                     SPNLSKVITPSNLEQNQYGDFMLNFTNEESDASIEMFGCDCITSLNKLKRLRGLTVGV
                     HGELLTDNVLMATCPHQQLLGT"
     CDS             complement(250714..251418)
                     /codon_start=1
                     /locus_tag="GM3709_199"
                     /product="carbonic anhydrase"
                     /protein_id="BAQ63434.1"
                     /transl_table=11
                     /translation="MKKIDFSRRNLLQLGALSLVSGSFITTMNKAISQEVVSQNEIQS
                     ELTPDKALELLLEGNDRFINNKVSNNNRSLSRVQQVAVGQNPFGILLSCADSRVPVEI
                     LFDRGFGDLFVVRNAGNIATSEEVGSIEFGSLVLGAKVILVLGHGNCGAVKAALEGNP
                     VPDNIQSILDVIKPAFNDLTPEQKKDIPTAIKANVKLQIETLKKSSVITKLIEENKLK
                     IVGGYYDLNTGKVSLI"
     CDS             complement(251578..252039)
                     /codon_start=1
                     /locus_tag="GM3709_200"
                     /product="2-hydroxy-3-oxopropionate reductase"
                     /protein_id="BAQ63435.1"
                     /transl_table=11
                     /translation="MVGATVEQFIQWESLLKNYSPNPILIGEVGKASALKLALNQMIA
                     GLTATFALSLTFLQQEGVSIETFMDILRSSALYAPTFDKKLSRMLDRNYDNPNFPIKH
                     LEKDINLFLTSAQNLGLNTESLEGINSIVSLVIKKGFANSDYSALIEAMKK"
     CDS             complement(252065..252433)
                     /codon_start=1
                     /locus_tag="GM3709_201"
                     /product="2-hydroxy-3-oxopropionate reductase"
                     /protein_id="BAQ63436.1"
                     /transl_table=11
                     /translation="MNRIAIFGMGLMGTPMTLKLAQGNIPVIAYNRTPVKLEPLKEVN
                     VPVTTNIQEAIEFGDCLILMLADFNGIQEVIFNSGVDLTGKTIIQMGTIAPNESKKVL
                     FEVEMRGGRIFRSTRIRKHS"
     CDS             252479..253699
                     /codon_start=1
                     /locus_tag="GM3709_202"
                     /product="membrane-bound lytic murein transglycosylase A
                     precursor"
                     /protein_id="BAQ63437.1"
                     /transl_table=11
                     /translation="MFLNQVKNHYCLCFNQFINILSLKIIIHNKNILNFMLLNIGLNL
                     FLNNPLLAQSVPLKLIESLPIKVVDEQLFTKDKQALIRAIDHSLSYLNTDKAKIVYEN
                     YTMAEFSRERVIASLRRFRQLLVNSTNAQQLQKVVEKEFRFYRSIGYDNQGTVSFTGY
                     FQPVYKASRQKTDIYRYPLYVKPSNFDSWQNPHPTRKDIEGEDGLGNNSILQGNELVW
                     LSDRLQAYLVQVQGSAQLQLTDGKIMTIGYNGATDYPYISLGKELIQDGKIPAEEMSL
                     PRLMTYLENNPDELDIYLPRNNRFIFFQETGGQPAKGSLNVPVTDERSIATDKSIMPP
                     GALALIYTRIPQVNNDKQLISPTVSRYVLDQDTGSAIKGAGRVDIFFGTGDIAKTKAG
                     LVDWTGDLYYLLLK"
     CDS             complement(253795..254034)
                     /codon_start=1
                     /locus_tag="GM3709_203"
                     /product="YoeB toxin protein"
                     /protein_id="BAQ63438.1"
                     /transl_table=11
                     /translation="MKNILLDIQAIEDLKWWIHQDKRIALKIMELIETLPDNPFSGKG
                     KSEMLRFNLSGFWSRRLTQEHRLVYEVKDNYIRIS"
     CDS             complement(254031..254294)
                     /codon_start=1
                     /locus_tag="GM3709_204"
                     /product="YefM protein"
                     /protein_id="BAQ63439.1"
                     /transl_table=11
                     /translation="MQTIHYDHFQENLTVVIDEISEKHQPIRLELSDSVRAIVLSEED
                     YNSMVETLYLLSNPVNAEKLLQAVNRTPDSATSWQQVKDELIG"
     CDS             complement(254349..256862)
                     /codon_start=1
                     /locus_tag="GM3709_205"
                     /product="mannose-1-phosphate guanylyltransferase"
                     /protein_id="BAQ63440.1"
                     /transl_table=11
                     /translation="MRAVLMAGGSGTRLRPLTCDLPKPMVPVLNRPIAEHIVNLLKRC
                     GIKEIITTLHYLPDVLRDYFHDGSDFGVNMKYAVEEEQPLGTAGCVKNIQQMLDDTFL
                     VISGDSITDFDLQAAIAFHREKGSKATLILTKVPNPIEFGVVITDSEGKIQRFLEKPS
                     TSEIFSDTVNTGTYILEPEVLNYLPPQEESDFSQDLFPLLLEMNEPIYGYIADGYWCD
                     VGHLEAYREAHYDALDRKVHLDYAYQETQSNIWIGENTYIDPSAIVESPCLIGHNCRI
                     GARAKIRSGTIIGDNVTVADDAELDRPIIWNGVIVGEEASLCGCVIARGTRIDRRSQI
                     LEGAVIGQLCNIGEEAQINTEVRVWPSKRIESGAILNINLIWGNIAHRNLFGQRGVTG
                     LANIDITPEFAVKLGAAYGSTLKSGSCVVVSRDQRSVSRMVSRSLMAGLMSVGIDIQN
                     LESTAIPISRTMTPHLGVAGGVHVRLHPDRHDYILIEFFDTNGINISKAKEKKIEGAY
                     FKEDLRRVQAMDIGDMSYPSQVLETYRDTFETQLNLEAIRNSNTKIVIDYVYSVSGAI
                     LPQLLAKFGCDAVVLNASLRQRAISTAERENLLFQLGHVVEALKANFGVQVSANGELL
                     VLVDESGIQIRGEELTALMVNTILTAHPRGTIVVPVNTSSAVEQIARRHDGKVIRTKA
                     NPTAIMEATQHNPNVVLGGSGDMGFIFPQLHPGFDAMFTIAKLIEMLTVQERSLTQVR
                     TDLPLVCHKSHSLRCPWKVKGSLMRYLVETESPENLELIDGVKIRQRHTDNWVLILPD
                     AGEPLIHIYTNSDSREWAEQNLQIYRARVQEFIMTQQSI"
     CDS             complement(257022..258344)
                     /codon_start=1
                     /locus_tag="GM3709_206"
                     /product="adenylosuccinate lyase"
                     /protein_id="BAQ63441.1"
                     /transl_table=11
                     /translation="MYLQKNKISVIERYTLPEMGGIWTDEYRLKTWLQVEIAVCEAQA
                     EVGNIPKEAVEEIKAKANFDVQRVLEIEAEVRHDVIAFLTNVNEYVGDAGRYIHLGMT
                     SSDMLDTALALQMVASLNLILECVEETIQAIRYQAQQHRYTVMVGRSHGIHAEPITFG
                     FKLAGWLAEMRRNRDRLIKLRQDIAVGKISGAVGTYANIDPRIESIACNLLGLEPDTA
                     STQVISRDRHAEFVQQIALVAASLERFSVEIRNLQRTDVLEVEEYFSKGQKGSSAMPH
                     KRNPIRSERITGMARIIRGNAIAALENVALWHERDISHSSVERVILPDSCILIHFMLK
                     ETTNLIQNLLVYPDNMARNMNIYGGVIFSQKVLLALVSKGMSREDAYRVVQSCAHQAW
                     NTKEGNFRHLIENNIEITQLLSDSEINSCFNPQEHLKNLDTIYQRLGI"
     CDS             complement(258620..260617)
                     /codon_start=1
                     /locus_tag="GM3709_207"
                     /product="hypothetical protein"
                     /protein_id="BAQ63442.1"
                     /transl_table=11
                     /translation="MIKFQKFNLSNNWQKLLLLISIFSSSPVFAQNIPSTTNSDSISS
                     QSTNIQASRPLNKVSKQEIDQMVRELEDLIYRVESTLITAEAKQNKYNAPMTSIADYV
                     LKNPPKSNSRTKENKIDIRYSNNLANQAIANAKQIAQDFPTLALQDYEQARQVWLEAR
                     RNLWDNYPVDRHLAQPEVRAIWLDRGTIVKAKSKEDLKPLFDRIAESGINTVFFETVN
                     ASYPIYPSRVAPEQNPMTRGWDPLQASIELAHERGIELHAWAWIFAAANQGHNRILGL
                     PENYLGPVLSRNPSWVLKDQKGDVFNRTPGFKKAFFDPANPQARRYIMTLLEEIATKY
                     DVDGIQLDYIRYPFQDGITKQQFGYTDVSRALFKESYGIDPKNITRSSPAWSQWTGFR
                     IKQISSFVEEASQNLKQKRPDLVISTAVFPMERKERLSTLQQHWEDWIYSEWVDMMVL
                     MTYALHTGTLEERTQGVYEFSMKNPSFIIPGIRLLNVPNSEAFDQLQSIRNMPSGGFA
                     LFAAENFNSGLQAMFKHTQGIPTETKEPLPHRQPFQSALVRYRALQKEWNFMLMNHQI
                     SIDPRSLKEWAQQADKLGDRFKQLAENPTQSNLTTTQKELSSLNMKLSKYLSQHKQEQ
                     PLQVQTWQNRLITLDNLLQYGERTIIANRSSKQIVNKLKFM"
     CDS             260984..261211
                     /codon_start=1
                     /locus_tag="GM3709_208"
                     /product="ferredoxin-thioredoxin reductase"
                     /protein_id="BAQ63443.1"
                     /transl_table=11
                     /translation="MKVGDRIKVKESVLVYHHPEHKKEALDIKGMEGELIEIVTEWQG
                     RPVSANFPYLVKFTKKFKVHFREDEIAVDDN"
     CDS             complement(261423..263120)
                     /codon_start=1
                     /locus_tag="GM3709_209"
                     /product="protein of unknown function DUF1400"
                     /protein_id="BAQ63444.1"
                     /transl_table=11
                     /translation="MSFFDRYFSRKLTAITLSILSLGVLDIKKVYSADNIFFVYSPLI
                     ATLRIDSLEEFATNGTVNQNLAFYLNLARVNEEQKVLFRKALTTPVKVDHVLISRLLN
                     TDEGERLLNYFGSVVNIPGGRNGRYILRGALIKAAMEENGLSLINVLRNLSVDVKVNI
                     RQALKYVAQVNLVIEGSDFFATEIANLALIEAESNPTVDFNKLKDIRQSGDFSVTNTR
                     LNLFDQKRNRRFYVELYQPEQLTPNNPVIVFSHGLSSRPEDFASIANHLASYGYVVAI
                     PQHPGSDIQQTKNFIAGFSRQIFILEEFIDRPLDVTFLLDELTRLNVSQFGGKLNLDS
                     VGVGGHSFGGYTALAVGGAKIDFDNLENSCKLAFGNLNNALLLQCRALRLPRKDYDFR
                     DPRVKAVFTANPVNGAIFGVNGLNQVKIPTFFGAGSYDPATPFAFEQARTFPFLNSQN
                     TYLQLQEGQAHVDFSQLDVGITDLVETVSNLTLPSPYLLEEYTNSMALSFFKVHLDND
                     ENYRVYLQSAYGKHLSEGQEFKTYIVTHKSVPPLKQKYQEFLQRNYDLIFGQQLLRN"
     CDS             complement(263367..264134)
                     /codon_start=1
                     /locus_tag="GM3709_210"
                     /product="hypothetical protein"
                     /protein_id="BAQ63445.1"
                     /transl_table=11
                     /translation="MQNFDLNNGNISLAKNYLEIKSELNNQGNFQGENNSNNDVNPKP
                     QLIPRPEYNPEYQLNSTTIINSTTEINNHNNNHHYHANNNHRLRDRISIFVDGNNMFY
                     AQQKNGWFFDPRKVIDYFSEESGFMLINAFWYTGLKDSQDQRGFRDALISLGYTVRTK
                     ILKEYYDDSSGRFSQKANLDIEIVVDMFNTVDQYDRVVLFSGDGDFERAIELLRSKNT
                     HITVVSTDGMIARELRNATDRYIDLNEIRGCIEKRDY"
     CDS             complement(264552..265388)
                     /codon_start=1
                     /locus_tag="GM3709_211"
                     /product="thiosulfate sulfurtransferase"
                     /protein_id="BAQ63446.1"
                     /transl_table=11
                     /translation="MSQTRTIVSAQWLKDNLDNPNVKIIDCRFRLSDSQWGYHQYIQS
                     HIQNSYYLHLNQDLSSPVELYGGRHPLPDSEVLGDKFAQMGIIHNETTIVAYDDSRFA
                     FASRLWWLLKYLGHDRVFLLDGGWQEWTNLNYPVSDQIPDPVSLGSFISQPRLDWVVD
                     INYVRQCQSFSETIIIDARSSDRYSGKFEPIDPIAGSIPGAKNVFWQDITTEQGFLKT
                     KEELESIWSPYKHDQEIIVYCGSGVTACVDIFALKTIEIDQCKLYVGGWSDWCSYPEN
                     FK"
     CDS             complement(265665..266000)
                     /codon_start=1
                     /locus_tag="GM3709_212"
                     /product="ribulose bisphosphate carboxylase small chain"
                     /protein_id="BAQ63447.1"
                     /transl_table=11
                     /translation="MQTLGKERRYETLSYLPPLTDQQIVKQVQYLLDQGFIPAIEFEK
                     DPLPTDHHWTLWKLPLFNAYSPQEVLNEVRECKAQYSDSYIRVIAFDNLRQCQTVSFI
                     VHKPNASRF"
     CDS             complement(266004..266417)
                     /codon_start=1
                     /locus_tag="GM3709_213"
                     /product="possible RuBisCo chaperonin RbcX"
                     /protein_id="BAQ63448.1"
                     /transl_table=11
                     /translation="MTYKQVVKDTAKVLQSYLTYQAVRIIINQLTETNPGQAIWLSEY
                     SDRKKIQDSDNYINDLMKENKELVLRILTVRQDLAEQIVEFLPEMVKTNIEQSNMEHR
                     RHLLERLTQTQSSSLMSSSVDEPKLESNQSENKEE"
     CDS             complement(266575..267993)
                     /codon_start=1
                     /locus_tag="GM3709_214"
                     /product="ribulose bisphosphate carboxylase large chain"
                     /protein_id="BAQ63449.1"
                     /transl_table=11
                     /translation="MVQAGSKGGFKAGVQDYRLTYYTPDYTPKDTDLLACFRMTPQPG
                     VPPEECAAAVAAESSTGTWTTVWTDGLTDLDRYKGRCYNVEPVPGEDNQYFVFVAYPL
                     DLFEEGSITNVLTSLVGNVFGFKALRALRLEDIRFPVALIKTYQGPPHGITVERDLLN
                     KYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFV
                     QEAISKAQAETNEMKGHYLNVTAGTCEEMMKRAEFAKEIGTPIIMHDFFTGGFTANTS
                     LARWCRDNGLLLHIHRAMHAVVDRQKNHGIHFRVLAKCLRLSGGDHLHSGTVVGKLEG
                     DRAVTLGFVDLMREDYVEEDRSRGVFFTQDYASLPGVMPVASGGIHVWHMPALVEIFG
                     DDSCLQFGGGTLGHPWGNAPGATANRVALEACVQARNEGRSLAREGNDVLREACRWSP
                     ELAAACELWKEIKFEFDTVDTL"
     CDS             268804..270729
                     /codon_start=1
                     /locus_tag="GM3709_215"
                     /product="phytoene desaturase"
                     /protein_id="BAQ63450.1"
                     /transl_table=11
                     /translation="MNSVISRRNLLKLFTVTGILGILGYSRLVKPQPTIHQWDTLTLP
                     RQLSKPKKVVVIGGGLAGLASAYELSNRGFEVTLLEKSPQLGGKIASWDIQVGDDTFK
                     MEHGFHGFFPQYYNLKSIVNEINIKDNFQSLDYYSVVFKGDKYKPENFLPSHSSFPWN
                     IVDLAISSQNSLHWGINLANPEHWRVFHAITSFKIPDSYYTLDNISVTDWAAKGIPQG
                     LFDLYFLPFAKSSLNAPDVLSTGELMQFFHFYFFGNPEGLAFNGTIDDMGTSLVNPIA
                     ENILKNGGKIITEANISKIQCEGDKISSIEFYQGDNISNVPFWVDINPLLQDNNYDYY
                     GAGDALFALAKDTDKAFSLSCTHQGCTVNKQENGQFLCPCHGAVYDRDGKVVNPPAQR
                     NLNTYKVVVKEDNRVKLVANTPKTTHQPEKIEADYFVMATDVNGLKHLFNLIEGEGET
                     CQQTKSQVTSLPLADPFAVARFWLDKDFDWQYSNFASLSGYKLTDSITLYHRIQREYK
                     QWAQKTGGSVVELHAYCYKEKEFPTQEAILATFQKELYEIVPELTNARILHQQLVNQK
                     NFSGYPPNSFKMRPQTETDIQNLMFAGDWVKMPFPCGLMERAVSSGLLSANAILYREG
                     LHRRDLLSVNPSGLFSI"
     CDS             complement(270985..271428)
                     /codon_start=1
                     /locus_tag="GM3709_216"
                     /product="hypothetical protein"
                     /protein_id="BAQ63451.1"
                     /transl_table=11
                     /translation="MDNWQNKLFEWLNNAQQELESFSAQINQDLQKNTEDWEKTFNEI
                     TEEVEDIFTSEFNQILIDVDHLMGNFLSFFFDEEYLQQHDRNLDIDEDLGFLFEDYKL
                     KPHPEKHPACVGCVNYHGQTYNGNLLVCAMHPYGWDDETCPDWKE"
     CDS             complement(271540..271863)
                     /codon_start=1
                     /locus_tag="GM3709_217"
                     /product="hypothetical protein"
                     /protein_id="BAQ63452.1"
                     /transl_table=11
                     /translation="MAESENLLQKAFYLGVGIASYAVEKASNKFQELKQQAEKIAITP
                     DFPQQLQKIADEMVNKGKITAEEARGFVDEIVQQSQNQAIKNDTSNPSSQPRPIEIIT
                     DDEDT"
     CDS             complement(271945..272112)
                     /codon_start=1
                     /locus_tag="GM3709_218"
                     /product="hypothetical protein"
                     /protein_id="BAQ63453.1"
                     /transl_table=11
                     /translation="MGKRVLLVQSLEILFLHGLDIFGNFNQYLIYVPQNFSGTFCLSR
                     SKTFVIILTKI"
     CDS             272086..273789
                     /codon_start=1
                     /locus_tag="GM3709_219"
                     /product="L-aspartate oxidase"
                     /protein_id="BAQ63454.1"
                     /transl_table=11
                     /translation="MNQQYSFPHSFDVIIIGSGAAGLYSALCLPNNLRVAIITKDKLK
                     KGASDWAQGGIAAAINPDDSSESHLQDTLKAGAGLCDVNAVKYLVENAVTSIQSLLKM
                     GVDFDHESNGELATTLEAAHSFPRVLHAADTTGRAIVSILRQKVLESDYIYVYEQAYA
                     LNLWLDEAKKDCQGVCLLYDNRIHWLKAQGVILATGGGGQVFAHTTNPTVSTGDGVAL
                     AWRAGAVLRDLEFVQFHPTALDIENAPHFLISEAVRGEGAHLIDNEKKRFAFDYHTDG
                     ELAPRDIVSRAIYSHLHKVSSDPVHDKVYLDLRPIPHDRIEYRFPNIINKCQQWGIDL
                     FSQPIPVSPAAHYWMGGVKVNLNNETSIGGLYAIGETASTGVHGANRLASNSLLECVV
                     FAESFRDFTIESKFTTEESSSLVYQRVEYDWLQEMSLIKEIREDLPITVWEGAGICRT
                     KVGLEKSIEQVIAWRSQLESLSICQWMMNLSSCQQYELVLPNAEENLKLAAETLNLMD
                     VAYLILKSALFRQESRGGHYRLDYPISDDRWQNHTLVQCNTWTQDNLTHVPHVNLNYA
                     S"
     CDS             complement(274034..275245)
                     /codon_start=1
                     /locus_tag="GM3709_220"
                     /product="carboxyl-terminal processing protease"
                     /protein_id="BAQ63455.1"
                     /transl_table=11
                     /translation="MSLVIILLFICTNVIYTPNAYAYTEEEKILLQSWRLVNEAYVDD
                     SFNNQNWWTIRQKFLKKPLHNREETYTAIKEMLALLDDPYTRLLPPENYHNLQITTSG
                     ELSGIGLQISINPENNQLEVVTPLPSSPAELAGIQPRDQIITIDGIDTQTLTLDEAAN
                     KIRGEIGTTVILEIKPQNQSTIKTYELKRDRLSLSAVSYDLDKSQPNYPIGYLRLNQF
                     SGNATKDLAHAMVKLEQEGAKGYILDLRNNPGGLLQAGIEIARLWLPPSTIVYTVNRQ
                     GILGSYDADGDAITDKPLVVLVNQGSASASEILAGALQDNHRAILIGEKTFGKGLIQS
                     LFELPEGAGIAITVAKYETPSHKDINKLGITPDRIVTQELISYFEIGTDKDLQYQEAL
                     TYLALEQETLK"
     CDS             complement(275318..276088)
                     /codon_start=1
                     /locus_tag="GM3709_221"
                     /product="methionine aminopeptidase"
                     /protein_id="BAQ63456.1"
                     /transl_table=11
                     /translation="MGNENIVLLSAREIDKMRQAGRLAAQLLEHLGKMVKPGISTYEL
                     NQEAEKWTKAKGAKSAPLGYGNPPFPASICTSVNEVICHGIPSKNQILKDGDIINIDV
                     TPIVEGYHGDTSKTFFVGTPSPEAKQLVEVTEECLYRGINAVRAGGRIGDIGAAIQEY
                     AESFGYSVVRNFVGHGIGRVFHTPPQIPHFGKKGTGKKLRPGMVFTIEPMINIGTWEA
                     DVLDDGWTALTKDRQLSAQFEHTIAITQGGVEILTKNS"
     CDS             276483..277166
                     /codon_start=1
                     /locus_tag="GM3709_222"
                     /product="hypothetical protein"
                     /protein_id="BAQ63457.1"
                     /transl_table=11
                     /translation="MNKSLQDYQYLYLHGFGSSPKSQKAIYFSKKYQEIGIKLKIVDF
                     NQPEFVNLTLTRQIHQVSEIIDNNPNQQFILIGSSFGGLTANWIGYKYFDHQMTQLDR
                     IKALILIAPALNFAKSWLPKLTPEMLNQWQEKGFIPVYHYGEKKELLLSYNFWEDLIT
                     YDDLIINHNIPTLIFHGTEDDTIPIEVSQEYAKSRPQVILKELKSDHSLNDCLEEIWL
                     TMKFFDGKS"
     CDS             complement(277305..279293)
                     /codon_start=1
                     /locus_tag="GM3709_223"
                     /product="multimodular transpeptidase-transglycosylase"
                     /protein_id="BAQ63458.1"
                     /transl_table=11
                     /translation="MVTFASFKELRHSRIFWYGFAVGFTINLGFLAFLISKWFQLNST
                     LPDNITNVVNYDRPNTLTIKAQDNTILAQFGDIAYDRKTITEIPEKLQQAFIAIEDSR
                     YYKHNGVDIQGIARASVANLQSGKVKEGGSTITQQLARIAYLDQDRSWERKLKEVIIA
                     QKIDHQISKEEILQTYLNVVYLGSGAYGVADAAHRYFSKSLDELTLGEIATLAGITPA
                     PSIYSPLENPESATTRRNLVLTRMAEQGYITPEEAQIAIETPLEIKSSPLKRQIKKAP
                     YFVDYVQKEMGKYVSRDKLAEGGIIVNTTLNPQWQETGEEIVENVIKRYGKWQKFQQG
                     ALVAIDPRNGEILTMVGGIDFANNQYNRVTQAQRQPGSTFKTFIYATAIAGGMSPYKN
                     YLDAPYVVDGYEPKNYGDSYRGDVSISQALTSSLNTVAVKSLIDVGWNPVIKVAEKMG
                     IESKLQPTYSLALGASEVNLLELTSAYGTLANQGQHLQVHGIKSIVNADGEILYQAKI
                     NPQTALDKDSANIMTWMLQQVVQSGTGIPAQIGRPVAGKTGTSDKARDLWFIGYIPQL
                     ATGIWVGNDDNKETWGSSAITAQMWRNFMLKATEKMPVETFGKPPGKLALDKATIKLE
                     PLKPRQSYHKVTIQQYTQNNDPPREYRRRRRRRRNYDV"
     CDS             279440..280867
                     /codon_start=1
                     /locus_tag="GM3709_224"
                     /product="hypothetical protein"
                     /protein_id="BAQ63459.1"
                     /transl_table=11
                     /translation="MTISIKKPILVAGVSLSFLLWIGESLKNSVNEAGDFSLLGLTLI
                     GSLWLFWQRKKNNKVINNYPLVVVNREDFDKKIAQIKYLLEDLITESPGHDLLNKFNE
                     KILIIDQKSQKKDLNLTIVSQNKITPQTLVNSLKQEFAENIVYSIESDIFNYTNYQSS
                     DDDNFNFKNLSLESDFILFILHGDITESEKKVIEKININQRILVLFNDIDYPLLEEKN
                     LIFENIKTKLKGIINAEFIIKIATNTQKVKVKKYIDKINYKEWEEVSQGQYNSLFNTL
                     RITFEKEKENLIIATSYRNSIDLEKEIRKELNIIRKQKALPLIEKYQIIAATATFANP
                     VSSLDLLATAAINTQMLIDLSAIYKQSLSVNQGKEISIELAKLMVKLGIVEVSSRMIT
                     TILKSNAVTFIAGGIIQGISAAYLTRLCGLSLIEYYEVAELKDNEGINLSVIKEKLQL
                     IFQQNRDNNFFNKFIQKTSLQFQNS"
     CDS             complement(280924..281622)
                     /codon_start=1
                     /locus_tag="GM3709_225"
                     /product="thymidylate synthase thyX"
                     /protein_id="BAQ63460.1"
                     /transl_table=11
                     /translation="MNYKDPLKDGKSKIELIDFMGNDLSIVNDARASFEKSSKELNEK
                     DIKLINYLITHNHTSPFRGVVFKFKVKAPLFIARQWYKHIVASNHNDEQLGWNEKSFR
                     YVAIDDSNEFYIPQVFRKQSKNNKQATIGSLDVEDNNLAISIYKQQCEASYKAYSQLL
                     ALGVGREQARGVLIPSVYTSWVWTVSLQALLNFIDLRRGEGAQSEIGAYAEAIVELIT
                     PIVPIAIQAWSSIE"
     CDS             complement(281798..283729)
                     /codon_start=1
                     /locus_tag="GM3709_226"
                     /product="ATPase components of ABC transporters with
                     duplicated ATPase domains"
                     /protein_id="BAQ63461.1"
                     /transl_table=11
                     /translation="MTIITVQSLKKDFGIKEILKGASFSIDDNDKVGLIGVNGSGKST
                     LLKILAGLEPHDGGEMVVKSGSKIIYLPQQPEIEANNTVLEQVFVYSGEQMQWIKEYE
                     DLSHRIAHADTITQEQLMGKLERVTEKINGANAWDLETNAKIILDKLGISDFEAKMGD
                     LSGGYRKRVALASALMAEPDLLLMDEPTNHLDAESVQWLQEYLQKFQGAIFLITHDRY
                     FLDQVTTRILEIDRGDMYSYSGNYSYYLEKKALAEESVASSQRKHQGVLRRELEWLKK
                     GPKARSTKQKARIDRVYEMKDKEFKQTQGKVEIDTPSRRIGKKVIELDNISKSFGDRT
                     LIKDFTYEFAPDDRVGIIGGNGVGKSTLMNLIMATIEPDNGKVEIGSTIHIGYFDQHS
                     DSLITAAQNEQRAIEYIKDVATYIETSDGSQISASQLLERFLFTPNQQYSPIAKLSGG
                     EKRRLFLLRMLISNPNVLILDEPTNDLDVQTLAVLEEYIESFKGCVIVVSHDRYFLDR
                     TVDTIFTFESNGNLRQYPGNYSVYLDYKKKQEKQLQEEKNANNKVVKQSKNVEVKDQN
                     FSTNIRKMSNYQRKELEKLETKIIPSLEIKKTEVETKLYIAKQDYETLNKLTLELANI
                     NQEIDIATTKWMELAELES"
     CDS             283949..284266
                     /codon_start=1
                     /locus_tag="GM3709_227"
                     /product="hypothetical protein"
                     /protein_id="BAQ63462.1"
                     /transl_table=11
                     /translation="MSHHREQNLDKFQLSLYLMPLFGPIWALINLKFFPYNLNSEQKK
                     TSRISLRLGLAWLITYSTLWAGGSLTSDLLSIRLLYFNGIITTTYFLICLILITRLWS
                     KKN"
     CDS             284322..284948
                     /codon_start=1
                     /locus_tag="GM3709_228"
                     /product="transcription termination protein NusB"
                     /protein_id="BAQ63463.1"
                     /transl_table=11
                     /translation="MSIRQQPRRTARILALLSLSQIKIKSDTLEDIEINDLILGAIRT
                     LTLEIESTIETASDELNRSNDHLFKSDTRATNIGSAKSMLKDAIVLTQKAINRIGNII
                     EIPEFVQLSRQHEVREYALELIGTVDRRKTEIEAILNEVMIDWTLNRLTQIDANILRL
                     AVAEMTFLNIEHKVAINEAIEIAKNYSDEDGYRFINGVLRKVSDKIKQ"
     CDS             285087..285503
                     /codon_start=1
                     /locus_tag="GM3709_229"
                     /product="hypothetical protein"
                     /protein_id="BAQ63464.1"
                     /transl_table=11
                     /translation="MRPYSLDLRQKIIHAREKQQCSIRQLAKNFGVAKSFVQKIIKQY
                     QETGDLKPRHSGGRPPKINPEQTVVLLEIINENNDATLWELAELFEKKTGLKLSTSTI
                     DRISRKFDDTVKKKHCMPQKNIVREFNKKDLNIGIK"
     CDS             285500..286039
                     /codon_start=1
                     /locus_tag="GM3709_230"
                     /product="mobile element protein"
                     /protein_id="BAQ63465.1"
                     /transl_table=11
                     /translation="MREINEEDLIFVDESGSNLAMLRLYGRAKKGYRVRGEKPQKRGG
                     NVSIVTAISLKEVVASRNIYGSVDGLTFEAFVIRDLVPKLWVGACVVMDNAKIHLGET
                     IRKEIEKVGASLVYLSPYSPDFSPIENFWSKVKNQIRKLKPRNYHDLVEAIGKAMEQV
                     TQLDMHNWFTHCCYCTSSF"
     CDS             complement(286101..286301)
                     /codon_start=1
                     /locus_tag="GM3709_231"
                     /product="mobile element protein"
                     /protein_id="BAQ63466.1"
                     /transl_table=11
                     /translation="MDNAPIHRKNKIKELVENAGHQVIFLPTYSPDFNDIEHDFSALK
                     RARMYSKEDISLDEIIRSYCDS"
     CDS             complement(286607..286948)
                     /codon_start=1
                     /locus_tag="GM3709_232"
                     /product="mobile element protein"
                     /protein_id="BAQ63467.1"
                     /transl_table=11
                     /translation="MYHNLELREKVIDDVENKGSVTKASRIFGVSRASIYRWLTRENL
                     KPTIVKYRHRKLNWSALYRDVIENPDDKLIERANKFGVTVPAISYAFKRMKITRKKNS
                     YAIEREIVQRE"
     CDS             complement(287083..287931)
                     /codon_start=1
                     /locus_tag="GM3709_233"
                     /product="oligopeptide transport system permease protein
                     OppC"
                     /protein_id="BAQ63468.1"
                     /transl_table=11
                     /translation="MFWRKFSKDKMAIAGLLTLIVIIVSILFLPIVYQTSIDKINFAQ
                     STLPPSWQHPFGTNDLGQDQLARALFGGRISLTVGISAMIVSIIIGTIIGSIAGYFGG
                     ILDNILMRLTDIFLSLPQLPVLLLIVYLFRDAIKEIFGAQIGIFVLVVFVIGLLNWMS
                     VARLVRGSFLQIKEREFIAAAKSLGANSGRIILVHILPNVFSVIIVAATLAVGNAIIV
                     ESTLSFLGLGFPPDIPTWGRMLYDAQNYLTSAPYMAIFPGLAIFFTVLSINYIGDGLK
                     DALNSK"
     CDS             complement(287967..288125)
                     /codon_start=1
                     /locus_tag="GM3709_234"
                     /product="hypothetical protein"
                     /protein_id="BAQ63469.1"
                     /transl_table=11
                     /translation="MTESLPNNIIDVNILRTMTAVNLKAMAKKRGIVGISKMKKDDLI
                     KVLSEKNT"
     CDS             complement(288106..288711)
                     /codon_start=1
                     /locus_tag="GM3709_235"
                     /product="chromosome (plasmid) partitioning protein ParA"
                     /protein_id="BAQ63470.1"
                     /transl_table=11
                     /translation="MNKTTNLSKLLFNLPENASEAVIDVNFASVLLNALGFEDQEIYP
                     QYPDGNGKFVDRAARKTVGDDVFLFTKTNPYLLLELKGKEINLAQGSPQYNSTVKQLK
                     QYLLAPNCRQAQWGMITNSIHLQLFRRHGKVVFPASECISLEEGNIDEIIADFRRQIE
                     KRNQALTITVYNNKGGVGKTTTSVNMAATLTLKRKYDRVFA"
     CDS             complement(288775..290115)
                     /codon_start=1
                     /locus_tag="GM3709_236"
                     /product="FO 2-phospho-L-lactate transferase like"
                     /protein_id="BAQ63471.1"
                     /transl_table=11
                     /translation="MVNSRNGRKKVNHLYKWLSPGILVKRWLLTSMIGILMTVLGLAI
                     WTKLTPIYRFLDFVIELLNKITNNIPSYISGPLVLIIGLFLLYWGQTRTLGSITEVLK
                     PNSDEDLIEVLWNYRRLNRGTKVVAIGGGTGLSTLLRGIKDYSANITAIVTVADDGGS
                     SGRLRREMGMLPPGDIRNCIAALADEEKLLTELFQYRFTAGEGLNGHSFGNLFLTAMT
                     EITGDLEGAIEASSKVLAIRGRVLPATLSDVTLWARFADGRVVEGESNIPEAGGKIVE
                     VGCNPSYPPATTAVIKAIQQAEYIIMGPGSLYTSIIPNLLVPEIREAIAKSSAPKIYI
                     CNIMTQKGETDSYTVSDHIRAIDQVCGGKIFDAVLVQGRSPSEEVLRKYALKHCHPVY
                     LDREEVVKLGRRIVQANIMSENQESTYVRHDPKLLGKVLFRWYSSTPRSKLFKY"
     CDS             290338..291720
                     /codon_start=1
                     /locus_tag="GM3709_237"
                     /product="hydroxymethylpyrimidine phosphate synthase ThiC"
                     /protein_id="BAQ63472.1"
                     /transl_table=11
                     /translation="MRTEWIAKRSGQANVSQMHYARQGVITEEMHYVAKRENLPVDLI
                     RDEVARGRMIIPANINHPNLEPMAIGIASKCKVNANIGASPNSSNIDEEVAKLHLAVK
                     YGADTLMDLSTGGGNLDEIRTAIIKASPIPIGTVPIYQALESVHGNIENLTPDDFLHI
                     IEKHAQQGVDYMTIHAGILIEHLPLVRNRITGIVSRGGGIIARWMLHHHKQNPLYTHF
                     DEIIEIFKKYDVSFSLGDSLRPGCTHDASDEAQLAELKTLGQLTRRAWEHDVQVMVEG
                     PGHVPMDQIEFNVKKQMEECSEAPFYVLGPLVTDIAPGYDHITSAIGAAMAGWYGTAM
                     LCYVTPKEHLGLPNAEDVRNGLIAYKIAAHAADIARHRPGARDRDDELSKARYNFDWN
                     RQFELSLDPERAKEYHDETLPADIYKTAEFCSMCGPKFCPMQTKVDADALTELEKFLA
                     KESEVVAMAK"
     CDS             291869..292723
                     /codon_start=1
                     /locus_tag="GM3709_238"
                     /product="shikimate 5-dehydrogenase I alpha"
                     /protein_id="BAQ63473.1"
                     /transl_table=11
                     /translation="MHIKGTTKLLGIIGDPIEHSKSPVMQNAAIEMLNLDYVYVPFEV
                     KKEDLEIVFKGFQAINLRGFNVTIPHKENVISFLTKITDTAKKIGAVNTVWLGGEGWH
                     GTNTDIDGFIAPLKELNRDWTKITPMVLGAGGASRAVIVGCEQLGCQEVRVIGRNLEK
                     LEALKDSFAYSNLNCQISVYSWDKLTNLIPDSELIVNTTPIGMYPNIDNSPLTKEQNR
                     LVKQNTIAYDLIYTPRPTLFLQQAQLQGAIIIDGSEMLVQQGAVGFEIWTQKQAPIEI
                     MRQALLNL"
     CDS             complement(292772..292975)
                     /codon_start=1
                     /locus_tag="GM3709_239"
                     /product="hypothetical protein"
                     /protein_id="BAQ63474.1"
                     /transl_table=11
                     /translation="MYMTPKSGVLLLLSCVTAIASVGSVFELSSGMPQLGQINTTIIL
                     FLSVPLTIVFFILAVMDARANLK"
     CDS             293314..293715
                     /codon_start=1
                     /locus_tag="GM3709_240"
                     /product="distant similarity with leukotriene C4 synthase"
                     /protein_id="BAQ63475.1"
                     /transl_table=11
                     /translation="MLLGTSIVTVSALLVYFVTIINVGRARFKYGVIPPAMTGDPNFE
                     RALRVQQNMLEQLILFLPLLWIFSYYVSELWGTILGVIWVFGRILYAWGYYQEAKKRA
                     PGFAISILSGMSLFLGCLISLGILVYQQIQL"
     CDS             complement(293800..294432)
                     /codon_start=1
                     /locus_tag="GM3709_241"
                     /product="glycosyltransferase"
                     /protein_id="BAQ63476.1"
                     /transl_table=11
                     /translation="MKKKSLIIFTRYPEVGKTKTRLIPALGAEKSADLQRLMTENTLK
                     KLDNLTNTIDLEINIYFSGGNIDLMKKWLGNKYSFYPQIEGDLGFKIYSAFEDNLKRG
                     KEQIIIIGVDCPDLDSQILQEAFLSLNNYDLVIGKAMDGGYYLLGLNMLEKILFTNIN
                     WGTSQVFSQTMSIAKKLNFTIHELPILRDIDRPEDLKYIGVSFTKEIIKP"
     CDS             complement(294618..294911)
                     /codon_start=1
                     /locus_tag="GM3709_242"
                     /product="mobile element protein"
                     /protein_id="BAQ63477.1"
                     /transl_table=11
                     /translation="MIFTGSLNAESFEGWLVKYLLPSLKEFSILIMDNAPIHRKNKIK
                     ELVENAGHQVIFLPTYSPDFNDIEHDFSALKRARMYSKEDISLDEIIRSYCDS"
     CDS             complement(295831..296613)
                     /codon_start=1
                     /locus_tag="GM3709_243"
                     /product="hypothetical protein"
                     /protein_id="BAQ63478.1"
                     /transl_table=11
                     /translation="MIANKSPASQAIELLIDLAQKGEIDPWNVQVIEIIDRFLAELGI
                     NESNNLDLQTTDLSRSGQVMLWASMLVLFKAETLEKLSQKPEEDEETECWEEDLEINE
                     NRRNFRNSDLDKQIKRRTSALPPKTRKVTLAELITQLREMESELEEKKVTHSLPLNKT
                     KKGYTRKQALRTITDLAHNENLTELAQQINDFLTENLVKNIDDSTIKLDQLVNCWQNH
                     KQDKVEDKVGVFWALLLLSSQSKVELHQEEFYQDLDIRLIDN"
     CDS             296799..298145
                     /codon_start=1
                     /locus_tag="GM3709_244"
                     /product="glycolate dehydrogenase"
                     /protein_id="BAQ63479.1"
                     /transl_table=11
                     /translation="MNILPTSEFNLSSENIKGFDLKNPPSQSLVDQCVHCGFCLSTCP
                     SYRVIGKEMDSPRGRIYLMNAINQGQASLDDSTAPHFDSCLGCLACVSTCPSGVQYDQ
                     LIAAVRPQVERNQPRNLWENFLRTIIFNLFPYPARLSLFLPLLWFYQISGLQTLVRKT
                     GVLKFFPRIASMESILPHINLKSLYKKYPYTIPAKGEKRYRVGVILGCVQRLFFDSVN
                     EATVRVLTANGCEVVIPQTQGCCAALPAHQGQENQAQSLARQMIDSFTDTQVDYIIIN
                     AAGCGHTLKEYHHILAEDLAYLSKAKDFVSKVRDIHEFLGEIGLNTDLLPITNDTVKV
                     VYQDACHLLHGQKISLQPRQLLQKIPNLELKEPLDNALCCGSAGVYNLLQPDVGNELG
                     EQKVRNLLSTGAKIIASPNPGCSLQISKHLQLQGKEIKIIHPIEFLDYSIRGEMIK"
     CDS             complement(298310..300382)
                     /codon_start=1
                     /locus_tag="GM3709_245"
                     /product="oligopeptidase A"
                     /protein_id="BAQ63480.1"
                     /transl_table=11
                     /translation="MTTVSNPLLIGEGLPPFNDIKSDHIVPAIEQLLTELDAELSHLE
                     AHFQPTWKGLVVPLNHIEERLRWSWGIIGHLMGVKNSPELRTAYETVQPQLVQFANKL
                     SQSKALYEGFTKIRYSQEWDSFESAQKRIIESAIKDAELSGVALEGEKKERFNQIQLE
                     LAELSTKFSNNVLDSTKAFQLRLTTPEEIDGLPASLLSLSAQTARSEGDEDATPENGP
                     WVITLDYPSYVPFLKFSNREDLREKVYRAFISRAGSGEFDNNPLITKILTLKREVAHI
                     LGYSNYAQVSLAKKMADSVESVEKLLEELRVVSYSAAQQELKELKEFAKIDNLNPWDV
                     SYWAEKQRETKFNFTEEELRPYFSLNQVLEGLFGLAKRIFGIIITPADGNAPVWHEDV
                     RYFQVANENNEVIAHFYLDAYSRPSEKRGGAWMDDCLGRAKFEQNGKIITRLPVAYLT
                     CNQTPPIDDKPSLMTFGEVETLFHEFGHGLQHMLTVIDYSGASGINNVEWDAVELPSQ
                     FMENWCLEKNTLFGMAKHYETGETLPYHYYEKLLASKNYMSGSAMLRQLHFSFLDLEL
                     HSRYQPDGKETPHQVRDRIAQTTTVMIPLSEDQFLCGFGHIFAGGYSAGYYSYKWAEV
                     LSADAFSAFEEVGLEDENSIAKVGRRFRDTVLALGGSLSPMEVFKQFRGRQPNTQPLL
                     RHSGLLMV"
     CDS             300551..300721
                     /codon_start=1
                     /locus_tag="GM3709_246"
                     /product="hypothetical protein"
                     /protein_id="BAQ63481.1"
                     /transl_table=11
                     /translation="MIIVFLAVFLIFILREITFNFIIGSFVSIFNLIGDYSEIVFFGI
                     IIVFLGWCFSDD"
     CDS             complement(300835..301239)
                     /codon_start=1
                     /locus_tag="GM3709_247"
                     /product="hypothetical protein"
                     /protein_id="BAQ63482.1"
                     /transl_table=11
                     /translation="MTLEVDQALKLLKEFSCVDVKLVESEIQKQQLQEALKLIVSLSD
                     DQNFGICASSVSQAFNTLKNYLQALEYNHNIEDNLSLENNPVYLKFSTERKSYNLSDY
                     QGKYRGVLITIFSDFNDRIVGTYGYLPLNLFS"
     CDS             complement(301477..304020)
                     /codon_start=1
                     /locus_tag="GM3709_248"
                     /product="cyanophycin synthase"
                     /protein_id="BAQ63483.1"
                     /transl_table=11
                     /translation="MRLDLEDVAEKPSNLIPGFYEGLVKILPSLVEHFCSRDHRGGFL
                     ERVQEGTYMGHIIEHIALELQELAGMPVGFGRTRETSTPGIYNVVFEYVYEEAGRYAG
                     RAAVRLCNSIITTGVYSPEELAQDLSDLRDLRANSALGPSTETIIKEAEARQIPWMLL
                     SARAMVQLGYGANQQRIQATLSNKSSILGVELACDKEGTKTTLAEAGIPVPRGTVIYY
                     LDELADAIADVGGYPIVLKPLDGNHGRGITIDINSQQEAEEAYDLASAASKSRAVIVE
                     RYYKGNDHRILVINGKLIAVSERIPAHVIGNGHSTIEELIQETNEHPDRGDGHDNILT
                     RISVDRTSMGVLKRQGFEMDTVLKEGEVAYLRATANLSTGGIAIDRTDEIHPQNIWIA
                     ERVAKIIGLDIAGIDVVTPDITKPLNEVDGVIVEVNAAPGFRMHVAPSKGLPRNVAAP
                     VLDMLFPNNHPSRIPILAVTGTNGKTTTTRLLAHIYRQTGKVVGYTSTDGIYLGDYMV
                     EKGDNTGPVSAGVILRDPTVEVAVLECARGGILRSGLAFESCDVGLVLNVAEDHLGLG
                     DIDTIEQMAKVKGVIAESVNADGYAVLNADDPLVAQMAKNVKGKVAYFSMNANNPIII
                     DHLRRNGMAAMYENGYLSIFEGEWTLRIEKAENIPVTMKGMAPFMIANALAASLAAFV
                     HGIDIELIRQGVRTFNPGADQTPGRMNLFDMKDFSVLIDYAHNPAGYLAVGEFVKNWK
                     GDRLGVVGGPGDRRDEDLMLLGKIASQIFDHIIVKEDDDNRGRDRGTVADLIVKGIVG
                     ENPQASYDVILDETEAIETGLRKVNKDGLVVIFPESVTRSISMIEKYQS"
     CDS             complement(304283..305101)
                     /codon_start=1
                     /locus_tag="GM3709_249"
                     /product="cyanophycinase"
                     /protein_id="BAQ63484.1"
                     /transl_table=11
                     /translation="MKQYLRSSVLVIGGAEDKVHGKEILQSFWHCAGGTDAIIGIIPS
                     ASREPTIIGDRYVSIFGEMGAKDLKVLDVRDRIQGEDKEYQEYVEKCTGIFMTGGDQL
                     RLCGLLADTPLMERIRQRVKLGEVTLGGTSAGAAVMGHHMIAGGSSGESPNRALVDMA
                     MGLGIIPEVIVDQHFHNRNRMARLLSALSNHPERLGIGIDEDTCAVFQKDEYIEVIGK
                     GTVTIVDGQAMSYTNHGKVAAEEPLALHNLRLHILGHGDRYNRKTHQPIAGRIE"
     CDS             complement(305304..305687)
                     /codon_start=1
                     /locus_tag="GM3709_250"
                     /product="hypothetical protein"
                     /protein_id="BAQ63485.1"
                     /transl_table=11
                     /translation="MKQNFQSKIININDSGFGCLLTFVIVSLVLGSIGLQWVVNGFLI
                     FIALLIITPIIGIWGFRWWLKRNLIEDECPVCNYSFTALNNTDCRCPNCGELLRVENH
                     QFIREIPPGTIEVDAIEVSSKILEE"
     CDS             complement(305665..305793)
                     /codon_start=1
                     /locus_tag="GM3709_251"
                     /product="hypothetical protein"
                     /protein_id="BAQ63486.1"
                     /transl_table=11
                     /translation="MNKTDDLKNVNFIFNVENVINENVKVNMTIIGDKKGETKFSK"
     CDS             306046..307014
                     /codon_start=1
                     /locus_tag="GM3709_252"
                     /product="7,8-didemethyl-8-hydroxy-5-deazariboflavin
                     synthase subunit 1"
                     /protein_id="BAQ63487.1"
                     /transl_table=11
                     /translation="MSKIITYSPAFTIVPTYECFNRCSYCNFRSDPYESPWLELHTAK
                     NMLSNLINKGIIEILILSGEIHPKSTRRQPWIRRIYDLAKLALSMGFLPHTNVGVLSF
                     EEMSLLKEVNVSMGLMLEQLTPNLLNTVHRHAPTKIPELRLQQLEWAGMLKIPFTTGI
                     LLGIGETLQERIESLKAIDKIQAKWGHIQEIILQPYVKGSQEELQGNSITISEIFEII
                     SIARDILPESITLQIPPNLIEKETTLLKSLELGIKDLGGIVPKDEVNPDYHHQNLMIL
                     AKTLNKAGWKLKPRLPVYPQYYSWLSNNLQRTIEDIIRKKPSDFVH"
     CDS             307057..307536
                     /codon_start=1
                     /locus_tag="GM3709_253"
                     /product="putative thylakoid membrane protein"
                     /protein_id="BAQ63488.1"
                     /transl_table=11
                     /translation="MILVNFFTFILTFILTFTTLINSVQALDYTKRDLFEADFSGQNL
                     SGSTFNKANLRSSNLSNANLQKVSFFGANMDSANLEGADLRNAVLDSARLTRANLHNA
                     ILEGAFATNTKFEKANIEGADFTDVILRPDVEEILCANAIGTNPVTGRNTRDTLYCE"
     CDS             307693..309999
                     /codon_start=1
                     /locus_tag="GM3709_254"
                     /product="ATP-dependent DNA helicase UvrD/PcrA/Rep"
                     /protein_id="BAQ63489.1"
                     /transl_table=11
                     /translation="MVDDKIDRDLKNKILSLVANLREGQKQLALWKGGKMAVSAVPGA
                     GKSHGLATAAAITIAKNKLHSNRQLIIVTYTRSATASIEKKVKEILTQELKLLPVGFS
                     VQTIHSLAVNIANRYPQLSQLEMENRTLTDINSSHPLIFDTVNQWVKNHPELYELLLK
                     GEKSLSDDESELLQRESILLNDILPKVAYNAISIIKSSDLTLNDSFYLPNNLSNPYPL
                     MTIAKGLYEEYQELMIKQQRIDYDDLILSALRVLKHDRAREILQEEVFAVFEDEAQDS
                     SPLQEKLLEILATDTQNNQTNFVRVGDSNQAINSTFTSADPKYFRDFCHQCQENNSFY
                     TMNQAGRSCQIIIDTANKTLTWVNNKIKAELVNKKVDDISSLIPFENQEIKPVIIAEN
                     STNINPQSEGKGLEIEYPKDIYQTVDLIKAKIIKLWDKKNKEKLENFAILVRENKQGK
                     FLYDYLKDLEKTHNLKVKLISDTDSYAKIPQEILSLLQFLDSPHSSQYLRKTLEIVTE
                     RLNLNLEDITSLSIYPEKFLYPTLIDCPQNEQVIKIKNECIKLLQARLELAPYQLIIF
                     LSLALKYDQLELATVQKLNERIKQEIKTNISLKSIIDTLKAIVNGEKFKGVEIEDEKS
                     YQKEGQLTIITMHKAKGLEWDYVFLPFLHENIIPGNGEGYMPKNASFIGKFNLADVTR
                     SILRSIVHHDKLDQKEMSIDEASLENNYQKKAEEYRLLYVAMTRAKKLLWMSSAKKAP
                     WRWGFFEDNGNKSQLQDQAPCPVIIALS"
     CDS             310001..311248
                     /codon_start=1
                     /locus_tag="GM3709_255"
                     /product="esterase/lipase/thioesterase"
                     /protein_id="BAQ63490.1"
                     /transl_table=11
                     /translation="MSFFIILFFALIGLFLSLWIIIPAPNLFLLPFGVAVPEISPFLV
                     IFNSLVLLLSIYLRESWYISIAISTISLILTLLPLIQIPNTIKKFDQEIELKLGEDYL
                     KSIPKSIQEKMRSDPFIWKDILRGIPQKKIRIKRGIEFAKFGETSLKLNIYQPLLEGK
                     YPTLIMIYGGAWRKGSPDSDERFSCYITHQGYTVITLDYRHAPKYHFPTQLEDINRGL
                     KYIKDNASHLNIDINNIAIMGRSAGGQLAFLTAYEPQEITFKALINYYSPINLTQAYQ
                     FPAVPDPINTRKVLEDYLGGKPDEIPDKYKQASPINHIKKNLPLTLLIYPERDHIVPV
                     KVADIISNKLTDFDNCHVLLTIPWAEHAFDAIFSGISNQIALYYTERFLAYALYSNIP
                     QFDIKLSMKGGGRREETGDSGNN"
     CDS             complement(311484..311612)
                     /codon_start=1
                     /locus_tag="GM3709_256"
                     /product="deacetylases"
                     /protein_id="BAQ63491.1"
                     /transl_table=11
                     /translation="MNLPVVSHSDYVTPLPDRHRFSMPKFKLLYELLLKDAIITSQ"
     CDS             311716..312852
                     /codon_start=1
                     /locus_tag="GM3709_257"
                     /product="hypothetical protein"
                     /protein_id="BAQ63492.1"
                     /transl_table=11
                     /translation="MNDSPIFISLIPNLMGGEGHIIPYHKSITKATKTLGWHHEVIYS
                     PEENLTLLPDNWYGCLKGNKLENDENFADKFKQVIIFSDSIRNYLKEKLVKNNSSQSY
                     IIFIERFIHLQLFALWLALLFLPKDNLYIWVLYRHNFHQHKTRFFYKILNKLLKNLVN
                     INNFSLFSDSELLANSMTKYFEEPLTVMPIPHTEFVEKIDNNKDNIICWWAGPPRSEK
                     GWDIIKKLSQCQTIFANKFTLVASKSADLIMINNGVKVILLDDNLPRKDYGYWLAKTD
                     IMLIPYNSIAYQERTSGVFTESVIAGNIPVTTVNTWMAEELLKFGLDQLILNWDNSEQ
                     VWEKINNIIKCKETKTKLKIMQKAYSQFHNLSNFANQFKISFMK"
     CDS             312944..313342
                     /codon_start=1
                     /locus_tag="GM3709_258"
                     /product="glycine cleavage system H protein"
                     /protein_id="BAQ63493.1"
                     /transl_table=11
                     /translation="MSLEYPDDLRYLDSHEYVRLDGEIATIGITAFAIEELGDIVFLE
                     LPELGDAIGVEDNIGTVESVKAVSEIYSPISGTVIDRNEMLIESPESIADDPYGEGWL
                     IKVRLDNPDDDLEDTLSADEYKSLVEPEDD"
     CDS             complement(313377..313997)
                     /codon_start=1
                     /locus_tag="GM3709_259"
                     /product="biopolymer transport protein ExbD/TolR"
                     /protein_id="BAQ63494.1"
                     /transl_table=11
                     /translation="MTQLSKESQVLEKKLSTNHHKFTTKPFKLWQDITEEEVRIEIVP
                     MIDVIFCILIYFILAAVGFSRQQALSLNLPKASTGTAQMREMLVVSLDNRGQLYLEKQ
                     PVSQVQLYSAIKNYHSLNPSGLMVLHASQEVRYSQVIEVLDMLKEVGGERVALATLPG
                     KSQAPTQTVDPYSGFNPYYPSYPDGSVTPQPVQPPVSPEPPPLPTN"
     CDS             complement(314322..314969)
                     /codon_start=1
                     /locus_tag="GM3709_260"
                     /product="ferric siderophore transport system"
                     /protein_id="BAQ63495.1"
                     /transl_table=11
                     /translation="MTLAELIEKGGVSIWPLLFLSILALGTIIERIWFWSKVLIKEEQ
                     ILNNIMDAATTNWGKVEEIASRYRNHPLGKFLNTPLQLDNPDPEVFHLALETAADDEL
                     ALMRKGDKILEGVIALSPLLGLLGTVLGLIRSLGSISLSDLGTASTSGVTQGIGESLI
                     STAVGLIVAITGVVFYRLFQAFWFNQVRIFRKAGSDLEVIYRQRWIQQEEQMGII"
     CDS             complement(315198..315740)
                     /codon_start=1
                     /locus_tag="GM3709_261"
                     /product="hypothetical protein"
                     /protein_id="BAQ63496.1"
                     /transl_table=11
                     /translation="MSSQSSKKTYKNVMEIFVDEEIQLQLANNRNLSLSANDLNLVEV
                     ATFALNRLPSLYASSQEGIQKQKAKGMVQLKPKVKQAVAQGFAAVVRDPLRKSTPLPS
                     EKTDTILDAKKTLTNLNDSFPKEELATLVDFMESFLQKVKREEITEQEVIKLFYLLDY
                     YGDENGDGLFFSNKKVIWVD"
     CDS             complement(315948..317759)
                     /codon_start=1
                     /locus_tag="GM3709_262"
                     /product="prolyl-tRNA synthetase"
                     /protein_id="BAQ63497.1"
                     /transl_table=11
                     /translation="MRLSQMLFQTLREDPAEAEIKSHKLLLRAGYIRRIGSGIYAYLP
                     LMNRVLQKISNIVREEMNATGAMECLLPQMQPAELWQESGRWETYTKAEGIMFSLIDR
                     QDRSLALGPTHEEVITTIAKEMIKSYRQLPTHLYQIQTKFRDEIRPRFGLMRGREFIM
                     KDGYSFHTSPECLKKTYQDMDQAYRNIFSRCGLKFQAVEADSGAIGGSGSQEFMVLAD
                     AGEDDIVYTEDGKYAANVEKAVSLPSDVIPSPFTTYEKKATPHTETIAKIASFLECSP
                     TNMVKNVLYQAVYDSGKTVLVLVSIRGDQDVNEVKLQNELVKLASNYQATTVLSLTVP
                     DRTAQGKWSTKPLPLGYIAPDLSDDYIAKSDQVEGNFLRLVDRTAVDLENFVTGANES
                     DYHVVGANWGKEFTLSKLIVDVRKAQVGDRSIHDPNQVLQTARGIEVGHIFQLGTKYS
                     QAMGATYTGEDGTEKPFVMGCYGIGVSRLAQAAVEQSHDKDGIIWPTSIAPYHVVVII
                     PNITDQEQVAVAEKLYTELNQAGIETILDDRDERAGVKFKDADLIGIPYRIVTGRSLK
                     QGKIEFVTRSTKESQDIAIEKVAKTLSEIIKNSYDFD"
     CDS             complement(317924..318961)
                     /codon_start=1
                     /locus_tag="GM3709_263"
                     /product="ABC-type Fe3+-siderophore transport system"
                     /protein_id="BAQ63498.1"
                     /transl_table=11
                     /translation="MKDSFIVIRSNRPSFSLWLDSRVPKTLVILTILSLIAITISISY
                     GEYYISPVDVIKTLWGFDTSSDFQFIINTLRLPRTLTAWLVGIGLAIAGCIMQTITHN
                     PLADPSIIGINAGAGLAAVLFIVVFPSLPIALLPFSAFIGGILVALAIYAVAWQGENS
                     IIRLILVGIGFNFIVSAITNIITTFGEINNVSQALIWLTGSVYGKTITQVLILSPWIL
                     IFTLVTWIMSKELNSLHLGENLGRGLGLPVQKTQLTLLISTVALSSASVSIAGAVGFV
                     GLIAPHIARFLVGNTHQGLIPVTGLVGGLLVVSADLLGRLLFTPLELPCGIITAIIGA
                     PYFIFLLSKSR"
     CDS             complement(319059..319316)
                     /codon_start=1
                     /locus_tag="GM3709_264"
                     /product="RelE/StbE replicon stabilization toxin"
                     /protein_id="BAQ63499.1"
                     /transl_table=11
                     /translation="MVWKIEFSRRVLKDAKKIKSANLDNNLKQLLDILKINPYQPPYE
                     KLSGNLKKYYSRRINIQHRLVYSIDEENKVIKIVSIWSHYE"
     CDS             complement(319300..319563)
                     /codon_start=1
                     /locus_tag="GM3709_265"
                     /product="RelB/StbD replicon stabilization protein"
                     /protein_id="BAQ63500.1"
                     /transl_table=11
                     /translation="MQVINASTARANLFGLVEQVNQDHLPRIITSKKGDAVLLSKEDW
                     DSLQETLYLQSIGGLVESLKQAELEDDWVSEDEFLRVLDGVED"
     CDS             complement(319639..320655)
                     /codon_start=1
                     /locus_tag="GM3709_266"
                     /product="ABC-type Fe3+-siderophore transport system"
                     /protein_id="BAQ63501.1"
                     /transl_table=11
                     /translation="MRVSLKSKNSSIPLVIPLIGAIVVLSLSFLASLTFGVADITWQD
                     LPQAFTAFDGSTSHLIITTIRLPRAIVALLVGGGLGVAGSLMQGITRNPLADPSILGI
                     NSGAVLAVVITTFLINEPSLNILAFFAFLGATISAIAVYFFASLGKNGLSPLSLTLAG
                     SAITVFCSSITTGILIVNQRTLDEIRFWLAGSIAGRDIELIKHIFPYFVIGLILALIL
                     ARQITILSLGEETAQGLGQNTLLIKIGAMVAVILLAGASVSLAGPIGFIGLIMPHLVR
                     LLVGNDYRWILPFSMVGGAILLLNADVMSRLIIKPQEVPVGLILPILGAPFFIYLIRR
                     RIRG"
     CDS             320831..321631
                     /codon_start=1
                     /locus_tag="GM3709_267"
                     /product="ABC-type Fe3+-siderophore transport system"
                     /protein_id="BAQ63502.1"
                     /transl_table=11
                     /translation="MKQISIRQLSLGYQNIKIINNLNLDIPQGKITILIGANGCGKST
                     LLKGIGRILKPRQGAVYLDGKAIHQLPSDKVAQSLGILPQNPTAPEGLTVKDLVIQGR
                     YPHQKWWQQWTLEDETQVNQALTLTGIQEFAHRELDTLSGGQRQRAWIAMTLAQNTEI
                     LLLDEPTTFLDLAHQIEVLDLLKELNHKLERTIVIVLHELNQAARYADYLVAIKQGYI
                     YAKGKPEEVMTSEIIKEVFGLHSHIIFDPITNTPLCIPIGGYQPMVKR"
     CDS             322367..322501
                     /codon_start=1
                     /locus_tag="GM3709_268"
                     /product="hypothetical protein"
                     /protein_id="BAQ63503.1"
                     /transl_table=11
                     /translation="MISYWKNEAALIAFAGEKWNVSVIPYGMEKFVKKCSVYHYESWD
                     "
     CDS             322630..323163
                     /codon_start=1
                     /locus_tag="GM3709_269"
                     /product="GCN5-related N-acetyltransferase"
                     /protein_id="BAQ63504.1"
                     /transl_table=11
                     /translation="MINFIKIREETSNDINLITEITKSAFKNHPYSNHTEHLIVKELR
                     KHNCLSISLVAEKEELLIGHIAFSPVEISDGTKNWYGLAPVSVKPEFQNQGVGKKLIR
                     EGLKILEQKNADGCVVLGEPEYYQKFGFKNNSNIQLMEVSQEFFLSLNFGTSTPKGQV
                     KYHPAFSVTSEDDRFYV"
     CDS             323365..323658
                     /codon_start=1
                     /locus_tag="GM3709_270"
                     /product="hypothetical protein"
                     /protein_id="BAQ63505.1"
                     /transl_table=11
                     /translation="MKINLQSLYGFYRNAIRNPKYRNWIILGTLVYVLSPFDISPDFF
                     PLAGQIDDFFLLSIMLTEVSQMVVTNLKNKKDKDKYSPNEPSKTVDVDAVSMD"
     CDS             324556..325305
                     /codon_start=1
                     /locus_tag="GM3709_271"
                     /product="hypothetical protein"
                     /protein_id="BAQ63506.1"
                     /transl_table=11
                     /translation="MFKNPDVLWLNTNPYLLRFNLPIIKYLSRHVNICQWEYSQTEDE
                     GTSLDIAIELLDDYISLLKKPVNLIGHSTCGLLGLLYAQKYPEKVKSLTILGVGINPS
                     LDWLSYYYLLRTNLYFSKERILSRLANILFGYHNYYYQKAFIGLLEKALLYSLSPHSL
                     YKRFNLSIEKISSPLMICGSENDQIVSWEEITKWKNYLKPQDILWQCPEGEHFFHYFQ
                     PSLVSENIINFLMSQVNTQPQLKEKELIINN"
     CDS             complement(325453..325929)
                     /codon_start=1
                     /locus_tag="GM3709_272"
                     /product="molybdenum cofactor biosynthesis protein MoaC"
                     /protein_id="BAQ63507.1"
                     /transl_table=11
                     /translation="MSNKLSHINSDGEANMVDVSSKSVTVREAIASGKIIMSKETFLK
                     IQEGNCPKGDIVNTAKIAGIMAAKQTSMLIPLCHPLLLHKIVVNIIPDESLPGYYIEA
                     IVKTKAETGVEMEALTAVSVTALTLYDMAKAIEKSLTITDIKLVSKTGGKSIINNG"
     tRNA            325984..326057
                     /locus_tag="GM3709_t2"
                     /product="tRNA-Arg"
     CDS             complement(326236..326982)
                     /codon_start=1
                     /locus_tag="GM3709_273"
                     /product="IMP dehydrogenase/GMP reductase"
                     /protein_id="BAQ63508.1"
                     /transl_table=11
                     /translation="MINNSKLAQAFSTKTALKVIAGLNNFDVANVSAICQSAEMGGAT
                     FVDIAADVNLIKTIKQLINLPVCVSAVEAQLLVSAVEAGADLVEIGNFDSFYSQGITF
                     SADDVLILTRETRALLPNVTLSVTVPHILALDEQVELAQALVSAGADIIQTEGGASSN
                     PNHSGVLGLIEKASPTLAAAYVISRGVEVPVMCASGLSDVTAPMAIASGASGIGVGSA
                     INKLNDRVAMIAVVRSLVEALNSSSLKVTV"
     CDS             complement(327144..327800)
                     /codon_start=1
                     /locus_tag="GM3709_274"
                     /product="phosphoglycolate phosphatase"
                     /protein_id="BAQ63509.1"
                     /transl_table=11
                     /translation="MTQKVLIFDFDGTLADSRKTLVHIANKLAGEFGFDRVTEDEIIR
                     LSNLSSREIVQQSPIPTYKIPFLLRRVKKELNQEIKKLQPFIGIKETLNSLKSQGFLL
                     GIVTSNIENNVLDFLKSNQLENHFDFIYSGSSLFGKDKIIKKVIQKHQLLTDHIVYIG
                     DETRDIEAAKKSKIKVVAVTWGFNSAHILAQHNPDFLIHQPQELTEIFNTKNIKISVE
                     "
     CDS             complement(327857..328807)
                     /codon_start=1
                     /locus_tag="GM3709_275"
                     /product="epoxyqueuosine (oQ) reductase QueG"
                     /protein_id="BAQ63510.1"
                     /transl_table=11
                     /translation="MINSKSIVTTEEIKEQALTIGFHKVGVTTVNYNIEKQEKNKQRL
                     QEWLDKGYQAQMAWMNNPKRQNIIECWPQAKSIVSLALNYYTPHQHSQKPNTAKISRY
                     GWGRDYHRVMTKKLKTLANWLKKQSNNVEVRYYVDTGPVQDKFWAQEAGIGWVAKNGN
                     VITTDYGSWIFLGEILTNIELRPDRPHTNHCGTCTRCLSACPTQAITEPFVVNANLCI
                     AYHTIENRQANLPPEITSKLNGWVAGCDICQDVCPWNQRFAKVTDVADFFPYPANLNP
                     TLTEIAQMTPLEWDQRFQGSALRRIKPEMWRRNAQVQIDN"
     CDS             complement(328985..329116)
                     /codon_start=1
                     /locus_tag="GM3709_276"
                     /product="hypothetical protein"
                     /protein_id="BAQ63511.1"
                     /transl_table=11
                     /translation="MDFITNLFSGLDLQVILQLTSVGFILIAGPVIVFILYALRGDL"
     CDS             329256..329603
                     /codon_start=1
                     /locus_tag="GM3709_277"
                     /product="Fe-S cluster protein"
                     /protein_id="BAQ63512.1"
                     /transl_table=11
                     /translation="MSQWLCVNNCGACCNLDPVDRPNLDEYLTSSELEVYMSMVGDDG
                     WCINYDQETRKCQIYDDRPRFCRVKPEVFLEKYGVPFNEFEEFAIDCCHQQIEGVYGE
                     DSKEMISYREQVA"
     CDS             329961..331529
                     /codon_start=1
                     /locus_tag="GM3709_278"
                     /product="lysyl-tRNA synthetase"
                     /protein_id="BAQ63513.1"
                     /transl_table=11
                     /translation="MFWADKIAESSQQPELVNDSKTPSGRVHVGSVRGVIIHDVMYRA
                     LKRAGKPVKFTYGVDDYDALDTIPHYLDKEKFAPYLGYPLCNVPSPDESSSDYAKYFM
                     REFLAVFEYLGVKAEIYYLRDLYRSGKLNPYIDKFLRHAQDVREVYKDVSKALRPDNW
                     YPFQVICENCGKIATTNVTDYDGEKVFYTCKEDATDWVKGCGHQGWVSPFDGNGKLPW
                     KVEWVAKWDLVGVTMEMAGKDHSQKGGSRDVANGICRKVLHKKPPFHSPYEFILVNGT
                     KMSSSKGVGSSAKDMADLLPPELLRFLMLRTQPKTVINFAPNYETITRLFRDYDNLLN
                     DYAQKSENNENIELDKTLLPLFYAQLDEEIKPYYTFDISTLISLLQVPHLDLKAEIIK
                     RSERPLNEYDWEKINQRIAVAKNWLENYADEEEKLVIYFDRVPEITANLTDEQKQYLS
                     TLKDILTMVEKWEGEELQTALFTATKQLGVSPNIAFPAVYYTFLGKEKGPKAGYLFSY
                     LDKDFVLNRLSEVI"
     CDS             complement(331713..332399)
                     /codon_start=1
                     /locus_tag="GM3709_279"
                     /product="urease accessory protein UreF"
                     /protein_id="BAQ63514.1"
                     /transl_table=11
                     /translation="MLMSKKLLLLLQLCNSSLPLGAYSYSEGLETLVEDQHLTDDKSL
                     KNWLLNELKYGSIRIESAIVVRAYQCYLIRDLNGLLYWNNWFTASRETAELRQQSWQM
                     GKSLLKLISSFDSEDEFLQEVINSLKLSGNYSIAFGIITAHWNIKIEDVLLGYLHNWI
                     SNLVNVGIKLIPLGQTQGQKLLLSLNEEISKQFESILSLKDEELSSCSWGLSLASIKH
                     EQLYTRLFRS"
     CDS             complement(332624..332797)
                     /codon_start=1
                     /locus_tag="GM3709_280"
                     /product="hypothetical protein"
                     /protein_id="BAQ63515.1"
                     /transl_table=11
                     /translation="MNNNQEKDLVSAGLTAAIGAGIITSYAVSQGQNPLVATGITVFS
                     ALLAVIIHQADLI"
     CDS             333045..334574
                     /codon_start=1
                     /locus_tag="GM3709_281"
                     /product="glucose-6-phosphate 1-dehydrogenase"
                     /protein_id="BAQ63516.1"
                     /transl_table=11
                     /translation="MFTLQENPLRIGLKQAKTPEPLILVIFGASGDLTQRKLVPALYQ
                     LKKEGRLPAEMTIVGVARREWSHDYFREQMREGIEEFSDGIGREDLWQDFADGLFYCA
                     GNMDEGESYQKLKAFLEELDVRRGTRGNRVFYLAVSPKFFPPAIKQLGAANMLEDPMK
                     HRLVIEKPFGKDLSSAQVLNRIVQKVCKEEQVYRIDHYLGKETVQNLMVFRFANAIFE
                     PLWNRNYVDNIQITVAETVGVEERAGYYETAGALRDMVQNHLLQLFALTAMEAPNGVN
                     ADSIRGEKVKALQSTRLADLKNLEKSAIRGQYTPGWMKGKPIPGYRDEKDVNPDSTTP
                     TFVALKLMVDNWRWQGVPFYLRTGKRLPKKVSEIAIQFKDVPLTIFQSAAQQTNPNIL
                     ALRIQPNEGISLRFEAKVPGSELRTRTVDMDFSYGSSFGMATSDAYHRLLLDCMLGDQ
                     TLFTRADEVEEAWRIVTPALTAWDAPSAPDSIPFYEAGTWQPPEAEFLLNRDGRRWRR
                     L"
     CDS             334666..336042
                     /codon_start=1
                     /locus_tag="GM3709_282"
                     /product="OpcA"
                     /protein_id="BAQ63517.1"
                     /transl_table=11
                     /translation="MTTPLVSLQAPKDVDLDYIDRELREIWQTYSGVGDGLTATRAST
                     FSFLIYEPEATQPLLALLGFYTGPVDGIGGPRTTSAIKAAQKSYGLEVTGLSSPKLLT
                     KLRAEFEIKQAKGKIDLADLASVKQYSPDIEGAGIADAIASINPCRIITLCPTTGKDE
                     GVKAQVSAYCPVNKRSANSLICCEYITVTGVSSAFERVGGVISELMIPELPKFMWWKA
                     GIDEDYPLFQRLLSECDRLIVDSSTFVRPEEELLKIGKLLDKDIPLIDLNWARLSAWK
                     ELTAEAFDPPERRSAIWEVDQVTIDYEKGNPSQALMYLGWLASRLNWQPVEYSYEAGD
                     YNITTVKLINPEGKEIQAELAGVPIADWGEVLGDLISLKLTSTNLDADCCTVLCSETT
                     GCMRMEAGGGAQSCRIQQVTSLADQSTETILSQQLQRWGKDVLYQESMVITTQILELW
                     LTYHLSST"
     CDS             complement(336366..337280)
                     /codon_start=1
                     /locus_tag="GM3709_283"
                     /product="transcriptional regulator"
                     /protein_id="BAQ63518.1"
                     /transl_table=11
                     /translation="MDRISCMQSFVRAVDLNSFSAVAREQNTTQPTISKQIASLEKYL
                     GVQLLIRSTTNLNLTEEGKRYYQYCQEILETVAEAEANLRGEEKARGILRLGCSVLFG
                     QMQIVPRLNTFIKSYPDVKIDLVMADHFVNIIEQGLDLLIRIGDRQDNSLITNRIGTT
                     RRITVATQSYFDQAGEPQTPEDLVNHHCIVYTHLATGNEWHFQGKEGIIKVKVGGYFQ
                     TDSSIAIRSAILSGLGIAVAPVWMFGDEIYQGNLKIVLQDYPPTSFPICAVYHRSRFY
                     PAKITSFINFLKSEFKLDPWVCDYEIMR"
     CDS             337405..337887
                     /codon_start=1
                     /locus_tag="GM3709_284"
                     /product="hypothetical protein"
                     /protein_id="BAQ63519.1"
                     /transl_table=11
                     /translation="MNFRLFASSLSALAISSTFLPIITPQAQAQMIMSFTVPFISNSG
                     IAGASGDTHFITLGVTGFSLESATISLPLDMGRSITAKVLDRNGTEIPSTIALTSGAV
                     TINFAQPVKPDNYVTIRLSGVDMSRMGGRVLYRVSAKLQEIGEEIPIGSAMVRLKDQT
                     "
     CDS             338056..338529
                     /codon_start=1
                     /locus_tag="GM3709_285"
                     /product="molecular chaperone"
                     /protein_id="BAQ63520.1"
                     /transl_table=11
                     /translation="MSLVRFYPLSDINSLHRQMNRLFDEITSWDNPTNTVLKPAIELF
                     DNQDSLSLKVLVPGIDKKDLDISVTREAVKISGEYRHHEENKENGYYVSEFNYGKFER
                     TINLPVAIQNEKVSADYKDGILTLNLPKIEEVKNKVFKVSLQENTQPALEANTAQ"
     CDS             339188..339418
                     /codon_start=1
                     /locus_tag="GM3709_286"
                     /product="hypothetical protein"
                     /protein_id="BAQ63521.1"
                     /transl_table=11
                     /translation="MKIMAILISLFIIGWLAASLIGTQAYFLGEQTKPIHQRNWDSES
                     FDQLAKSFTGKDTDYLVRIPAYSIDAYNATKN"
     CDS             complement(339550..340188)
                     /codon_start=1
                     /locus_tag="GM3709_287"
                     /product="two-component response regulator"
                     /protein_id="BAQ63522.1"
                     /transl_table=11
                     /translation="MKDIPSKKLLLIDDDPNLILLVKDYLEFNGYEVLTASQGMEAIK
                     ILEKETPDLIICDVMMPEMDGYTFVQEIRQNPRLDWLPVIFLSAKGQSKDRIKGLTQG
                     ADVYMVKPFEPDELVAQVRSTLNQSVRLMGSNPRKTENYPRIQVPKSVELTPTETKVV
                     DLVAQGFSNKDISQALGVSQRTIESHVSNMLNKTGLHNRTELSRWAIQNELV"
     CDS             complement(340233..340628)
                     /codon_start=1
                     /locus_tag="GM3709_288"
                     /product="ferredoxin"
                     /protein_id="BAQ63523.1"
                     /transl_table=11
                     /translation="MIEESVKNLGLSHIQRHVFLCCDQAKPKCCSKEDSLESWQYLKK
                     RLKELNLDHPTVENPYCIFRTKVDCLRVCVEGPILLVYPDGTWYRNATPNTIEKIIQE
                     HLIGNKIVEQYLFHQHPLPFSKIEEIVEE"
     CDS             complement(340979..342073)
                     /codon_start=1
                     /locus_tag="GM3709_289"
                     /product="D-amino acid dehydrogenase small subunit"
                     /protein_id="BAQ63524.1"
                     /transl_table=11
                     /translation="MSKVIVIGSGIVGSTIAYELSKYPDLDITLIDEKNPGTGATGAA
                     LGILMGIISHKTKGKAWRLREISLKRYDTLIPELETITGLEIPYNQQGIVKLLFSDDD
                     LTKWENLAHIRSTQGYNLSIWSQEELRNRCPEINVSFLLGAVYSPCDRQINPTFLTKA
                     LVKGASLRGVKCIFGEKVVSLTTIGEGNNRYCNEVNLENRSLSADWVILATGLGTSSL
                     IQSLGSNIAVKPVLGQALLVKHPRWQTPDNFSPVITGNDIHIVPMGNDELWLGATVEF
                     PDNLDRLIPNEELLMNLQKKAIEFCPSLASAPIMLSWTGKRPRPEGKSAPIIEKLDNY
                     HNIILATGHYRNGILLAPATALSVKELIDN"
     CDS             342737..343906
                     /codon_start=1
                     /locus_tag="GM3709_290"
                     /product="clock-associated two-component sensor histidine
                     kinase SasA"
                     /protein_id="BAQ63525.1"
                     /transl_table=11
                     /translation="MSLSHNESELFPNIPSINKNTNLQLLLFVDNRRSSQKNVEQIKN
                     YLQSLTVDYSFQLEVLEITKHPHLVEHFKLVATPALVKVTPPPQQTLAGSNLTAQLQK
                     CWYKWQNSLQDSNVSSFSSNESAFQTCLPSVDLIHLQDELFQLKQEVDQLKQQIQFKN
                     QMLTMLAHDLRSPLTAASIALETIELAQNRPDYCENRSLYNRLFQQAKNQFFIMNKMI
                     AHLLNSSKSISGQLNIVPKKVNLAMISEEIILDLQSKLREKKQHIIKEIPQDLPFVYA
                     DENLLRQVIINLLENAIKYSPCSAPIVLSIIHKTSQKIQVSIIDIGSGIPDTKKERIF
                     EDHFRLERDQQKDGYGIGLTLCRRIINAHYGQIWVDDNSNNNQGSCFRFTLPVYN"
     CDS             complement(343953..345962)
                     /codon_start=1
                     /locus_tag="GM3709_291"
                     /product="chaperone protein DnaK"
                     /protein_id="BAQ63526.1"
                     /transl_table=11
                     /translation="MGKVIGIDLGTTNSCVAVLEGGKPIVITNQEGSRTTPSIVGFGK
                     GNQRLVGQLAKRQAVTNAENTVYSIKRFIGHRWEETEGERRRVTYNCVRGKDNMVSVD
                     IQGKSYTPQEISSMILQKLKNDAETFLGETVTQAVITVPAYFTDAQRQATKDAGVIAG
                     LEVMRIINEPTAAALAYGLDKQDEDQFVLVFDLGGGTFDVSILQLGNGIFEVVSTSGN
                     NQLGGDDFDAVIVDWLIAKFNQQEGIDLRSDKMALQRLREAGEKAKIELSNLMETSIN
                     LPFITADESGPKHLELELSRPQLEDLIRPLIDDIVHPMEQALKDSGLRKEQINRIVLV
                     GGSTRTPAISAKIEEYFGSSVPIDRSINPDEAVALGAAVQGGVLGGEVRNLLLLDVTP
                     LSLGLETLGEVFTKVIERNTTIPTSRTQVFSTAIDGQSSVEVHVLQGERSMIKDNKSL
                     GKFLLTGIPPAPRGVPQIEVSFDIDVDGILKVSARDKGTGVEQSILITNTGALSSSEI
                     DSMRQEAERFASEDSRRLELVEIKKQLDSLMYSYQLTLDKNPHLVSNELRNNIELSRR
                     KLEEAIDSPTTPVKQVEELMKNFRTLVVNIGAQAYQSNQDPTVIGGFEQKDNTAYEEL
                     DSDDDFKSIEDEILSGLSQISEDPSEFDFDYDKDETITGDYETVD"
     CDS             complement(346046..346867)
                     /codon_start=1
                     /locus_tag="GM3709_292"
                     /product="heat shock protein GrpE"
                     /protein_id="BAQ63527.1"
                     /transl_table=11
                     /translation="MMSETDNYPDLEQEIEMADKQENSEPEQMMPDENSTTLKTDLTS
                     DQVSCHSEDLADESIEELTLEVESEPETTTSQENEQPQSCSIDEATQSYINQLEEEIT
                     ALKAKLETEIEQGKTFQGQYMRLTADFDNFRRRTTKEKEELEHVIKKRTIMEFLPVVD
                     NFERARTQIKPANDGELNIHKSYQGVYKTFVDSLKKIGVSAMRPEGQPFDPNYHEAML
                     REPTKEYEEGIVMEQLVRGYLLNNEVLRYAMVKVAAIHEEESENTETIENLSEDN"
     CDS             complement(347001..347675)
                     /codon_start=1
                     /locus_tag="GM3709_293"
                     /product="hypothetical protein"
                     /protein_id="BAQ63528.1"
                     /transl_table=11
                     /translation="MTHNLVHRLTEIQQSIPPHVRLIAVSKKVSIEAMRVVYHEGLRD
                     FAENKLQDAIVKQEKLRDLSDICWHFIGHLQTNKAKKAIECFPWIHSVDSLKLAQKLD
                     FYAQQALENSIIFQLPQVCLQVKVLPDENKYGWSVEHLYQDLSSLKFLNNLNVRGLMT
                     ILPLGLSSTQILSAFQTLRDLRDRLQNSFNSNFDQLSMGMSGDYLLAIEAGATMIRLG
                     TKLFVP"
     CDS             complement(347744..347896)
                     /codon_start=1
                     /locus_tag="GM3709_294"
                     /product="hypothetical protein"
                     /protein_id="BAQ63529.1"
                     /transl_table=11
                     /translation="MIIQPQETIFEPLSRTEARLLIEGKLRRLRSNGEWETYKQVNQL
                     YQRTFQ"
     CDS             complement(348396..349163)
                     /codon_start=1
                     /locus_tag="GM3709_295"
                     /product="putative stomatin/prohibitin-family membrane
                     protease subunit aq_911"
                     /protein_id="BAQ63530.1"
                     /transl_table=11
                     /translation="MEGILTILVPVIIFVLTGFKIDREYERGVIFRLGRMSSIKGPGL
                     YWTIPLVDQKAKVDIRTKTVEIKSQETITADSVTVKVNAVLYYRILDPNRAINKIEDY
                     TTAVYQAAMTTLRNVLGQNALDNILRNRDKMNIQIQEIVDEITEPWGVVIERVEMKDV
                     EIPQSMQRAMAQEAEAIREKRARLIKAAAEKDASIMLSEASQQMMNNPIALELRRLQT
                     LTEIGAENNTTTVMLVPTELITLTKQMADKLARESED"
     CDS             complement(349286..351808)
                     /codon_start=1
                     /locus_tag="GM3709_296"
                     /product="glycogen phosphorylase"
                     /protein_id="BAQ63531.1"
                     /transl_table=11
                     /translation="MTQETTSELYCTPTIKVEDDRTGMSPETLKRAFLDNLFYIQGID
                     RTQASNYDYYVALAYTIRDRLLHRFLKTTDTYKKNPQTKLVCYLSAEFLMGRYLGNNL
                     VNLDIYEEVEKVIAELGLDLNELIEQEPDPGLGNGGLGRLAACFLDSLASLEIPAIGY
                     GIRYEFGIFFQLLRDGWQGEMPDNWLRFGNPWELPRPDETVPVKLGGYTQGYYDSKGH
                     YRVSWIPDRTVLAIPHDTPVPGYKTNTVNPLRLWKAEASEEFNFEAFNAGNYDRAVEE
                     KINSETISKVLYPNDNTPAGKELRLAQQFFFVSASLQDLIRIHLRNNKNLDNFHERVA
                     IQLNDTHPAIAVAELMRLFVDEHGLDWDRSWYITQKTLSYTNHTLLPEALETWDVSLF
                     EKLLPRHLEIIYEINHHFLEDVRTWYPGNEELLSQMSIIGENNGKRVRMANLACIGSH
                     AINGVAALHTQLLKQETLNAFAFLWPEKFYNKTNGVTPRRWMVLSNPKLSQLITSKIG
                     EGWVKDLSQIQQIEKYIDDPDFCRQWRDIKQANKQRLADYIFKQRAIEVDVNSIFDVL
                     VKRIHEYKRQHLDVLNIITLYNRIKRNPDLNIAPQTFIFGGKAAPGYFMAKLIIKLIN
                     SVADVVNKDPDIRGRLKVVFLPNFNVSLGQKIYPAADVSEQISTAGKEASGTGNMKFS
                     MNGALTIGTLDGANIEIREEAGAENFFLFGLTAEEVAQTKAHGYNPRHYYENNAELKE
                     VIDRIADGYFSHGDTQIFKPIVDSLLYDDQYMLLADYHSYVECHKQVAVAYQDQEKWT
                     KMSILNSARMAKFSSDRTITEYCNEIWNVKPVKIELDTYNSN"
     CDS             complement(352058..352945)
                     /codon_start=1
                     /locus_tag="GM3709_297"
                     /product="methylenetetrahydrofolate dehydrogenase"
                     /protein_id="BAQ63532.1"
                     /transl_table=11
                     /translation="MVAQILDGKSLAKKVQSRLQVAIQEKIAEKKRPPGLAVLMVGDN
                     PASAVYVNNKEKSCQKIGMKSFGKHFPTNTTQEELTAVIEELNQDPNVDGILVQLPLP
                     DHFDSVALLHTIAPEKDADGLHPNNLGKLVRGEKGLRSCTPAGVMEILKEYNIELAGK
                     KAVVVGRSILVGKPLALMLLEENATVTIAHSKTHNLEEVTKEADILIAAVGKTEMITA
                     SMVKPNAIVIDVGINRIDTPDGKGRLVGDVDYNKVREIASYITPVPGGVGPMTVAMLL
                     QNTYESYKNQLIIDNPRGI"
     CDS             353283..353414
                     /codon_start=1
                     /locus_tag="GM3709_298"
                     /product="hypothetical protein"
                     /protein_id="BAQ63533.1"
                     /transl_table=11
                     /translation="MSDGIVPKVGDQISVEGILKYKEIVIEGEEFNEFYLQQISSEK"
     CDS             353426..353863
                     /codon_start=1
                     /locus_tag="GM3709_299"
                     /product="hypothetical protein"
                     /protein_id="BAQ63534.1"
                     /transl_table=11
                     /translation="MILLASLFSTFLISNSQLSPEFIELKKRLETYNFTVKIESPPVR
                     SAYGLLEIKTRTIWIEPLVFDLGIALPTLIHEATHAAQLCGGNGEIRALNLPFSPPNI
                     SRPFFTHYNHGLRRHLEAEAYAIQTHPDSYNLVLSLLDKHCKN"
     CDS             complement(353976..355034)
                     /codon_start=1
                     /locus_tag="GM3709_300"
                     /product="hypothetical protein"
                     /protein_id="BAQ63535.1"
                     /transl_table=11
                     /translation="MPSKYLLIASSEPYTGKSATILGIAHQLQNKGIKLGYAKPIGTC
                     FNPLDTVRDEQDLQFISQILNLPESQIKSPLLLLDEKTIVEYIDTKINYQEQLVEYCT
                     SIDADLVLLEGAGNLIQGNLFHLSAPEISEKIDASVLLVVKYEPLLIIDQILSAKQVL
                     GDRLIGILINSIPHQQLDILENTIKPFFKSQNIEVLGMLPTDRLLQSVSVRELVSQLK
                     AKVLCRNDRLDLMVESLTVGAMNVNSALEYFRQRQNMAVITGSDRTDLQLAALESSTN
                     CLILTGHTPPQQLILARAEDLEIPILTVDFDTLTTVEIVDRAFGTVRLHETIKVECVQ
                     NLIEEHFNIDLLLQKLNN"
     CDS             complement(355164..355805)
                     /codon_start=1
                     /locus_tag="GM3709_301"
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="BAQ63536.1"
                     /transl_table=11
                     /translation="MSIITNTLPTNLESIAHQSRVASISRTTKETDIQVQVNLDGEGK
                     CNVNTGIPFLDHMLHQICSHGLLDLDIQAKGDIEIDDHHTNEDVAITLGQAIAQAVGN
                     RKGINRFGHFVAPLDEALIQVALDFSGRPHLSYGLDIPTQRVGNYDTQLVREFFVALV
                     NHSQITLHIRQLDGINSHHIIEATFKAFARAMRMALEIDIRRIHEIPSSKGVL"
     CDS             355897..356670
                     /codon_start=1
                     /locus_tag="GM3709_302"
                     /product="hypothetical protein"
                     /protein_id="BAQ63537.1"
                     /transl_table=11
                     /translation="MPQHISIIIVFELRAILAGATRDWSQFSGLGICYIPQLVLEELE
                     FLTKRAVSETDEKTAREFLRFFPDSGWQVTQGMTHHDSLTGMEGEDMSKNARLQLAIA
                     ESIYYLSLENPHKLVILVANQQSLREEVDNLGQDNLISLTLPQFIQWLRTQQKPINVS
                     QKIASLSNGNVSYTSPANSSLVKNINNNGKGVSKNPENYSSKTKVKTKNKNNTLSFTI
                     SGLLATGGLIITMMVVWYFIQPKSFQKFWEKTGLPTLNN"
     CDS             357119..357991
                     /codon_start=1
                     /locus_tag="GM3709_303"
                     /product="hypothetical protein"
                     /protein_id="BAQ63538.1"
                     /transl_table=11
                     /translation="MGKIWELDFYSRPILDDNNKKLWEILICESPISIDTDVNSLFRY
                     SQFCSNNEVNSITLQKAIDTAIEKSGETPSKIRFFRRQMNNMIIKGCELAGVPVFSSR
                     HTYALNKWLEERNQDFYPQQSGYDEKSAQSTSVQYPQNNPINLPDAVKGDKKDKWALV
                     SLSAEDFAEMKEWDIGFAEAFPLSMINIQPHTLIPGLIIFSQRALPLAGWMSGLELGY
                     LRLDKGNFPKICLETGVSDSWILANLTDKATLAEGEGFEKAKKQASGVHFLGVQSSPE
                     SESFAGFWLLLDNQ"
     CDS             358036..358623
                     /codon_start=1
                     /locus_tag="GM3709_304"
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="BAQ63539.1"
                     /transl_table=11
                     /translation="MSQRTIIKGTGIPLIGNDIDTDRIIPARFLRCVTFDGLGEQVFA
                     DDRIALKGEHPFDLPQYQKAKILVVNANFGCGSSREHAPQAIARWGIEAIVGESFAEI
                     FFGNCLTMGIPCVTTSSGNIKSIQNLLHGNPDISMTLDLETLKIQCGHYSSSVKMDSG
                     ARSMLTTGKWDTCGLLTKNIDQIKATATKLPYLTW"
     tRNA            359045..359131
                     /locus_tag="GM3709_t3"
                     /product="tRNA-Ser"
     CDS             359469..360479
                     /codon_start=1
                     /locus_tag="GM3709_305"
                     /product="phosphoribulokinase"
                     /protein_id="BAQ63540.1"
                     /transl_table=11
                     /translation="MTQDRVVIIGVAGDSGCGKSTFLRRLEDLFGKEFMTVICLDDYH
                     CLDRKGRKEAGVTALDPRANNFDLMAEQVKALKNGQAIDKPIYNHETGELDPPERIEP
                     NKVIVIEGLHPLYDARVRELVDFSVYLDISEEVKINWKIQRDMAERGHSYDDVVASIM
                     ARKPDFTAYIEPQKQYADIVLQVLPTQLIKDEKEGKILRVRLIEKEGIPHFEPTYLFD
                     EGSTIDWRPCGRKLTCAFPGLKMYYGPDNYMGNEVSILEIDGQFDNLEEIIYVESHLS
                     RTSTKYYGEMTELLLKHKDYPGSNNGTGLFQVLVGLKMRETYEQLTGIAAKSEEKEVA
                     TV"
     CDS             360638..361636
                     /codon_start=1
                     /locus_tag="GM3709_306"
                     /product="adenylate cyclase"
                     /protein_id="BAQ63541.1"
                     /transl_table=11
                     /translation="MVNFTLKDNPITTADFAFNAIAKQINKISKYEQKILTEDDPENL
                     HQIRVGMRRLRSVLSVFDTALIIPSTVNEQKIGNIARILGKQRDLDILKINLECKFNH
                     ESLDQESKIIKKIIQKIDKPTSKKFDKNITDILKNKKYQHLKEDLFSWLENPQYNSIA
                     SRKIEQILPDLLLPQISTFFLQSGWLIGTEILDRGDIIIKQNLLDKDIYLLINQQGFN
                     LHKLRKEAKKTRYQLELFTDFYPEEYQTYLEFIVKVQEVLGEIQDHLCLHNHLTEVMG
                     NKWQKKLNNLHDLIVQDKLLKWQEWQDLQIKFFSGDFCHNLRHIINNISSNNIIKG"
     CDS             361696..362382
                     /codon_start=1
                     /locus_tag="GM3709_307"
                     /product="hypothetical protein"
                     /protein_id="BAQ63542.1"
                     /transl_table=11
                     /translation="MSIEQFTLLIHPFFAIVGVFPLVGIVSYFAWETRQRRLEVKAGD
                     KTKIPPSVGINHVKIGKWLSTAVITVTLIGFSQPIITKNILKEQLWQTNFFQFIFIVL
                     MFIFTIASFVLLFRARVKLWRGIFASLSGMGVIILGCQDGIFRRSNEWFWSHYYYGVI
                     VCLLMIFSVAIIDDIYRDKSHKWRNVHIILNCLALLLFIGQAITGARDLFEIGLWTPP
                     PALILPFIIL"
     CDS             362413..362973
                     /codon_start=1
                     /locus_tag="GM3709_308"
                     /product="hypothetical protein"
                     /protein_id="BAQ63543.1"
                     /transl_table=11
                     /translation="MQIIDQKLTLTEFLHLPETKPIKQYIDGEIIEKPMPQSKHSRIQ
                     LKLGMFIENIASKNKIASAFPELRCTFNNRSIVPDLSILKWDNIPLDSEGELIDKITI
                     APDWIIEILSPDQNSMKVTKNILFCLKHGCQMGWLIDTEDKSVLVYYSDKPTEYFDNF
                     NDKLLAPEFLSELTLTIEDIFSWLKY"
     CDS             363062..364402
                     /codon_start=1
                     /locus_tag="GM3709_309"
                     /product="ribosomal RNA small subunit methyltransferase B"
                     /protein_id="BAQ63544.1"
                     /transl_table=11
                     /translation="MNNPRQLAFQALQNIYQQKAYTDIALERVFSSTSLSSFDRHLVS
                     ELVYGIVRRKRTLDSLINQLATKKASQQPLNLRIIIQLGLYQLRYLDKIPESAAVNTS
                     VDLAKNNGLSKLSGVVNGILRSYLRLSLKEDPLILPSDFIPRLGVKYSFPDWLVSHFV
                     QEFNVKQTKKLLEWYNHSPNIDLRVNSIKTTREKLQEILLNNGIETTFLPNISQGLRL
                     TNSAGNISQLDCFKEGLFTIQDASAQMVSHFLNPQPNETIIDACAAPGGKTTHIAELM
                     QDTGIIIGCDRNLSRLKKVTENVERLKLKSIQLGEGDSSELTEWENKADRVLVDVPCS
                     GLGVLHKNPDIRWRKKPEEIKSLTELQLKIIENCSKWVKNGGILVYSTCTLNKEENED
                     IIARFVENNPLWQLVDKNNDSESNFSITSRGIVKIFPPVDDMDGFFMAKLIKGD"
     CDS             364406..364825
                     /codon_start=1
                     /locus_tag="GM3709_310"
                     /product="hypothetical protein"
                     /protein_id="BAQ63545.1"
                     /transl_table=11
                     /translation="MTKENQTKLLIKILVGTAWIDGVIQSQERKYLQKMVTENNLHED
                     ADIKSLLSEIKPVNPSQCYQWLEEYLGDNPTMRDYEDLLGSISALVYSDGDVHTQEAK
                     LLNRLQNLDPQTQSKKSILDQVLGSVKQLYKKAIADN"
     CDS             complement(365305..366339)
                     /codon_start=1
                     /locus_tag="GM3709_311"
                     /product="osmosensitive K+ channel histidine kinase KdpD"
                     /protein_id="BAQ63546.1"
                     /transl_table=11
                     /translation="MAPGVGKTYRMLQEAKNLKKEGIDVVIGLLETHNRQETIVQAEG
                     LEVIHRQSINQGNLTLTEMDTKAIIQRFPQLVLIDELAHTNIPGSLNQKRYQDVEEIL
                     IAGINVYSTLNIQHLESLNDLVAKITGVIVRERIPDRLLEEADEIVVIDVTAETLEQR
                     LLDGKIYAPEKIQQSLQNFFQRKNLIALRELALREVANTVEEAEESLSSKQCYLIQER
                     VLVCISTYPNSLRLLRRGARLANYMSVPLYVLFVENPDHFLTKTETLHIETCQQLCRE
                     FSGNFLRVKSYNVPTTIAEIAEQEKITQIVIGESQQSRWKQFFKGSFTQKLMKLIWKK
                     QIDLHIIATE"
     CDS             complement(366431..366970)
                     /codon_start=1
                     /locus_tag="GM3709_312"
                     /product="alkaline phosphatase like protein"
                     /protein_id="BAQ63547.1"
                     /transl_table=11
                     /translation="MFLENLFPPIPSELIMPLAGFTVSQGKMELIPAIAAGVIGTILG
                     AFPWYYLGIIVDEIKLEKLADQYGKWIFVSGGDINKANKWFNKYGNVAVLLGRLVPGI
                     RTLISLPAGINAMKMSSFVIYSTIGTLLWVSLLTGAGYVLGNNYVLVEEYIAPFSKIG
                     LLSIGFLFVIWVIRKQLKK"
     CDS             complement(367092..367913)
                     /codon_start=1
                     /locus_tag="GM3709_313"
                     /product="nitrate ABC transporter"
                     /protein_id="BAQ63548.1"
                     /transl_table=11
                     /translation="MVFPTENQIKSSTINSEDFLVVENVVKAFKKTDGSDYVVLNGIN
                     LTIGQQEYVSVIGHSGCGKSTLVRIVAGLEKPTSGMITLEGKRIRKPGADRMMVFQGY
                     ALLPWLTVRENIRLAVDEVFKTANKAEKISIVNEHIEMVNLTPAADKYPHELSGGMKQ
                     RVGVARALATRPKLLLLDEPFGALDALTRPKLQQQVIDIWENHRQAVMMITHDVDEAI
                     FMSDKVVMMSNAPNATIGKILDIPLPRPRYAHELRETPEYYELRNQALDFLEKYQ"
     CDS             complement(368011..369405)
                     /codon_start=1
                     /locus_tag="GM3709_314"
                     /product="nitrate ABC transporter"
                     /protein_id="BAQ63549.1"
                     /transl_table=11
                     /translation="MSKYQNRRFFLQGMGATAGTIAFYGCTHQQGKQPNKIPESALAV
                     EQIIKPETLEKPNLTVGFVPVNDCAPFAIAWEKGFFRKYGLNVTLSREASWANSRDGI
                     IFGRLDASPVVSGAVTNARLGAEGARKFPLCAAMTIHRHGNALTMNRKLWEGGVRPWN
                     TYNGNLDAFGQNLRNYWQKAPLHERVWAVVLSSAIYEYFVRYLVASVGLNPLDELRII
                     ITPPPQMVSNMRIGAMQAYMVAEPWNTRAISGNEGIGFTFAQGREIWRGHPDRLLAVQ
                     ESFIKENPKTYRSLVKAMIEACQYCSKQENREEVAKIISQRSFTGAKTKYTEPGIVGN
                     FNYGGFDDQPRIKKSLETTLFFDIPPEVSTVENDHSTFLWQSDGFWLMTQAARWGQIP
                     EFPKNAEEIVSQGWQTKLYRDIAEEMGIKCPKEDHKVVSGDAFIDGKSFDSSDPIGYI
                     KSFDIRANSPQIFG"
     CDS             complement(369410..370216)
                     /codon_start=1
                     /locus_tag="GM3709_315"
                     /product="nitrate ABC transporter"
                     /protein_id="BAQ63550.1"
                     /transl_table=11
                     /translation="MKAKKNNFLNFVTNSNFLLPIVGFVGVIALWWVIALFRGEMMPT
                     PPEALAKNLDFILNPFYRRGPGDLGLGWLLLASLRRVLIGFFLGAIVAIPVGFLIGMN
                     HSAWQIINPIIQVFKPVSPLVWLPIALAIFNSAEPSAIFVIFITSLWSTIMNTAEGVM
                     NIPKEYLEVADVLEMPRWKQLFKVVLPASLPYIFTGLRISLGIAWLVIVAVEMLTGGV
                     GIGFFVWDEWNRLNVSSVFLAVFVIGLTGLILDYALAQLQVMITHRPARG"
     CDS             complement(371153..372400)
                     /codon_start=1
                     /locus_tag="GM3709_316"
                     /product="histidyl-tRNA synthetase"
                     /protein_id="BAQ63551.1"
                     /transl_table=11
                     /translation="MSIIQAIRGTKDILPEEIIYWQFLEKTASEIFAKASYQEIRTPI
                     FEQTPLFERGIGEATDVVGKEMYTFIDKGDRSITLRPEGTAGVARSYIQNKLFASGGV
                     DRLWYCGAMFRYERPQAGRQRQFHQIGLELLGSNTPRADVEVIAIATDILKALGLKNL
                     TLQLNSVGSKEDRQNYRQALVDYFTPYKDDLDVDSQDRLSRNPLRILDSKDQKTQEIA
                     ANAPSILDYLENDSKNHFDKVSTLLSLLGISYELNPRLVRGLDYYTHTAFEIISSDLG
                     AQATVCGGGRYDGLISQLGGTPTPAVGWAMGMERLILLLEQLQPLKASTPDIYFISRG
                     EKAENQALVIAQQLRQDGFKVELDLTGSNFAKQFKRADRSGAKICLVLGDSEVEEETI
                     QIKNLGTSEQKTVSQENLILNLS"
     CDS             complement(372802..373572)
                     /codon_start=1
                     /locus_tag="GM3709_317"
                     /product="twin-arginine translocation protein TatC"
                     /protein_id="BAQ63552.1"
                     /transl_table=11
                     /translation="MTTQELEKKSQDKNEDYWNEIPNQTEAEMPFFDHLEELRQRIFV
                     SIIAMGIGAISCFFFVKKIVAWLEIPAGDVKFLQLAPGEFFFVSIQVAGYTGILISAP
                     VILYQIVQFVTPGLTRKERKTIAPIVFGSSILFFSGLAFAYYLLIPAALNFFVNYGGD
                     VVEQLWSIDKYFKFILLLMFSTGLAFQIPIIQLLLGTLNIVSSQQMLSAWRIVVLGGV
                     ILGAVLTPSTDPLTQSLLGGAVLALYFSGIGIVKLTGK"
     CDS             complement(373769..373885)
                     /codon_start=1
                     /locus_tag="GM3709_318"
                     /product="mobile element protein"
                     /protein_id="BAQ63553.1"
                     /transl_table=11
                     /translation="MRRNNELEKTITRLLNENKLEINWSKKFKNKENLINAS"
     CDS             complement(373891..374691)
                     /codon_start=1
                     /locus_tag="GM3709_319"
                     /product="leader peptidase"
                     /protein_id="BAQ63554.1"
                     /transl_table=11
                     /translation="MANFFIYLIIFIWGASIGSFLNVVIYRLPAKISLINPPSRCPKC
                     LHPLGITENIPVFGWLWLAGKCRWCHTSISPRYPLIEAITGFLFVLIFHQFGFTWLTL
                     GYSILLSWLIALAMIDFDTMTLPNSLTQSGLIIGLGWQTWLGFTIGGINSALQYLFIS
                     IFSTVIGIWLFDIIRVLGTIIFGKPAMGGGDPKLTAMIGSWLGWQGVLLTGFLACLLG
                     TIFGVCAIVFKLLKKGQPMPFGPFLVLGAISTMFWGDRILSTYLEYML"
     CDS             complement(374833..375867)
                     /codon_start=1
                     /locus_tag="GM3709_320"
                     /product="ribonucleotide reductase of class Ia"
                     /protein_id="BAQ63555.1"
                     /transl_table=11
                     /translation="MPLTPIFNPLGDDRIENRTIWFGNTTNLMQLNDVRYSWAIGLYQ
                     QMRENFWIPQKLDITQDVTDYWNLTNDERRAFEGILSYLTFLDSVQTCNIPHLKSAIT
                     APEISLCMAEQISQEGMHNHAYQYMIETIIPSDKRDQVYDFWRTDKVLSARCEFIAGF
                     YQKYIDNPTKENYFIALLSDYLLEGLYFYNGFIYFYNLAARMLMPGSADIFKMINRDE
                     LSHVRLYQKLIPEAMESFNYSLDQIYDMFNTAVEHECKWTNHIVGNNILGITESSTER
                     YTKYLANIRLRAIGLDPIYNNSQYSKSPYTHLEKFSDTKKEGNTKANFFESSVTSYVM
                     SSGVSGWDEI"
     CDS             complement(376082..376504)
                     /codon_start=1
                     /locus_tag="GM3709_321"
                     /product="blue-copper-protein-like protein"
                     /protein_id="BAQ63556.1"
                     /transl_table=11
                     /translation="MKKLLIIISINILFFCNFIIDVQANTDYEIIDVSLGNEQGQLIF
                     TPNELKFSTGKKYKLVLNNPSPEKHYFTAKDFADASWTQKVQAGKVEVKGAIHELELK
                     PEGIAEWVFIPEKKGSYDLYCSIKGHKEAGMKGIITIN"
     CDS             complement(376666..377538)
                     /codon_start=1
                     /locus_tag="GM3709_322"
                     /product="5'-methylthioadenosine phosphorylase"
                     /protein_id="BAQ63557.1"
                     /transl_table=11
                     /translation="MEAVTIGIIGGSGLYKMEALQNIEEITLDTPFGSPSDSLITGTL
                     DNTKVVFLPRHGRNHHLLPSELPFQANIYALKQLGVKYIISASAVGSLQKEIKPLDFV
                     IPDQFIDRTKNRQATFFGEGIVAHIAFGNPVCDKLGDVLAQAMKNLNLPDITLHQGGT
                     YICMEGPAFSTIAESNLYRSWGGSIIGMTNLTEAKLAREAEIAYATLALVTDYDCWNP
                     EHDHVTVETVIQNLHQNAINAQKVIRETVKLIADKPFVSTAHSALQTSIFTPLDKVSP
                     EIKEKLASILQKYL"
     CDS             377668..378546
                     /codon_start=1
                     /locus_tag="GM3709_323"
                     /product="dTDP-4-dehydrorhamnose reductase"
                     /protein_id="BAQ63558.1"
                     /transl_table=11
                     /translation="MICKIRFPLTLMKILVTGAAGSVGQIITNHLCKAGHQMIPVDFI
                     EPEKIIFADLRDEKVVFQLFDQYNPDLVIHLAAIKNIQFCEQNKELSHITNFGVTKLI
                     TEICQEYKARMIYFSTDYVFGKYDQFWQERDQPCPTTQYGKDKVASELFIQNKLRNHS
                     IIRTAQLYGIKNDFITLICNTLNCGNKLKAFTNLVNCPTWINDLLVMLDRIINQSQHG
                     TFHCVGPEALSRYDFAIKIATKLGLDTAYIEPVALDFSVDIRPSIVRLNGEKTYQTLG
                     FYPKTLTENLSKTTMK"
     CDS             378645..380204
                     /codon_start=1
                     /locus_tag="GM3709_324"
                     /product="hypothetical protein"
                     /protein_id="BAQ63559.1"
                     /transl_table=11
                     /translation="MTKKSFYIVIIKSFKYLILFVLALVFLLSVIFSLNKRMHYDLAF
                     MNYIAYLINEHEFVPYRDIFEINMPVSYLFHIAIGKLLGYSDIASNIANLIWLSIMVA
                     VTWLIMKQFDRLIAFTSCILFGCIYIQSNFYMERDMIAVLPIATTILLSIYLKNTNLL
                     KFKYFLIGVLFGVAAMFKPHLILGFPFLMIYNFINDFNNDKKNLILNYLKNTLLSLLG
                     FSLIIFICILWLWQIDALESFWQILSSYTPLYTRMTRELQSNYLSYLFNSYRSFGGYG
                     LLIVTSVLGVYIVLSEAFLEKTKRLSILLLFLAFIYSLYVVISGRFLGYHWAPYVYFT
                     SLCTALVLFNPKTSQKLDRILFPLIVFIFTVTLTIGSSVKSTIAQFIFKIPPQSNELY
                     FNQADEITNYLKKSLIPGSLVQPLNYCSGHLYGMLKSNAVIATPYIVDFYFYHHTSNK
                     YIKRLRKDFIQRLKTQMPTFIIRSLINEDSCVNYSLSTFPELYNFIEKNYTVDYASET
                     TIIYKNIKITD"
     CDS             380243..381460
                     /codon_start=1
                     /locus_tag="GM3709_325"
                     /product="methyltransferase"
                     /protein_id="BAQ63560.1"
                     /transl_table=11
                     /translation="MNCHGLSLKRFFDLGYQPNGNNFPRLYEFKQEQTFPFAMLVCTD
                     CWQVQIEEFPPVDSMFVNHPYVTGLNQPVVSHFEELVQEIIRKFQISSNSLILDIGAN
                     DGSLLTKFRDHGMRVLGIDPCKRSNQLASNMGIIVFETFWNKKSAEAIKSLGIRPDII
                     TATAVFYHIEDIHDFIQGLDMIMDENTIFCTQCVYLKDIIEKLQFDHFYHEHTMIHAI
                     APLKDLFAKYKMRLLDVDFYPIHGGSFVLYVARNDSPFVTSEKIENVIKDECRFGLHN
                     LKTYQEFFERVEKNKNDLLSLLRQIKMSGNNIFGLGAPLKGNTLLNYYNIGTDYLDYV
                     TEVNTYKVDRYTPGTHIPIIHEDSVKEQPDYYLILSWNFLDFFVEKYADYLNNGGKFI
                     VSHPKVRIVEKYL"
     CDS             381457..382173
                     /codon_start=1
                     /locus_tag="GM3709_326"
                     /product="glycosyl transferase"
                     /protein_id="BAQ63561.1"
                     /transl_table=11
                     /translation="MKISLIILFKNELEYAKVTLETVYGYLSERHIDFEQIAVDDSND
                     GTWDILQEFASLHPNNTIVVKGGEPSGYGKALQRGFGEANGDIIIPFNGDMCDSLDDV
                     IRYIQLIKAGNDMVFGSRFMQGSTINGFSNFKTLISRLGNLFLQVLFRVDCNDLTNSF
                     KAYRKDVLKEIQITSSGYSIGLEVALKAIQRKYKYTTIPISWSDRQYGQSKMSIVKSI
                     ISYLYVAYKQFFFPSIMAET"
     tRNA            complement(382285..382358)
                     /locus_tag="GM3709_t4"
                     /product="tRNA-Met"
     CDS             complement(382444..383256)
                     /codon_start=1
                     /locus_tag="GM3709_327"
                     /product="TPR repeat-containing protein"
                     /protein_id="BAQ63562.1"
                     /transl_table=11
                     /translation="MLKIIIVIFLCCFCFFQNPTLAEDNPSNTFTEEQLQEGENIAHQ
                     AILATENGDFIQAEIYWTQLVEKFPTNPAVWSNRGNARVSQNKLQDAIADYNESIKLA
                     PSAPDPYLNRGTAYEGLKEYDKAIADYEKVLQLDPEDAMAYNNLGNANAGLKNWKNAA
                     EYYHKASELSPNFAFASANESLALYQLGKKEEALKKMRNLVRKYPMFPDMRAALTAVL
                     WENGQQGEAESNWVATIGIDSRYKDLYWLKEVRRWPPNMVLALEKFLTLEND"
     CDS             complement(383332..383673)
                     /codon_start=1
                     /locus_tag="GM3709_328"
                     /product="histidine triad (HIT) nucleotide-binding
                     protein"
                     /protein_id="BAQ63563.1"
                     /transl_table=11
                     /translation="MNETIFSKIIRKEIPANIVYEDDLCLAFKDITPQAPTHILLIPK
                     KPLERIDSAKMEDQTLLGHLLLTVKKVAAEANLNNGYRVVINNGNDGGQTVNHLHLHI
                     LGDRQMQWPPG"
     CDS             383826..383969
                     /codon_start=1
                     /locus_tag="GM3709_329"
                     /product="hypothetical protein"
                     /protein_id="BAQ63564.1"
                     /transl_table=11
                     /translation="MNTPLPYLQLIQHFSEYIQPRDSGLIAYCHQAKKPSLRLEWLLL
                     QSA"
     CDS             384323..384853
                     /codon_start=1
                     /locus_tag="GM3709_330"
                     /product="hypothetical protein"
                     /protein_id="BAQ63565.1"
                     /transl_table=11
                     /translation="MKIIDSKGRLFGKVNILDLGAIAVILLVLIGIFIVPGPTGSIAQ
                     VGSGASDTIELNVLVRGLSVKDAPQFLASLKDTTVKIIVRNEPSGTLKIESVEELPNY
                     IIASQPDGSVKAVLDPRPIVAFSTDMLMLTSGKGQMTDDGAVLANQKIKIGTVLELDG
                     NNYNFRGSVIGVNKRN"
     CDS             complement(385087..385635)
                     /codon_start=1
                     /locus_tag="GM3709_331"
                     /product="hypothetical protein"
                     /protein_id="BAQ63566.1"
                     /transl_table=11
                     /translation="MPSKKSLNDIRKESSWLDTNFFLSLSLFFCTYAVVGWSIANLAN
                     KWAKIITEQNTIINLLIQEDLLPLIIKLSILFGTVFLSLILSSPLVLITIIFEESINS
                     DLKAFIAILFWSIVLVFVFCSFDYFSDLLVITSSNILLRLDLQKFNNNNSQVLFFIFV
                     MASIAFSVGFILFDFVSKGVVA"
     CDS             complement(385780..386265)
                     /codon_start=1
                     /locus_tag="GM3709_332"
                     /product="allophycocyanin alpha chain"
                     /protein_id="BAQ63567.1"
                     /transl_table=11
                     /translation="MSIVSQVILKADNELRYPSSGELQGIKTFLDSGLQRLKIAETLA
                     ENEKKIVEKASRELFRKRPDFRAPGGNASGQKQYNQCLRDFSWYLRLATYGVLAGDKE
                     PIEKIGLIGVKEMYNSLGVPLAGMIESIRCLKEASLALLSKEEGEETGPYFDYIVQFM
                     S"
     CDS             complement(386442..386999)
                     /codon_start=1
                     /locus_tag="GM3709_333"
                     /product="TsaC protein required for
                     threonylcarbamoyladenosine t(6)A37 modification in tRNA"
                     /protein_id="BAQ63568.1"
                     /transl_table=11
                     /translation="MHTDIVYLLLANALIPSSANKIHELKGWNPPKPLTLLSNQHKIS
                     EYAVLNQDAKILVNKFPYPISIIIPHRQNLPDVVTAGHKTIFVSCPDDFIYNLVTQSF
                     FPIVAGTASLGGELRANNADTAKDFFGDEVSLIIDGGKSKYGIRTTLIDCHLPLPTIL
                     NYGLISYDDLRPILPHIELPSHLRK"
     CDS             complement(387266..387679)
                     /codon_start=1
                     /locus_tag="GM3709_334"
                     /product="hypothetical protein"
                     /protein_id="BAQ63569.1"
                     /transl_table=11
                     /translation="MNASEQAKGLEITSKIASIVNLFKQYFPDGKADLKPWHNDPDTI
                     NLVDPDSIDIAFHFPGWSRKIQSRSILLQIRFHQDLVDNKQRLIGIETAGFNHTGEVW
                     RLSTVDNWQLEGRCLPTEEITNKLKEFCRDIFQLF"
     CDS             complement(387666..387782)
                     /codon_start=1
                     /locus_tag="GM3709_335"
                     /product="hypothetical protein"
                     /protein_id="BAQ63570.1"
                     /transl_table=11
                     /translation="MKTFNFYGLREFKIPVLLKHSTTNSILKKYNIKVYERI"
     CDS             complement(387854..388714)
                     /codon_start=1
                     /locus_tag="GM3709_336"
                     /product="hypothetical protein"
                     /protein_id="BAQ63571.1"
                     /transl_table=11
                     /translation="MLSRRYLLSILVFFGIFSFSPALKAQALLPYTPELNQDFFDNYG
                     SQLLQDAVQLTRFQEYELAVSRAKLAVQLSPNRYEPWFILGTLEIQSNNLEQGVKALQ
                     EAKKLAPQQADVLFSLGNSYFQVGDYEASVKELQAGLKINTEVPQSYFDLGNAYFKLT
                     KYSEAIASYQQAVKLEAEFWPAINNIGLIKYEQGKIDQAIESWRKALKIDSKQAEPTL
                     AIAVGLYAQGKQEEAVKLGQTALKMDNSYGSIEFLKENLWGEKLLNDTRKFFTNKDIE
                     PLVKKETSSN"
     CDS             complement(388892..389458)
                     /codon_start=1
                     /locus_tag="GM3709_337"
                     /product="hypothetical protein"
                     /protein_id="BAQ63572.1"
                     /transl_table=11
                     /translation="MYNSDDLQILDEMINDNSKLNLITNNKKKEVILKEIDGHEYSVT
                     IKNIPEETIVIKSDCFESPESIFKNTKRECKRCDFIIISYEENRKFIIFIEMKSGKGD
                     NKEIIQQLKGGKCLVKYFQIIGKEFWQNLNFLDNYNYRFVSFAKILVPMRSNKRKKDK
                     NIHDSPENMLKISSPKTIVFSKLIGQLS"
     CDS             complement(389464..390798)
                     /codon_start=1
                     /locus_tag="GM3709_338"
                     /product="hypothetical protein"
                     /protein_id="BAQ63573.1"
                     /transl_table=11
                     /translation="MKIKIKNLGIFKQAEFTLGDLTIICGKNNTGKTYVTYSLFGFLN
                     FWHNIISCEIEQTDIEKLLREGIVHINLGKYLDNSQQIIEYGCRKYIDLLPFVFSSPE
                     NSFKNTSFSIDIDLGKNQLNQKYEEFIGSTNKQIFSLEKKEDSKELVITLLSENKEIE
                     ISENVIKKIISSIIKNIVFSQFFPNPFIVSAERTGTAIFRQELETPRILLHEAKTIKY
                     PLAVKKNIEFIKDLDIIVKQDSFIIKEYPDILNDFTNIIGGIYNINKNDQIYFVPTGK
                     KIKLSMDESSSGVRSLLDLGFYLKHIAKKGDLLIIDEPELNLHPENQRLIARLLARLI
                     NLDIKVLITTHSDYIIKELNTLIMLNQDKPYLQEIALREGYRKEELLSPNQLKVYIAK
                     EELISLDNRQRRTRCQTLVEADITPDLGIEVSSFDDTIETMNRIQDEIIWGE"
     CDS             complement(390888..393518)
                     /codon_start=1
                     /locus_tag="GM3709_339"
                     /product="ClpB protein"
                     /protein_id="BAQ63574.1"
                     /transl_table=11
                     /translation="MQPTDPNKFTEIAWDAIVRSQDICKELKNQNLEVEHLILALLEE
                     NTIATKIFSQANIDTTLLNKQLQTFATRQPRMFSVNQLYLGRSLDSMLDRAEICRESW
                     QDEFIGISHLLVAFSEDQRIGKKTLKSFNIDPQDFQIKVKDFKTKIEKEEAQTTEPEE
                     TTEKEPPLTKFGRDLTEEAKAGKLDPVIGRDDEVRRVIQVLSRRSKNNPVLIGEPGVG
                     KTAIAEGLAQRIVNGDVPESLKNRQLISLDMGSLIAGAKYRGQFEERLRSVLKEVINS
                     DGQIILFIDELHTVVGAGSREGGAMDAGNLLKPLLARGELRCIGASTLDEYRKHIEKD
                     PALERRFQQVYIKQPSVEDTISILRGLKERYEVHHGVKITDSALIAAATLSHRYITGR
                     FLPDKAIDLVDEAAAKLKMEITSKPVELEVLDRRLMQLQMEQLSLQGEEKNDKSAQDN
                     LERITAEIDDLQIKQRELSSQWLIEKELLDEIHALKEEEKELRLQVEQAERAYDLNTA
                     AQLKYGKLETLQQDIESKEVKLLEIQSQENAMLREDVTESDIAEIVAGWTGIPVNRLL
                     ETERQKLLELESHLHDRVIGQNEAVAIVSAAIRRARAGMKDPSRPIGSFLFMGPTGVG
                     KTELARALAAFLFDSEDAMIRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLSEAIRR
                     RPYSVVLLDEVEKAHRDVFNILLQVLDDGRITDSQGRVVDFRNTIIVMTSNIGSEYIL
                     KLAGDDKNYEAMKDKVLVALNKHFRPEFLNRIDDLIIFHGLKKEELREIVSLQLVRLQ
                     KLLGEQNISIELTPEAQDYIVDVGYDPTYGARPLKRAIQRELENPLATKILENTFTEG
                     DKVMVTFEDDRLVFNKSLDS"
     CDS             complement(393667..394599)
                     /codon_start=1
                     /locus_tag="GM3709_340"
                     /product="C-1'-hydroxylase CruF"
                     /protein_id="BAQ63575.1"
                     /transl_table=11
                     /translation="MIEKCNLRGEKPLFKDIFREKEGYFLISHVVAMIFGLAGLLLVL
                     PHPEFIASLPEIGQWAFSWSMIGGGVVYMILGWAAIAIYAYRQLGTFHWLAFMIPALG
                     ISLISELLGTSTGFPFGAYHYLSGLGYKISGLVPFTIPLSWFYLGFSSYLIARVGLNK
                     LAIHSWLKDLGSIVFGSLLLMSWDFVLDPAMSQTTVPFWLWDQPGEFFGMPYQNFIGW
                     FGTGFIFMTVATYLWNLKPLDFDNISLTIPAGVYIGNFGFAMVMSMGAGFYLPIVLGI
                     LLGILPLVVFLWLANQNNNQEKNASAETLASVPQ"
     CDS             394550..394699
                     /codon_start=1
                     /locus_tag="GM3709_341"
                     /product="hypothetical protein"
                     /protein_id="BAQ63576.1"
                     /transl_table=11
                     /translation="MSLNKGFSPLKLHFSIMKITEIGKIKFILHILQIFIKFYVESYQ
                     NLLDR"
     CDS             complement(394813..396450)
                     /codon_start=1
                     /locus_tag="GM3709_342"
                     /product="cleavage and polyadenylation specificity factor"
                     /protein_id="BAQ63577.1"
                     /transl_table=11
                     /translation="MIRRQEILSIPQVPLSCYPFGVGNYTEGVAILLQIGNYRILLDC
                     GIADIDCFSPSNQPPANWVFCSHAHQDHARSLLSLHQQFPKLPIYTSDVTAKLLPLNW
                     LEENNTNSFAQVLPWRSPISLQSDLTVELYPAGHLPGAACFLFQYSYNNRVYKIFYTG
                     DFCLSNLQLVEGLSLDSLRGLNPDVLIVEGSYGTARHPHRRQQEKHLMERIKTALNSN
                     INVILPVPTFGLGQELLKLLRSHHQFTGTNLDIWVDGDLPTACDLYLELMDYFPANVQ
                     NFAKHQSLFWDDKIKPRMRRVTEVSSRHDLTISPSIVLTDKLSHLQEYCGKSREKWLV
                     LIPEQSKINHSSIFQEFTTNINPKNILVENYLLAEHSDGRNTTQLVHNLRPQHIVFIH
                     GSPNYLADLTSLEELQNRYQLHSPSVGITVDLPIGAQFMQPKVTPQTNYEGELNETGA
                     YITITLPEQINRDPRWQNFADTGLVEARWQGEELVLRGLSQRELLQQNSILRRQLNPE
                     SCGNCIYYREQICSNNDSPLNTLKVPADGYCPLFEGI"
     CDS             complement(396463..396585)
                     /codon_start=1
                     /locus_tag="GM3709_343"
                     /product="hypothetical protein"
                     /protein_id="BAQ63578.1"
                     /transl_table=11
                     /translation="MDVKILIVILTGLFIVSALFFGTRNGFYDTDDYDGNGSAH"
     CDS             complement(396964..399438)
                     /codon_start=1
                     /locus_tag="GM3709_344"
                     /product="hypothetical protein"
                     /protein_id="BAQ63579.1"
                     /transl_table=11
                     /translation="MKKQIIWISISLIITIFFPKSIEAAEKINLVYNSLVFSISIDSL
                     EHFAKTGELKSDLKQYTSSLDEKTLAEIRFFLNKNYNFDKIIVSKLSHTSLGEDLLTE
                     LGKVISTHRDKNGFYAIRGAILTTANQQSSWTILDVLRNFPASGVFVNLELLAQLKDD
                     MFSYQSYRDAIAKSIELQANTEKAQFANTNLNTLENLSQKGKYQVSQETIMVERQDLR
                     QTTQGFVREYSFEVDVYFPQNQEEKKPLILISHGFGSLKENFVNLAQHLASYGFIVAV
                     PEHIGSNLQYREELLKGTLSSALSPVEYIARPQDISSVIDKIKELASKQEIWQKRVDF
                     SKIGAIGDSLGGTTVLSLAGAPLNIARLKTECQQNQVIVNTALILQCQASHLPPVEYN
                     LQDSRIKAIISTHPLTSAIFGPESLSKIKIPIMITAGSNDVITPVVIEQIHPFLWLKS
                     PFKYLLFFQPGTHFSSTQPIPEYTLNNMPEVLIGKNRAITSQYFYGIAVAFMEAYLNN
                     NQKYLAYLTANYGDFSGSENFKVSQISNLTPDNIIQVYGNNLPLQIIPPLVVSFPLEN
                     DDRSIIEDIKSNGILKVAYPQNSPPFGYINNEGYWEGYCGFLGDELATYLQTQLDLSL
                     KPDIVFLPSNLNNRFDLVKTNQVHLECGANSMIKTFEDASFSIPFFVTGNYFLIPKAL
                     DNKFNTNQSLQNFRIGVIKNTSTATFLAEKYPQVKPIYFNELEGFKEEIKALENNSID
                     AIIDSRILLENQLSSLKNPKEYQIVPSLPLNCDYYGLLLPKQDKEWIEIVNSFLTKTP
                     LREKYFLPEVETNLVKTLNYCLNQSK"
     CDS             400140..402650
                     /codon_start=1
                     /locus_tag="GM3709_345"
                     /product="phosphoenolpyruvate synthase"
                     /protein_id="BAQ63580.1"
                     /transl_table=11
                     /translation="MINTAPEKISTTTKQEKFVLWFEEVGIEDVPMVGGKNASLGEMI
                     QQLTAKGVNVPTGFATTAYAYRYFIKKAGLEDQLRKIFANLDVEDLPNLQTVGRQARA
                     LVLNTPFPKELELAISDAYFKLCQRYGADPTLCTTEDEEEMMRLRNCSYDTDVAVRSS
                     ATAEDLPDASFAGQQETYLNVHGVKQVLESCHKCFASIFTDRAISYRTVKNFDHFEVA
                     LSVGVQKMVRSDLASSGVMFSIDTETGFKDAAFVTSAYGLGENVVQGAVNPDEFFVFK
                     PTLKQGFKPILNKRLGSKEIKMVYDLGGGKQVKNVPVSESERLQYSITDEEALTLARW
                     ACIIEDHYSEKRGQNSPMDIEWAKDGQTGQLFIVQARPETVQSQKSSNVLKDYKLKAT
                     SEVLITGRAVGEMIGQGLARVILNVHQIGEFKAGEVLVTNKTDPDWEPIMKKASAIVT
                     NQGGRTCHAAIIAREMGIPAIVGCGNATGILKTGQDVTVSCSEGEEGRVYSGLVPFDI
                     IETQLDNLPKTRTKILMNVGNPEEAFKLASIPCDGVGLARLEFIIANHIKAHPLALMK
                     FDELTDESVKKEIAELTLGYQNKADFFVDKVAQGVGTIAAAFYPNPVVVRMSDFKSNE
                     YANLLGGADFEPKEENPMIGWRGASRYYDEKYRDAYGLECKALKRVRDDMGLTNVIPM
                     IPFCRTPYEGRRVLAEMEKHGLKRGENGLQVYVMCEIPSNVILADQFTEIFDGFSIGS
                     NDLTQLTLGLDRDSSLVAHIFDERNQAVKDMVAMVIEKAKRNDRKIGICGQAPSDYPE
                     FARFLVELGIDSISLNPDSLLKTLLDIAKLEERLDANK"
     CDS             402704..403915
                     /codon_start=1
                     /locus_tag="GM3709_346"
                     /product="hypothetical protein"
                     /protein_id="BAQ63581.1"
                     /transl_table=11
                     /translation="MQQNIPRIESLKVQNYRALHNLELKEITPLTVFLGPNGSGKSTI
                     FDVFAFLSECFTESLRTAWDRRGRFRELRTRGSEGYIVIEIKYREEYHPRKSPIITYH
                     LAIAEENNRPFVAEEWLQWRRKSSGKPFRFLDFKRGEGQVVSGDTPDAENERISEKLE
                     SPEFLAVNTLGQFSKHPRVSALRKFITSWYLSYISADNTKTSTEAGAQERLTPMGDNL
                     PNVIQYLKEEHPERLDKILEILSLRIPRLEKVEASIMPDNRLLLQIKDAPFVQPILSK
                     FASDGTLKMLAYLTLLYDPQAPQLIGIEEPENHLHPRLLPELAEECRSASSNTQLMVT
                     THSPFFVDSLKPEELWVLYRDEKGFTQAKRTADMKGVKEFIEHGALLGSLWMEDYFDV
                     GNPLKNSGKGR"
     CDS             403935..404174
                     /codon_start=1
                     /locus_tag="GM3709_347"
                     /product="hypothetical protein"
                     /protein_id="BAQ63582.1"
                     /transl_table=11
                     /translation="MNLEFLVEEASLKEALQNLLPKILPSEITFNIHDFRGKEDLLKK
                     LPNRLKGYKAWIPNDYKIIVMIDEDREDCLKLGDF"
     CDS             404259..404654
                     /codon_start=1
                     /locus_tag="GM3709_348"
                     /product="hypothetical protein"
                     /protein_id="BAQ63583.1"
                     /transl_table=11
                     /translation="MALKQKLEGIAKQTGFITKTSRTNNQDFQVLNRIVVEELEAWFF
                     GDINAIRQAYPRVSQNLINQKPYRNPDNIKGGTWEALEKILNKAGYFQGGLQKLVCAR
                     EISGYMNLNENRSKSFQIFVQGLLEIIKT"
     CDS             405119..406363
                     /codon_start=1
                     /locus_tag="GM3709_349"
                     /product="processing protease"
                     /protein_id="BAQ63584.1"
                     /transl_table=11
                     /translation="MKQNQKHIQKTTLNNGITLIVIENPTTEIIAGRIFCRNAGSLWE
                     ATHQAGIFHLLASVMSKGTRHLSSLEIAEKVESIGAALGTDTSSDYFLVGMKTITEDF
                     SEILALAGEIIRYPSFPDTEIELEKKITLQNILSQKEQPFNLAFSQLREMIYGQHPYG
                     FSVLGTENTLNQLTAFDLKECHQKHFTPDNFVISLAGKINLDQAIEMVENIFGDWQKS
                     HNRNKLNPYPLYPQALDRKIEQENQQSIIMMGYLSPEITHPDYPILKLLTTYLGNGLS
                     SRLFVELREKRGLAYDVSAFYPTRLDKSQFVVYMGTASQNIEIGKEGLYNEIQRLRQE
                     KLSAKELEIAKSKLLGQYALGKQTNAEFAQIFGWYETLGLGIEYDEIFPQQINNVTLE
                     DIQRVANTYLKDSSLCTSIVGK"
     CDS             complement(406402..406779)
                     /codon_start=1
                     /locus_tag="GM3709_350"
                     /product="hypothetical protein"
                     /protein_id="BAQ63585.1"
                     /transl_table=11
                     /translation="MSSIEKLQPASKADTLMYQPYYGKEQHEILPYALSLYQQGFLEG
                     ERIIEGKKNIPFVAIWYVSRLPAEPTRCRIQFDGSADLSYEVNLSNSEFIEFLILLIK
                     NFKQSRQTDFSQKFYRKLLRLDD"
     CDS             407391..410462
                     /codon_start=1
                     /locus_tag="GM3709_351"
                     /product="alkaline phosphatase"
                     /protein_id="BAQ63586.1"
                     /transl_table=11
                     /translation="MTTLNGTGLADSLNGSSLSPLTINGLAGDDTLLGGLQGDTLDGG
                     DDNDSIIASRGNDSIIGGSGDDTINYANIGTAVTLQATGLLSKGSFGTDTLVGVETII
                     GATNRANVIDASSSTSAVLVDLANDTLTVVDFDGMGGDLNFQIINFVNVTGGSNDDTI
                     IGNLSNNVLNGSAGNDSILGGLGNDTIDGGADNDSLLGGDGNDRILSGIGDDTILGGM
                     GNDTIVLVAGDKLVYGGNDTTFDQGTDTADYSQLNESITLQATGLVVKGAGGASGTDT
                     LAGIDNIIGDTGTGIVNTIDVSNEDLGGGAIDVDLGTNTLDVVNVDFGSGVIPLVSFG
                     VTNFINVVGSNGSDTITGSSLANNLQGGDADDTINGGSGNDTILGDAGSDTLNGGLGN
                     DSVVGGDGDDTLIGSRGNDRLIGGDDMMTTDTADYSDLGQRVTLRPQGVVAKDGGFGT
                     DTLVGVETIIGTTGQSNLIDVSTSSLDINVDLGNDTLTVIDFDGMGTDLNFDVINFVN
                     VTGGSGNDTIIGSAVANTLNGGVGDDSIQGGAENDNLNGGNGNDILEGGDDNDTIIGS
                     SGSDSIFGGVDGTDSGTDTANYSALTQAITLQPLGVVAKGTLGTDTLSGIETIIGATN
                     RANVIDVSTASAGLSIEVDLSNTSTDNLTVADSGMTFMGSFAVRNFRNVIGTDGNDTI
                     TGDSSTNLLDGGDGDDTLNGGTGNDTLVGSSGNDSLLGGTGTDTANYSSLGEIVTLGA
                     TGTITKETLGTDTLSGVEVIIGATGENNAIDASTATSGVSITVNLATTTNNLTIAGVP
                     FATLPNPIFSVRNFVNVTGTNSVDNITGSTVDNTLSGLDGNDFIDGGSGNDSLDGGID
                     GDTLIGGIGNDTLIGNNGADSLVGGTGNDTLTGDSGNDTLIGSAGKDTLTGGGGSNVL
                     DYRTLSDSLLSNFDIITDFSDTDDDFRVSSFGGFNNGTFNVASLTASAIASGLSGISF
                     GAFQAATFTLTTDVGSSYLVINNSTAGYSSSTDAIVRLEGFAGTLTNANFV"
     CDS             410620..411699
                     /codon_start=1
                     /locus_tag="GM3709_352"
                     /product="putative metal chaperone"
                     /protein_id="BAQ63587.1"
                     /transl_table=11
                     /translation="MTKVESVNTEINIMDVPKQGLPVTIITGFLGSGKTTLLNHILQN
                     QQGVKTAVLVNEFGEIGIDNDLIISSDEDMVELSNGCICCTINTDLVDAVYKVLERDE
                     KIDYLVVETTGLADPLPVALTFLGTELRDMTRLDSIVTLVDSENFSLDLFNSDAAYNQ
                     IAYGDIILLNKTDLVDSADVDLLEVRLRDIKQDARIMRTTKSQVPLPLILSVGLFESD
                     KYFDQDDSSDDHEHNHHCTEDHEHDHNCGHDHHDHSHHHHSDHLENDGFTSVSFVSDK
                     PFNIRKLQSFLDNELPVNVFRAKGILWFQESPDRHIFHLSGKRFTIEDDEWKKGQTRE
                     NKLVFIGQNIDGDRIKQQLEECLYR"
     CDS             411892..412620
                     /codon_start=1
                     /locus_tag="GM3709_353"
                     /product="sepiapterin reductase"
                     /protein_id="BAQ63588.1"
                     /transl_table=11
                     /translation="MEISPNQTRAIITGASSGIGKATAIAFASSGIDLCLIGRSHAKL
                     TEVAHLAQEYGVQVKVISADFSDVSTIRSKIQSIAEEYGNIDILVNNAGMGYTNLLRD
                     TSLADWQKVLDLNLTSVFECVMGVLPSMRKHGKGTIVNVASISAQTFFPEWGTYSVSK
                     TALVTFGQCLALEERSNGIRVTTIFPGAVDTPIWDTNTVQAQLDRTAMLKPETVAQAI
                     LQTVLLPQEAVIEQLTITPSIGAL"
     CDS             412748..413470
                     /codon_start=1
                     /locus_tag="GM3709_354"
                     /product="GTP cyclohydrolase I"
                     /protein_id="BAQ63589.1"
                     /transl_table=11
                     /translation="MTEFSNGSNSPKISPDASLSISTEVYNNVATRPDRNTHNGQVAQ
                     INLSHEENKQQMMDSVRIILESVGEDPEREGLLKTPKRVAEAMQFLTQGYSQSLEKLV
                     NGAIFDEGHNEMVLVRDIDFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMY
                     SRRLQVQERLTRQIAEAIQTILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMLGV
                     FQEENKTREEFLNLIRHKPSFL"
     CDS             complement(413952..414680)
                     /codon_start=1
                     /locus_tag="GM3709_355"
                     /product="hypothetical protein"
                     /protein_id="BAQ63590.1"
                     /transl_table=11
                     /translation="MKNKSLLTQIRNASLIGATVISCWLTQTTKLLALPQDAIVQKLR
                     PIPVFTIADGQGAPLIASNDQNGKVAGVFISKQDANSFVEKLKKDNPDLGKQVQVVPV
                     SLGEIFELSETNAKEKEPIIFAYVPTREQVEQAKKLNTEYQSGVPLFVAKAGEDQGYL
                     TIKQNEQEVIPFFFDQQQVQQLVDNFKKAQPNLASSVKIEVVILEGILEALKQGDDEM
                     LTKIVLWPSKESIEFLRANAPKEK"
     CDS             complement(415087..417024)
                     /codon_start=1
                     /locus_tag="GM3709_356"
                     /product="biosynthetic arginine decarboxylase"
                     /protein_id="BAQ63591.1"
                     /transl_table=11
                     /translation="MTKFWTIEDSNKLYQIEGWGEPYFSINAEGNIVVSTRGDEHKID
                     LFELVESLKKRDINLPLLIRFSDMLDDRLKRLHDCMNEAIDRYNYNNVYRGVYPIKCN
                     QHKQLVEALVEYGKPYNFGLEVGSKPELMIALATLEVDKNRERLLICNGYKDEEYLET
                     ALLAQQLGHNLIIVIEQISELFIILKLAQKLNLKPQLGVRAKLQTKGSGHWGNSTGEK
                     AKFGLTIPEILTVINKLKSEDKLDCLKLLHFHIGSQISSIAVIKDAIREASQIYVQLS
                     KMGAGMKYLDVGGGLAVDYDGSKTNFYASKNYNMQNYANDIVAAVKEACDENNISSPI
                     LVSESGRAITSHHSVLIFNVVSSNNPPLELPQPTEEKEHLIIRNLWETYETINEDNYQ
                     EMYHDAVQFKDEAISLFNFGYLTLIDRAKAEQLYWGCCHKIYQITKNEAYVSDDLNDL
                     NDLMIATYYINLSVFQSAPDAWAIDQLFPILPIHRLNEKPTIKGVLADLTCDSDGKID
                     KFIDLLDVKNALELHPLKPIKEQDIDNPENTDFKPYYLGMFLVGAYQEIMGNLHNLFG
                     DINVIHIQSKKENYQIKYVVKGDTVTDVLKYVEYSAEDLTEKLRCLTENALLEKQIDL
                     EKSQLLIKNYEENLRGYTYLS"
     CDS             417354..418148
                     /codon_start=1
                     /locus_tag="GM3709_357"
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="BAQ63592.1"
                     /transl_table=11
                     /translation="MNIVLILFLITALSLSGCQQLEATNGTENNTTANQENVTSQTET
                     PVDQTSQMAQNSQNNQNTQNTMNLPRLEGTATVVMKVNGQSITIEVDGNNAPITAGNF
                     VDLVKKGVYNGVVFHRVVKDPSPFVVQGGDPQGKNPKIPASALGTGSYIDPVTNTPRY
                     IPLEIRPEYDETKTDVESPAIIYSQTITQPPELKHDYGVIAMARSQMPDSASSQFYFT
                     LADLPFLDGSYAVFGKVTEGMDVVEKIKQGDRIESAEVIAGAENLK"
     CDS             418320..419441
                     /codon_start=1
                     /locus_tag="GM3709_358"
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase"
                     /protein_id="BAQ63593.1"
                     /transl_table=11
                     /translation="MVKVVVTGISIISCLGDTKATWQGVINGISGIKFRQPFDYLSCL
                     PLGLIKSHPSFIGDVTFTLIKDLINHSNLELPLKDTGIVIGSSRGCQSQWEIFLSSPK
                     PSFSPLWLNTLPYQPSIITANYIQTNASVLSPTNACATGLSSIAQGYELIKQKRCKSV
                     IVGAVETPITPLTIAGFSQMKALSNKGCDPFGKERSGFVLGEGGAMLMLETEESARNR
                     QAKIYGEILGWGMSCDAQTMTAPEKEAYTAIKTIKLCLERSQIQPEEIDYINAHGTGT
                     ILNDRREAKIINHLFPQNPKVSSTKGVTGHTLGASGAIATALSFLSLEKQILLPNTNL
                     SCPEFDLNFCTQGEKYSLQKMLCFSFGFGGQNAVLAIRK"
     CDS             complement(419655..420341)
                     /codon_start=1
                     /locus_tag="GM3709_359"
                     /product="archaeal/vacuolar-type H+-ATPase subunit H"
                     /protein_id="BAQ63594.1"
                     /transl_table=11
                     /translation="MIANNVPSQLPVSHIPSSQEKPPQIEEMAVDMVEEIERLEDFIL
                     NSTRIPFVGKTLVDEDILMKQLDAIRINIPDCLEQATQILQHREQILAEAQNYAQKIV
                     ENAQRRATQLLDESRIVQQAETQAHQIRRQVQQDCENLQRKTISEVEQIRQRIQQEAM
                     KTRQQAILEAEDIQNEADIYADSVLSKLEKDLGDMLRVVTNGRQQVQVHRQTVSIPPR
                     KDMTISKKAS"
     CDS             complement(420452..420931)
                     /codon_start=1
                     /locus_tag="GM3709_360"
                     /product="hypothetical protein"
                     /protein_id="BAQ63595.1"
                     /transl_table=11
                     /translation="MLILAFIVSCSVILGWGASYGFSSNSIVQNTKSVDKATGNFKIG
                     EDFYLENCATCHIPVPPAVLPQETWQRILENPGNHYGVKVEGLTGFSQRLMWQYLQNY
                     SRQLLKDEIEPKYMAQSRYFFALHPNVTLPSPITLNSCIECHTQAKDFNYRVNFDRN"
     CDS             421144..422304
                     /codon_start=1
                     /locus_tag="GM3709_361"
                     /product="phosphoribosylaminoimidazole carboxylase ATPase
                     subunit"
                     /protein_id="BAQ63596.1"
                     /transl_table=11
                     /translation="MTKKVGVIGGGQLAWMMAQVAPQEDIHLLVQTPSHNDPAVSLAT
                     KTIFAAIDDPQATAQLALDCDVITFENEFVNLLELQKLADQGVCFYPRLSSLSPLLDK
                     YEQRCFLQNQGLPVPNFKAYESLDDFNSFSFPLVLKARRHGYDGQGTMIVNSSTELKA
                     ILAKFDGIPLLIEEFIPFDRELAIIGVRSVTGEIKIYPVVETYQQNQVCRWVIAPTRL
                     TEIQQENINSIVEKLLIALDYVGVLGIELFLTKNGEILVNETAPRTHNSGHYTLDACY
                     TSQFAMQLQAITGKKLGNIELKSSGAVMVNLLGFEVAYSDYQEKRAKIAQMGAFVHWY
                     GKNESRWGRKLGHATMLLTKNTPEEIDQQGKLIAQQIESIWFDTPLSYIREL"
     CDS             complement(422445..423638)
                     /codon_start=1
                     /locus_tag="GM3709_362"
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="BAQ63597.1"
                     /transl_table=11
                     /translation="MDTKTFKRNLQQSENYHRKGFGHQEEVTATLNQEYQSSLIQTIR
                     QNNYEITKGNVTIRLAEAFGFCWGVERAVAMAYETRTHFPTQKIWITNEIIHNPSVNQ
                     RLKEMNVDFIPFNEGIKDFSVVNSGEVVILPAFGASVEEMQLLNNKDCTIVDTTCPWV
                     SKVWNSVEKHKKRSYTSIIHGKYKHEETVATSSFAGTYLVVLNMIEAEYVANYILKGG
                     NKEEFLTKFKNAYSEDFNPDVDLERLGIANQTTMLKSETEAIGKLFEQTMLKKYPPNE
                     LNDHFMSFNTICDATQERQDAMLDLVKEKLDLIVVIGGFNSSNTTHLQEIAIEYKIPS
                     YHIDSSDRILLNNKIEHKPLDKDLEIKNNWLPQGKITVGITSGASTPDKVVEEVIEKI
                     FISKS"
     CDS             423871..425217
                     /codon_start=1
                     /locus_tag="GM3709_363"
                     /product="bicarbonate transporter"
                     /protein_id="BAQ63598.1"
                     /transl_table=11
                     /translation="MSNFSRRRFLVTTGTSAITAVFLKGCLGNPPETTSSTSNTEVTP
                     VTLTPEITPETPVIKLGFAPIFEAAPLIVAKEKGFFAKYGMNEVEIAKQANWGSARDN
                     VEIGSAGGGIDGGQWQMPMPYLISEGLITKNNVKIPMYVLAMLNTQGNGIAIAKTQEG
                     KNITLDMTKAKDYIVGLKQSGKPFRAAFTFPKANQDFWIRYWLAAGGINPDTDVNLMT
                     VPAAQTVANMKTGSMEGFSTGDPWPTRIVADGIGFMPALTAQMWANHPEEYLAIRADW
                     VDKNPKATKAVLKAVMEAQQWCDTQSNRSELAQILSGANYFNVPATVLEPALMGKYKM
                     GDGQPDIDDYKLAVQYWKTEKGSVSYPYKSLDLWFITESVRWGFLPSSYLDNAKALID
                     KVNREDIWKEAAKEAGIPEADIPTSTSRGIEKFFDGKEFNPENPKAYLDSLSIKKV"
     CDS             425263..426093
                     /codon_start=1
                     /locus_tag="GM3709_364"
                     /product="bicarbonate transport system permease protein"
                     /protein_id="BAQ63599.1"
                     /transl_table=11
                     /translation="MATTIRTSRNNSNFLSKFWKKNGKNILPPILGILGFLLIWQLFS
                     SIGLVKLPGPISLITNERTRIYLMYPFFDRGGTDVGLFWQAMASLQRVLIGYSFAAIV
                     GIGVGILVGLNPFLNKALDPLFQFLRTVPPLAWVPIALAALQQNQPAALFVIFITAVW
                     PILLNTVVGVQQIPQDYINVQQVLQLSNKKFFFKILIPSALPYIFTGLRIAIGLAWLA
                     IIAAEIVMSGIVGIGFFIWDSYQNNYISDIILALIYIGAIGLILDKLMAWIQSKIVRE
                     "
     CDS             426182..428182
                     /codon_start=1
                     /locus_tag="GM3709_365"
                     /product="nitrate ABC transporter"
                     /protein_id="BAQ63600.1"
                     /transl_table=11
                     /translation="MSVFVAVDNIEKVFPLTGGGEYLALKGINLEIKKGEFISLIGHS
                     GCGKSTLLNMIAGLDLPSEGIVTLEGQKIQKPGPERMVIFQSYCLLPWLTVRQNIALA
                     VDQVMATFSQSERDEIIEEHIDLVGLRHAVDKLPNQLSGGMRQRVAIARALSIRPKLL
                     LLDEPFGALDALTRGNLQEQLMQICDRYQITGIMVTHDVDEAVLLSDKIVMLTNGPGS
                     KIGGILEVDIPRPRQRMEVVNHPSYYSLRSEIIYFLNQQKRIKKIRAQKQGVISRHGL
                     EKVNLEIGFVPLTACAPLAIAKEKGFFVKHGLDEVNLVRETSWRGIVDGIAGGYLDAA
                     QMPAGMPTWLTVGGNQDEPLPVVSALTMTRNGNGVTLAKKFYDMGIHDGHHLKRMLLE
                     SVEENHTFGMVHPSSMHNILLRYWLAAEGIDPDQDVHLQTILPAQMIADLKAGSIDGY
                     CVGEPWNLRAAMEGFGFTVATDLEVWNGHPGKVLGVREDWANAYPNSHIALVKALLEA
                     CQYCADANNQEEIRTILSDRKYLSTNIDYIQLGDPNSYSCNLEKSVEYAHHRFYGDGM
                     NRPSRTEHLWMMTQMARWGDIPFPRNWVEILERVCRVGVFSTACRELGLSDLKYRREA
                     IKLFDGVPFDGEDPIGYLNHLEIKRNITMAEIPLNSRILIAA"
     CDS             428268..429110
                     /codon_start=1
                     /locus_tag="GM3709_366"
                     /product="nitrate ABC transporter"
                     /protein_id="BAQ63601.1"
                     /transl_table=11
                     /translation="METSTKKFAQKMEKQLYQDSFLTIENVSKVYPTPTGSYTVLQDV
                     NLNVNQGEFICVIGHSGCGKSTLLNMVSGFAQPTSGSVNLKGKPITKPGPDRMVVFQN
                     YALLPWLTVFENVYLAIDSVYPQKKEAEKRAIVREHLALVGLTEAADKKPTQISGGMK
                     QRTSIARALAIRPEVLILDEPFGALDPITKEELQEELLNIWNEYRCNVLMITHDIDEA
                     LFLADRLVMMTNGPSATIGEVLNIPFPRPRDRERIMEDPTYYDLRNYALDFLYNRFAH
                     DDVA"
     CDS             429196..431979
                     /codon_start=1
                     /locus_tag="GM3709_367"
                     /product="cAMP-binding proteins - catabolite gene
                     activator and regulatory subunit of cAMP-dependent
                     protein kinases"
                     /protein_id="BAQ63602.1"
                     /transl_table=11
                     /translation="MFNKTPEKTMHSVRWILTTAWFLIILSLFYDPISPFLTSPDNLA
                     SPLRVNLDTCVAVQGNCLEKNAYYLGAPIFWGIVVPSSIFILLIFGHELWRRICPLSF
                     LSQIPRALGWQRKIKRVSANGSVRFEIPRIDKNSWLGRNYLYLQMSWFFIGLCSRILF
                     VNADRLALAIWLLFTIFIAIFIGYFFGGKSWCNYFCPMSPVQKIYGEPQGLFTSKAHI
                     GDDKITQSMCRIIEDNQEKSACIACQSPCIDIDSERSYWDSINQTDRQLLYYGYFGLV
                     IGYFLYYYLYAGNWDYYFSGIWAYEKDQLNTLLNPGFYLFNQPINIPKIIAVPLTLGM
                     FTFISYFLGKSIEKFYQNKYKNKISPELVRHRIFTILTFIIFDFFFIFAGRSWLTLLP
                     IKIQYIWDFALVFLSSIWVYQTWRRSPEIYSKESLATRFRKQLTKLGLNIGRFLDGKS
                     LENLNTDEVYVLAKVLPGFSKDKRQEVYKGVLKESLEEGYVNTVSSLEVLEQLRSELS
                     ITDDEHRTILTELGVEDPSLLDPSKLHSVENSVRLTGYRKALERMLSLQQKASLDELL
                     ENNSQDIRKLRQEYCITYQEEEEILHGLQPESGIIARSEHIISQLEQLIERYHALNQP
                     RFLPQGDILNLLRKTVRQKKRLLVRGLLEIIENCEDLTIAREIARRLGNISPGVLPDI
                     LENPTSNWYYRLQPEILNLLSQPTNTIPTCSLDIDIQTIISHLQGLLMESNPITQAIS
                     LYILAQIDLKLAQAEAQELLVIKNHFLVQETANTLLKSDTLNLSNFNTLEKLIYLGNA
                     NFFEEIHSNTLIALAELSYFNNYQENQVISDEGDTCRELLLLISGRVEIILSRENDTP
                     IISSLLPGQILDELEVLSHGKQSGKIIAKTNPTKILAVAIDSFDDILEEDHEFSRRIL
                     ELETNRLKQLITK"
     CDS             complement(432344..432862)
                     /codon_start=1
                     /locus_tag="GM3709_368"
                     /product="cytochrome C553"
                     /protein_id="BAQ63603.1"
                     /transl_table=11
                     /translation="MLFTTQKQISGVAITLVAIASNLSFMNIAKAEEISCQGTLGAIT
                     VDNVKVPQGKTCTLNGTTVKGNIVVNNRATLKANGAKVNGNIQAEGATAVNVNSNTTV
                     GGSIQIKQGGSASIVSNKIQGDVQLESNSGKLTVSKNNIGGNLQCKENKMIPVGGDNI
                     VEGNKEDQCSKL"
     CDS             433019..434200
                     /codon_start=1
                     /locus_tag="GM3709_369"
                     /product="aldo/keto reductase family"
                     /protein_id="BAQ63604.1"
                     /transl_table=11
                     /translation="MEYRRFGRTELQMPVFSCGGMRYQYKWQDVQISEIPEDNQRNLE
                     ATIKKSVELGINHIETARFYGSSEIQLGQILPKLPREKLIIQTKIAPEEDSKIFRANF
                     EKSLRYLNVDYVDLLGLHGINTLQLLDYSTRSSGCLEEAKKLQEEGKVRFIGFSTHAP
                     TDLIIKTIQTNQFDYINLHWYWIYQKNWEAILEANRHDMGVFIISPSNKGGMLYQSPS
                     TLKKLTKPLSPMVFNNLFCLSHPQVHTLSIGASQPSDFEEHLETLPLLSQSQKLLSPI
                     IKRLENHAEKVLGEEWLRNWEIGLPNHEETPGNINIPMILWLRNLAVAYDLVEYGKMR
                     YNLLGNGGHWFPGQKADKLNEFDLKKCLINSPYKDQIPKFLAEAERILGGQEVKRLSQ
                     S"
     CDS             complement(434545..435696)
                     /codon_start=1
                     /locus_tag="GM3709_370"
                     /product="UDP-sulfoquinovose synthase"
                     /protein_id="BAQ63605.1"
                     /transl_table=11
                     /translation="MKALVIGGDGYCGWATALHLSNKGYDVAILDNLGRRHWDDKLGV
                     HTLTPIASIQQRIKRWYELTGKKIELFIGDITNYDFLIKAFRQFEPESIVHFGEQRSA
                     PYSMIDREHAVFTQVNNVVGTLNILYAIKEEFPDSHLVKLGTMGEYGTPNIDIEEGYI
                     EIEHNGRKDVLPYPKQPGSFYHLSKVHDSHNIHFACKVWGIRATDLNQGVVYGVLTEE
                     TGIDELLINRLDYDGVFGTALNRFCIQAAIEHPLTVYGSGGQTRAFLDIRDTVRCMEL
                     AIANPAEAGKFRVFNQFTELFSINDLANMVQKASATLGLKVEVNNIQNPRVELEEHYF
                     NAKNTNLLDLGLKPHYLSDSLLDSLLNFAQKYKGRVDMEQILPKVSWRR"
     CDS             complement(436102..436767)
                     /codon_start=1
                     /locus_tag="GM3709_371"
                     /product="phycocyanin alpha phycocyanobilin lyase related
                     protein NblB"
                     /protein_id="BAQ63606.1"
                     /transl_table=11
                     /translation="MSKVDLTEICSKLESSNSKDRLLALASLREVEAEDAVPLIKKVI
                     DDEMLPVRSMAIFALGVKKTDECLPILVKLLETDPDYGIRADAAGALGYLRDIGAFEA
                     LVRSFYEDTQWLVRFSAAVSLGNLGDIRAKQVLLEALHSGETVLQQAAISALGEIKAE
                     DCIEEILTFAQSEDWLIRQRLAESLGNFNTQKSISALKYLAKDVNPQVSQAANYSLKK
                     FNF"
     CDS             436976..440107
                     /codon_start=1
                     /locus_tag="GM3709_372"
                     /product="alpha-mannosidase"
                     /protein_id="BAQ63607.1"
                     /transl_table=11
                     /translation="MNLQKVILTLKSLTELEIQNNWFYLDRDLDNSPINIDQNWQKGI
                     VNEKNYLVWEKGNQVRWFAQKIIIPKSLNNNYPLDSLSLRIALTWWAELAQIFVNGKL
                     VCEGDLFDCSSRILFTEKVNIGEEYIISLRLVSPSHDIGGLMASKCLYESNYNDIDPS
                     FIANELTILEKYINQFYPEKNTFLEEEVSKINWNVINNQSLFRQELANLRNRLLPLSN
                     YIKERNFYLLGHAHLDMAWLWTLEETYEVAQRTFNSVLNLQKNYSYLTFGHTTAYLYK
                     WIENHNLPLFTQIQQAVKNNLWEILGGMWVEPDVNLISGESLVRQLLYGQKYFLEKFG
                     KYNNIAWLPDTFGFPWQLPQILQQAEINYFVTGKLHWNDTNKFPYGCFWWQSPDGSRI
                     FSLMSPPNVAGVMDTNPLTMTNYSVDWENQTGLKDVFWLPGVGDHGGGPTRDMLEVGK
                     RYDRSPFFPKLNFTTAQEYLEKISSISCDNLPVWNNELYLELHRGCYTTHGDQKYFNR
                     YSEKLLYQAELFSTIANILSRKFKQKLNINADHQKRIKENWQKVLLNQFHDILPGTSI
                     TPVFTEANQLWQEIINDTESILQDSLTSITSYINFDKISQKNYQIIVIFNSLNWQRSE
                     IIEIDINNDNGILYNVFDENGKSLKTQISKDGKLLFFAKNIPSIGYKSFYLKSNETEK
                     ITSFIEEKNVLNNENYILENQYIKVNIDIETGNIISFYDKINNQEVLNGYGNELQLFE
                     DKGQYWDAWNIDPHYQNYPLENPTLTSIKWLEKGLLRQIIRIEKTFNRSSFIQDYILN
                     FNTPILTIKNKVHWQEDYTLLKVNFPLKIESNFVTYDIACGNIKRTTKPETDREKAQW
                     EVCGHYWADLSNNNYGVSLLNDCKYGYDSKPNQLRLTLLRSPKWPDEKCDRVTPLGEQ
                     GYHEFSYSLYPHKNDWKKGNTVKKGYELNVPLQILFLDKKKAQLSVLPTTTELIKINA
                     DNLILMALKITEEDSNKILFRGYECYGDYCDFTFKSILDFSLKTRVNLLEHPVKNQNQ
                     KIKPYQIFSFICE"
     CDS             440174..440650
                     /codon_start=1
                     /locus_tag="GM3709_373"
                     /product="acetyltransferase"
                     /protein_id="BAQ63608.1"
                     /transl_table=11
                     /translation="MTIIIRNIQPSDYKVIISVIDEWWHGRKMRDMLPKLFFIHFQET
                     SFIVEKENKIIGFLIGFLSQTHSEEAYIHFSGIDPNFRQQGLGNSLYHKFFQVVQKYD
                     RKRVKCVTSPLNKNSIAFHLRLGFEIEKGNATEKDISYHLNYDGDGEHRVLFIKQL"
     CDS             complement(440778..443183)
                     /codon_start=1
                     /locus_tag="GM3709_374"
                     /product="hypothetical protein"
                     /protein_id="BAQ63609.1"
                     /transl_table=11
                     /translation="MLKIELPNIPPSAWQCEIGKIWEKPYTVRYASNLDDGANHGMPL
                     GGFGSGCIGRGVNGDFNLWHIDGGNHIFKALSACQFSVFEQVEGESPQVYAMSTTPPD
                     NGSLSSWAWYPQGQGTYSALYPRSWFDYQGVFKSHLICEQFSPIWGGSYQEASYPVAV
                     FDWSIHNPTDKEITLSIMFSWQNSVGWFTNTIKSPTVKVRDDGSPEYEYQPRWGDSTG
                     NLNQWIQDNFRVGCLFDRIRMNDEPQEGEGQFAIASVTNPTLEVFYHSRWNPKGDGSE
                     LWDYFAMNGTLPDYQDETPAEPGEQIAGAMAIRFTIKPGKTKKIPFVLAWDFPVTEFA
                     QGINYYRRYTDFFGRNGKNAWSIVRTALKHSDMWQNRINEWQKPILIRSNLPDWLKMA
                     LFNELYLLADGGSLWTAATENDPVGQFGVLECIDYRWYESLDVRLYGSFSMIMLWPRL
                     DKSILEAFSHAISHSDDTPRIIGYNRASAIRKAKGATPHDLGAPNEHPWEKTNYTSYQ
                     DCNLWKDLGCDFVLQVYRDYLFTGSQDQDFLWECWDSIVETLHYVKGFDLDGDGIPEN
                     SGAPDQTFDDWRLQGISAYCGGLWIVSLEAAIAIGKILMANPPMNPNLQPDDFPEGIR
                     SSIEIFADWLAKSRAIYHQTLWNGEYYNLDSQSGSDVVMADQLSGQFYAQILGLPDVV
                     ESEYVRSTLNKVYDACFLKFHDGKFGIANGLKPDGKPMKENDTHPLEVWTGINYGIVA
                     FMILNGMKEEGLKVAETVVKQVYENGLQFRTPEAITAVGTFRASHYLRAMAIWAIYHV
                     LNK"
     CDS             complement(443268..444221)
                     /codon_start=1
                     /locus_tag="GM3709_375"
                     /product="hypothetical protein"
                     /protein_id="BAQ63610.1"
                     /transl_table=11
                     /translation="MTRLKRPPYSRLEVHLLREGIVESIHQGEVVVADDRGRILAVAG
                     DPETVSFMRSSMKPFQALAVTSTGVMERFDLNDKDLAIVCSSHQGKIEQARQVFNILW
                     RSDIEPSYLKCPIPEGKDSALQHNCSGKHAGMLAVCQQRNWDLDTYFHRSNPVQQLIL
                     NKVAELLCIPGAEIMTARDDCGVPTYALELGQMATLYAKLASGNSIDLERIVRAMTHH
                     PTMVAGEGAFDTELMNLTDGMLVSKSGAEGIQCIGNIGQNMGLAIKILDGAKRAKYAT
                     AIHVLKQMGWITPTVAENLGDKFLRIDDYRRLEVAGELCLL"
     CDS             complement(444286..444789)
                     /codon_start=1
                     /locus_tag="GM3709_376"
                     /product="uncharacterized membrane protein Ycf36"
                     /protein_id="BAQ63611.1"
                     /transl_table=11
                     /translation="MTESTTFCPVPLEQQPLNEYQELAQSWFFSWVILPKWQFARKLT
                     WVIILSLLICVPISAASFPPQETFFSFLLCSLLGSSFFVGFALVRLYLGWRYIGDRLR
                     KTKIVYEESSWYDGQVWEKPPEFYRRDQLIFQYQVQPLLKKLQKSLILLLGLMGSGGI
                     TLWLIPN"
     CDS             complement(444819..445244)
                     /codon_start=1
                     /locus_tag="GM3709_377"
                     /product="ribosomal silencing factor RsfA"
                     /protein_id="BAQ63612.1"
                     /transl_table=11
                     /translation="MTKSHLQIDNYCSDQKINLSDTNISSKDLALIIAEAGDDRKADN
                     IVLLNVEKMSYLADYFVIMTGFSQPQLRAISLSIEDEVYKKVNRNPRRIEGKNEGNWI
                     LHDYGDVIAHIFLPEARQFYDLEAFWGSAEKTLFKAISN"
     CDS             complement(445597..447153)
                     /codon_start=1
                     /locus_tag="GM3709_378"
                     /product="3'-phosphoadenosine 5'-phosphosulfate
                     sulfurtransferase DndC"
                     /protein_id="BAQ63613.1"
                     /transl_table=11
                     /translation="MNSTSIQIPLFPPRSLEELIGDINILTAEIQELYCQDYLPWIIG
                     YSGGKDSSCILQLIWNAIAALPEQKRQKKIYVISTDTQVENPIVAHWVKGCLKRMEIA
                     AKEQKMPFEPHLLTPAVKDTFWVCLMGKGYPAPRHGFRWCTDRMKIQPADNFIRETVR
                     NHGEIILVLGVRKAESATRAKNMEKHAKGRFRDRLNLNSHVPNSYIYTPIENWRTDEV
                     WLYLLQWKNPWGGDNQDLFTMYRGATADNECPLVVDTSTPSCGDSRFGCWVCTMVSKD
                     KSMEAMIQNDEEKEWLQPLLDIRNELDIRDDRDKRDFRRIYGKVELFERNLEGTTSIE
                     PIPGPYVKKWREHWLRKVLEAEVSIRKFAPPEFQEIKLITTEELSEIRRIWLEEKHEF
                     DDSLPRIYQEVKNEEFIDPRIGAGNSLLGKEEWEILQDLCEDEMELELMTKLLDIERQ
                     YFTKIRRIGIYQALEKCFETSSRSKEEAIANAHYIREIKNAAKQGDVKTLQQKLTWGN
                     VKFAQKENPS"
     CDS             447487..447978
                     /codon_start=1
                     /locus_tag="GM3709_379"
                     /product="hypothetical protein"
                     /protein_id="BAQ63614.1"
                     /transl_table=11
                     /translation="MIKTRCSQNSKKQRKLRSIKRYWQYYRLRLLRLKEHPHKIARGF
                     AAGVFAGCFPFIGLQFVMAIIFALLIRGNKFTAILGTWISNPFTSVPLFLFNFQVGKL
                     VLSLFINNSDLHFNWDSFAEVKDLGTEIIVTLLFGSLLVGLCFSSIAYYLIIDLLKKR
                     KNP"
     CDS             complement(448001..448993)
                     /codon_start=1
                     /locus_tag="GM3709_380"
                     /product="pentapeptide repeat family protein"
                     /protein_id="BAQ63615.1"
                     /transl_table=11
                     /translation="MEVNEFIERYSAGENRFTGATLAGIDLVGADLIGIVLNDANLQK
                     ANLTFCYLSRADLSRANLEETNFSGANLNQASLVGANLHRGEFHGAILQKADMRNVKL
                     TLANLLDANLIEVDLRFADLSSANLKGACLRGANMRLEKRAKPTILKGANLDKADLKS
                     ADLQGVDLRNASLVGANLREVNLRGSDLTGADLTQANLKGAFLTEVDLTGAKLIGANL
                     SNTKLERAKLIDTDMSMVNLESATMPDCKLIRANLIQANLTFARLNRSDLSRANLYGA
                     IMRNASLMEVFFARTNLTSADLTNANLIGADLSSANITGVNLEGAIMPDGQVYH"
     CDS             complement(449013..450179)
                     /codon_start=1
                     /locus_tag="GM3709_381"
                     /product="hypothetical protein"
                     /protein_id="BAQ63616.1"
                     /transl_table=11
                     /translation="MIISSDIIASIAHDLSHSQEAKRAKKLIFYVSQRYWESDFSIID
                     NYSFESLLKNLYDNNPTADDLKALLYQAVNTLNRKEVYVKIAKYVFQRMSPLYDSDEH
                     SLPQEQNQGNEFESDLVDRIVENIEYHEESPRIKKLIFAACKQYWENDINVIEMYDLR
                     ELLLELYQLYPNPKRLKKALENIVSTINRQNFYSFIADTIVGELTYLYKHDTAEAVAD
                     NDSEQEEETQLIKAKSKNTSTESVPPTFNQDIETNVESSESEDTSDLDLSGSIMAAGV
                     PEGQVIPWLKLDNLFDLKQEIMQYTNPLRAKIMLFYAIYQIDISEQHWSIVRTCSLDD
                     LLIRMFQQYGKDIKTIESHLMLVANSSIEGLEPEDNAQAVSAIVESVKHFYKKA"
     CDS             450537..451166
                     /codon_start=1
                     /locus_tag="GM3709_382"
                     /product="alkyl hydroperoxide reductase subunit C-like
                     protein"
                     /protein_id="BAQ63617.1"
                     /transl_table=11
                     /translation="MEIINMGIQVGQKAPDFTATSVINQDFRTLKLSDYLSQYVILFF
                     YPLDFTFVCPTEIIAFSDRHDEFKALNTEILGVSVDSEFAHLAWIQTERKQGGIGDIN
                     YPLISDLKKEISTAYNVLEPNAGVALRGLFIIDRNGIIQHITVNNLSFGRSVDETLRV
                     LKAIQYVQSHDNEVCPVGWQEGDKTMNPDPVKSKVYFSTVEKETRNEAT"
     CDS             complement(451324..452442)
                     /codon_start=1
                     /locus_tag="GM3709_383"
                     /product="radical SAM domain heme biosynthesis protein"
                     /protein_id="BAQ63618.1"
                     /transl_table=11
                     /translation="MNKESISPKKKKSIWQLAKESIIDGGPSMCQFAITSACNATCGF
                     CNFAVDKMPIEQRRYVSLEEAKQAAEILYENGVYFIIYVGGEPMLHPHLMEIITHASS
                     IGMAPMLVTNASLLTKDRIDELAKTGLVSVIISIDASEVTKHEQNRGLRGVCDRIKLA
                     NQHFKKYNISTTASVTMSRLIDDYKQLPPFLESLGFDSVTFSYPLTTLASSYLGYAES
                     NLVDYTKEELDQRFEAIKALKKEFHVVNPTASIEDMQRHLKGETENFGCLGGWKFFYL
                     DWFLNLYRCHNWAEPMCHITEFDGSQRIRDNCTACMMDCYRDSSVMQHIAVSVSDGVQ
                     ALRKGNLKEAFNHWFNHNNLISLRSVIEEAKWLKTIDN"
     CDS             452789..453241
                     /codon_start=1
                     /locus_tag="GM3709_384"
                     /product="hypothetical protein"
                     /protein_id="BAQ63619.1"
                     /transl_table=11
                     /translation="MTQVTDKIDLKSLYEIDDHLWLEKTVDLLKEKRFNDLDLENLIE
                     ELESLSKRDKARVASLLEQIIRHLLMLQYWSKEYDRNSNHWKVEIISFRNQLDNNLTN
                     NLIIYLEKELDKIYSKVLRYVKQKTENIVDFPDTCPYSLEQILDDDYF"
     CDS             453490..456378
                     /codon_start=1
                     /locus_tag="GM3709_385"
                     /product="tRNA nucleotidyltransferase"
                     /protein_id="BAQ63620.1"
                     /transl_table=11
                     /translation="MDLILCHQTADFDALGAAVGLTKLHQGAKIVLTGGAHPSVRRFL
                     ALHRDEFDLIEFRSVNPQKIRRLFIVDTNQFDRLGKVVEWLHLEHLESITIYDHHEEN
                     HPSKNEHIKATTIKHIKKVASCASLICEFLQQNGITLTNIEATVMALGIHVDTGSLTF
                     EQTTPRDAAALAWLMSQGVNMRTLGEYVEPSLSPQLQELLPKVLKDLQTETINGSCVA
                     WILLETPNFIAGLSNLTERIRNLVEIDVLLFGHFYNKHKSSQPYPLTAKSGGDFSENS
                     KIEIREEKKVPTVGDLEANYDNKKIITLDNLDVNSESNKGKLTVIGRSKLESVNLASI
                     FTDFGGGGHSSAASFCFRCENPQDVIDNLLHRIKNLIPPPLMARDLMSSPVRTIRPST
                     TIEEAQRILLRYGHSGLFVVNSKAELQGVISRRDIDLALHHGFSHAPVKGYMTKNVQV
                     IHPDTSLGEIEGLMVSNDIGRLPVIADNELLGIVTRTDVLRYLHQTRQNIDNFTQEEN
                     SPLLSCLSPSLAKHLHPPIWTLLQQGASYAQSQGWHLYLVGGGVRDLLLTEEYQTFSL
                     QDIDLVVDGFHRTAITGAGVKLAEALQSFYPQARLSIHGEFQTAALLWHKDEILDSLW
                     VDIATARTEFYPYPAANPEVESSSIRQDLYRRDFTINALAIRLTNPHGGELLDFFGGL
                     EDLRSNLIRVLHPNSFIEDPTRIFRAVRFAVRLNFTIEAQTREYINYAISCGVYERVS
                     LEKTSIPALTTRLKAELNYILQAQYWKPALKLLAEINALKCLHNNCKLTPQLWWQIRC
                     LDRWLKYYNLDEKNQKVSSWLLRLEIILASFEEGVKVAENLQLPKDSIERLKYLSINN
                     EKIKTELFSYQNISQKVKFLSSYQSISLLLIAVKNNKNIRSTIWKYLMKWSKVKPILN
                     GDDLRKFGYKPSKQYKQILTEIQGLYLDGKINNFQEAKNLIFKKYPCY"
     CDS             complement(456395..457174)
                     /codon_start=1
                     /locus_tag="GM3709_386"
                     /product="PatA subfamily"
                     /protein_id="BAQ63621.1"
                     /transl_table=11
                     /translation="MTESSKSPKVPIREFIGSRQSNLFQTLKQPQFTGELILGSSKGE
                     EWTFYLYLGRIIYATGGKHPVRRWIRNVTRFAPALITYLPSIDKKALNKDSLQKCWEY
                     ELLNYWLEQQLVTRQQLSQIIRNAIVEILFDVTQAMEIVFQLNTSQSLPSQLVFIDAD
                     QVIVEAWEDWQKWQGAKLADRFPNDCPLVRQSDQLKQKTSPKTYQIMMKLFNGKNTLR
                     DLSLQLNQDIMSMTRLMLPYIQLGLIDLISVPDTPLPLSKI"
     CDS             457320..457913
                     /codon_start=1
                     /locus_tag="GM3709_387"
                     /product="molecular chaperone GrpE"
                     /protein_id="BAQ63622.1"
                     /transl_table=11
                     /translation="MKTNTILQNLMKEVEINDYLELSRKSQVSELQFYRLENNLLDHI
                     PLGVLKKIAQVFNISVTMLIEKLENIDDRDSGTKNEELTTSIINEYQRETISILESLL
                     LQLPTFSYAVKNNPDLPAIRLLPLLEPLNKLLSSWEIDSIGKVGDIVTYNPQEHELMD
                     YGDDDNPTQVEIRYVGYRQKDKLLYRAKVSPVTINNE"
     CDS             457929..458252
                     /codon_start=1
                     /locus_tag="GM3709_388"
                     /product="arsenical resistance operon repressor"
                     /protein_id="BAQ63623.1"
                     /transl_table=11
                     /translation="MVLKEINDTESLVKGFQALSDSKRMQVLDLLRTRELCVCEITEI
                     LEISQSKLSFHLKTLREANLVNTRQEGKWTYYSINLVKMVVLEQYLSEFRRSIVTLPT
                     RICQD"
     CDS             complement(458298..458654)
                     /codon_start=1
                     /locus_tag="GM3709_389"
                     /product="arsenate reductase"
                     /protein_id="BAQ63624.1"
                     /transl_table=11
                     /translation="MTLLVYGIPNCSTCKKALTWLEENNVNYQFINTKEHPPSKNSIE
                     NWVKSLGIKSMRNTSGLSYRALGEEKNTWTQEQWIDAFAQDAMLLKRPLFVKNNQGVL
                     VGFRANETVKKELLCN"
     CDS             complement(458850..459377)
                     /codon_start=1
                     /locus_tag="GM3709_390"
                     /product="hypothetical protein"
                     /protein_id="BAQ63625.1"
                     /transl_table=11
                     /translation="MNLIAHENITFEEAINLTTNFIEQIPQLSESEKSSIVSSLVLTE
                     NGARGFFVTYLTHENSIVDGVSSGIIEGLKTSPEIVSELLVKNVAMSTAMKITHTRNN
                     NLEMAEKSYGVTQRSLMLINKLSLPQSNEKIISLTNTIKDKKGVYQDFLNRWGYDDEQ
                     KQTILDIFNKNEFSI"
     CDS             459588..460940
                     /codon_start=1
                     /locus_tag="GM3709_391"
                     /product="probable signal peptide protein"
                     /protein_id="BAQ63626.1"
                     /transl_table=11
                     /translation="MTTTDINKLDRVGISTFITEQLNSKNIDISANLTDKINEYQGLK
                     MNVSDIFKNYYVKYLLSDEGKESLSDKQKKYIKQERRKFFNETLDLKIYKSVNNPRQL
                     EELMTDFWFNHFNVFANKLPNYQRFLIHNYETQAIQAHALGKFRDLLQATAQHPSMLY
                     YLDNWQNVSPRDKKSSKGLNENYARELMELHTLGVNGGYTQEDVISLARILTGWGIMN
                     QKTPQNENGFYFFESLHDYGDKNFLGHTIKGSGIEEVYQALDILAYHPSTANYISYKL
                     TQFFVADNPPNSLVKKLAKTFLDTQGDIKIVLGKLFDSEEFWDSKYYGNKFKTPYQYV
                     ISLLRIRNIENPPLTSTMATLRDLAMSPYNCVTPDGYKNIQSAWLSPDAMIKRVNFAT
                     NISSGKNEKINNNSQVNPRTFFKNFTDFFSSKTIELIKNTDQKWQSALILGSPEMMYK
                     "
     CDS             460956..462176
                     /codon_start=1
                     /locus_tag="GM3709_392"
                     /product="putative exported protein"
                     /protein_id="BAQ63627.1"
                     /transl_table=11
                     /translation="MKRRTILQQMALFTGSLIIPIGVNSWVGKTLGKTVSQKKLIVVF
                     LRGGVDGLNVIVPHEEDEYYDNRPTIALPAPNEKNGVLDLDGYFGLNPVLKDLMPLWE
                     KKQLTFVHGCGLTTNTRSHFQAQYYMENGIPGSEKVTQGWMNRLLAILGEKNPTQAVN
                     VGSTTPQILTGSMPVANLPRIKENIKKQPLDRSEINQIFTQLYNGNDPLSLAYQQGKQ
                     TREIFMRDLEKDMMESSKNAPSSSNFVQEVKQIATLMKGEANTQLGFIDLGEWDTHVN
                     QSAALNQRLAPLGKGLATLVKELGDTYNDTTIVVMSEFGRTVKENGNKGTDHGRGNVM
                     WIIGKNIKGGQFYGEWQTLKPDQLFEGRDVNVSTDFREPIAHILSKNFNLSEQLISQV
                     LPNFNQKNNLNFLS"
     CDS             complement(462202..462744)
                     /codon_start=1
                     /locus_tag="GM3709_393"
                     /product="hypothetical protein"
                     /protein_id="BAQ63628.1"
                     /transl_table=11
                     /translation="MRRLVVLNLMNKESGFSLLELVVVFVIMGIVSAIGAPSLVASQR
                     QGRVNEAFSKIRSALLEAQLNANRQSATCTLTIATTGVTATTQGCLLENITVDSSIVD
                     INSSAGTLPQTIAFAYQGTTANAQVLQIRRKNFSGTAMQETGKCIIISSIGMIRTGIY
                     DSTATSNCNNAENKRYDSNP"
     CDS             complement(462722..463234)
                     /codon_start=1
                     /locus_tag="GM3709_394"
                     /product="hypothetical protein"
                     /protein_id="BAQ63629.1"
                     /transl_table=11
                     /translation="MSIDRKGKKQGGFSVLEVLVTILVLSGFLLGSLQATVLATLLRV
                     QAQDKQDAANWLQQDLELVRYQAFLLDNPTEASGLTPTKANACSGSTYGQRLQDFIDG
                     VYASTATVTVNTKSYNVTRTYTNSGNILRIAYLVEYGTTHPRYKGSGANNTLAELSTE
                     VIPNAALSCS"
     CDS             complement(463304..464869)
                     /codon_start=1
                     /locus_tag="GM3709_395"
                     /product="hypothetical protein"
                     /protein_id="BAQ63630.1"
                     /transl_table=11
                     /translation="MKKNTEDLRNLLVWAYRSNILKGQNKETGNTLIIAMSIGLLVLI
                     ASSLSVLSSSKDKTNAQAGEFTKQAMGVAELGVTRVHNFLAKNSKVAEFPLDQWATQA
                     GTMQVQGTFSNTSGSNSTCSALTSSGGGTTVATLVDTFKTNGDTVINNASTAADFKKG
                     GFKVTNYTLADVNLNTSGVTTSSLQTLAGSVAVGQTYGHGILTVEGQINPNATSLSNL
                     FASNPNNSKTKIEVAIPLKKATVNVPLPGVWISSQEIGSPTNSVINATLLVPDCENMG
                     LNIMPGNSVIISSIQFPPLPTPPSDTNPNYYDLGDIDDSLRLPRNGDSPIETQSITHN
                     GTTYSVPVYKYKVDDIELNGGEQIKIVPGRKVILHLYGNIDIGGSQVIDNSCDIGIGY
                     VCNSTTKVVTYLLGSPSVFRRENLQVLGYGQNTGGATSQEPHICLAGGAELFGFVFAP
                     DYAVGAAGTGSGNGITGAVWARMFNPPSTCGSNTGQVVVVQDITDWASVGLMPTNIPP
                     KIDNIVKWERKGN"
     CDS             complement(465195..465383)
                     /codon_start=1
                     /locus_tag="GM3709_396"
                     /product="hypothetical protein"
                     /protein_id="BAQ63631.1"
                     /transl_table=11
                     /translation="MYRFPLSNISKKLLKADNTERNIYKISLSGYGIHWLIIDEDLSI
                     DSLLKLAQLNHYQLPKVS"
     CDS             465644..467044
                     /codon_start=1
                     /locus_tag="GM3709_397"
                     /product="diaminopimelate decarboxylase"
                     /protein_id="BAQ63632.1"
                     /transl_table=11
                     /translation="MLLTEKSTAEKLILTSDSQSSPNQRLLPLTATINEQNHLEIGGC
                     DVTELVTQFGSPLYILDEKTLRTCATQYRDAFKEFYPGESQVIYASKAWSCMTIVSIL
                     ASEGIGFDVVSGGELYTTTKALEISGYTENQISDKIYLHGNNKSVSELELAIDSQCKI
                     IVDNWLELETLAQLTAQKQQCVNILIRLTPGIECHTHEYIRTGSIDSKFGFSVHQLEA
                     VFTFVKQQSYINCIGLHAHIGSQIFELQPHHDLAGVLADWFKKALDYGLPVKELNVGG
                     GLGIRYTESDDPPSITAWVKTVATAVKKACEERNLALPKLIAEPGRSMVATACVTAYT
                     VGGRKVIPDIRTYVSVDGGMSDNPRPITYQSLYQVVIGNKMREGNTEKVTIAGKHCES
                     GDILIKDIEIPDTQPGDVLVVLATGAYNYSMASNYNRLARPAAVLVNQGEANLIIRRE
                     TYDDLVKQDLIPSRLS"
     CDS             467342..468145
                     /codon_start=1
                     /locus_tag="GM3709_398"
                     /product="hypothetical protein"
                     /protein_id="BAQ63633.1"
                     /transl_table=11
                     /translation="MKNCQNIALKTLLISLLLSSCTPNQVTPEESIAQASLTLVANGE
                     DFVRQGFVSKDGWRIDFNNVNVTLGETIAHQTNPPFSAEGEGELQPIKSISIIDKPVT
                     INLAEGDENAPPIKVTEVIAPIGQYNALTWKLVNNNFNSIVLDGTATKDSKTIKFTIN
                     IPLELSYVCGEFIGDERKGILEEGKSAELETTFHFDHIFGDKETSADDELNLGALGFQ
                     PLSNLATNGVLNTDLSSLKNSLTPEDYGKLVDNFRSLGHVGEGHCRLLQ"
     CDS             468540..468767
                     /codon_start=1
                     /locus_tag="GM3709_399"
                     /product="hypothetical protein"
                     /protein_id="BAQ63634.1"
                     /transl_table=11
                     /translation="MAIAPSVSADDKPPRNAKPLSEIIKNLENTGYSPIVDVDYDDNQ
                     GWEIKAYRNNQKRELKVNPVSGDILSDKQED"
     CDS             complement(468764..469231)
                     /codon_start=1
                     /locus_tag="GM3709_400"
                     /product="hypothetical protein"
                     /protein_id="BAQ63635.1"
                     /transl_table=11
                     /translation="MKISQLKTVKLSAIALIISGSGLFMMNQLSTPVQANNVTPVIIA
                     QNPIKTGKFVTVKQEKQTTGEVKIITENGKRYLELSSDFTTAKGPDVQVILHRNAQIE
                     VNPKQTEYFNVAMLKSFNGGQRYLIPDHVNINDFKSVGIWCREFNVTFAFATL"
     CDS             469738..470922
                     /codon_start=1
                     /locus_tag="GM3709_401"
                     /product="GCN5-related N-acetyltransferase"
                     /protein_id="BAQ63636.1"
                     /transl_table=11
                     /translation="MNTSTCSKSSLKIRAIQYRDLNSVSTLLQQRLSIEYNNCQALLL
                     ERVQKYQSFYGLLELSKLFSVSNDFYIYVAEKDQQIQGLIQVAPFNHTRSTWKVEQVL
                     INYNTSISHLLIGNRSIGSQLLRHCFEKIWEARTWVLEVNVNEKNTLGLYRENGFQPL
                     AQITHWHCPPTLLQKLAQQEPNLPNLLPVSNADAKLLYQLDCVSMPPMLRQVFDRHID
                     DFKMGLGRFILQQIQGWLTHSSEISAYVFEPQRKAAIGYFKLYLSKDGSKPHEAILTV
                     HPAYTWLYPKLISQMATVIQSLPPQSLLVTSSDYQPEREEYLEKLGAERVDQNLLMSR
                     SVWHKLREAKPLESLNLPEVLNGLKPVHTPIPTPWIKSWLENTYNSSSLPNHPDSHNS
                     NE"
     CDS             complement(471052..471582)
                     /codon_start=1
                     /locus_tag="GM3709_402"
                     /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
                     /protein_id="BAQ63637.1"
                     /transl_table=11
                     /translation="MIFFETKLKGAYIIKPEKITDERGFFARSFCQKEFNKYSLNSNF
                     VQCNISYNKIKGTLRGMHYQNLPYPEAKLVRCTQGAIYDVIIDLRKNSPTFKHWIGEK
                     LTAKNHKMIYIPEGFAHGFQTLEDDSEVFYQMSEFYYPECAKGIKFDDPNFKIEWPII
                     NKIISERDISYHLWDE"
     CDS             complement(471587..472810)
                     /codon_start=1
                     /locus_tag="GM3709_403"
                     /product="methyltransferase"
                     /protein_id="BAQ63638.1"
                     /transl_table=11
                     /translation="MQNFSCRSCGNLNLNLVLSLGKTPLANRLLTKKQLTEDEPIYPL
                     DVVFCPDCNLVQITETIPPEILFKDYFYFSSFSDTALENAQNIANYIINKYQLNKNSL
                     VIEIASNDGYLLQNYQQKNIPVLGIEPAQNIAKIAQEEKGINTITEFFNAELAKKLKL
                     QNKQADVIHANNVLAHVADLNGVVEGINILLKPEGIAVIEVPYLKDLIDHCEFDTIYH
                     EHLCYFSLTALDNLFNRHNLTIFDGEKISIHGGSLRLFIGKNKSQLKTIKDLLKEEQN
                     LGINQFYYYENFAHKVEKLKINLIDLLHRLKAENKTIAVYGASAKGSTLLNYFKLGKE
                     TIDFVVDRSTIKQGYFTPGTHLPIYDPAKLLEIMPDYVLLLTWNFADEILRQQAEYRD
                     KGGKFIIPIPELKIV"
     CDS             complement(472853..473827)
                     /codon_start=1
                     /locus_tag="GM3709_404"
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="BAQ63639.1"
                     /transl_table=11
                     /translation="MMNKFWQDRTVFITGATGLVGGWLVKYLINTGADIVCLIRDWIP
                     QSLLIQTKDFEKVKIVRGDITDQCLLERILGEYEIDTVIHLAAQTIVGVANRNPISTF
                     ETNIAGTWRLLEACRLSPTVKQIVVASSDKAYGDQLILPYDETTPLQGKHPYDVSKSC
                     SDLIAQTYAHTYNLPLAIARCGNFYGGGDLNWNRIIPGTIRSIIKGENPIIRSDGKYI
                     RDYLYVEDGANAYMLLAQKLAENSELRGEAFNFSLEIKLTVLELVNHVLKLMNSDLQP
                     KIINQASNEITAQFLNSKKAREILSWTPLFELEKGLEKTINWYRESLK"
     CDS             complement(473827..474597)
                     /codon_start=1
                     /locus_tag="GM3709_405"
                     /product="glucose-1-phosphate cytidylyltransferase"
                     /protein_id="BAQ63640.1"
                     /transl_table=11
                     /translation="MKVVILAGGLGTRLAEETEIIPKPMVEIGDRPILWHIMKIYAHY
                     GFNDFFIALGYKGDYIKRYFLDYCHINSSMTINLKNGHINTHENKAEDWQIHLMDTGL
                     DTMTGGRIKRLQPWLENDTFMVTYGDGVSNINIQELLEFHKSHKCLATVTAVRPPARF
                     GGLMFKGDLVDQFTEKPQAGEGWINGGFLVFEPEIFDYLTGDDDGLEVALLEKLADKG
                     QLAAYRHQDFWQCMDTLRDKYRLKDLWDSGNPPWKVWG"
     CDS             complement(474870..476810)
                     /codon_start=1
                     /locus_tag="GM3709_406"
                     /product="potassium efflux system kefA"
                     /protein_id="BAQ63641.1"
                     /transl_table=11
                     /translation="MSFLFCVGFSPQVSAVIPFTPNLESPTNQLPETPTWDLNRARNC
                     GRFVCSDVFFYGNRRWYKDLITLASARDNRPIRDVSFEIEQRSRLVQYIFRQIFENIS
                     TSNQLGQTEVKDLKFWVLTSGKPIHPLTPIVDVGYENNQNVIFMAPKPELGLTQQTIL
                     TVTGIDARANNTNVEDLAQQWRIKVRDSLSEAIWGLEMDRQLPFLRLQVSVITIICAL
                     VFVFIIRMFQKLIFRHRNSLLLELKELEHSLIVDAEAIATDSSISYNDKKSQHPKESK
                     VVEEDNGNSFQNFLSRGIDGSRKLIHDGVSLSAKLLPKSIRKKQNIIRQRINIVELIM
                     SLSFLSQVTILLFTIGSIAFTYRETRFLFNLFFLQALLFPVIWILMVFCDKFVDFWID
                     YALNEWAKEQQELHPDSNRPTLRINTYSPALRGATTVFFTVSGIFLYLSFIGINARLL
                     TGAGAIAVVFAFLSRNLLEDMLNGILIFVTDRYAVGDVVNINSMGGLVEKMNLYTTSL
                     RDLDGNLTVIPNGRINTVINMTKDWSRVNFTVEVTWDTDLKGVVTILKYIGEQMYDDP
                     QWREKMLSPAEVLGLDRINYEGIMIRVLIRTKPIQQWDVGREYRWRVKEAFDLAGIKI
                     GVPQTEILHRPSENNIIPSLYN"
     CDS             477097..478467
                     /codon_start=1
                     /locus_tag="GM3709_407"
                     /product="predicted glycoside hydrolase"
                     /protein_id="BAQ63642.1"
                     /transl_table=11
                     /translation="MSSFVFSQWLSLRVLKLLSLFFASYFTILLISVWNVPVFSQNTP
                     EIRAVWLTTSDTDTLLDRPKMKEAIANLASLHFNTIYPVVWNSGYALYPSKVAQEERI
                     QPFVHKGLQGQEPLGELIEEAHRHKMLVLPWFEFGFMAPPSSELALKHPNWLTKAQDG
                     TQSTYSAAGEVVWLNPFHPEVQKFITALVMEVVNLYDIDGIQFDDHLCLPVKLGYDTY
                     TTNLYRQETGLEPPKDYKEANWMRWRANKLTEFVAQLNQTIKAKNPNKILSISPNPYN
                     TSYNSFLQDWLNWVRKDLIDELIIQVYRSDFAVFKSEITKPEIREAKGKIPVGIAILT
                     GLPNRVTPIEFVREKTLAVRQERLGIAFFFYGSMWSTTPELRSERKSSFQYLFPYQSH
                     RIARVNPIKPNNPTNPVTSTNTVNPIKPSNPVNPSNGVTPNNSTIIDSSIDPTNVTSE
                     PILIID"
     CDS             complement(478722..480308)
                     /codon_start=1
                     /locus_tag="GM3709_408"
                     /product="hypothetical protein"
                     /protein_id="BAQ63643.1"
                     /transl_table=11
                     /translation="MQRTPFVEDSLQGNLGITLVNVGKALLILIIGLIFANIVKGQIK
                     KWLKKTDIDNRFSTMVVGDQSDNDPLIPTEKWISEIVGWIITLFVIVAFLDALELQSV
                     SQPLNLLLGEVTKFLPRIGGALLLILLAWGVATIVKLFVTKILTQFHLDEKLNAQVKE
                     DDTATITDNEPIALSETIGNALYWFVYLLFLPSILSILELEGTLSPLNELVNDILGIL
                     PNVFAAIIIAFLGWIVAQVVKKVVVNLLTAIGANNIGAKFGLSTTNRKQSLAYIIGSV
                     VYVLVLIPIAITALDALQIQAISTPAIAMLKQVLDILPKLFAAIVIIGLAYFGGQYLS
                     ELVINFLTTIGFNNVFVWLGITQPSRRFVNSEQLIDEIPINNTPINKTPAEIVGSIVL
                     VSILLVASLTAVDILQIDALKQVVAFVLVLGGQVLVGVIILGIGLYFANLVFKLIANS
                     GSHQARLLAQVARIAIIVLVSAMALERIGIAPNIVNLAFGLLMGGIAVAIALAFGLGG
                     RKTADKLLQQWLESFNKKSI"
     CDS             480607..481332
                     /codon_start=1
                     /locus_tag="GM3709_409"
                     /product="triosephosphate isomerase"
                     /protein_id="BAQ63644.1"
                     /transl_table=11
                     /translation="MRKIIIAGNWKMHKTQGESLEFLQAFLPHLEDTTETREVVLCVP
                     FTSLNFMSKNLHGSRVKLGAQNIHWADQGAFTGEVSGAMLSEIGMNYVIVGHSERRQY
                     FGETDETVNSRLLAAQKYGLIPILCVGESKTQRDAGETENIIMNQLQKGLVNVDQNSL
                     VIAYEPIWAIGTGDTCEATEANRVIALIRSQLTNKNVTIQYGGSVNPSNVDEIMAQPD
                     IDGALVGGASLDASSFARLVNYQ"
     CDS             481600..482469
                     /codon_start=1
                     /locus_tag="GM3709_410"
                     /product="dihydropteroate synthase"
                     /protein_id="BAQ63645.1"
                     /transl_table=11
                     /translation="MSDSLIIRNHRFIWGSRTYLMGILNVTPDSFSDGGQFNHLETAL
                     KQAQMMIDRGVDIIDIGGQSTRPGAKQITLEEELERVIPIIKAIREVSDIPISIDTTR
                     AIVAQTSIEKGADIVNDISGGTFDRAGAFHDRTMLSTVAKLQVPIILMHIKGTPKTMQ
                     TLTDYQDLIGEIKQFLQERIEEAITLGIKKEHIILDPGIGFAKNYEQNLEILRNITEI
                     KTLGFPVLIGTSRKSFIGKILNRENPQERIWGTAATCSYAITQGADILRVHDVSEMYD
                     VIRVTDALTKNSY"
     CDS             482579..483697
                     /codon_start=1
                     /locus_tag="GM3709_411"
                     /product="branched-chain amino acid transport system
                     permease protein LivM"
                     /protein_id="BAQ63646.1"
                     /transl_table=11
                     /translation="MVEYLVFLTISASLYALFALGLNLQWGFTGLINFGHVAFMTVGA
                     YITVLLALKGVPLIIGVMLGAIASSALGLLIGLTSLKLREDYLAIVTIGVSELIRLIV
                     QNEQWLTKGTFGVQSYPLPFGKFQPNFFGKISMIFLLTLLTAFVLWQLWRNFRQQLGF
                     NRQIQGKSFQPSSRLSIYLWGGIALTFILLVYINGSIALYNYSYKAGLMLLILIILAL
                     VYYGLDLLVHSPWGRVLKAIREDEEIPKALGKNIFWYKLQSFMLGGAIAGVAGAFYSW
                     QLTTIYPSSFEPLLTFNAWIIVVLGGSGNNAGVILGAIIFWGYDSLTRFIFSNSDIIN
                     DSQVGALRVMIIGLILMILMIWRPQGILGKKQELSLGR"
     CDS             483774..484286
                     /codon_start=1
                     /locus_tag="GM3709_412"
                     /product="CDP-diacylglycerol--glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /protein_id="BAQ63647.1"
                     /transl_table=11
                     /translation="MNVPNSITFSRIVLVIPLIYLLYQPSIIFQWLAFGIFILAALTD
                     WLDGYLARKLNQITELGKFLDPLTDKILVITPLLILIERQVIPAWGVLIILVREIVIA
                     GWRVNPQLSQKNSISGANIWGKLKTVVQITSIALLIIPLSSIWQTIGLICFWVSVILT
                     IISGIIYIRE"
     CDS             484379..485593
                     /codon_start=1
                     /locus_tag="GM3709_413"
                     /product="tRNA nucleotidyltransferase"
                     /protein_id="BAQ63648.1"
                     /transl_table=11
                     /translation="MQTSLHSFIIDNLPFPLTVLPDDCYLVGGAVRDVLLQRKKESID
                     LDFVLPHSAIKIAKNIANLSNAGFVVLDADRHIARIVFPHVTVDIANQEGDSINVDLA
                     RRDYTINSIAFHCQKQEIIDPFHGQEDINKGIMRMISQKNLEDDPLRLLRGYRQACQL
                     NFTIESATRATIQQLTSLLSKVAKERINMELEYLFASENGSYWLTEAFRDGLLSIRHP
                     YLSQTKINYLTNIDNSARWFQEKWLEFKSITPSYYQNAKLACFTDNNPENAEQELINL
                     KYSRQDIKSVTTILKYTPSLLKKDFATNLADQYFFFSAVGDILPILAIFAHAHYIDSE
                     LIILLVDRYLDDNDIVAHPQPLVTGKEIMESLQIPPSPLIGKLLTDISIAYIEGKINT
                     KDDALQWVKKFR"
     CDS             complement(485590..486231)
                     /codon_start=1
                     /locus_tag="GM3709_414"
                     /product="hypothetical protein"
                     /protein_id="BAQ63649.1"
                     /transl_table=11
                     /translation="MSNTIHRQYISPNCVLSLQGFSDDNNDVMSVLTQAECQIVGHTT
                     ILSGGLVFVENLIKAVSAYSQELLSGLSHSGQSTDDQYICLRKLPEKNRHLLIWQEKK
                     EDTNNQLEIELSTIQFFDLLDTIDQLSVDKYTLPQLEDNLYPLSRRYRQGDISIVEQS
                     TPLALGFVGLALASIALFMIPNPSTIKDPNQEPKPIPNNNTQVIPPSQTPNGN"
     CDS             486374..487456
                     /codon_start=1
                     /locus_tag="GM3709_415"
                     /product="membrane-associated protein containing
                     RNA-binding TRAM domain and ribonuclease PIN-domain"
                     /protein_id="BAQ63650.1"
                     /transl_table=11
                     /translation="MIDVIIISIFVLAFAGIGFDLIEILPDDIQNQISNIQALRWLAA
                     GFASIIGLALGLVAQTTYRRLEQKIRKTPIEVIITRAIGLVIGLLLANLMLAPIFLLP
                     IPGNFSFIKPMMAILGSIMFAVLGVSLADAHGRTFLRLINPNSIESMLVAEGTLKPVA
                     TKILDTSCIIDGRIQQLLATGFLEGQILIPQFILNELQQLADATNDQKRVRGRRGLDI
                     LNQMQETYPEKIVIHPEEYEDVTTVDAKLLHLAHDINAMLITNDFNLSKVASLQKIEI
                     LNVNDLAQAVRPIYLPGDYIDLKILKHGKEPSQGIGYLEDGTMVVVEEANGHVGEEMR
                     VIVTSALQTSAGRMIFAKTNASAVIS"
     CDS             487644..488207
                     /codon_start=1
                     /locus_tag="GM3709_416"
                     /product="lipase"
                     /protein_id="BAQ63651.1"
                     /transl_table=11
                     /translation="MVHGITDTGNVFNSMKSYFQDKGYTIYTIDLIPNFGTADLRDLA
                     QQVKLYIDSKFNSEEKIILLGFSMGGLVTRYYLQRLNGLEKVDQYISISAPNNGTNLA
                     YFVPLKGILQMRPYSKFLQDLNQDVKETLGKIKCLTLWTPFDTMIIPAKSSLLNLGKE
                     VRVPVLIHKWMLSDNRVFLKIDSFLNI"
     CDS             complement(488222..488743)
                     /codon_start=1
                     /locus_tag="GM3709_417"
                     /product="hypothetical protein"
                     /protein_id="BAQ63652.1"
                     /transl_table=11
                     /translation="MVNESLNHIRQTIILIKYYSFDLHSYKIIELIIKWTKIYPHHWL
                     PLGVTEAIYQGRLKAISVEQILNIWLKKGEVNQSFNYEFSCLIKPDAFFSYQEDQELK
                     YFFTNVNSQQNFDIFTVNKKSEELLKDRVINMDKIDKSSIEEHESSLNNFKPLEDYSQ
                     CFQKLKGFIAIKN"
     CDS             489147..490235
                     /codon_start=1
                     /locus_tag="GM3709_418"
                     /product="hypothetical protein"
                     /protein_id="BAQ63653.1"
                     /transl_table=11
                     /translation="MSRPVLYLAITNHGFGHAVRMTTIASQIQRLNSDILLVLVTTAP
                     RWLLESYIEGDFIYRYRAFDVGVIQSDSLTMDLEATRKKMTEYRLRENEIVAGEVEFI
                     NINKVGLILADIPAMAASIGEKAGIPCWMMSNFGWDFIYRDWGGDFVEIADWLTNRYQ
                     KCQRLFRLPLAEEMRSFPLVENVGLTGGIPRYSESELREKFNITTDKEKTILLTFGGL
                     GIEAIPYENLSRFPDWQFITFANNAPDLPNLLKITNKLDRPVDFMPLCGTVMSKPGFS
                     TFSESLRLDIPLISLTREGFAEAEILLQGLKDYSYHKIVNYQEFFEGNWDFLKTELLP
                     PQSHSKIDKNGTEFIAQEIVNFFNKSVS"
     CDS             complement(490247..491074)
                     /codon_start=1
                     /locus_tag="GM3709_419"
                     /product="hydrolase of unknown specificity RsbQ"
                     /protein_id="BAQ63654.1"
                     /transl_table=11
                     /translation="MNELVKRHNIQILGKLDAKKTLIFSHGFGSQQSTWELILPAFEQ
                     RYRIILFDLIGSTFLGMDEFDIQHYCSFKEYAEDLIKICSFLEIKKASFIAHSASCMI
                     GTLVAIKNPNFFKELIFIGASPRYLDDTNYVGGFTEKEVIEMLNAMTKNYYDWINHYT
                     VKAIDDPKQPFLSQEFAQSLLKLSPDIALIVFKMIISSDYRKEVSQLKLPTLIIQPQD
                     DMFVPLEVGFYLNKMIENSKFQILPTKGHFPHLTHPFMIAHTISRYLNRSSNKAKRI"
     CDS             complement(491346..491639)
                     /codon_start=1
                     /locus_tag="GM3709_420"
                     /product="death on curing protein"
                     /protein_id="BAQ63655.1"
                     /transl_table=11
                     /translation="MAYRVVWSPKAVEDVEAIAGYIARDSPSYAAAVVCKVIEITNNL
                     QKEAKQGRLIPEIEESTIIEQFAYSYRLIYRVEEEIVTVIALIHGKRLLYLTD"
     CDS             complement(491624..491812)
                     /codon_start=1
                     /locus_tag="GM3709_421"
                     /product="prevent host death protein"
                     /protein_id="BAQ63656.1"
                     /transl_table=11
                     /translation="MSSPKKKVESMLRKLPDDCTIEDIQYHLYVLGKVRQGLQVADTE
                     GVLQQAEVEGLLSKWLIE"
     CDS             complement(491970..492242)
                     /codon_start=1
                     /locus_tag="GM3709_422"
                     /product="hypothetical protein"
                     /protein_id="BAQ63657.1"
                     /transl_table=11
                     /translation="MPKLTPNSPLYNFPLPEIENWLRKMGCEQNPQELNCWYVKKGEW
                     EANITLEIEDLIVSYLHAGGDGSDIKRAFRYSLSRQDIENAVFSGP"
     CDS             complement(492297..492764)
                     /codon_start=1
                     /locus_tag="GM3709_423"
                     /product="DnaJ-class molecular chaperone CbpA"
                     /protein_id="BAQ63658.1"
                     /transl_table=11
                     /translation="MNSNRTNFSFPSKGYFTNTHYGLLNLHPSASPIDIRRAYRELSK
                     LYHPDTTNLPLEEAKQKFQRLNEAYGTLANPERRSLYDLKIGYSRWNVIQSPYDFTLS
                     SPEQEDGMKSSYLDPTERPLSSGELFALLLMGITIFSCMLLAITIAWLRTSAI"
     CDS             492889..493422
                     /codon_start=1
                     /locus_tag="GM3709_424"
                     /product="hypothetical protein"
                     /protein_id="BAQ63659.1"
                     /transl_table=11
                     /translation="MIFLCAVTVWFSYSGISQADINNDRYDGNIFVVYAGNGSLVPSK
                     LTLKQSLDREKPVVLVYYLDDNSDSKQFAFIVSRFQEFYGRAASIIPINVDTIPPQDQ
                     YKPDEVGYYYKGAIPQTVVLDQQGKIVFDGIGQVKFEDVDDVLRQVFDLVPRSQSVEL
                     KRKTFNEFNSELVPEAK"
     CDS             complement(493545..494324)
                     /codon_start=1
                     /locus_tag="GM3709_425"
                     /product="phage shock protein A"
                     /protein_id="BAQ63660.1"
                     /transl_table=11
                     /translation="MGIFDRISRVVRANVNDMIDKAEDPEKVLEQSLREMGDDLVKMR
                     QAVAQAIAAQKRTEQQYQKNLSEANTWQQRAQLALTKGEESLAREALVRKKTHGDTAA
                     TLKAQLDGQVGQIDSLRRNLTALESKIAEAKTKKDMLKARMSAAKANQQLQNTISSIN
                     TNSAMSAFERMEDKVLQMEAVSQSAGEIAGYGEDVKWAQLEGGSAVDDELAALKAQLS
                     GTPEPTASLPPSVNTSESSQTSASVVDNELEELRRQLQKDY"
     CDS             complement(494484..495059)
                     /codon_start=1
                     /locus_tag="GM3709_426"
                     /product="signal peptidase I"
                     /protein_id="BAQ63661.1"
                     /transl_table=11
                     /translation="MTKVTENISKSDPKISFWTPIKENFVIVVIGLILAVLIRIFIAE
                     PRFIPSESMFPTLSIGDRLVVEKISYYFTPPQDQDIVVFTPPPQLQVLGYDRDQAFIK
                     RIIAHAGEIVEVKEGKVYVNEKPLSENYILEPPNYNLNSVVVPEGYVFVMGDNRNNSN
                     DSHIWGFLPQENIIGKAIFTFWPPQHLGKIS"
     CDS             complement(495219..495839)
                     /codon_start=1
                     /locus_tag="GM3709_427"
                     /product="hypothetical protein"
                     /protein_id="BAQ63662.1"
                     /transl_table=11
                     /translation="MIMTQSMRSSVPKASRKLIGEILQEAGLISSEQIQIALGVQSQC
                     LKLRIGEILALKGWLKQETVDFLVAVCLENKAITSNHLQPIGYYFQKAGLLTEEQINN
                     VLKDQKKLGIKFCYLAVMKGFLKQKTADFFLDNMANKSPEVSLKINQYDHRSQTQTVI
                     GDYNLYESIKDQETIIIESDRKEKININYSYVQDQEIEYSPIWIDV"
     CDS             496034..498076
                     /codon_start=1
                     /locus_tag="GM3709_428"
                     /product="hypothetical protein"
                     /protein_id="BAQ63663.1"
                     /transl_table=11
                     /translation="MFKFIRQNFWQKLISIPLGVLTTTPVMASIPRNPDQVVECEILV
                     VGSGLAGAATAYEALLMGKTVCLTDITDWVGGQISSQGTSALDERSTQRKELFFPRGY
                     LELRANLEKFYGKSNPGECWVSSSCFLPKDAGEVLKNQLKEAAKKGKGTLKWFPNTVI
                     KDLKIETVANAGTGQQIVEAIAIQHEAQPNTPPLNTEPLSKVIEDAYTYADSPRLKKN
                     IIKFTSPKNPKTKGKANWFVIEATETGELIGLTDVPYRLGIDPRSELEPSSSSTTQDP
                     YCTQGFTYTFAMEQTAEPQPQPEPSFYKQYEPYYSYELKRLADFDLVYTYRRIWKAEP
                     SETVTFEGINFSKPTPGDISMQNWTWGNDYRPGTSKDNLIYTKEQLQQTGQFKPGGWM
                     GGLRTETLRKGEENAIGFYHWLVAGTTDSQLGDGVKKPYPNQKLLKGLDSPMGTMHGL
                     SKYPYMREGRRIIGRPNYAHPDGFMVNEIDISRRNYQDDYYRKTLPPDQYRRLQALLS
                     GLEGFSVLSGQVSPDEVKNRTRSTIYPDAVGIGHYAIDFHPCMTESPHEKPGNKERKG
                     ERRGQGQAYPFQIPLSAMIPQKIDNMLVVGKSIATSHIAAAAYRVHSFEWSSGAAAGI
                     TASLALKKGILPYEFTEGFAFKNKNLQELKITLDKSGNPTQFPNTSIFNQNWDDWR"
     CDS             498515..499642
                     /codon_start=1
                     /locus_tag="GM3709_429"
                     /product="aldo/keto reductase family"
                     /protein_id="BAQ63664.1"
                     /transl_table=11
                     /translation="MKYRRFGKTELNLSIFSLGLMRCCYEESQLLNTLQKALELGINH
                     LETARGYGESEKYLGLALQKLKIPRNQIFITTKLTPVNDSQVMKKWLDESLQNLGIDY
                     IDCLAIHGINTWQHLDLLTEGNSYLTVLSQAKKEGKIRHLGFSTHGSLELISATLSTG
                     FFEFVNLHYYYFFQHNYPIVELAEKMDLGVFIISPADKGGRLYQPSTKLKQICHPFSP
                     LLLNYRFLLNNRSITTLSVGASNPEELTIPLSVADEDGELTSLELEIFDKIDKTLQDT
                     LKLDRCSQCYQCLPCPENINIPEILRLRNLGVALDMTDYASYRYQMLENAGHWFWGKK
                     GDKCTDCGECLPKCPENLNIPDLLRDSHTRFNGSARRRLWE"
     CDS             complement(499704..500933)
                     /codon_start=1
                     /locus_tag="GM3709_430"
                     /product="hypothetical protein"
                     /protein_id="BAQ63665.1"
                     /transl_table=11
                     /translation="MLRKIQSFISLFFTKSRNINNEPVNKVSLTVIIIIDLFILFNVF
                     AGLDDISRWYLSPSQAYPCYSQWQNYQQDTRVDRDFLIVSEALNKVYNSPENYEESPE
                     GHLGKVSPICINFTTLKDNINKPNNKLIFTTIEDKQKQVTSLEEKNQTIRNQYDSTLL
                     EKIAGQPSNLSINQVEAQKARQELDKNNLNINSLQKEIKDLKQQLLATPESVNFISFL
                     NSEIKFNEVKQGYEKALFWYPSIQIIFQLLFLLPLIFISLFVHKLSIKKGYGLISLMS
                     WHLLVIFFIPLLIKIFEFLQIGVIFKFFFDIITVIFGGLLFLINYLYIFLIPAIGFGI
                     IKFFQQIVFNPKNQASKRVEKSRCLNCGKKIQRDHHHCPHCGYSQYVECHNCQSLTYK
                     LMPYCYHCGTVQNENEQ"
     CDS             complement(501083..503227)
                     /codon_start=1
                     /locus_tag="GM3709_431"
                     /product="ComEC/Rec2-related protein"
                     /protein_id="BAQ63666.1"
                     /transl_table=11
                     /translation="MTKKNNLDIYRGLIAYIAGLLFTGFFLQSQGLLFSIGILTISIV
                     ISVIIFFKPITGVNISSIFLLGLIVISGFFYYYWRFPSLDSLDIRNQISSVNSANNVA
                     VTGKIISNPRLNQNQKARFVLQAEKLITSEGNSPTVTGKVYVTAPLLSVIGLFPSTQL
                     TVIGKLYQPLPPLNPGGFDFASYLEREGIFSGLSAKSVSLKKEGNWWQKALFYLRLRM
                     IQTHVRYLDVPLGNLVSSMVIGSRAVDLDFDLQNSFRLAGLAHTLAASGFHVSLLLGT
                     VLFFTRSLSPRHRLWIGILSLLIYTTVTGFYPSILRSSLMGIVGLIAMINERSVKSSG
                     ILLLAGVILLLINPLWIWDIGFQLSFLATLGLIVSLSPIVNKLDWLPPTIANLVAVPL
                     AATIWTLPLVCYHFNHIPVYGILTNILATPFVIIITLVGIFSAFIGVFIPVLGSSIAF
                     LLYPVIRLLIILVEISNKLPFSSLAVGKISIISLILGYLIIILITFNKWCQKYWLSLT
                     LFTFIFLTIPLIYQKFTLQQLTIMTTRDKPVIVIQNRGKNAIINLNDKNNVLFNLLGF
                     LKSQGINNLELVLVNNNTSNQLALKVLQKYISIESVIYPTQKTINSLQIIDKNNNYIY
                     FQLFNSSWLLLQETKNIIFPETIKTDIIISPNNLKITQILKLKPKVLITNLSTLNKKN
                     LEDLSINNIKILSWHNGAIQWQPETGFINYDE"
     CDS             503789..504853
                     /codon_start=1
                     /locus_tag="GM3709_432"
                     /product="mannose-1-phosphate guanylyltransferase"
                     /protein_id="BAQ63667.1"
                     /transl_table=11
                     /translation="MTTKKFIPVILAGGKGERFWPLSRVQYPKQFLCLDRTGRSLLQN
                     TALRLLSLAQGWENIIVITSELLAEGVKQQLPLLPLNNILVEPMGKDTAPAVTWASLY
                     IKSYYGNDSIVGFFPADHYIGNQEEFEKIIETGVNFAQENEAIVTLGIKPDYPSTGYG
                     YIEQGEVTTEKNNRPIYRVTRFTEKPDRVTAEKFIATNRYSWNSGMFIFQVDIVLKEL
                     EKYAPEILQNLQEKGKLAYQDLEKISIDYALMEKTTLAYIIPSDFGWDDLGDWNALER
                     LLTPEESNVVIGNHINLDTKNSIIYNNQSEEVIMTIGLEDVVIVREGNATLVVNKNKT
                     QDIKKALQILQQKKDSQNFL"
     CDS             505241..507040
                     /codon_start=1
                     /locus_tag="GM3709_433"
                     /product="sulfur deprivation response regulator"
                     /protein_id="BAQ63668.1"
                     /transl_table=11
                     /translation="MDISPIFLTIIVLIVALIAFIAEWLPVDLTSLSVAVVLMVLGLV
                     SPDEGISGFGNSATITVMAMFILSGGITKTGILNIVRDWLIKWGGKNPTRQILVMGTI
                     VGSISAFINNTAVVAIFLPIVEQWSKQTKVSVSKLLIPLSYATVLGGMITVLGTSTNI
                     LASGVAVQLGYPAFSIFQFTALGLPVFIIGLIYLSLVAPKILPARKPAGGESLSEDYE
                     LNEYVSEMIIPPKSSLIGQTLRTSEIQRKFDLDILEIIRNDEHFPPPLADKLLAVGDI
                     LLVRGSRNNLLNIKDERGVEILADYKFNSDNLEKDNNNKEEKIAEVLILSNSRLIGST
                     LKDIRFRQRYNCTVLAIRRGQELIRERLGKVSLKFGDLLLIQAPKESFIGLQTTRELL
                     VLEEKNRDGLRQDKALIALVIIIGVILISALDIVPILVSSLVGVILMVITGCLKPGEI
                     YGAVRWDIIFLLAGLIPLGIAMDNSGTNQWLADNLLGVAGNLSGYWILVLFYFATSML
                     TEVLSNNAAVVLMIPIAVKIAENLGYDALSFMYVVTFAASNSYLAPIGYQTNTMVYAP
                     GGYKFLDYTRIGLPLTVTLTLITPLLVIKIFGI"
     CDS             507343..507894
                     /codon_start=1
                     /locus_tag="GM3709_434"
                     /product="ADP-ribose pyrophosphatase"
                     /protein_id="BAQ63669.1"
                     /transl_table=11
                     /translation="MSKKQELPEILAPRLFFQGRKFQFEVNKLKLPNGAQGEWECIRH
                     PGGALAVPVTDDGELVLVRQYRFALKSRLLEFPAGTVEKGENPETTIKREIEEETGYT
                     AKKWQNLGTFPLAPGYSDEYIYAFLAQDLEKLPNPPSQDDDEDIEVVLMTPSAFEKLA
                     LTSNEIDAKTITSYFLARHFLVS"
     CDS             508031..509656
                     /codon_start=1
                     /locus_tag="GM3709_435"
                     /product="hypothetical protein"
                     /protein_id="BAQ63670.1"
                     /transl_table=11
                     /translation="MAPSKSKKNGGCFTFFILTLLATGAGYYYGKNFLLGSELTLESS
                     SQVIPQSALANTFISTNQEQWAKLEEFSTPFTQEMIDKNWKKLVNDNLGQQNQNIDYQ
                     QDILPWLGGISFAVLPSSESEINYDIVTILGIKNKLKANSFLQKIKQNNTEKPIETKY
                     QNITIYQIDNNNNQIWVSVFNNYLVIAEEEKIIQKIIDTYKGGESLADVSSQNLPSQN
                     GILQVYLPDYNNWFLNIIKDTLPEINIENSAQAQLGKIDSITMNLSVENHGLKLSSLV
                     NLSQPVTFNPNIKPVSNNLLTKIPDNTICLVSGGGVNQIWQELNKEKQNIPELDLFIS
                     QAKIVTLQWLNLDLDKDIFSWLDGEFALALLSPNNNQFSQGLNGLLLLESSNKTQGEA
                     TFKNIENAARLFPFIQINQNNIDGISITEWSSPQEKLLSYGWVNNNNFLLTFSSNFQD
                     IKNMEKSNSLSENNVFKIATESLPKTNYGYFYCNLEKAFSLAENLDDNLWDSSTLEFK
                     AFANSITAIAITNSPVNNSTNQVDLNISLSKNK"
     CDS             complement(509777..510610)
                     /codon_start=1
                     /locus_tag="GM3709_436"
                     /product="hydrolase"
                     /protein_id="BAQ63671.1"
                     /transl_table=11
                     /translation="MKSTENKVKVGSLEWFYRENLPCENNDKTPVVLLHGLMSQSFCW
                     LEIMPILAEYGYRSIAPDWLGWGLSDKPDKRDFDYTPSAYITAFKALIEELKLEKISL
                     VVQGFLATVGIQYALQYPDKIDKLVILNTPIFSSEKLPWQMAQCGFPLLGDMVTQDPL
                     IVDRTLEKGSGFVISDQNLAFYRKPIVTSSLAGRTLVTIVKKLNIKQVTEEIEMGLKQ
                     WEKPCLIIWGKDDPWLKFEPLEELVKDNNKLKLIVLEEAKHYPQEHFSKEITPNLVNF
                     L"
     CDS             complement(510827..511687)
                     /codon_start=1
                     /locus_tag="GM3709_437"
                     /product="internalin"
                     /protein_id="BAQ63672.1"
                     /transl_table=11
                     /translation="MSLFKFSLIVGFLATNLSTGNAIAQHRFTIAQTNISITSFSDWC
                     SQEKSLPEATQKTINAIVKSLRVENCQQAAEIVPKVFSINISSQEISDLRPLASFINI
                     SELTLYDNEIVDISPLKSMINLKKLILGHNQISDLTTLNSLTNLEKLYISDNKIDDIK
                     PLSSLTKLQTIYINENNVSDLQPLNNLTNLRELYANNNKIFDLTPLSNLTNLQELYLD
                     KNEISNLSPLSTLKNLEELSLNNNKITDSDIESLWDLDSLKQLYIHDNPVSRQFCPNN
                     KNALCFIGNR"
     CDS             511794..512201
                     /codon_start=1
                     /locus_tag="GM3709_438"
                     /product="hypothetical protein"
                     /protein_id="BAQ63673.1"
                     /transl_table=11
                     /translation="MTSPTPIKSSSIYYSPNTIKRGEKALRCTPFQLTLFMTMINASV
                     DLKEITLQRGLEKNYTVKSIPENKVENELMWLIKVGILRREVDGQGITDSFRLTPLGR
                     IIMENWQKDFGKIPPATWKDYLLNFLNYYLNLG"
     CDS             512296..513768
                     /codon_start=1
                     /locus_tag="GM3709_439"
                     /product="cobyric acid synthase"
                     /protein_id="BAQ63674.1"
                     /transl_table=11
                     /translation="MGTTSHAGKSSLVTALCRLLWRNGWLVTPFKGQNMALNAYVTAT
                     GGEMGYAQALQAWGAKVVPRVEMNPILLKPQGNMTSQVIMKGEVVGVTNAKEYYQNYF
                     EKGWEVITESLETLAQEFDLVVCEGAGSPAEINLKHRDLTNMRVAKHLNADTILVADI
                     ERGGVFAHIVGTLELLDPEERSLIKGIVINKFRGDKTILDPGIEWLENYTNIPVLGVI
                     PWFDSALPSEDSLGLLDRSSRKKVYELKINVIKLPHISNFTDFDPLEAEDSVLIEYIE
                     PNGKLGYPDAVIIPGTKTTIADLKILEKTGMMSQIREYVESGGTILGICGGFQMLGNK
                     ILDPEHLEGLEENCQGLDLLPIKTILKQEKITRQREVSANYPQQGLPVDGYEIHQGYT
                     EMIPFLVKQRKIRYLPLFDDETLGIVNEIQSVWGCYLHGIFDNGAWRRAWLNSLRQKR
                     GLPSLPTGISNYRQQREELLDSLADLVEKHLNLESFFHNF"
     CDS             513987..514958
                     /codon_start=1
                     /locus_tag="GM3709_440"
                     /product="3'(2'),5'-bisphosphate nucleotidase"
                     /protein_id="BAQ63675.1"
                     /transl_table=11
                     /translation="MSYQTEKEIAISAVIEAAKLCEKVRQDIPPALEKQDKSPVTVAD
                     FGSQAIICKALKEAFPDIPIVGEEDATEIRQSTSGDTIKKITDYVREIIPSATTDQVL
                     DWIDYGNGKVTNKFWTLDPIDGTKGFLRQDQYAIALALIEDGEVKLGIMGCPALKLGT
                     EETGFIFVAVKGEGSYKMSLTGGEWSKLQVVSQEDKTRFRFVESVEASHGDQDQQNAI
                     AKAVGITTNSVRVDSQSKYGIVADGEAGLYLRLPNPKYPNYRENIWDHAAGSIVVEEA
                     GGKVTDMYGKPLDFASASKMNDNRGVVVTNGLIHDTVISALSMMNSQ"
     CDS             515023..516360
                     /codon_start=1
                     /locus_tag="GM3709_441"
                     /product="potassium uptake protein"
                     /protein_id="BAQ63676.1"
                     /transl_table=11
                     /translation="MTIARTICLGFIAVISIGTLLLMMPFSTETGEWGDFITALFTST
                     SAVCVTGLTVVDTGTYFSLWGEFFLMCLIQVGGLGYMITTTLLILLIGKKFDFRQKIA
                     INDSFDRPFLQGSRNLVISVFATTFILESVAIVGLFSVFAKDYGFLQGLWLAIFHAIS
                     AWNNAGFSLFVDNLIGYQTSIPVNLIISALIIFGGIGYQVIIECFFWILDKFNSKNNQ
                     KFDLSLNFKVVTRTTLILLLFGTIAFFITESHNENTFANFSYHEQLIMAWFQSVTTRT
                     AGFNSIDIGKMTMAGLFISIGLMFVGASPSGTGGGIKTTTLSILLNSTKAVLRGQEKV
                     IMYKREVAVSLILKAMAVVFGSAMTVVMMTLIISLLHPDFQFIAILFEVVSAFATVGL
                     STGITASLSALAKLALVFTMYLGRVGVLLFMGAIVGDPRPSRINYPPENLLVG"
     CDS             516367..517119
                     /codon_start=1
                     /locus_tag="GM3709_442"
                     /product="Trk system potassium uptake protein TrkA"
                     /protein_id="BAQ63677.1"
                     /transl_table=11
                     /translation="MSDNNNPSSNTAQQKLKNFFSLDLSSLKFLNSLRKSSRQFAVIG
                     LGRFGRAVSETLYNMGYDVLGADVDEKLVAQALTDKIATNAIRLDCTEANALKEAGIF
                     ELDTVIIAIGNYLEESIITTLNVKEAGVKYIVAKASSETHGKLLKKVGADLVVYPEHD
                     AGCELAYTLTKPGILDRFELDPDNSIVEVCIPPEFDGKTLAEVKLRSQYGLNVLAVGN
                     DDKFIINPPPQYVLTQGLSMVVIGSNKDINRL"
     CDS             complement(517355..517513)
                     /codon_start=1
                     /locus_tag="GM3709_443"
                     /product="hypothetical protein"
                     /protein_id="BAQ63678.1"
                     /transl_table=11
                     /translation="MKVCIKCKGTGKILEKRLSEYLNSFDYYPVPCPHCQQEEDTLNL
                     PKVYSLNN"
     CDS             complement(518327..519070)
                     /codon_start=1
                     /locus_tag="GM3709_444"
                     /product="permeases of the major facilitator superfamily"
                     /protein_id="BAQ63679.1"
                     /transl_table=11
                     /translation="MLNHSLLSQLTTFFPTVRENFAEILFSWWWQKEKRQNVLVFFAS
                     AFLVSIPVFFQAPLVRLFPLISLLLTFVWIQLSFSLKRQPESYIWGDILWGFSWSWLC
                     GSIYWGWLRDNPAIHIPIEAIGLPFALWCIWKGWGLIGNYFYLGSLIGTAITDLYFYI
                     AGLIPYWRELMITDPSLVKPILQSSIAQVQTVWGISWAVLLANVLLGISLYALQKKET
                     HYIAFAGAVLSTIFTDALFLIAAYLGMNS"
     CDS             complement(519217..523518)
                     /codon_start=1
                     /locus_tag="GM3709_445"
                     /product="circadian input kinase A"
                     /protein_id="BAQ63680.1"
                     /transl_table=11
                     /translation="MPQLLQSNKSKKTPFSNISLKWVLIVPFVVQILGAVGLVGYLSY
                     KSDRESIKELIVEIHRETTNNVVGYLDNYLATPVLINRINADAFRLGYLNLNNTSQLE
                     QYLYNQLQQFPKVSHIMVGTEKGVFRVANRNPSPSILETNPNKPNQLDVYKVDEKGKK
                     TQLINSFQPFNLQSRPWYKFAVKAGKPVRIPIFQLSDNSDLSLNSSYPIYDSKTGKLL
                     GVFSAASDLNFFRKYISSLQIGKNGRVFIVDKNGFLIGNSTNHLPFHKTEKNGEIILE
                     KIKAIDSEDSLIQATSRYLTNQFNGFNNINQKLPLDFLREDNGDRQFVQVVPYEGNLD
                     LDWLIVVVVPESDFTTKIEDNNRRTIFLSFLTLITTTGVGILTARWMSAPISSLSQAS
                     KSLAKGEDYEALSENHFIREIGILSVSFNQMAQQIQESFNNVERALKESEAKYEITLT
                     TLQESEARWQLAVEGSGDGTWDWNPQTNQVHFSRQWKLMLGYDDDEIGDRIEEWSDRV
                     HPDDIASCYEDIAKYLRGETTIYQNEHRMLCKDGTYKWILDRGQVIERDDKGQPLRFI
                     GTHSDIHNRIQTELELKDSERKYRELINNLHAGMVVHDKNSAITLCNSTASKLLGLTF
                     EQMSGKTAIDPAWHFFLENSEIMPFEAYPVNQVLKTQQPLRNYLVGINRPIDQSRVWV
                     LVDAFPEFDSKGEIKQVIVTFIDISDRKRIEIELQQSQAKFQRLVEDIGEKFVVFSHN
                     GIEGIVNYLSGGFASVFGVSQENMIDKYWGKSINWLPESIEIATDSIIQMTENKADFM
                     QFEMSFIHPDNSVHTIQVSQHPARDNNGNVVAIEGIVEDITERKKAEKTLQSQFNKII
                     LLRKISDKIRQSLEIEIILESGVNEIGKVFNVNRAVIFTCYPDKEKNITKVVSVAVYI
                     SGDYPSFLNIEIPVIGNPYMETLVTQEGAIPVDDVTTYLPLANVQNIMELMQIKSLLA
                     AGTFYQGEVNGAIGLHHCDKHHHWTEDEIELLESLAGQFGIAIAQSKLLKQEQERLQE
                     LAQKNTQLQKAQQSAEAATQAKSEFLANMSHEIRTPMNGVLGMTQLLSMTNLTDEQQD
                     IVKTIKDSGDALLTIINDILDFSKIESGKLELEEHPFNLPKLIKSVSNLMSQIAESKN
                     LNLKYSINPDVATNFLGDTSRLRQILLNLMGNAIKFTHQGEIFMNITNYKNSSENLIV
                     SVKDTGIGIDGDRLKKLFQPFSQADASISRKYGGTGLGLAISKSLINLMGGTIWIESK
                     GNIGGNPDDNWVLDSCTEGTTFYFTLRLKTSLDSDIQEAKITEKPLESLQSDKSNLKI
                     LLAEDNKVNQKVALLTLKKLGYTADIANNGVEVLQMLEKQFYDLILMDMQMPEMDGLT
                     ATKIIRESSQSQPYIIALTANALEGDRQICLNAGMNDYISKPIVIKELSQSLSKL"
     CDS             complement(524021..524845)
                     /codon_start=1
                     /locus_tag="GM3709_446"
                     /product="transcriptional regulator"
                     /protein_id="BAQ63681.1"
                     /transl_table=11
                     /translation="MNFFKKPFIETIDYNQIRQEQLDKIAILIKEKRLELDFDQEIIS
                     NHLHIPVSILKAIESADLSHLPEPVFTQQLIRKYANYLKLNGDELTDKFPVQLTSKIK
                     EKKYGFQGLNFSFKLNIKPQHLYLFYFLLLFFSIRNLSTILESPLFTQTKIPQKQIFE
                     TNTNPPTASPPVNTNPEIISIVEKQQEKPPTPEELTVKVTVKDDCWVKVSVDGKPTFE
                     GVLNKGLQKQWVGKQKVTIRAGNAGGLLISVNGEKPQELGKVGQVQEATFELPIRS"
     CDS             complement(524984..525733)
                     /codon_start=1
                     /locus_tag="GM3709_447"
                     /product="ribosomal small subunit pseudouridine synthase
                     A"
                     /protein_id="BAQ63682.1"
                     /transl_table=11
                     /translation="MIERVQKILREWGIASRREAETMILQGRVKVNGVNTQLGDKANP
                     SIDTIEVDGKILNKNYRPSLVYLLLNKPKDYICTCDDPEGRKTVMDLLPPQLKSGKGL
                     HPVGRLDRNSTGALLLTNDGELTLNLTHPRYHLEKTYIVTLKGNIPNKIIQQWSEGFM
                     WEGKQTLPAEITVNQRHNNQTKMEIILQEGRNRQIRNIAEFFGYPVISLHRKAIGFLK
                     VGSLPYGNYRHLTKEEITILKQSEKLVRNQI"
     CDS             525802..525921
                     /codon_start=1
                     /locus_tag="GM3709_448"
                     /product="hypothetical protein"
                     /protein_id="BAQ63683.1"
                     /transl_table=11
                     /translation="MTIFAESFIFVLSQYFHKKDFAENIVTTLSFKFKINPKN"
     CDS             525925..526644
                     /codon_start=1
                     /locus_tag="GM3709_449"
                     /product="hypothetical protein"
                     /protein_id="BAQ63684.1"
                     /transl_table=11
                     /translation="MTIKSKSEIITRFLTPAIKFWLRSQLETVEDLKMEIHAGDKQIL
                     TGKINQVSLETTKAIYQGIHVSKASVNTENIAVNLGGILRGKPLKLLQPIFVNGEVIL
                     TDNDLQTSLESSLLHQGLIDLVHLLLEHQEILNYENILAQYKFFWNNITLKDDKFILT
                     AVLTNSIEENFNLTITSSLTLKNDRILLFNPIKIIGIPEIKNIIITEFEVDLGNDVSL
                     EKLILTSQNLSCIGKLKVISE"
     CDS             526774..529521
                     /codon_start=1
                     /locus_tag="GM3709_450"
                     /product="circadian input kinase A"
                     /protein_id="BAQ63685.1"
                     /transl_table=11
                     /translation="MKISKITKNFNKLPLQIILIISFLTPTITLVGLVGYLSIKNSEK
                     IVKEMINNLSQEIATQVVQNLDSYLALPQQISQNNYRLVQGNFLSFDNLQSWEYHLWQ
                     QIQDFPNIAFIAVANTNGEYRAGERLNNNIFTINMVSPNNNFTFKSFNTNELGEKTNL
                     YKSLPNKDIREQIWYKKAITQGKQVWSDLHVSYLEPVLLISNLRPIDIDNNGKFEGFL
                     NTTIKLDQLSNFLSSLKLSPSSQVFIVNNQGELIANSTLEIPFNQKDKTLILAQNSDD
                     KLTSFIAKSLKNKISNFAEIKNTEKFIFSLDNDNYFTQVIHYQHYLGLDWFVVVVVPQ
                     SDFMKPINATFKVTILILLLALIIAIIISLLTSRWLAKPIQELATASYDLSQGNLTKK
                     IKIQGVKELTNLSHAFNYMAEQLLTSLHALEKVNNELENRVLTRTQQLAEAKDKAEVA
                     NQAKSTFLANMSHELRTPLNAILGFAQLMMRSNTLPPQDKEKIGIINRSGEYLLTLIN
                     NVLDLAKIEAGKMSLNPQKFDLYRLLDELEDFLRLNAEQKGLQLIFEKHKETPRYLET
                     DSVKLRQVLINLLSNAFKFTQEGGVSLFVKPEKLNLENEPKKINLRFEISDTGSGIEE
                     KQIQELFKPFNQTDTGKNSQEGTGLGLVISRKFIELMGGEITVKSEITVGTTFLFNIL
                     ANKVDNIPMEKESFVSRVIGLQSQDVASRILVVDDKTVNCQLLSSLLIPIGFAVREAY
                     NGQEALNVWEEWQPHLIFMDMRMPVMDGYEATQAIKSTIKGNATAVIALTASVLEEEK
                     VICLSAGCDDFLRKPFRQQAIFEIIQKHLGVEYIYESDSSFVDHNYDILTTENLMVMS
                     DNWLKEMYSATLILDEDKILNLIREIPPENQNLANSLQELVNNFQLEQITQLIETIIQ
                     K"
     CDS             529606..531180
                     /codon_start=1
                     /locus_tag="GM3709_451"
                     /product="two-component hybrid sensor and regulator"
                     /protein_id="BAQ63686.1"
                     /transl_table=11
                     /translation="MKINNYQNKRDILIVDDLPDNLRVLSEILIERNYQVRKAINGKT
                     AIRAAQLSMPDLILLDIKMPEMDGYDVCKELKSNKKTAEIPIIFISALDDTIDKIKAF
                     EVGGVDYVTKPFHVEEVLARIESQLTIQRQKKQLQKEIEQRKYTEEILHQSRAVLSSV
                     LNSSLDGIAALQAIRDNSTGEIIDFRCLIVNPVIAKVFGKNKNDLVGKIGIRKIIDKI
                     DNNLFNSLVKVVETGKSLSTDLYYQCDSLKYWFHFIAVKLGDGCSVTVKNITSRKETE
                     LELKKINLDLETFSRSVAHDLRNYINNINFAGNLLAEEINLDGSENEKELIDIINLSC
                     DRTMSILEGITQLSQLKSEPIKPISFNLSPLVSEILNYLQNNEPRINIKFMIQDDVFV
                     NADRKLLNIAIENLIKNAWKYTKKTDETIIEFGEIKSTEKLWQEKIKLIDISPLQFKQ
                     KSIYFIKDNGIGFNSVLEKELFTPFKKLHGDSDFDGTGIGLSIVRRIIELHDGVIWAE
                     SQLNQGAAFYFILATD"
     CDS             531457..532794
                     /codon_start=1
                     /locus_tag="GM3709_452"
                     /product="isochorismate synthase"
                     /protein_id="BAQ63687.1"
                     /transl_table=11
                     /translation="MLQAIIPTHQTFFYLENQQQQLTVLGFDVAQISVGKGDQRFSQG
                     RDFIQDCLSNTLIIGCNHLPFSGPHFFCNFTYTPSEIPQIWHNTVFPDATILFPQWQV
                     IRSSGLSLVSRNGTAPSSHHCLLVANLEIEPSKLTLHDRIEKIIEQVTEKLRELEKFS
                     YQSVILAQPSLKELQGKYVIPLKDYKRGVERAVRAISANQFQKIVLANAIDIKITRPF
                     QIASSLQILRHTYPECYLFAVRHGGTATFLGATPEVLLRTNDGKLITEAMAGSAPRGN
                     TKIIDVEIANRLLQSDKERYEHLVVVDFIVDCLEKLGLIPQVIKTLSLRQLSNIQHLW
                     TPIYANLPNNLHPLDIVAQLHPTPAMAGIPRNQVLTKLQDYEPFDRLLYAAPLGWVNA
                     QGNSEFVMGIRSALIEDNQARLYAGAGIVAGSNPEQELAEVQLKFRTLLNTLV"
     CDS             533116..534081
                     /codon_start=1
                     /locus_tag="GM3709_453"
                     /product="multicopper oxidase"
                     /protein_id="BAQ63688.1"
                     /transl_table=11
                     /translation="MVISRRQLLQSAIMGGGLVSLGSLYSKVSAKSSSVIIPPLPLVP
                     DLQHNFNPLILSREFDYGTVKKEKGLTVREFQLTANSQTIQLNSAISFVSWNVNNRIP
                     APTLRAKQGDILRIFFNNEDGHSHTLHFHGIHGSEMDGVTPIKRGENFIYEFEAKPFG
                     VHLYHCHIPPVTRHVSKGLYGVLIIDPPKPRPPADEIVLVMGGYDINNDDKNELYAFN
                     GIPNFFRDYPIPIYQHQLIRLYILNMIEFDSATTFHIHGNMFRVYPTGMTLTPSYTSD
                     VITMGVAERHILEFTYDYLGKFMFHPHQDYIAEHGCMGNFQVVSR"
     CDS             534121..534885
                     /codon_start=1
                     /locus_tag="GM3709_454"
                     /product="hypothetical protein"
                     /protein_id="BAQ63689.1"
                     /transl_table=11
                     /translation="MKNSQLFSFLSLLTISFTFTLFMSDYGLKALEVNNSYYKQHKID
                     HSQHQKILDKDLDFMTNLGLIKGHLMLGKELLVLGEYEQAEPHFGHPVDEIYGNLEPE
                     LEARNILSFKTELTILHDLVKFSPQDNKVMSQYDQAMVKIDEAISNLSVEKRNNSEFI
                     SQVIKNLLATVKEEYSAAIIGNKVVENVEYQDSRGFVLYSLILYENMDNNSPLKAKMQ
                     PILFQIKDAFPQAIPPETIIFSSEKMEQLVNNFPVN"
     CDS             complement(534988..535527)
                     /codon_start=1
                     /locus_tag="GM3709_455"
                     /product="mobile element protein"
                     /protein_id="BAQ63690.1"
                     /transl_table=11
                     /translation="MREINEEDLIFVDESGSNLAMLRLYGRAKKGYRVRGEKPQKRGG
                     NVSIVTAISLKEVVASRNIYGSVDGLTFEAFVIRDLVPKLWVGACVVMDNAKIHLGET
                     IRKEIEKVGASLVYLSPYSPDFSPIENFWSKVKNQIRKLKPRNYHDLVEAIGKAMEQV
                     TQLDMHNWFTHCCYCTSSF"
     CDS             complement(535524..535940)
                     /codon_start=1
                     /locus_tag="GM3709_456"
                     /product="hypothetical protein"
                     /protein_id="BAQ63691.1"
                     /transl_table=11
                     /translation="MRPYSLDLRQKIIHAREKQQCSIRQLAKNFGVAKSFVQKIIKQY
                     QETGDLKPRHSGGRPPKINPEQTVVLLEIINENNDATLWELAELFEKKTGLKLSTSTI
                     DRISRKFDDTVKKKHCMPQKNIVREFNKKDLNIGIK"
     CDS             complement(536048..536926)
                     /codon_start=1
                     /locus_tag="GM3709_457"
                     /product="mobile element protein"
                     /protein_id="BAQ63692.1"
                     /transl_table=11
                     /translation="MVISAVTTHIYDGVRSFPLDVELYEKAENFPLGKDDPQFQKKPD
                     IAFNLIEKCLNRNYHPQIILMDGGYGNNTNLLEKLEQKNLKYIGIIAKNRLVQVVKED
                     LRESEKRIDEIAKLLPQESFEEIKTGKNGEKTLWVATIKIKLSALSGIKTVAIVMNAP
                     SFEKSTDIDYLMTNETGEKVCANWIVETYTSRNWIEVFYREIKGWLGLSEYQVRNKRS
                     LMRHFILVFCADTFIQWHRLTGGLRRQWGNKPLNTFAEALEAFRTAVSFRFFQWLKDN
                     VEVFSLYKASLGFIWA"
     CDS             complement(536892..537314)
                     /codon_start=1
                     /locus_tag="GM3709_458"
                     /product="mobile element protein"
                     /protein_id="BAQ63693.1"
                     /transl_table=11
                     /translation="MKEITSSSMPPCFERWCQKIDPVLKTKAQKREFRNYLGGLLGDS
                     QRKNLTQIAHNNLDITYHKLHHFLTESTWNYDEVNNKRLEIIASCRQTKISRSFSLII
                     DDSGHRKSGNFTDCVGRQYIGEIGKTDNGNIRSHHPHL"
     CDS             complement(537440..539032)
                     /codon_start=1
                     /locus_tag="GM3709_459"
                     /product="CTP synthase"
                     /protein_id="BAQ63694.1"
                     /transl_table=11
                     /translation="MTKFVFVTGGVVSSIGKGIVAASLGRLLKSRNYSVSIVKLDPYI
                     NVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFTDTSSSRLNSVTTGSIYQAVINKE
                     RRGIYQGATVQVIPHITNEIKERIHRVAKNNSPDVVITEIGGTVGDIESLPFLEAIRQ
                     FRKDVGRDNVLYLHVTLIPWISVAGELKTKPTQHSVKELRSLGIQPDVLVCRCHTTIP
                     HNIKEKIAEFCDVPSEAVITSSDASSIYEVPLILEKEGLAQQVLQLLKLENRSPHLEK
                     WENLVSKMQHPEHKLKIAIVGKYIKLSDAYLSVVEALTHAGIHSQAEIELIWVDAEDI
                     ELQVAEKYLSNVNGIIVPGGFGNRGVDGKVKAIEYARQNKIPFFGLCLGMQCSIIEWA
                     RNTANLERANSAEFDEETPHPVINLLPEQQDVIDLGGTMRLGVYPCRLVPNTLAHSLY
                     QDEVIYERHRHRYEFNNVYKNQFLDTGYKISGTSPDGRLVEIVELPDHPFFLATQFHP
                     EFKSRPSQPHPLFLGFIKACLV"
     CDS             complement(539191..540003)
                     /codon_start=1
                     /locus_tag="GM3709_460"
                     /product="phosphate transport ATP-binding protein PstB"
                     /protein_id="BAQ63695.1"
                     /transl_table=11
                     /translation="MQESLINEEESLRNAVLELRDVDIFYGSYKAVREVNLDIAQNKI
                     TAFIGPSGCGKSTILRCLNRLNDLISSFKLKGSVTYHGQNLYAKDIDPVEVRKRIGMV
                     FQRPNPFPKTIYDNVAYGARVNGYKGDLDELVETSLRRAALWDEVKDKLGESGFSLSG
                     GQQQRLCIARTIAAEPEVVLMDEPCSALDPISTLKIEELMQELKENYTIVIVTHNMQQ
                     ATRVADMTAFFNAEAVGKGSKIGYLVEFDKTEKIFSNPQEQSTKDYVSGRFG"
     CDS             complement(540140..541024)
                     /codon_start=1
                     /locus_tag="GM3709_461"
                     /product="phosphate transport system permease protein
                     PstA"
                     /protein_id="BAQ63696.1"
                     /transl_table=11
                     /translation="MITTTIGSLKKKSSSPRVILGSVMTGLSGLCMVLTLIPLIAVLY
                     FVIIQGFSRLNVDLFTQLPPPPGLDEGGLANAIIGTLAVVGIAAILAVPIGVLAAVYL
                     SEFSNGNKFATSIRFATNVLSGVPSIIAGIFAYGLLVSSGIVGFSAIAGGVSLAVLML
                     PTIIRTTDEALKIVPQEIRWAALGVGAYNYQTVLKIVLPAALPGIITGVTLAIARAAG
                     ETAPLIFTALFSNFWPNISPQGLLEPIATLSVLVYNFAILPFPPQQELAWAGSLILVF
                     LVLGTSIIARLATRRKIY"
     CDS             complement(541085..542044)
                     /codon_start=1
                     /locus_tag="GM3709_462"
                     /product="phosphate transport system permease protein
                     PstC"
                     /protein_id="BAQ63697.1"
                     /transl_table=11
                     /translation="MTQSDSTTDNPMMGERSPLEKILDQGFKWLTFGLAISIGLVLVS
                     IAIIIFMGAYPAIAKFNIGFFTNSNWNPVTDEYGVIAVIYGTIVSALISLIIAIPLGV
                     GAAVFLSEDFIPEEIRSVLVFLVEILAAIPSVVYGLWGIFILIPITKTFGIWLHGNFG
                     WFPLFSTEPAGPGMLPAGIVLSIMILPIIIAISRDSLASLPPDLRQASLGLGATRWET
                     IFRVLIPGAISGIMGGIMLALGRAMGETMAATMIIGNSNRLSISILDPANTIASLIAN
                     QFAEASGLQISALMYAGLVLMILTLIVNILAEYIVNQVKAKYE"
     CDS             complement(542299..543438)
                     /codon_start=1
                     /locus_tag="GM3709_463"
                     /product="phosphate ABC transporter"
                     /protein_id="BAQ63698.1"
                     /transl_table=11
                     /translation="MIKSKNRLIGSLSALTFALSLTACGGGTPTTTTEGTGETETGEQ
                     TSSLSVPFESNVALTGAGASFPAPLYQNWFVALNQKLPKLQVNYQSVGSGAGVEQFTA
                     GTVDFGASDTAMKDDEIAKVSKGVLMLPVTAGSIVFAYNLPGVEGLKLSRETYVDIAL
                     GKISKWNDPKIVADNPDLTLPDKPIVFVHRSDGSGTTGVFTMHLSSISEDWKTKVGEG
                     KTVQWGPDGGKFLGGKGNEGITATIQQNEGAIGYVEYGYAKNNNLTMATIQNKAGQFI
                     TPTDEAASATLASVELPENLRAFITDPEGEQSYPIVTYSWILAYPKYDDANKAIAMEA
                     MIQYALTEGQKVAPALGYVPLPPNVAQKVAGIADQITPDFTINVN"
     CDS             543911..544891
                     /codon_start=1
                     /locus_tag="GM3709_464"
                     /product="phosphate ABC transporter"
                     /protein_id="BAQ63699.1"
                     /transl_table=11
                     /translation="MLSGCGSIKSEESKTISIDGSSTVFPITNLIVEKFNALDTDDIS
                     IESNFSGSIGGFRNFCEGKTDINNASVPIPKDFMEECKKNDIAYIELPVAFDALTVVT
                     HPSNSWAKTMTVEELKTIWQPSAENNITRWNQVNSQWPDKTLNLFGPGKDSGTFEYFT
                     VAIVGEDNSRNDYVYSEDDEALVNGVVQDPNALGYFGYAYYSQHQDKLQAVAIDNGNG
                     AIMPSDATIIDNSYRPLTRPLFIYVNAKKAQENKGLAKFVDFYLTNASQIVHEVGYLP
                     LPQSAYGVAKIHFNKHQVGTVFNGQPVLNATINELLTRTYASEGKEGYVY"
     CDS             complement(545007..546569)
                     /codon_start=1
                     /locus_tag="GM3709_465"
                     /product="NAD(P)H-plastoquinone oxidoreductase"
                     /protein_id="BAQ63700.1"
                     /transl_table=11
                     /translation="MDFSSQIASQLNAMAILPEGIVIVTLLLVLIFDLIFGRKSVSWL
                     PYLAIFGLLASVGALFYGWDNPHPTSFLGSFTSDNLSIVFRAIVALSTAITILLSIAY
                     IENTGTSLAEFIGIMLSATLGGMFLCGASELVMIFVSLEMLSISSYLMTGYMKRDPRS
                     NEAALKYLLIGAASSAIFLYGSSLLYGLSGGMTNINTISTTLLAGEGLESLGLAIALV
                     FMIAGIAFKISAVPFHQWTPDVYEGSPTPVVAFLSVGSKAAGFALAIRLLVTVFAPVT
                     EQWHFIFTALAILSMVLGNVVALAQTSMKRMLAYSSIGQAGFVMIGLVASSQAGYSSM
                     IFYLFTYLFMNLGAFACVILFSLRTGTDKISDYAGLYQKDPLLTLGLSLCLLSLGGIP
                     PLAGFFGKIYIFWAGWQAGLYSLVLVALVTSVISIYYYIRVVKMMVVKEPHEMSEVVK
                     KYPPIRWNLPGMRPIQVSLVFLIVATSLIGILSNPVVTIANKSVNSSLVLQPSMEASI
                     NTLSAREIKTVL"
     CDS             546843..548780
                     /codon_start=1
                     /locus_tag="GM3709_466"
                     /product="DNA gyrase subunit B"
                     /protein_id="BAQ63701.1"
                     /transl_table=11
                     /translation="MITENQTTNYGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLV
                     YEVVDNSIDEALAGHCTHIEVEINSDGSVSVTDDGRGIPTDVHPTTKKSALETVMTVL
                     HAGGKFGGGGYKVSGGLHGVGISVVNALSEWVQVTVWRQNQVFTQRYERGVPITELIA
                     QPDTEHSTGTSISFLPDNQIFTETTEFDYNTLSGRLRELAYLNAGVKITFSDRRIVPE
                     HIETYCYEGGIKEYVTYMTREKEVLHQDIIYVEGEKNGVQVEVAFQWCIDSYSDTILG
                     FANNIRTIDGGTHLEGLKAVLTRTVNNVARKRNKIKENEPNLGGENVREGLTAVISVK
                     VPDPEFEGQTKTKLGNSEVRGIVDSLVGEVLNDYLECNPSVADSVIDKAIQAFKAADA
                     ARRARELVRRKSVLESSPLPGKLADCSSRDPSESEIFLVEGDSAGGSAKQGRDRRFQA
                     ILPLRGKILNIEKTDDAKIYKNNEIQSLITALGLGIRGDEFDPTQLRYHHIVIMTDAD
                     VDGAHIRTLLLTFFYRYQRQLVEEGYIYIACPPLYKLERGKNHFYCYSDRELQQKIAE
                     FPANANYNIQRFKGLGEMMPQQLWDTTMNPETRMMKRVEIEDAAQADHIFTVLMGDRV
                     APRREFIETHGPRLNLTQLDV"
     CDS             549024..551387
                     /codon_start=1
                     /locus_tag="GM3709_467"
                     /product="hypothetical protein"
                     /protein_id="BAQ63702.1"
                     /transl_table=11
                     /translation="MIKQYLLIDDYDNALVFCENLIKNNPNNLDYYWYLGLIYLLMGK
                     ESSAENIWMSVIFDNVENIADISNNLVLFLDNYGVYQLEENKINNAIKIYHKIQEIEP
                     NYITLSLEFSRIINQWINEAINLTKNHLFNPAKTKYQLIIQFETNNALIWHNLALVYY
                     ELLEYQQGYQAIINAINLDPSNFLYYFYAGIFLEKTNYSQDAILFYQKAINLNPNHID
                     SYNNLGNIFIENNQLKEAEKCYKLAIKIDNKNYGTYINLGNLYLKQGKIDESLGNYQQ
                     AIILNNDEEIYFWIVNNIRSFNYIQEAIKFAKDNSKFFPNNLLINLVFYSILPYIYQQ
                     ESDINYYRNNVTYFLEKISTALTVTSESNKKSALKIIDLYTNYHLNYQAQNDLYLQSL
                     YGNFIHEVMKANYPQYCQPIKNKLTLNDGKIKVGYISYCLRSHVVGKLSLGWIKYHNK
                     ESFDVYCYYLGDFLEDKITLEFKQHSTKFYHFSDRLSTENIAQQIRENDLDILVFLDL
                     SMYPRMSQLAGLRLAKIQCTTWLHPITSGIPTIDYFISSELIEKEKAENHYSETLIKL
                     SNLSIVYAQKDIPKVNKDRSKFYLKDNNIIYITSQFPSKYLPQYDYIYPEIAMNINDC
                     QFVFIHPKVNQNNEQITNELWRRIKKNFTKYGLNWQNYCIFLPTINNSEDYWQLFTSC
                     DIFLDTIGFTGFNSTLDALESFLPVVTYSGDFFRTRQSEGILKMIQVIDTIAKNEQDY
                     LKIAIELGINSKFRESIVNKIKQNIRLVYDDLTPIKALENFYHNIII"
     CDS             551652..554606
                     /codon_start=1
                     /locus_tag="GM3709_468"
                     /product="glycosyl transferase"
                     /protein_id="BAQ63703.1"
                     /transl_table=11
                     /translation="MRVLIAEFDVFHKIGGGQTFYRRLIETNPNIDFYYLIVEEKSNN
                     FRPKNAKVLPYKQQYIKSDLQDLSTSLPLEKMYRPFLIASNISYSVKGFDFDIIDYPD
                     YEQFGLFLASALSYHQVKFSKIVISLHGIVSQSLLHDWEINKEYINNLEFVENLQYKI
                     ADIRYGISKNYLEWWQKINDIPNYYYHPLHFLDLTPKLNYQPSKTKPSLNFIGRKEKG
                     KGVDIFINLVSFLPKNLYSEGNIIGSNPETLDGKTGEFYLQQMLALRFSSINILPAVT
                     RYALQEKFALNSVTILPSRFDTLNLVALESLFSGCPTIISQNAGVCRFLEDNFSHIPF
                     IKLDIDNFYSSLPQITELLNNYHEYRLNLQEKITSFSCKLDRKELNLVDIYKQSSNFE
                     EETRKKAHQWYKELINHCQKKQYWGKSQLIEITKKRVNPIVNLVKNQVNETKIKVNER
                     KNIVTNQLIKSVFFSAEYERVLNLSYTSGKEIDDKINKLKNLSHPLKLSSQKKVNKLK
                     SGYYVNRLKIWQEIARLEKIRENNLLSASYEIRIIRLLNQDKFNQLETVTNILVNNNF
                     DKEAFLLKLLYSPAKNSPQLAYEYLLNNYQSLLNYQEKSYEFIKDYRQKKNYRVSIVV
                     SLYNAENKLKHFLSILAQQTILLKQDAEIILIDSGSPQQEYQVFQQLLPTLNLPILYA
                     RSEERETIQSAWNRGILLSQSPYITFLGVDEMITADGLEILADKLDRNDNLDWVVGNS
                     LVTEVDEKGNWQKDLMTYNRRNFNQDLVYLDTCYLTYVGGLYRRNLHFRFGFYDETFR
                     GAGDTEFKNRVLPYINCELVENVWGIFWNYPDDRTTQSPLAEIEDIKAWYIYRSLGGI
                     KYAFENQNPSKAEKLLLHCLNYRKTFLNNNSTDFDLAYQLILWLDENFPQSTFLQFAE
                     GVGKIRNAYQNLEYCQDERLILWQLWQTKKLTEKISYHHQKIAQNLEINNFNPNYQIF
                     YDNRYQQHSLLW"
     CDS             554924..555271
                     /codon_start=1
                     /locus_tag="GM3709_469"
                     /product="hypothetical protein"
                     /protein_id="BAQ63704.1"
                     /transl_table=11
                     /translation="MKKFAFINDAAEREYKELPKEIQQDFGVSLKAIQENKKPFLHIT
                     PLKSIGVGVIELKINGSPAFRCVYIAKFMNTVIVLHSFKKTTNQVDKQAMKTLTQRYK
                     ELQVEISKIKKNN"
     CDS             complement(555272..555589)
                     /codon_start=1
                     /locus_tag="GM3709_470"
                     /product="helix-turn-helix motif"
                     /protein_id="BAQ63705.1"
                     /transl_table=11
                     /translation="MALKFYETPFHVTQSPEIASKNALKTDLTIMIRDIIEQEGWTQI
                     EAAQRLELTQPRISDLINGKIDKFTLDMLFLVLDKLGFRANFTFTNINQASILIEKMP
                     ITA"
     CDS             complement(555765..556268)
                     /codon_start=1
                     /locus_tag="GM3709_471"
                     /product="hypothetical protein"
                     /protein_id="BAQ63706.1"
                     /transl_table=11
                     /translation="MNTISHSNHREHKEINWSAIILFALGFWLSGSLLLDFVLIPALS
                     VSGMMTEGGFASAGFLIFGVFNRIELICASLVLTTAFVFSVNHNFDKQKQGLFIIFSS
                     LLFLIALAYTYLFIPNLSAWGLCLNQFNPSLTMPSAMISWHEGYWVLEALKYGLGITL
                     LRWSYTK"
     CDS             complement(556407..556991)
                     /codon_start=1
                     /locus_tag="GM3709_472"
                     /product="hypothetical protein"
                     /protein_id="BAQ63707.1"
                     /transl_table=11
                     /translation="MKIDIYLTRYLLLIFTLFNNLFIWCNYPNIALAETVINKKKCDY
                     NLDDLSKLLVKDIPDYANRVIQRSRIHSHPLDFFPIYVITAGNTELQSLPLAQNQYKT
                     TLKSSSEDDIKQVFFTTLERQYSSNDLIIETQNFHWLMVTETPKGWQMIMLLTKLGYP
                     DDLNNQNFISSPPRDSSEGIIGQSVKLWLRDCQS"
     CDS             complement(557000..557701)
                     /codon_start=1
                     /locus_tag="GM3709_473"
                     /product="orotidine 5'-phosphate decarboxylase"
                     /protein_id="BAQ63708.1"
                     /transl_table=11
                     /translation="MNQDKIIVPLDVPDLKSAIELVKLLPEVSFWKVGLELFVATGAD
                     ILKFLKDKNKRIFLDLKFHDIPNTVKNATRSALQHQVDLLTIHAMAGREALTAAKEVV
                     KNSGDDRLKLLAITVLTSINSRQLAFDLKIPLELPEYALNNAMMAKECGIDGGVCSPH
                     EVQKLKEVCGKDFLLVCPGVRPVWATAEDQQRIMTPKQALQKGADYLVIGRPITKAEH
                     PQIAWSKIVEEVELS"
     CDS             complement(557887..559131)
                     /codon_start=1
                     /locus_tag="GM3709_474"
                     /product="tryptophan synthase beta chain"
                     /protein_id="BAQ63709.1"
                     /transl_table=11
                     /translation="MTVTPIKTTSKFTQVPDNFGRFGQYGGKYVPETLMPALSELETA
                     YHQYKNDRDFQQELNQLLKDYVGRANPLYFAERLTKHYAKSDGTGAQIYLKREDLNHT
                     GAHKINNALGQVLLAVRMGKKRIIAETGAGQHGVATATVCARFGLDCVIYMGVEDMER
                     QKLNVFRMRLLGAKVEPVSAGTGTLKDATSEAIRDWVTNVESTHYILGSVAGPHPYPM
                     MVRDFHGVIGKETRSQCLEKWGGLPDILLACVGGGSNAMGLFYEFVGDASVRLIGVEA
                     EGSGIASGKHAATLTQGKPGVLHGAMSYLLQDTEGQVTEAHSISAGLDYPGVGPEHSY
                     LKDEGRGEYYSVTDDEALEAFQLVCKLEGIIPALETAHAFAYLKKLCPNLEGSPRIVI
                     NCSGRGDKDVQTVAKHIEGIDL"
     CDS             559323..560396
                     /codon_start=1
                     /locus_tag="GM3709_475"
                     /product="glucose-1-phosphate thymidylyltransferase"
                     /protein_id="BAQ63710.1"
                     /transl_table=11
                     /translation="MKALILSGGKGTRLRPLTYTGAKQLVPVANKPILWYGIEALVNA
                     GVYDIGIIISPETGGEIQKKTGDGSRFGANITYILQENPDGLAHAVKIARPFLGDSSF
                     VMYLGDNLIADDLSQYLDEFTTKNLDALILLRKVSNPSAFGVATINDYGEVLELVEKP
                     KYPQSNLALVGIYFFSPEIHNSIETLKPSARGELEITDAIQSLLLSKKLVSARKLQNW
                     WLDTGKKDDLLEANRIILDTNLSAENLGSIEEKSQIIGRVKIGKNTRIINSTIRGPVI
                     IGENCYLENCFIGPYSSIADNVKLTETDLEHSVILESAEVLGIQQRIVDSVIGQRTKI
                     HLALKRPKAVSFMIGDDSQIELI"
     CDS             560510..560632
                     /codon_start=1
                     /locus_tag="GM3709_476"
                     /product="hypothetical protein"
                     /protein_id="BAQ63711.1"
                     /transl_table=11
                     /translation="MVLENKKERNDVFTKFKVKIIGKLNIISIETKINYFLSKL"
     CDS             560629..561345
                     /codon_start=1
                     /locus_tag="GM3709_477"
                     /product="hypothetical protein"
                     /protein_id="BAQ63712.1"
                     /transl_table=11
                     /translation="MKIKKLFTYVCCVVIGIALFSFGRASVLNAQEPNQSLTLSQKNS
                     DQIEIVVPNFLTKSEVFRKNNEWILEQSNLMADSGNSTEIIKFACEPRQVEVYNYNAG
                     VISYCRKKNFKIAENDSARVEIKSGASRTPHWHDTWEEQVLMSGSAKTVLIDDKGKVY
                     EEILEPGMICFVPQGWTHWSETVGDETATFLLIFPAGFKTFELSDSIVNINPKLMESI
                     IGVKLSNVEKNPDALVILPK"
     CDS             complement(561894..562457)
                     /codon_start=1
                     /locus_tag="GM3709_478"
                     /product="mobile element protein"
                     /protein_id="BAQ63713.1"
                     /transl_table=11
                     /translation="MMVKSLFSLAGRQTEGFLESLFVLMGIDLPVPDHTTVFRRAKNL
                     DVVLPVNKRDEPRHVVVDSTGVKVYGEGEWKTRQHGVSKRRTWRKLHLAVDEKTGEIL
                     VAEVTTNNCHDGDVLESLLEAVEGEIEQVSGDGAYDRAAPELRSDQRKCYRAIAIINL
                     RDSLFVQIWQISLLVSNSRFYSQIRSN"
     CDS             complement(562506..562631)
                     /codon_start=1
                     /locus_tag="GM3709_479"
                     /product="mobile element protein"
                     /protein_id="BAQ63714.1"
                     /transl_table=11
                     /translation="MKQKYHLRNWSEYDRGLKQRGSLTFWLSEEVLSNWILTEKS"
     CDS             complement(562695..563021)
                     /codon_start=1
                     /locus_tag="GM3709_480"
                     /product="alkaline phosphatase"
                     /protein_id="BAQ63715.1"
                     /transl_table=11
                     /translation="MTPLNQALAEAELQLLQAVLNDSLEANLITAFGDNYNVTIANNI
                     FSEWRNGDFNNLPKIKILSPTVMNGANGAYSTSNNTIYLSSTLVEQKSITEIRDVLIE
                     EYGFVA"
     CDS             563281..563928
                     /codon_start=1
                     /locus_tag="GM3709_481"
                     /product="phospholipid-lipopolysaccharide ABC transporter"
                     /protein_id="BAQ63716.1"
                     /transl_table=11
                     /translation="MTTTSDEVWQLLKELIEAQKETDRRFQETERLLKENAQETDHRF
                     QEIKDSFAETDRRFRETERLLKQQSKKTDEQIGKLGNRLGEFVEWQVRPAVVRLFQER
                     GIDVHEFLPDVSVKRATGGLQIDLLVVNETEAILVEVKSKLSQADVDEHLERLGKFKE
                     LMPRYRDVNALGAVAGMIVPDDIGSYAYRKGLYVLAQSGENVVILNDKKFKPRVW"
     CDS             complement(564082..565758)
                     /codon_start=1
                     /locus_tag="GM3709_482"
                     /product="GTP-binding protein HflX"
                     /protein_id="BAQ63717.1"
                     /transl_table=11
                     /translation="MTTETIYGNLQGLKPSQLKQLQKLYHQHIRNDRLTTTELAERIA
                     AISTELKQPVCVYLNRRGQVIRVGVGTPRQTQIPPLELPRYGVQRLSGIRCLATSLKP
                     VPPSEACLTAMARQRLDALLMFTLTGNGVIRKGGGASGFIENTYLAHLLPIQENEAFW
                     EVSQPQDIEDIAEQDFLDLVDSLEAEFSREFVAQEVSSDDDRVLLVGLMTGNMTEQKF
                     RDSLQELALLVDSAGGKVLGTIEQKRSSPHPQTLVGAGKVEEIALQVQTLGANLVAFD
                     RDLSPAQVRNLELQFGVRVVDRTEVILDIFAQRAQSGAGKLQVELAQLEYMLPRLTGR
                     GLAMSRLGGGIGTRGPGETKLETERRAIQKRITRLQQEVNQLQSHRSRLRHQRQQQEI
                     PSVAIVGYTNAGKSTLINALTNAEVYTADQLFATLDPTTRRLTITDKNSGESRTILLT
                     DTVGFIHELPPSLVDSFRATLEEVTEADAMLHVVDLSHPAWESQIQSVKAILGDMPLA
                     PTIELIVFNKIDRADSEHLEIAKNNYPQAVFISASERLGFDTLRSRLVSF"
     CDS             566070..566915
                     /codon_start=1
                     /locus_tag="GM3709_483"
                     /product="GCN5-related N-acetyltransferase"
                     /protein_id="BAQ63718.1"
                     /transl_table=11
                     /translation="MTENNFIISSIEDESELELMISWAKNEGWNPGIYDAKTYYETDS
                     KGFFLGKLNGEPIGCISAVAYDLTFGFLGFYIVKPEFRNQGFGIQLWRRGLEYLGERN
                     IGLDGVVAQQNNYRKSGFKMAYNHVRYQGIGGSNISHNLVELNSISFQELITYDMQCF
                     PTNREKFLTNWIKQEKSIALGLVKNEQLQGYGVIRPCANGYRIGALFADNVNIADTIY
                     QGLVADKQDCPIFIDIPSHNLLAQKLVEKYKMYPVFEAARMYNKNFPDVVINKIFAVT
                     SLELG"
     CDS             complement(566968..567681)
                     /codon_start=1
                     /locus_tag="GM3709_484"
                     /product="ribonuclease III"
                     /protein_id="BAQ63719.1"
                     /transl_table=11
                     /translation="MEIKDTRRTRELLKLLQRLGIEDVSRIDWSLLDLALTHPSVSTI
                     NNYEQLEFVGDAVVRLASAELLLEIYPDLPVGEFAAIRSILVSDKFLAEIAEEYGFDL
                     YLLMTPSVRNDKWGKVSRLADAFEGVLGALYQSTKNMDLVRFWLDPILQEKAAQVHAD
                     PARQNYKDALQEWTQGKYKLLPTYKVTQNTILEDENDRFIAEVWLEDKLLGKGKGATK
                     KASQQAAAQEAFNLVVSKK"
     CDS             complement(567781..568776)
                     /codon_start=1
                     /locus_tag="GM3709_485"
                     /product="tRNA dihydrouridine synthase A"
                     /protein_id="BAQ63720.1"
                     /transl_table=11
                     /translation="MTLQPIISVAPMMDYTDRHFRYIMRKMTKKTLLYTEMITTQAII
                     HGDRAKLLDFSEEEKPVSLQLGGDNPQQLAECAKIGQDWGYDEINLNVGCPSSRVQNG
                     NFGACLMAHPHKVAQAIEAMEKAVNIPVTVKHRIGIDDQDSYQDMVYFVKTLADSGCQ
                     RFIIHARKAWLQGLSPKENRDIPPLRYQDVYRLKQEFFPLTIEINGGITSIEQTKKHL
                     NYVDGVMIGRAAYDNPYLFAYVDREIYGEDKAIASREEIIESLYPYIDFWTSRKVKLN
                     TIMRHLLQIFAGQTGTKAWKRYFAENGNTFLDGSKIVSQALVMIKKGNEENTTKE"
     CDS             complement(568803..569357)
                     /codon_start=1
                     /locus_tag="GM3709_486"
                     /product="CopG protein"
                     /protein_id="BAQ63721.1"
                     /transl_table=11
                     /translation="MLKIKLIKSLTGIALIGIIGSVTLSSHNPSYAHETHENHRNNST
                     TLSVWDKATVNYSGSKKITVYNSPSCGCCKQWMAHMKKHGFEVTDIKTENIDAIKQKN
                     NLPSQLASCHTAIINGYVMEGHIPADDIKRFLSQKPKMKGLAVAGMPIGSPGMESDKI
                     KQPFNVIAFNNKGKSEVFNSYKNY"
     CDS             569890..570630
                     /codon_start=1
                     /locus_tag="GM3709_487"
                     /product="diguanylate cyclase/phosphodiesterase with
                     PAS/PAC sensor"
                     /protein_id="BAQ63722.1"
                     /transl_table=11
                     /translation="MTNPKIITSVTSQLKLYTLLSQLKLPKSYLGKIMLVAFIGTHIP
                     LLSLFFYAITVTSLTTDTKIKVLVVALIATLVGTGITLFTLQKLLIPITLTAKSLRQY
                     LETNKIPQLPTKFKDEAGVLMADTQYSIGKLDELIQQLKNYDSLTALPNRLLFHRQLQ
                     QLISELPHYQNTLAIMLVDLDGFQNINNIFGHESGDFVLRHVSQKLSQHITKRDILAR
                     VSSDEFALVHSVTSVEGLNRPLAKLNTR"
     CDS             571171..572181
                     /codon_start=1
                     /locus_tag="GM3709_488"
                     /product="diguanylate cyclase/phosphodiesterase with
                     PAS/PAC sensor"
                     /protein_id="BAQ63723.1"
                     /transl_table=11
                     /translation="MSNQYADKILDTVAEKLTLDNNEINITASIGIAILENEKTDTNE
                     LFNQADMALRLAKEQGRNTYRFYSEEMNQTLLRRFQLERDLHHAIEKGELQVYYQPQI
                     DINSGDIVAAEALLRWQHPEYGFVSPALFIPIAESSNLILDISTWVLRTVCQQNQSWL
                     SAGFPELCVAVNLSGKHFQQENLADEIRDILQETELKPHQLELEITEGLLIDDVQKAI
                     NILQQLHNYGFLLALDDFGTGFSSLSYLKRFSLDFLKIDQSFVRGIPHDNDDNAITRS
                     VIALAHSLQMSVIAEGVETIEQANDLQDHGCYKLQGYYFSRPIPAQDFTRLWEEKLEK
                     YN"
     CDS             572230..572949
                     /codon_start=1
                     /locus_tag="GM3709_489"
                     /product="glycosyl transferase"
                     /protein_id="BAQ63724.1"
                     /transl_table=11
                     /translation="MTFNRKIININATINGGFIKCCPLTKNDIQQLGLRGIHCGSGLN
                     LHTGWLNTDYLQIGDQFGNTSNIGNLIVVAENQYYLQHDQTQPIPIEDSVFDYAFSEH
                     FIEHITIEQAIQWLKEIRRILKIGGVLRLSTPDLYLYVSGYLDNTQSFYKQHCDNLSK
                     MGFKNPPQRKAWMMNQIFRFWGHQWIYDFDEIKTIAVAAGFKTQDVLKYNFQQGSIPE
                     LFKLDLADRSDESIYVEIRKT"
     CDS             573058..573465
                     /codon_start=1
                     /locus_tag="GM3709_490"
                     /product="photosystem II protein Psb27"
                     /protein_id="BAQ63725.1"
                     /transl_table=11
                     /translation="MMKSYLSKLLALVLVITIGLFGCGESSTGLTGNYTDDTLKVLQS
                     LTVAIELPTDIDIETKKATQEQARKQINDYVSRYRKDANYGGLKSFTTMQTALNSLAG
                     YYTSYGSRPLPDKLKTRLNQEFKQVEFALKKGY"
     CDS             573649..574671
                     /codon_start=1
                     /locus_tag="GM3709_491"
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="BAQ63726.1"
                     /transl_table=11
                     /translation="MSNQFNVAILGATGAVGTEIIDLLIERNFPVKELKLLSSPRSSG
                     QKIPFKNELIEVQAVDENSFKDVDIVLASAGGSTSKKWANTIVSSGAVMIDNSSAFRM
                     DMDVPLVVPEINPEDAKKHKGIIANPNCTTILMGVAIYPLHQIQPIQRIIVSTYQSAS
                     GAGARAMEEVKIQSQAILNGENPVAEVLPYPLAFNLFPHNSPLMDNNYCEEEMKMVNE
                     TRKIFGDNSLRISATCVRVPVLRAHSEAINIEFAQPFSVAKAREIIAQAEGVTLMEDW
                     DKNYFPMPINATGKDDVLVGRIRQDISNPNSIEMWLCGDQIRKGAALNAVQIAELLIT
                     KNLLKS"
     CDS             574813..575706
                     /codon_start=1
                     /locus_tag="GM3709_492"
                     /product="4-hydroxy-tetrahydrodipicolinate synthase"
                     /protein_id="BAQ63727.1"
                     /transl_table=11
                     /translation="MSDYIFGRVLTAMVTPFNEDLSVNYGVAEKLADHLVNNGSDGLV
                     ICGTTGESPSLEDHEKYELLKVVKNAVGDRAKIVMGTGSNSTAKAIADTQKAAKIGID
                     GSLQVVPYYNKPPQEGLYQHFSSIAKSSPDVPMMLYNIPGRTGKNLEAETTARLAHDL
                     DNIVAVKEASADLEQTARIRILTPSDFLIYSGEDFLTLPMMTVGGIGVVSVASHLVGK
                     EMQTMITAYKNGNNSLAQEIQQKLYSLFKVIFCNTNPIPVKFALQLQGWDVGNVRLPL
                     TPLLANQQKEVEKVLQDLELL"
     CDS             576063..577952
                     /codon_start=1
                     /locus_tag="GM3709_493"
                     /product="Zn-dependent hydrolase"
                     /protein_id="BAQ63728.1"
                     /transl_table=11
                     /translation="MYQIQARKRKTTASEKPTVILPERNKNKKPTLKIIPLGGLHEIG
                     KNTCIYEYEDELILVDAGIGFPTDGMHGINVVLPDMTYLKENQHKIKAMVATHGHEDH
                     IGGIPYHLKQIDTPIIYGPRLAMSLLRDKLEETGLQDRTIIKSVSPRDVVKIGKHFRV
                     EFIRNTHSIADSFTLAIHTPIGVLIHTGDYKVDHTPVDGEYFDFHRLAELGQEGILCL
                     LGDSTNSEVPGFTPSERSVYPGLEKVFNQAKGRLMVTTFSTSVHRINMLLELAMQYNR
                     KVGVVGRSMLNVIAHARNLGYIKCPDNLFVPLRNLGSLPENEVLILCTGSQGEKFAAM
                     TRISKGEHRQVKIRPGDTIIFSANPIPGNTIAVVNTIDRLMMQGANVVYGKQANVHVS
                     GHGCQEDQKLILSLARPKFFVPVHGEHRMLVQHSKTAQSVGIPAENIVIIQNGDTIEL
                     TADSISKGEKVPSGIQLVDTAGVVHDNVMEERQRLAEDGVITIAASVDNQGRLLTQPQ
                     INLRGVVCKIEVSTLERMIIRTVDKTIGDRLKSSLLLNGHDQVNWTSIRIDVETNLER
                     LIQRELNSESLVIFMLQVQENTSKTVTNNNNGNNNVTNIDSEEEEEETDGKFTRRRRK
                     TTVSV"
     CDS             complement(578012..578605)
                     /codon_start=1
                     /locus_tag="GM3709_494"
                     /product="cobalt-precorrin-6y C15-methyltransferase
                     [decarboxylating]"
                     /protein_id="BAQ63729.1"
                     /transl_table=11
                     /translation="MIWQYKTSGIPDELFERLPGIPLTKKEVRLLILSALRLEENSVI
                     WDVGAGTGTISIEMALLCPNTKIIAIERDPDVANLIKKNCDLFQVNNVEVIEGNAPHC
                     FTNLTPKPDRIVIGGGKSVKDILLKVWDYLPSQGRVVAMASNLENLYQLSEGLAQSRA
                     CNIEVVQSSINRLETRGLSQVFAAIAPVFILSGEKIS"
     CDS             578732..580174
                     /codon_start=1
                     /locus_tag="GM3709_495"
                     /product="signal recognition particle"
                     /protein_id="BAQ63730.1"
                     /transl_table=11
                     /translation="MFDALAERLEDTWKKLRGQGKISSSNIQDALQEVRRALLEADVN
                     FQVVKGFVAEVEKKALGAEVISGVNPQQQFIKIVYDELVKVMGESNVPLAKAEKSPTV
                     ILMAGLQGAGKTTATAKLALYLKKQQRSCLMVATDVYRPAAIDQLITLGKQISIPVFE
                     LGKDANPVEIARQGIAQGKEQGFDTVIIDTAGRLQIDRDMMAELAQIKEVVQPHEILL
                     VVDSMTGQEAANVTRTFHEEIGVTGAILTKMDGDSRGGAALSVRTISGQPIKFIGVGE
                     KVEALEPFYPERMASRILNMGDIVTLVEKAQEELDIADVEKMQTKMMEARFDFNDFLK
                     QMRLLKNMGSFAGVMKLIPGMNKLGAGALEQGEVQLKRTESMINSMTKEERANPQLLA
                     QSPSRRRRVAKGSGHEEKDISRLVSDFTRMRTMMQQMSMGGGLPGMGGMPGMGGLGGL
                     LGGGNRPGNRNQGTPKKPKKVKKKRGFADL"
     CDS             complement(580208..581566)
                     /codon_start=1
                     /locus_tag="GM3709_496"
                     /product="hypothetical protein"
                     /protein_id="BAQ63731.1"
                     /transl_table=11
                     /translation="MNQPDYLLQCRQILKSAITELGFSLTEDKIWKIAGLIIEGMSGK
                     WRNFHTFEHILMVSNTGDPLITLAGLFHDLIYLQVDQIIPFNLTPYLNLFIYQKENNF
                     YIKSKLLEDDHCFSIVLEIFDLNLGDNLLPSKGQNEFLSALIAAKILESDLPLSVITR
                     IVTIIELTIPFRQCKNDNTTIPLELQKRLEKVNQKFNLDLTSEEIIITIEQAVKLANL
                     DVSGFAASDVTDFINNTWLLLPETNHSLNDTLKYTVKDYRFALVNTTKFINFISPELI
                     FHQYQNEPNIETFQELINRCENNLNIARLYLAVKLVGISILEALSSHLLPNIPLAFLW
                     GFSEENHPHSSIFDFLPSFSPCKIHNEQEKLILDLLNFQFQRNLFSPTNHSLFSTFIV
                     NYLSFEEVIKYQSQCYLFFNNLLSREDFLSLFPPTLITLLSNAIAQLLEEKQLGFIKE
                     QR"
     CDS             complement(581765..582157)
                     /codon_start=1
                     /locus_tag="GM3709_497"
                     /product="hypothetical protein"
                     /protein_id="BAQ63732.1"
                     /transl_table=11
                     /translation="MKSKRFLTFINFSIISFSLSLLSSPSFAQSAKPIFDQQQCVEGL
                     VKEGLKADHASTWCNYKQECLVRSQKEGLPADAAKSVCDCSIKEFRKRYTTDKFKELT
                     KKADSDSKVAKELREVGESCFEGILFEQ"
     CDS             complement(582311..582640)
                     /codon_start=1
                     /locus_tag="GM3709_498"
                     /product="hypothetical protein"
                     /protein_id="BAQ63733.1"
                     /transl_table=11
                     /translation="MLSIVCVTPISVVVFNSSNNPALAQLRGQDSQQFFDRGNQVMEQ
                     QIQEIQQENIRQLEEQNTLKEENLESQLEIKNSEESPIKEIPDTVTEMENNVPESPND
                     EIKIEQQ"
     CDS             582994..583278
                     /codon_start=1
                     /locus_tag="GM3709_499"
                     /product="DNA-binding protein HU"
                     /protein_id="BAQ63734.1"
                     /transl_table=11
                     /translation="MNKGELVDAVSAKADVTKKQADAVISATVEAIMEAVSSGDKVTL
                     VGFGSFESRERKAREGRNPKTGEKMDIPATKVPAFSAGKLFKERVAPPKA"
     CDS             583419..584402
                     /codon_start=1
                     /locus_tag="GM3709_500"
                     /product="L-threonine 3-O-phosphate decarboxylase"
                     /protein_id="BAQ63735.1"
                     /transl_table=11
                     /translation="MLDFSASINPLGPPEKAIEAIIKGIKELDHYPNPDYPQFRLGIA
                     KHHQIDQDLVLPSNGAAELLTWIAWEAHDLEGVMLPSPCFADYRRALNTFNIPCKFYD
                     LEQLETGLSKGYNGALLINNPHNPTGKLWQKKTLLPYLQKFRLVIIDEAFMDFLLPNE
                     QESLIDVVEDHDNLIILRSLTKFYSLPGLRIGYGVSNPDRIRKWQKWRDPWSVNNLAA
                     IAGVKALSDFEFQQKTWQWLKPTRQKLRDDLSQIEGLKPLPSSANFMLVETRIPSSQL
                     QLELLKREQILIRDCLSFPELGEKYFRVAVKKQEDNRKLTTTLADILTPQI"
     CDS             complement(584500..584733)
                     /codon_start=1
                     /locus_tag="GM3709_501"
                     /product="hypothetical protein"
                     /protein_id="BAQ63736.1"
                     /transl_table=11
                     /translation="MKTLEKTAQDYSIEMIKDEVRHLVDKGTVSRHQPIYILCQYIPA
                     REWVCVECELEKCDYLLRDQIGDLIACENWDND"
     CDS             complement(584883..586478)
                     /codon_start=1
                     /locus_tag="GM3709_502"
                     /product="beta-hexosaminidase"
                     /protein_id="BAQ63737.1"
                     /transl_table=11
                     /translation="MNIDNREKLTKKLSLREKIGQLIVVRTTGYIFDHQIRYPAWEAT
                     QSQLKKWLQELNLGGVILLGGSCAEIAYRTQQLQSWAKTPLLIAADIEEGVGQRFTGA
                     TWFPPPMALSKIALDNLSLAQKYAQDMGNITAKEALAIGINWILAPITDVNNNPDNPV
                     INVRSFGDNPQVVSDLATSFIKGCQSYPVLTTAKHFPGHGDTTTDSHLHLPQVNHNLE
                     RLGEIELLPFQQAITEGVDSIMTAHLLVSAFDGINPATLSFSILTQLLREKMNFSGLI
                     VTDALIMGGVAKYATQEEIAVKAIQAGADILLMPENPEVAVNSIEKAIHDGILSEARI
                     DQSLTRIIEAKSKLSFQMPHIDIISPPEARSTVNEILVKSMSYGGQFPMKAKDKGINL
                     VVVQDLLNCDFLHRQTPAITIPESYGYQTQIFDQRNLHLAQYDDQDILLQAFIRGNPF
                     LGNGGLTDSAKVFYEKLLKLDRVVGIVIYGSPYILDWFLPRLKKNTPWVFTYGQMSEA
                     QELTCQYLFNLSTDHDIKKGDFL"
     CDS             complement(586478..587767)
                     /codon_start=1
                     /locus_tag="GM3709_503"
                     /product="glycosyl transferase group 1"
                     /protein_id="BAQ63738.1"
                     /transl_table=11
                     /translation="MKINWFSPLPPANTEIANYTKTLLPYLQEKVEVTLWTNQQKWDE
                     ELEKYTSVKQYKLEQMPWFELNQGDVNIYNLGNNASFHGEIWQVAQLFPGIVILHDQK
                     LQDFFYMFYPDKNDYIQQMKKTYGQEGGESARLFLNEYHSMEFMTENYPLTSLALENA
                     LGVITHNREVYLSLSQENQWLIGYTPLPYINDRCESNLDQKQQQKPYKLIMFGFIGKN
                     RRLETVLQALSQFKQKDSFRLNIYGQLWDENYIREQIQILDLENLVTIHGFVSDEELD
                     FALSNSDLGINLRYPTMGEASGSQMRLWNHSLPSLVTKIGWYSNLNSSAVAFVRHDRE
                     IEDIHKHLQGFLDNPSHYQQMGRKGKKILETDHRPELYAEAIVNFVTEISKYRSHSSI
                     DRIVKRVAIELNYLNSDIKSPEYLSYISETIKFITAK"
     CDS             complement(587842..588858)
                     /codon_start=1
                     /locus_tag="GM3709_504"
                     /product="glycosyltransferase"
                     /protein_id="BAQ63739.1"
                     /transl_table=11
                     /translation="MGGAEIHGDSLVKALRDFGHETELVTIPFKTYPNQRILDTMLMF
                     RLLDVTESCGQKIDLIIPLKFPAYLTPHPNKVLWLLHQHRDAYDLWNNPVCGLAHNPD
                     GQQFRATIINGDNNAFAECRQIYANSQNVAKRLKKFNNVDSIPLYHPPKNADRFHTQN
                     PQSYFFFPSRLTKIKRQELVLEAIAKTHHSVKVIFAGSSDDGKYDRDLKEIAEKLGIF
                     DRVIFLGKISEEEKLKYYAECLAVIYPPFDEDYGYVTLEAMLSSKPVISCSDSGGPLE
                     FLINQETGIIVEPNPLSLAEAMDQLWDDRTRSKIMGKNGKKHYESMNITWSNVVQKLT
                     SIVT"
     CDS             complement(588894..590195)
                     /codon_start=1
                     /locus_tag="GM3709_505"
                     /product="hypothetical protein"
                     /protein_id="BAQ63740.1"
                     /transl_table=11
                     /translation="MLEINVPNINTKKIKEKIISEIESIQTQEKLYSEEHPLWITIQE
                     QIKYFQGFIETAKSRAEIRNSWPNSLNKFPFTLLQPLAIIFFKILKLLFKDQREVNYN
                     ILKALEESVKLNQMFLEQIKAINLNSQEELNTVKFINLDLKNKINTLDNKYIDRINYL
                     TQKQEDLFYKSIYFQGDLTQQKLLINLFLNQLLDSQNTEILNKPIKEFIERKNNYLDS
                     FYLALENKFRGKREAIKEQQKKDYLSLLQGLNIDSVESQILDIGCGRGEWLEVLKELG
                     YNAKGIDLNEVMVNECCGRNLDVINQDCLDYLKSLSVESLSLITGFHLIEHLPFNILW
                     ELLAQSLRVLKSGGLVIFETPNPDNVLVGSRNFYIDPTHRNPLPSAMVKFLVESIGFI
                     NVEIINLHPISDQKIEGGELADRFNEYFYCSQDYAVIGYKP"
     CDS             complement(590464..592527)
                     /codon_start=1
                     /locus_tag="GM3709_506"
                     /product="alkaline phosphatase"
                     /protein_id="BAQ63741.1"
                     /transl_table=11
                     /translation="MVTQLISKNASNQPANNSIVFPIGGGNIDTASNLIVFSTTAFNF
                     IPDTNGVEDIYLYNKTTKTFINLTALKANGTPTTLGSSNPSISGSGNKIVFESLEPNL
                     ASIPALPGSDIFLVEDFSSTPPKFTLLTAGYNNVSFNPFISQNGNWVVFETLATTQGG
                     GAALTNVPDGGDGDRDIILLNLITNQTTWVSQVTNGGGNGVGDSTNSSVSDDGRYVVF
                     QSNVNNLIPTVTDTNGTTDIFLFDKNNNSLTLISKKINAVAPVTTANASSINPIISDN
                     GRYIAYESVASDLVSVDSNGVRDIFVYDIQLGTNKLISLRPNGVQTTADSRNATISDN
                     GEFIAFESNDASLVSSDNNNLTDIFIWNNDTISLFSSDSAGNEGNKASTNASISSDGQ
                     EVIFISNATNLDTSVPGQNGVTQELFVASATPPPNISIGNVTVSENAGTATLTVSLST
                     AGTSPITVDYKTTNGTATSGTDYQAIPTTTLTFNPGELQKQVVVNILDDTVIEQQEIF
                     TVDLSNAIGATILTNGDKGTVTINDNDTPPEPLLNTPFTRFQNKNRSGTYLFTGPQES
                     QSVRQNFPNFVEEGTAFKVAVQPNDDLIRINRFQNEDVPGTYLFAGEVESQSIRQNFP
                     NFIEEGIAFYVYDKNASQGVDFYRFQNTQQPGTYLFVGQEERDSILANFPQFKLEGVA
                     FEVVV"
     CDS             593049..594455
                     /codon_start=1
                     /locus_tag="GM3709_507"
                     /product="hypothetical protein"
                     /protein_id="BAQ63742.1"
                     /transl_table=11
                     /translation="MKIDNVLQIVDRLIFQERGKHLDNIQRVLILEVWKGNNYASIAN
                     IYHCSESYVRDSASKLWKILSAQIGEKIYKANFRSTIERLYLNSLYFSSDSVNNCDDR
                     SKFFSEEKLFNSTSEQNTVIQKYHDLGLAPTIINFFDRQTELKSLSNAIFSNHAQLIN
                     ISGFVGVGKTTLVKYFVDLYKNEFDIIIWESYSYPKNLDNFLINYFEKINKILLFNTS
                     NLSNLENFIEVLKKIKCLIVFDDIHNLFIQKKLSGAYQNIYKNYQKMFEVIAQVQHQS
                     HLILISQEKVIDFESFNNTSLYRLNLEGFNVPIVFLFRDTYFKDKKELVKLNNLYRGN
                     CLFLNYIILTIKNIFTGSINDFLLHEKLFIPQEIKSIFDNLFDRLSTIEKEMIFFLTN
                     KDNSITLKQIEESIHLSSSEIINALQSLYRRYLLEENHNNGITYFILHPLFKEYIASE
                     IYNLTDENTQKVTNLISP"
     CDS             complement(594502..595839)
                     /codon_start=1
                     /locus_tag="GM3709_508"
                     /product="alkaline phosphatase"
                     /protein_id="BAQ63743.1"
                     /transl_table=11
                     /translation="MANFDFGIIDGNFFTNNGTVTSNSDDVFFFTLEDSSSVIHVNLF
                     NITGGDADLELYEDSNLNGTLDSGDLLVVSSTRNNNEDEFIKILEADIDGINLDSDYL
                     VKVFSFDGNTVDYDFSLVMTEATPSEEVGINLSPNNQTVFSDFIRGTNSSIVNRNFDA
                     IEYTTSQQGVIFGQISTDFNETNLNVRIFDDSNNNTVFDPRDEILGQQEITRQNGFIS
                     IPVEAGRGFVQLENLSDSGYDYSLTASYANASTTDQSALTLRGGTAQIAYVAYYGRPA
                     DPSGVNFWNEILRNGNVNYSPRTGDTLTGNQRTVYNRIVNDFGNSAESNRLFGNMSNR
                     EKVNQVYNFTFGRDAETAGLNYWTTQLNNGAVTLATFALEVALGAQNQDIIVLRNKIN
                     SADLFSTSINTQAERTAYSGSSAEVFGRDWLDPFENFTANQRIVDSALTALTE"
     CDS             complement(595996..597885)
                     /codon_start=1
                     /locus_tag="GM3709_509"
                     /product="prolyl oligopeptidase family protein"
                     /protein_id="BAQ63744.1"
                     /transl_table=11
                     /translation="MTQTTIGNYSKWRSPITSDLIVSGSIGLGAVKFDDNNIYWLESR
                     PSESGRCVIVCLNQDDTLEDITPKPFNVRSRVHEYGGGAFFIHDSIIYFTNFVDQRVY
                     KQKKGKTPQPLTPESKLRYADFVLDKSHNRLICVAEDHSNDSIEPENKLVLIDLTTGE
                     VKNLVTGADFYSSPRLSPDNSQLAWIAWHHPNMPWDNTELYLANINPDGSLTDIRLVA
                     GGKNESICQPEFSPNGILYFSSDRRNWWNIYRRENNGNISSLYPLDAEFGYPHWVFGE
                     SVYGFADENTIICTYTQDGISHLASLDTKNKSLTDLNIPFTNIAYLQVNGDQILFTGG
                     SPTQPTAVVKLNIATGDTKILKQSSNLDIDSGYLSQPQQIEFPTSQGKTAFAWYYPPQ
                     NKDFSAPEDELPPLLVKSHGGPTAATTASYNLRIQYWTSRGFAFVDVNYGGSTGYGRD
                     YRQRLNNNWGIVDVEDCINVAQYLVKQRKVDENKLAISGGSAGGYTTLAALTFHDTFK
                     AGASYYGVGDLEALAKDTHKFESRYLDNLIGKYPEEKAIYQARSPINHIDKLSCPVAF
                     FQGLEDKIVPPNQAEMMVKALENKGIKTMYVTFPDEQHGFRKAENIKLALDNELKFYN
                     FIFNN"
     CDS             complement(598149..599459)
                     /codon_start=1
                     /locus_tag="GM3709_510"
                     /product="dihydroorotase"
                     /protein_id="BAQ63745.1"
                     /transl_table=11
                     /translation="MTSNLLIRNAQILLPNNDIFLGDLSIKQGKIAEIGSELRDDSAQ
                     IIDGTGLTLLPGVIDPQVHFREPGLEHKEDLFTASCACAKGGVTSFLEMPNTVPLTTT
                     QATLDDKLYRASQKCLVNYGFFMGATAENLDDLRNAHPACGIKIFMGSNHGALLVSTE
                     TEIEPIFAKGSRLIAVHAEDQARIVERKKLFKGNTDPAIHSQIQDEIAALNATKLAVK
                     LANKYQRRLHILHLSTGIEAEYLRQHKTPWISTEVTPQHLLLNTTDYERIGTLAQMNP
                     PLRSPENNDILWKALLDGVIDCIATDHAPHTLEEKAKPYPHSPSGMPGVETSLPLMLT
                     EYKKGRCTLAQVVKWMCTNPAKLYNIPHKGEIKIDYDADLTLVDLNSYKPVLKENLAT
                     KCKWSPFEGWNLTGWPIYTIVNGNIALEKGQLNTDVRGKALSFS"
     CDS             599524..601050
                     /codon_start=1
                     /locus_tag="GM3709_511"
                     /product="uridine phosphorylase"
                     /protein_id="BAQ63746.1"
                     /transl_table=11
                     /translation="MKNYQSEKSQQKLFFFFKLLNWYYDRLFISKIMAIVSVLNFGLV
                     IFDLTYIPLRDIWLNGQITLGQFKLGPYEYNGIQLTVLPKSWRNNIIKYDVIKGIEPY
                     RDTNFYLEEVDLLEESINQYGLKDENTEKILKNLREMSINMIREDPFRLANKSGTLEI
                     IKNRMKEHMDNYINNPESSSTLAFTSFWTVTNLENNLSQQLSFFNEEIRPLINTNYYR
                     PIGENGQFVNYFGLIDFPFIVIIFIDFVIRCLVISFRFNGVKIQDAIFWRWYDLIFFL
                     PDFRWMRIVPITIRLNQSRLLTYQRIKKQISQGFVAGIAGDITQIVMLRIVNQVQKTI
                     EKGQIEKVLFKEETKEYIDLNDTNEIAEVIKLLINLVAYEMLPEIRREVETLLAYIFQ
                     KTITESPIYQNIEHLPGLKTLPENISNKLAIQSYQIFLNTIDNMLKEDPIFENYLEKI
                     LEKATKTLNIRPNARYDINKIEELLVILLEEVKVNYIQNLSEDDIEALLDETRAINNN
                     "
     CDS             601314..602027
                     /codon_start=1
                     /locus_tag="GM3709_512"
                     /product="two-component system response regulator"
                     /protein_id="BAQ63747.1"
                     /transl_table=11
                     /translation="MSRILVIDDDAAIAELVSINLEMAGYDICQAEDGIKGQALALQI
                     QPDLIMLDLMLPKVDGFTVCQRLRRDERTANIPVLMLTALGQTQDKVDGFNAGADDYL
                     TKPFEVEEMLARVKALLRRSERSLPTAKHSEILSYGALTLVPERFEAIWFDKSIKLTH
                     LEFELLHCLLQRHGQTVPPSDILKEVWGYDPNDDIETIRVHVRHLRTKLEPDPRRPRY
                     IKTIYGAGYCLELNQTKTN"
     CDS             602103..602642
                     /codon_start=1
                     /locus_tag="GM3709_513"
                     /product="hypothetical protein"
                     /protein_id="BAQ63748.1"
                     /transl_table=11
                     /translation="MGINNIVDQALETGYLTPTMEAEVGKLCETSSELSLEEYMALDK
                     LMGALLTGEVTAMPRKQFINVMEELVVSEVISRVAEIETTSNRLLDVGDISAYALNRL
                     PPLYATTEEGANFQREKAKDELKTLITEQVEQSISLYLDRPEFHPERQVISKGSEPNN
                     VFKQVSQLLQSQASNYEPI"
     CDS             602723..603091
                     /codon_start=1
                     /locus_tag="GM3709_514"
                     /product="hypothetical protein"
                     /protein_id="BAQ63749.1"
                     /transl_table=11
                     /translation="MLPFSWEFNTTIIAGSCLWCLALYIGFATLRESVIDGLYRWFNF
                     AERFLYTSDAEFERTRKGRESQNAFLASLMSIIPFLAMGILSNWLTELTFGRNWSISV
                     GILVCISCAVYDLGRRDSQG"
     CDS             603098..603883
                     /codon_start=1
                     /locus_tag="GM3709_515"
                     /product="putative ABC-2 type transport system permease
                     protein"
                     /protein_id="BAQ63750.1"
                     /transl_table=11
                     /translation="MRYFDESLAVSQRILTELFRRKRSLIFWAIFPIFILLINSYIIA
                     ERVKITTALAMKISAPSSLVGAALFFSCLGGTIATIVSEREQKTLKRLFISPLSGVSY
                     FLGIFFAHSFIGLLQTLLVYGLLLTVLFIKEMSISGSIILGLIIIILSIISYVGVGFI
                     LGTQLAKRTEDVNAIVATFGVPLLIIGGTFFPSSFFPKKLLQFAQFNPIFHMNEALIK
                     VWGKGKSFEDIQGHFFFLLLFSITMVFFGWLCYERMITKEKTL"
     CDS             603968..604753
                     /codon_start=1
                     /locus_tag="GM3709_516"
                     /product="5-nucleotidase SurE"
                     /protein_id="BAQ63751.1"
                     /transl_table=11
                     /translation="MKILISNDDGIFAEGIRTLANTIALQGHEVTVVAPDRERSATGH
                     GLTLHQPIRADKIEGIFATGVTAWSCSGTPSDCVKLALSAILKDKPDFVLSGINHGSN
                     LGTDILYSGTVSAAMEGTIEGITSIAFSLASFTLKEFQPAANYAVKLINKLTENPLPE
                     TTLLNVNIPPVAETEIKGVKITRQGIRRYIENFQKRLDPRGKSYYWLAGELIEEIDQP
                     EHIYLPPDLSTDVQGNKENYITITPLQYNLTDVVTVKRLEGFV"
     CDS             complement(604774..605781)
                     /codon_start=1
                     /locus_tag="GM3709_517"
                     /product="RuBisCO operon transcriptional regulator"
                     /protein_id="BAQ63752.1"
                     /transl_table=11
                     /translation="MSDIPFSLDQLRILKAIADEGSFKRAADSLFVSQPAISLQIQNL
                     EKQLAVPLFDRGGRKAQLTEAGNLLLAYGEKIITLCQETCRAIEDLQNLQGGTLIVGA
                     SQTTGTYLLPRMIGLFHQKYPYVSVQLQVHSTRRTSWAVANGQVDLAIIGGEVPLELQ
                     DILEIIPYAQDELALIIPPNHPFAEQETIAKDDLYSLNYITLDSQSTIRKVLDQVLSR
                     CEINTSELKVEMELNSIEAIKNAVQSGLGASFVSVTAIEKELKMGIIHRAHIEGIEIQ
                     RTLSVIVNSNRYRSKAAEAFIKEILPQFSSDNYMSSLEQLSKKEKPFLDKSVEISNDE
                     L"
     CDS             606036..606818
                     /codon_start=1
                     /locus_tag="GM3709_518"
                     /product="15-cis-zeta-carotene isomerase"
                     /protein_id="BAQ63753.1"
                     /transl_table=11
                     /translation="MHHFDAKMINFFYFDLMAQISPSTLPNWLTPSHFIMIGLLLMFA
                     IVHSGLAALRMWGESKIGVRLYRVLFALLSIPLATVLIIYFFNHRYEGLVLWQVQGIP
                     GIKTTVWILSFISFLFLYPATFNLLEIAAVAKPEVHLYETGIIRISRHPQMVGQVIWC
                     IAHTLWLGTTFTIVTSLGLIAHHIFAVWHGDRRLTKRYGESFIKVKERTSIIPMLAIL
                     DGRQKLEIKEFLKPAYVGVTGFILFFWWLHPWLMTATARVSL"
     CDS             607071..607409
                     /codon_start=1
                     /locus_tag="GM3709_519"
                     /product="thioredoxin associated with NnrU/NnuR ortholog
                     membrane enzyme"
                     /protein_id="BAQ63754.1"
                     /transl_table=11
                     /translation="MISVNQTTFNQEVLESPYPVLVNFWAPWCGLCLMLNPILNKIQS
                     EWQGQLKIVSINADQNLSLANSYRLRNLPTLLLINRGEIIHRLEGFQSREELYNSMNS
                     VMLNLMPESA"
     CDS             607537..608016
                     /codon_start=1
                     /locus_tag="GM3709_520"
                     /product="phosphopantetheine adenylyltransferase"
                     /protein_id="BAQ63755.1"
                     /transl_table=11
                     /translation="MIAIYPGSFDPITLGHLDLIQRSSILFEKVIVAVLKNPNKTPFF
                     TIEKRVQQIQECTANIKNIEVDSFSGLTVEYAQKKQAGVLLRGLRVMSDFEQELQMAH
                     INKTLENKIETVFLATNTELSFISSSVVKEIAKFGGSIDHLVTSNIAQDLYSNIRNK"
     CDS             608163..608978
                     /codon_start=1
                     /locus_tag="GM3709_521"
                     /product="peptidase M48"
                     /protein_id="BAQ63756.1"
                     /transl_table=11
                     /translation="MGYHSPISDRNPETNNRQLLILFALFSGVGLTIIIGLFILLNQV
                     VNLIPVSVEQKIGSLIVNEYKQKNKLSSTEIKLNKIVDKLEQLLPSNTTEKRNYQVLY
                     IPEDTVNALAIPGDTIIIYEGLLKQVESENELVMILSHEIGHFAHRDHLRSLGNIFLT
                     KLLINYLLGGVEILQSGADFTNILAHAQYSQAQEKKADEYGLDLLNKYYGHVAGATDF
                     FQRLMTENKQTEQRNIIAFIASHPLPEKRIKNLEKLIKNKGYILQKKVDWIDN"
     CDS             complement(609061..610311)
                     /codon_start=1
                     /locus_tag="GM3709_522"
                     /product="S-layer domain-containing protein"
                     /protein_id="BAQ63757.1"
                     /transl_table=11
                     /translation="MNKLSQSKATTALLLCLTFGVETTIPIVASLANPPVVMAQNSQF
                     EDVSSNYWAANFINPLVQRGVIAGFPDGTFKPDAPVTRAQFAAMVQKALPRNSVRSPI
                     NFNDVPSNYWANTAINNAFSMGFLSGYPGQIFRPEQNIPREQVLVSLANGLNFSPNKN
                     INTILNSFNDSSNISNFARSPVAAATEKNLVVNYPTLKQLNPVRNATRAEVAAFIYQA
                     LVSQGKLQAINSNYIVALTPTVNETESVLNRGQKIPVQYQEDKIFVTNTETVPITFTV
                     TKNIDSNKVIVIPRNSKVIGELRPSGNNGTRFFGKSIELPNGRVLRVKSSSQTITEIE
                     SVTKGMDVGKLLRNAAFGTGAAAAIAGVTGDRRITTGELLIGTGAGVLATLIPQFLGL
                     NRVDLLVVQPKGLNIKLDEDLIIN"
     CDS             610763..611227
                     /codon_start=1
                     /locus_tag="GM3709_523"
                     /product="bacterioferritin"
                     /protein_id="BAQ63758.1"
                     /transl_table=11
                     /translation="MEGNQEIKLQLNNILKLKLTAINQFFLHARMCKSWGLNKLNEYE
                     YRYSIKLMKQADKIIERVFFLEGLPNLQSLGKLLIGEAVSEIIANDLTMTMELADTLR
                     TSINLCESLQDYVSRDLLTELLEETEEEIDWLESQQWLMANSGLENYLQSMI"
     CDS             611238..611705
                     /codon_start=1
                     /locus_tag="GM3709_524"
                     /product="bacterioferritin"
                     /protein_id="BAQ63759.1"
                     /transl_table=11
                     /translation="MKGNKKVIKQLQKLLRSELSARDQYFTHSRMYQDWGLNKLYDRI
                     DHEMHDETAHADMLIKRLLFLETIPDLSEQEGLNIGSDVPEMLRNDLELEYKVIGDLK
                     EAIAICEEEQDYQTREILRVMLGDTEEDHAYWLEKQLGLIDKIGLQNYLQSQM"
     CDS             complement(611696..612256)
                     /codon_start=1
                     /locus_tag="GM3709_525"
                     /product="expressed protein"
                     /protein_id="BAQ63760.1"
                     /transl_table=11
                     /translation="MASIIWVARHGHRFDFAYPEWFNTALRRYDPPLSEEGKIQAQNL
                     GINLKNEVIDHLIVSPFLRTIQTAHIIADIINLPLKLEPGLGEWHNPHWMTEKPLTHP
                     PEELRLFYPRIDWNYRSTITPIYPETEAMVLERMKETAQILIRKFSGNLLLIGHSISV
                     IGITKALVGEKKEIKPDFCSITKIYI"
     CDS             complement(612347..612538)
                     /codon_start=1
                     /locus_tag="GM3709_526"
                     /product="hypothetical protein"
                     /protein_id="BAQ63761.1"
                     /transl_table=11
                     /translation="MPTITYNRFIKFLQEELDVPQDSIAIAQRSVDHNLGLIPMVLWQ
                     YGLVTIEQLDRIYDWLETS"
     CDS             complement(613046..613573)
                     /codon_start=1
                     /locus_tag="GM3709_527"
                     /product="hypothetical protein"
                     /protein_id="BAQ63762.1"
                     /transl_table=11
                     /translation="MMRYSSPLIITLSFLFLSCGFQPSSVSGSDENVSPKITPVDNTI
                     QSQNLPIGAKLLINQEVIELEIAQTPQQQAIGLMYRDSLLPNRGMLFPFNPPQTVSFW
                     MKNVSIPLDMIFVSDGVIKHIAKAPPCEIEPCPLYNSTVPIDQVIELAGGRTEELKIK
                     VGDEINIEFLEKMKN"
     CDS             complement(614057..614485)
                     /codon_start=1
                     /locus_tag="GM3709_528"
                     /product="photosystem II 12 kDa extrinsic protein PsbU"
                     /protein_id="BAQ63763.1"
                     /transl_table=11
                     /translation="MKLWHRVVTVFSFILFLCSVAFSQPAQALDFNTILQGTPRLVAA
                     DNTRRNVADDLLGTEFGQKIDVNNSDIRDFRDLRGFYPKLASIIIQNAPYEQVEDVLL
                     IPGLTDTQKERLQANLDNFTATPEAEVFNEGDERYNAGIY"
     CDS             614891..615526
                     /codon_start=1
                     /locus_tag="GM3709_529"
                     /product="alkyl hydroperoxide reductase subunit C-like
                     protein"
                     /protein_id="BAQ63764.1"
                     /transl_table=11
                     /translation="MVLQLGDAVPNFTQASSMGEISFYDWAGDSWVVLFSHPADYTPV
                     CTTELGTVASLQSEFQKRNVKTIALSVDGVESHKGWINDINETQNTTVNYPILADDDR
                     KVADLYGMIHPNSLNNLTVRSVFVIDPNKKLRLSITYPASTGRNFDEILRVIDSLQLT
                     DYYQVATPANWQDGGDCVVVPSIPTAEAKEKFPKGVTEIKPYLRMTPQPNK"
     CDS             complement(615931..616860)
                     /codon_start=1
                     /locus_tag="GM3709_530"
                     /product="phytoene synthase"
                     /protein_id="BAQ63765.1"
                     /transl_table=11
                     /translation="MLQLPKKLQPKQPLASPEESYEYCRQVTAKYSKTFYLGTLLMPK
                     EKRSAIWAIYVWCRRTDELVDGPQAKLTTPETLDLWEQQLESVFAGQPIDDPDVALVD
                     TLQRFPMDIQPFRDMIAGQRMDLYRNRYETFEELNLYCYRVAGTVGLMSSAVLGIDET
                     YLNAPWYHHSVYIPEEEAVALGIANQLTNILRDVGEDRSRNRIYLPLEDLARFNYTEE
                     DLFNGVIDDRWYNLMQFQIDRARQYYEDAERGIKALNPDGRWPVWSALMLYQGILDVI
                     IKNNYDVFNRRAFVPTPNKMLYLPVAWLRAQVL"
     CDS             complement(617047..618462)
                     /codon_start=1
                     /locus_tag="GM3709_531"
                     /product="phytoene desaturase"
                     /protein_id="BAQ63766.1"
                     /transl_table=11
                     /translation="MRIAIAGAGLAGLSCAKYLADAGHTPIVLERRDVLGGKVAAWKD
                     EDGDWYETGLHIFFGAYPNMLELFHELGIEDRLQWKEHTMIFNQPEKPGTYSRFDFPD
                     LPAPVNGLVAILRNNDMLTWGEKIKFGLGLLPAIVQGQEYVEAMDKYSWSEWMAKQNI
                     PPRIEKEVFIAMSKALNFINPDEISATILLTALNRFLQEKNGSKMAFLDGSPTERLCK
                     PIVDYVTERGGEVRLNAPLKEILLNEDGSVKGFLLRGLNDAQDEIFTADVYVSAMPVD
                     PLKVMLPTSWKEMPFFQKLEGLEGVPVINLHLWFDRKLTDIDHLLFSRSPLLSVYADM
                     SNTCKEYSNPDRSMLELVLAPAADWIAKSDEEIIEATMQELRQLFPQHFNGDNPAKLL
                     KSHVVKTPRSVYKATPGRQAYRPFQKTPISNFYLAGDFTMQEYLGSMEGAVLSGKRTA
                     QVISKDYPVSINFQQPEPTTV"
     CDS             complement(618763..620373)
                     /codon_start=1
                     /locus_tag="GM3709_532"
                     /product="amidase enhancer"
                     /protein_id="BAQ63767.1"
                     /transl_table=11
                     /translation="MKFNSCLNFNLISPQLWLTLPLLLGALFFPNLPVLAVDLKVGIV
                     QRFGDELEDEITLKSNEGDSLTVKFTNISNQEEKTLTTNQLKLSIVAQPLPNKLIEER
                     LILGDYGTFETAEDSANRWQSLGIDVEITQPGRWQVWAKRSTYSNPLLKRLLLSAIQE
                     KGYQDVYIETAILLEKPIVSFKINDNTYQANYLEINSSKNIIQVKDGIKGTWRNYGGT
                     FTLQPNSYGNYTLVNKVDIETYLRGVVPHEIGSNVPMAAAEAQTIIARTYALRNTRRF
                     QADNYEMCATTHCQVYYGLTGTSSTSDKAIASTKGLVLTYDNELVDALYSSTTGGITS
                     YFEDVWNGQNRPYLKSVIDSPQQVWNLGENTLESEANFRKFISLQNGFNETGRSLFRW
                     NRKSSIQDLSKDLQKYLERTKHPLKDFKIIKEMKIVNRSSSGRIIKMDVITDSGVVSL
                     AKNEVRSAFTPPRSTLFYLDPFFDKNNKLAGYAFVGGGFGHGVGLSQFGSYNLANLGW
                     SAQRILQFYYPGTKVEPLNNSIIFWRPD"
     CDS             complement(620651..621754)
                     /codon_start=1
                     /locus_tag="GM3709_533"
                     /product="ceramide glucosyltransferase"
                     /protein_id="BAQ63768.1"
                     /transl_table=11
                     /translation="MGSIVYYLYSLYSCYRFFSQKEEVNVDFSPPISILKPLWGLEYN
                     LEENLTSFIIQNYPQYQIIFCVRDKHDPVILLVEKLINRYADRDLKLIVNDRIIGYNY
                     KVSNLANGLKYCDYNLILIADSDIEVKEDYLKKIVQPLQQEKVGVVTCLYQSLSHNFT
                     GIIESLGVACNFIPNVLTARQLEGVKFAFGSTILIRKKILEKIGSFERIANSLADDFL
                     LGNLPTKLGYETVLSNYIVKHQITEEIFNHYLKRQIRWFRCIRVQRFKGYLGMIFTYG
                     TINSIIFCLFNHLSFFSLIVLIITLSLKLLLNYKLSFKYLNNDTIIQYLGLIFVVDLI
                     RFYIWSIALFGNKIKWGNNHFILKSNGELSIDS"
     CDS             complement(621880..622971)
                     /codon_start=1
                     /locus_tag="GM3709_534"
                     /product="GTP-binding and nucleic acid-binding protein
                     YchF"
                     /protein_id="BAQ63769.1"
                     /transl_table=11
                     /translation="MLRAGIVGLPNVGKSTLFNAVVANAKADAANFPFCTIEPNVGVV
                     AVPDERLEVLAKISKSVKIIPTRIEFVDIAGLVKGASKGEGLGNQFLANIREVDAIVH
                     VVRCFDDDDIIHVSGSVDPIRDIEVINLELALADLTQVERRVERLRKQVKNNKEAAEE
                     MGILERILPILNDGKPARFLNLTPEEEIIVKPLGLLTSKPVIYAANVTDEDLATGNEW
                     VEQVKQQVASENAKVVVVSAQVESELVELSLEEKAEFLESLGVTEGGLQSLIKATYEL
                     LGLRTYITTGETETRAWTIIAGMKAPQAAGVIHTDFERGFIRAETVAYEDLVKTGSMA
                     AAKEQGLVRSEGKEYIVKEGDVMLFRFNV"
     CDS             complement(623070..623366)
                     /codon_start=1
                     /locus_tag="GM3709_535"
                     /product="hypothetical protein"
                     /protein_id="BAQ63770.1"
                     /transl_table=11
                     /translation="MITSEIENSPKRYRMFLDNSRTGNRYTLTLEESNGEWIASWYST
                     ILENQRVEGSDANLVAINADQAFHQAKYLIEKEDEDIIGVDWQFENPLPPWIVD"
     CDS             complement(623959..624840)
                     /codon_start=1
                     /locus_tag="GM3709_536"
                     /product="beta-carotene hydroxylase"
                     /protein_id="BAQ63771.1"
                     /transl_table=11
                     /translation="MQSVSPVLTSVPREYLKAPGGFNPTVLMFITAILLITFSTVGYF
                     LWGWIDWICFCANVLALHMSGTVIHDASHNSAHSDRIINSILGHGSALMLGFAFPVFT
                     RVHLQHHANVNDPENDPDHYVSTGGPLWMIAARFFYHEIFFFKRQLWRKYELLEWFLS
                     RLFLFTVVFLGINYGFIGYVMNFWFVPALVVGIALGLFFDYLPHRPFRERDRWKNARV
                     YPGRVLNLLILGQNYHLIHHLWPSIPWYKYEPAYYATKPLLDAKGCDQSLDLLNGKNF
                     WSFLYDIFLGIRFHDKH"
     CDS             complement(624950..625342)
                     /codon_start=1
                     /locus_tag="GM3709_537"
                     /product="hypothetical protein"
                     /protein_id="BAQ63772.1"
                     /transl_table=11
                     /translation="MNGSTLYLLEQTVYFEKSFQKLVKTYKSQDEKIRFSQNISNYLD
                     ALIINPYPPQARTEPLPSGLKLSQEWRFYKLVIVIAKGASGQIRIMYLLNEKDKIIKP
                     LWIYSHQQFTKRPPDKEIKQVIQEVFEE"
     CDS             complement(625314..625901)
                     /codon_start=1
                     /locus_tag="GM3709_538"
                     /product="putative prophage protein"
                     /protein_id="BAQ63773.1"
                     /transl_table=11
                     /translation="MVSPLTVAKYFIIRAYEDGRDDQMTNMKLQKLLYYSQCLYLALF
                     DEPLFLEDIQAWRYGPVCPPAYHFYSEFEAQQLPIPTPEYINEELKAVLEEVWQYFGQ
                     YHAYYLSDLTHLEFPWKKARKDLPSYASSNESISIEDMKLLGQKKLLEIEQNHPHYEQ
                     IISHILKGEINSHKKYKPQYIKQGEVNEWLNSLLA"
     CDS             complement(626157..626654)
                     /codon_start=1
                     /locus_tag="GM3709_539"
                     /product="cytochrome b6-f complex subunit IV"
                     /protein_id="BAQ63774.1"
                     /transl_table=11
                     /translation="MSNPNSQLIKKPDLNDPKLRAKLAQNMGHHYYGEIAWPNDILYM
                     FPVCILGALGLIVGLSILDPAMIGEPADPFATPLEILPEWYLYPVFQILRVLPNKLLG
                     IACQAAIPLGLMLIPFIESVNKFQNPFRRPIAMTVFLFGTLVTLWLGAGSIFPIDKSL
                     TLGLF"
     CDS             complement(626795..627463)
                     /codon_start=1
                     /locus_tag="GM3709_540"
                     /product="cytochrome b6-f complex subunit"
                     /protein_id="BAQ63775.1"
                     /transl_table=11
                     /translation="MFTKQVTDSPVYKWFNDRLEVDAISDDISSKYVPPHVNIFYCLG
                     GITLTCFLIQFATGFAMTFYYKPTVTEAFTSVQFIMNEVNFGWLIRSIHRWSASMMVL
                     MLILHVFRVYLTGGFKKPRELTWIVGVTMAVITVSFGVTGYSLPWDQVGYWAVKIVSG
                     VPAAIPVVGDQMVELLRGGASVGQATLTRFYTIHTFVLPWLMAVFMLLHFLLIRKQGI
                     SGPL"
     CDS             complement(627668..627991)
                     /codon_start=1
                     /locus_tag="GM3709_541"
                     /product="hypothetical protein"
                     /protein_id="BAQ63776.1"
                     /transl_table=11
                     /translation="MTQIVEVNLVDVLTRLENKIEPLENKIDRVQSDVTEIKIDIEKL
                     KVQNEESNKRMESIDKRIDGVDKRMEGLDTRLNTLTIGFLSIVGILVTGLLTAVAKLI
                     SLPSF"
     CDS             628114..628626
                     /codon_start=1
                     /locus_tag="GM3709_542"
                     /product="carbonic anhydrase"
                     /protein_id="BAQ63777.1"
                     /transl_table=11
                     /translation="MKLLRNIDFPESAFIADNASIMGDVEIGRGSSIWYSAVVRGDVE
                     KISIGSYTNIQDGAVLHGDPNKVTILEDYVTIGHKAVIHSAHIKTGCLIGIGSIVLDG
                     VTVGEGSIIGAGCVVTKDVEPRSLMVGIPAKKLREIGEDEAQDLINHAKKYYQLALYH
                     GGKSDNKGFY"
     CDS             complement(628585..628788)
                     /codon_start=1
                     /locus_tag="GM3709_543"
                     /product="hypothetical protein"
                     /protein_id="BAQ63778.1"
                     /transl_table=11
                     /translation="MIVRAIVEWDEETETYTATCPKLSFVSSFGDTKQEAISYLKDAI
                     NLMLEPISDNLIKSLIITFSTMI"
     CDS             complement(628916..629995)
                     /codon_start=1
                     /locus_tag="GM3709_544"
                     /product="RecA protein"
                     /protein_id="BAQ63779.1"
                     /transl_table=11
                     /translation="MATSTMAQNSDKSDKEKALNIVLTQIERNFGKGSIMRLGDATKM
                     KIETISSGALTLDLALGGGLPKGRIIEIYGPESSGKTTLALHAIAEVQKAGGIAAFVD
                     AEHALDPTYSAALGVDIDNLLVAQPDNGESALEIVDQLVRSSAVDIVVIDSVAALVPR
                     AEIEGEMGDLQVGLQARLMSKALRKVAGNIGKSGSTVIFLNQLRQKIGISYGSPEVTT
                     GGTALKFYASVRLDIRRIQTLKKGSEGEYGIRAKVKVAKNKVAPPFRIAEFDIIFGSG
                     ISRVGCLLDLAEKTNTVTRKGAWYSYNGDNIAQGRDNAVKYLEENPEIASEIEQKVKA
                     ELEINNVSFETASDDSEEDFTSIDE"
     CDS             630333..631040
                     /codon_start=1
                     /locus_tag="GM3709_545"
                     /product="hypothetical protein"
                     /protein_id="BAQ63780.1"
                     /transl_table=11
                     /translation="MTNQLHLQYITSLSATEWNTWRQKNPQIVPDLRKADLSRLNLSN
                     FNLKEANLIEVDLSQATLIKTNLSKASLSKANFTRVYSRDANVSLANLQDANFFGAYF
                     TGADFSRSCLSGANFQEANCSDSFFITSDLTYANLSRGIFRGVSFMEANLNNADLKET
                     ALNQGDFTLAKAYNSDFSKATLTNIIIEDWKINNQTKFNLVICDHLFLRSQQRISSDN
                     QIFPDTAKFLEFAVNTH"
     CDS             complement(631190..633442)
                     /codon_start=1
                     /locus_tag="GM3709_546"
                     /product="circadian input kinase A"
                     /protein_id="BAQ63781.1"
                     /transl_table=11
                     /translation="MFIPSLSLISRIIPYQMFTKISHLWRDLVNENSLNGIYFTEDNL
                     INSDVDNVKNEKTSFHSFQLFVSKNIQALLLVEKKINEFYYQITISFEHQEILDFLGL
                     IDHKISLNRDKISDVKNILLTNNQKNIQEENFIFTLMNIITEPLAFQENYLADYSHHQ
                     SIEVILRNRIEQERILHQVTQQIQQDLDLLIIVKMTIEQVQSLLQIDRLLIYQIRVPI
                     KQESSEETILIDTVTYEAKASSVIPSVLNFQEESCFNNIKDCEEKYLKGFYLAIDDIH
                     NSNINLCLKELMQKLGVKAKIAIPIIVKNELWGLLIAHQCFAKRKWKSNEINFLKNIA
                     EYLAVAIYQYNSYHQLEEQKILLEEQIEKKAKQLQDALIVAQIANQSKTEFLGSISHE
                     LRTPLTCIIGLSGTLLHWSKDIKNNLSLEQQIRYLKIIQDSGRKLLQLINNILDFADI
                     EAGKSLLYMEEISLENLGKMLYLSALEIARNKGINIKLDSTINKSLDLFYCDGERVYQ
                     ILLNLVDNAIKFTPYGGEVIIKISRNKNQVIFQIEDTGIGINQEQIPLLFTKFQQLEN
                     YRTRTHSGTGLGLALSKHLVELHGGIIEVKSIIDKGSTFTVILPNSSQTHNLKSKVSD
                     KEISDLKTNKTIVIICEDDEIGTFLCQLLTAAEYQVIWLVDVYEAINRIKLINPSIVI
                     LEQNQEISLEISQNIKLKSEDNLYLMIIRDRISGNEWENLSNSGVDEYLLKPLQPRLL
                     LRKIAKIINH"
     CDS             complement(633946..635025)
                     /codon_start=1
                     /locus_tag="GM3709_547"
                     /product="lipoprotein precursor"
                     /protein_id="BAQ63782.1"
                     /transl_table=11
                     /translation="MNVRFAIASDLHIALPETIDTNVNRFHLTQFSIPALEVVLQHLN
                     TLNLDFLLLPGDLTQNGEIVNHQWLQAKLETLSYPVYVIPGNHDVPSLKGSKNTIAFQ
                     EFPEYYQKFGYKNTKSHDYTCELADGLQLVALNSNHFNEEEKQLGCLMENQLIWLEET
                     LSKLTDKLVLVMIHHNVIEHLPNQSNHVLGCRYMLDNASQLLSILNKYQVRFIFTGHL
                     HIQDIATSNGIHEITTGSLITYPHPYRILELKDNQLSIESHHITQLPDIKNLAYFSKK
                     WTSDRSFPFMITMLTSPPLNLSLTEAKEYAPLLKNFWADIAHGDKIFDFTQLPPHINQ
                     YFQLFGAVDQDGQPRTIDNNIKIIL"
     CDS             635062..635709
                     /codon_start=1
                     /locus_tag="GM3709_548"
                     /product="tRNA"
                     /protein_id="BAQ63783.1"
                     /transl_table=11
                     /translation="MARVRVRQHVNPLSNRYQQLISIPDWSQIYSNLSLPFHLDLGCA
                     RGRFLLQMAQQNPDRNYLGVEIREGLVTEANEIKEEYHLSNLYYVFGNINHSLTNLLA
                     SLPPYSLELVTIQFPDPWFKKKHQKRRVVQSEIVEILAQFLSPKGQVFLQSDIKEVAE
                     EMLDRFLENSQFKPLKPEIWLTENPLEVMTEREIATINKGESIYRSILTINIRKD"
     CDS             complement(636009..638201)
                     /codon_start=1
                     /locus_tag="GM3709_549"
                     /product="assimilatory nitrate reductase large subunit"
                     /protein_id="BAQ63784.1"
                     /transl_table=11
                     /translation="MSKKVTTVCPYCGVGCGLEVQPPSEGKTINCDSEGNPIWKVMGD
                     RNHPSSLGKVCVKGATVTEAMAKNRLEYPLFREKLDQEFRQISWESAYNLIVNRINTV
                     RETIGVDGICMYGSGQFQTEDYYIAQKLIKGCLGTNNFDANSRLCMSSAVSGYIGSFG
                     ADGPPCTYEDLELTDCAFLVGTNTAECHPIVFNRLRAYHKKNPHVKLIVVDPRHTATA
                     EVADLHLPINPGSDIDLFNGIAYLLLQWNAVDYSFIDRYTNHFEDYKEIILHYPPEVV
                     AQKCGISIEDLETCTRYWVESDKVLSMWSMGLNQSSEGTAKVRTLINLHLMTGKIGKA
                     GSGPFSLTGQPNAMGGREAGGLAQLLPGYRSVLNPNHRAEVEVLWGLPSGSIDDKVGK
                     SVWEMILGLETGEVGLFWVAATNPVVSMPDLERTKKALLKSPFTVYQDAYYPTETAYY
                     AHLVLPAAQWSEKSGTMTNSERVVTYAPKFSNPPGEAKADWEIFAEVGRRLGFEQYFN
                     FQNVAQVHQEFASITEDRPCDMSGMTHQLLEQYGAIQWPFPLGSNPENRYGRRLYTDL
                     KFHTKNEKANFAPLHSRGLAEPPNPDYPLVLTIGRLYGHWHTMTRTGRIDKIKKMHPE
                     PFLEIHPKDAHKLNLEDNDFVKVASVRGEAQFKIQITRSIAPGTVFVPMHWGFLWAKN
                     AEANSLTHPHACPISKQPELKACAVNLTKIIPQSDIKLSAKKGNRDKN"
     CDS             638553..639209
                     /codon_start=1
                     /locus_tag="GM3709_550"
                     /product="hypothetical protein"
                     /protein_id="BAQ63785.1"
                     /transl_table=11
                     /translation="MKIKYLLKPKNFLYHINKVNIFFCSLALLFFSILSTLVATGKLK
                     ELDEYLLTQLHVILPDWFVYIAKASYFVGEAEVAVFIVLFSLGFLVWKKYWDEAQVLA
                     LFTLSILILIDKILKPFFAIPRPLDRLVDNAFGNSFPSGHASGNLLLYFLLAYFFSRS
                     FPENKTYFYILATFLIILMGISSAYLRVHWVTDILASYCVGYILFSLAVTLLKSSKNN
                     "
     CDS             639288..641048
                     /codon_start=1
                     /locus_tag="GM3709_551"
                     /product="4-amino-4-deoxy-L-arabinose transferase and
                     related glycosyltransferases of PMT family"
                     /protein_id="BAQ63786.1"
                     /transl_table=11
                     /translation="MREKKLQINSESLQKSPEKLWAISIVSLSIICGVAFFLNIGNIG
                     LIDKTEALYVEVARQMVITNNWISPHWNDNYFYSYPAGGYWFLALSFKLFGISEFSAR
                     LPIALTATAVVFMVFYTLRYFGYIENKPKNPLYLWLTAWIGGSIMALNPAWIAWGRVA
                     VSDMLLSSAVSLAMLTFFLGYAQPDKPKTQRIFYSIFPILLSIAVLVKGPIGIILPVL
                     GIGIFLLYVGKFWEIFWEIKTFRTIGIFLILTLPWYIAAIIMDGEIFVNEFLAVSNFK
                     RFTSVVFNHPGPWYYYIIWGTVLMLPWIVYFPLAVMNLSCWRWQKVRQSPRQSQLGLY
                     AFCWFITTFVFFSAAATKLQGYILPVTPAVVIIIALFWGEKLRESSPKNEKLFLVSAI
                     FNLIILLALSIASAISVSLIGEDTSAPTFAENLGKSGIPIISAISWGLGVVTAIALLW
                     KKPLWRWFWSSNLLAFFAFVTFVFPPLIPLLDIERQQSFRAISLQIKEEIKPQEEVFL
                     IGFTRYSIVYYADHSVNFVHGIEDFQDQIKQKNLQGKTILVVVESKYLEDSPLGKMDY
                     DLVSQKQAYKLIRIARDNIL"
     CDS             complement(641217..642473)
                     /codon_start=1
                     /locus_tag="GM3709_552"
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="BAQ63787.1"
                     /transl_table=11
                     /translation="MSRNYLFTSESVTEGHPDKICDQISDTILDALLTQDPSSRVAAE
                     VVVNTGLVLITGEISSKANVNYIDLARKKIADIGYTDAGNGFSADSCSVLIALDEQSA
                     DIAQGVDKAQEQRENLSEDELDKIGAGDQGIMFGFACNETPELMPLPISLAHRMARRL
                     GLVRKSGELPYLGPDGKTQVTIAYENDQPIGIDTILISTQHAASIGNITDNKAIQATL
                     RDAIQEVVVNPVFHDLQIKPTDKTRFLLNPTGKFVIGGPQGDSGLTGRKIIIDTYGGY
                     SRHGGGAFSGKDPTKVDRSASYACRYVAKNIVAAGLATKCEVQVSYAIGVAQPVSIFI
                     ETFGTATVPEEKLLPLVKANFDLRPAGIIQMFNLCSLPAQRNGRFYQDVAAYGHFGRT
                     DLDLPWERIDKATLLRDAVSQTLAIA"
     CDS             642586..643158
                     /codon_start=1
                     /locus_tag="GM3709_553"
                     /product="hypothetical protein"
                     /protein_id="BAQ63788.1"
                     /transl_table=11
                     /translation="MKILKFLVSGLILTISACQKETPQPTESSPISSQKKQEIINKIY
                     TQQKEINLCNQQRDNELTHDSANIYFLNDREYLIEIICFLGAYQSNYQYLLFDRKSSE
                     IKVINFATFDNSTDNLKLTNTNTLNGMTDFDSNNQTLILITKSRGLGDCGSFAQYHWR
                     DHSFELKEYRYKQDCDEVYLPPENYPLIYP"
     CDS             complement(643336..643449)
                     /codon_start=1
                     /locus_tag="GM3709_554"
                     /product="hypothetical protein"
                     /protein_id="BAQ63789.1"
                     /transl_table=11
                     /translation="MQFYHIYISDLGLDDGELLIMMSNDSADIAIADYAHG"
     CDS             643557..644066
                     /codon_start=1
                     /locus_tag="GM3709_555"
                     /product="inorganic pyrophosphatase"
                     /protein_id="BAQ63790.1"
                     /transl_table=11
                     /translation="MDLSKIPPQPKAGIINVLIEIPGGGKNKYEFDKEMNAFILDRVL
                     FSSVKYPYDYGFVPNTLADDGDPLDGMVMMDEPTFPGCVIASRPICMLEMIDGGDRDE
                     KILCVPAEDPRYDHVKSMKDVAPHILEEIAEFFRSYKNLEKKETNILGWKDIDQVAPL
                     VEQCVKAYK"
     CDS             644298..645398
                     /codon_start=1
                     /locus_tag="GM3709_556"
                     /product="urea ABC transporter"
                     /protein_id="BAQ63791.1"
                     /transl_table=11
                     /translation="MNETILEIDDLTVSFDGFKALNHLKFKMNKGELRVIIGPNGAGK
                     TTFLDVITGKVQPTQGNVFFKGKNLRKISEHQIARMGIGRKFQTPRVYLNLTVKENLD
                     LVANKTKNVFSTLFNKATEQDKRSVASLLETIGLTAKAELQAALLSHGEKQRLEIGML
                     VAQSPDLLLVDEPVAGLTDEETENVGNLLLALAESHSIIVIEHDMEFVRQIAKQVTVL
                     HQGTVLCEGTMNEVQNDPRVIEVYLGQETSLERDEIVIVRIAATMAWADFNLTPEEQD
                     IIITNLSKQFATSEEDELQLKEELVNFLAENIPLIDLVPLLETQQEKEKVLKLSYQII
                     NNHGINELENQVYQELLELLNLPEEIVHSIIN"
     CDS             645539..646240
                     /codon_start=1
                     /locus_tag="GM3709_557"
                     /product="urea ABC transporter"
                     /protein_id="BAQ63792.1"
                     /transl_table=11
                     /translation="MLNLSSLNVYYGESHILRDVDLSINSGEMVCLIGRNGVGKTTLL
                     KTIMGLLKSRTGEINFKDKVIDKVTTDQRAKLGIGYVPQGRDIIPRLTVKENLILGLE
                     AIPNKVKVKKEVSEEIFELFPVLKTMLNRMGGDLSGGQQQQLSIARALMGKPQLLLLD
                     EPTEGIQPSIILEIESAVKKIIKETGISVLLVEQHLHFVRQADRYYAMQKGGIVASGL
                     TSQLSQRVIQEFLAV"
     CDS             646323..647660
                     /codon_start=1
                     /locus_tag="GM3709_558"
                     /product="phosphoglycerate mutase"
                     /protein_id="BAQ63793.1"
                     /transl_table=11
                     /translation="MTTRVIIVRHGQSSYNAQKMIQGRCNESIITEKGEKQALLLGKT
                     LKNIKFNGFYCSPLQRAHKTAQIIQELNDYNPNLTIAEKLREINLPIWEKWKKEDVKR
                     EYPEEYRLWKEKPHQLKMMVDGEEFYPVLDLYRQAEDFWREIIPQHNNETILITAHNG
                     INRCLILTALGMSPSYYHTIQQSNCCINVLNFTGNFGESVQLESLNQTSHLGMALPDF
                     RPEQKQGLRLLLVRHGETEWNRMSRFQGVQDIPLNDNGRQQAQKASDFLKDVSIDFAV
                     TSPLLRPKETAEIILQNHSSVTLTTKKDLEEISHGLWEGKLETEIEAEYPGLLNQWKE
                     KPETVQMPEGENLDQVWKRAVDSWHEIIKENLEEGKMKTGLVTAHDAINKVIVCYLLG
                     LKPANFWNIKQGNGAVTVIDYPQGLDGMPIFQAINITSHLSDSVFDRTAAGAL"
     CDS             647882..648184
                     /codon_start=1
                     /locus_tag="GM3709_559"
                     /product="hypothetical protein"
                     /protein_id="BAQ63794.1"
                     /transl_table=11
                     /translation="MNEFEKLCPEFVEKTRQETKCLYYGFSFNGNIVHCREGYQDAEG
                     VLTHLANVEILLQQALTISDLIRLEIHGNETQLEKLRQPLANFKPDFFVLKYGFRK"
     CDS             complement(648207..648323)
                     /codon_start=1
                     /locus_tag="GM3709_560"
                     /product="hypothetical protein"
                     /protein_id="BAQ63795.1"
                     /transl_table=11
                     /translation="MLEMKMLSPNTPQEVRLIPILCKKLRRENFMAIAFPLK"
     CDS             648373..650370
                     /codon_start=1
                     /locus_tag="GM3709_561"
                     /product="peptidase C14 caspase catalytic subunit p20"
                     /protein_id="BAQ63796.1"
                     /transl_table=11
                     /translation="MLVGINQYSHGKNLRGCITDVDLQKELLIHRFGFSPNDIITLLD
                     RQATRENILTAFQQHLIQQAENNDVVIFHFSGYGRQVKLNWDESLWQNSFITYDSVTP
                     KDDCVEDILLDTLNKLAQSLKTNKYTFIFDTSFISSPDSIANKFSLRCHESTQKFIIS
                     TIELDFNQQLKNSNSKITLLKNNNSLSNFILSPSLNSIAVEINSLNFNVGLFTYCLTQ
                     SLWENLPQTDNLTFMKKVAFQVALSSGNGEKIIFYSNKKQDDFIYHLPFIKDTQGEAI
                     INNFTDPNLVDLQLLGLPLLVLYNYGLNSCFVAKTKDEKIITIQINSLQGNKAKGILI
                     NTSKNLITQGLILQESLRVIDRNTGLNIGLNNSLEKIEKVDATSALSAVSNIESVINL
                     GDNFVDCIFGKFINKINSIEGYSLFSPAGILFPNTYPKITNEAVSSAVKRLIPSFKIA
                     LAEKLLHLTFNQSSSNSYLNINLEINNDNQTFSPPSQTTPNRIKTSSNFIQQSGDNGD
                     NLLISIPLGSQFKVTINNENDHDLYYLLLGINSSRQIVAYFSPNSYMINAKNTISIPE
                     KSSSLKWLFNDKKGIGELILICAKSPFNQTLNQLYQISEMKPNNEQIILLENPVIIAQ
                     AILEDLHLGSNINSNLVNNLSDVYALDINNWTTFNFVYEIV"
     CDS             complement(650609..653116)
                     /codon_start=1
                     /locus_tag="GM3709_562"
                     /product="diguanylate cyclase/phosphodiesterase with
                     PAS/PAC sensor"
                     /protein_id="BAQ63797.1"
                     /transl_table=11
                     /translation="MSDTAENKHILTIKYDKIKQNVILKNEVYSIGRHSTNSIVIHHA
                     TISRYHCSILPVKYKDKNQQELFWIIDGDLKGNRSANGLFVNGIKCLSHELKSGDEIT
                     IGGDQVQVSYFVSNDAHNEEIASSDININNNSSSLDDSKETMVQDFSIRGVTTLTGKD
                     DKTDFFLEEILFILHNQHTELICPILTIDLNNKVTYTNNIFKEKFSDFRQNYTLSPFI
                     KNLVLELTKNDKKFCIREIKYKEQNYTQYAHFIENKTQIKSYIFSFSERDNIENALRE
                     NEEKYRAVVRQISEGIILIDPITKQIIEANNAYCSLMGYSPSEILSLKLSDLVATDPE
                     ISDSIIRKVQRNRLNVTQESIHRHKDGSLINVEVNISIIYYSAKEFICYAVRDITERK
                     LSEEMLRYQACHDLLTELGNRNLFNEQLHKAIARAQRYKNQFAIMFIDLDRFKNINDT
                     LGHDIGDKFLQGVAHRIRDCLRNSDLIARWGGDEFTILLSEIKTSQDAALVAERILQA
                     LKKPFPVMEYELRAYLSMGIAIYPQDGDNLDTLLKNADTALYQIKEKGGNNYQYYNDS
                     MNRTQKELLRMEGYLYEAIKQNQFQLYYQPQINVKTWQIVGMEALIRWKHPILGCVSP
                     IRFIPIAEQTGLINALGEWVLLTACNQHKIWEKMGLPPLKMAVNLSPRQFQQKNLVSA
                     FKKILEDTKLDPKYLELEITESSIIDHPELTKDILNQLIELGISISMDDFGSGYSSLG
                     YLKKFPFQKIKIDQSFVRELKNEPQDLAIISAVITLGKGFNLEVVAEGIETLEQLKLL
                     KELQCEIMQGYFFSHPLPADEATNFLQSMNKNGVNFV"
     CDS             complement(653236..654411)
                     /codon_start=1
                     /locus_tag="GM3709_563"
                     /product="Unncharacterized conserved protein"
                     /protein_id="BAQ63798.1"
                     /transl_table=11
                     /translation="MLNNPLLDKIFERINNSPEKKITFAEYMNLCLYDREYGYYNSEK
                     TIIGKEGDFYTSASLSPDLGELLAIQLEEFWEVLGKPCLFQLVEMGAGNGNLALNILN
                     YIINHYPKFASCIEYIIIEKSEKLREKQKQLLTEKISNLITIKWENLLSIDDNSIIGC
                     CFSNELIDAMPVNLIRFSQQQLQEIYLTKENNTLVIKYDSLSQKEISKYFDMINVVFK
                     SNVYPENYQTEVNLSAIDWLKQISAKLKKGYLLTIDYGYSADKYYHPQRSEGTLKCYY
                     HHRHHHNPYVNIGTQDITCHVNFTALQKYGELFGLSTLSYTKQALFLMGLGLGDRLNQ
                     LSNGKMSLTQILQRRQELHNLINPEGLGNFGVLLQTKNLTLTQNKIPLKGFKNYDYI"
     CDS             complement(654482..655066)
                     /codon_start=1
                     /locus_tag="GM3709_564"
                     /product="hypothetical protein"
                     /protein_id="BAQ63799.1"
                     /transl_table=11
                     /translation="MTDSTNIKALAKLMAADFSNQQQAFDNPPFFAHIRVCMRPLPDS
                     LLGGTSLFLEQAYDFLLNQPYRLRVFKIHVVDDHLELEHYKLKEETEFYGASRNLEKL
                     KELSIEHLEKMNGCDMIAEGNGNYFKGYVKPGKACIVIRKNKESYLDNSFEIDQEKLI
                     SFDRGRDLVTDELLWGSVAGPFHFTRLTSFADEV"
     CDS             complement(655073..655780)
                     /codon_start=1
                     /locus_tag="GM3709_565"
                     /product="phycocyanobilin lyase beta subunit"
                     /protein_id="BAQ63800.1"
                     /transl_table=11
                     /translation="MSIETTINPVNQLIEAVEKADSAPKLLDAVTELANSQSKEAIPT
                     LIKVLGYNNPGAAVAATEGLISIGESVIEPLLTSLDNYNYGARAWAVRVFAGIGDIRA
                     LDLLIKAAINDFSLSVRRAAAKGLGSLQWHQLSPEKLISTQVQILDTLLTTINDGEWV
                     VRYASIVSLENLYLAIDSNFSNAQIIDNNQVNDINLSENLLNQITAKLTEIMKEDGEI
                     AIQSRAKLALKKIHNKL"
     CDS             complement(655864..656151)
                     /codon_start=1
                     /locus_tag="GM3709_566"
                     /product="hypothetical protein"
                     /protein_id="BAQ63801.1"
                     /transl_table=11
                     /translation="MNLNIRELETYSQQNPQEVLIITAEDNHEEVKIMIFKGFSSNLS
                     GGTEFDPDVPILSSGASILKLDRVMSPYNPVNPQYIQSNLTPSEFLQIIRK"
     CDS             complement(656282..656875)
                     /codon_start=1
                     /locus_tag="GM3709_567"
                     /product="L-lactate permease"
                     /protein_id="BAQ63802.1"
                     /transl_table=11
                     /translation="MEETLLKALVWTNYKLFVFLCLIVPLILSVWALTAQIQSIQRLL
                     VIYWRVASLMAIAIYLLIPVWQVGYIAWFLGHILVVISLWFWVDINDEIRDLPKSSLR
                     LILRSWRWAMTFYGTISSILFIPFLRCSISSSASVEKLCRVWLEAPWQYKSIFHANST
                     PGFLGFLGMTGLVIYLIYLFYFLTFRLIKQGRIALEQ"
     CDS             complement(656946..657170)
                     /codon_start=1
                     /locus_tag="GM3709_568"
                     /product="protein CP12"
                     /protein_id="BAQ63803.1"
                     /transl_table=11
                     /translation="MSNIQEKIQEEIKEAREVCDINGKGSPECAAAWDAVEELQAEAS
                     HQKENEPQKTSLEQYCDANPDAAECRLYED"
     CDS             657739..658905
                     /codon_start=1
                     /locus_tag="GM3709_569"
                     /product="aspartate aminotransferase"
                     /protein_id="BAQ63804.1"
                     /transl_table=11
                     /translation="MNKLATRISQVNPSITLTITAKAKAMKAEGLDVCSFSAGEPDFD
                     TPDHIKLAAKQALDDGKTKYGAAAGEMPLRQAIANKLKKDNNLEYKAENIIVTNGGKH
                     SLYNLIMALIEKDDEVIIPAPYWLSYPEMVTLAGGKSVIVNTTAENEYKITPEQLIQA
                     ITPKTKLFVLNSPSNPTGSVYTPDEIKALAQIIVDRDILVVSDEIYEKILYDGATHLS
                     IGAVNEEIFKRTLISNGFAKAYSMTGWRVGYIAGDINIIKAMTTVQGHSTSNVCTFAQ
                     YGAIAALESSQECVAEMLLSFTERRKVMYSAVESIANVSTPLPLGAFYLFIDISKTGL
                     KSLEFCDKLLTQEKVATIPGIAFGDDNCIRLSYATDMDSIEKGMTRLGNFIKSL"
     CDS             complement(658953..659180)
                     /codon_start=1
                     /locus_tag="GM3709_570"
                     /product="hypothetical protein"
                     /protein_id="BAQ63805.1"
                     /transl_table=11
                     /translation="MDDRDKNRIEKLEVASNTLTIEDSQEKKSSMTYRGFHYNRLKYN
                     RLKNVESIPQSKQNNVTYRGAKIDQSKKEIV"
     CDS             659236..659406
                     /codon_start=1
                     /locus_tag="GM3709_571"
                     /product="hypothetical protein"
                     /protein_id="BAQ63806.1"
                     /transl_table=11
                     /translation="MAKIAKRIGVGADTSPTIQVIAVTKADTAKIKQIISSIIFTSEY
                     LLFISGFLISVL"
     CDS             complement(659593..660180)
                     /codon_start=1
                     /locus_tag="GM3709_572"
                     /product="anthranilate synthase"
                     /protein_id="BAQ63807.1"
                     /transl_table=11
                     /translation="MILVIDNYDSFTYNLVQYLGELGNKYSVAKEIKVYRNDQITVTE
                     IISLNPDGIVISPGPGNPDSAGICLELVTKLAPNYPILGVCLGHQTIGQAYGGKIVSA
                     PTLMHGKTSLINHHNIGIFQDVKTPFNATRYHSLVVDKNTIPSTLEITAWTDDGIIMG
                     LRHKEYSLVEGVQFHPESILTDSGLKLLGNFLKNL"
     CDS             complement(660526..660990)
                     /codon_start=1
                     /locus_tag="GM3709_573"
                     /product="diacylglycerol kinase"
                     /protein_id="BAQ63808.1"
                     /transl_table=11
                     /translation="MSKFQIISLSPSTIPDGVSGTLLKKEKRNLAWKVAPNLISSFKY
                     AWQGVKYAFVTQRNFRIHTVMTSVALSAGFYLHATTVEMAIISLTCATVLVLELLNTA
                     IESVVDLTVKQSYHELAKIAKDCAAGAVLISAIASVLVASFILLPDAIALIL"
     CDS             complement(661204..661722)
                     /codon_start=1
                     /locus_tag="GM3709_574"
                     /product="metal-dependent hydrolase YbeY"
                     /protein_id="BAQ63809.1"
                     /transl_table=11
                     /translation="MKQYRTDLYVEDLFFFENQQESPIQESQWQDWIEKWLSLLELDL
                     DPQKTYEISLIFTDDQEIQSLNQQYRDKNQPTDVLSFAALETDFPDADFMDTVSLGDV
                     IISVQTAQKQAQLQGHSLNVELVWLASHGFLHLLGWDHPDDNFLREMLTLQEFLLNSI
                     GIQPPSVQDFFV"
     CDS             662039..662758
                     /codon_start=1
                     /locus_tag="GM3709_575"
                     /product="transporter"
                     /protein_id="BAQ63810.1"
                     /transl_table=11
                     /translation="MLQKIKQDLKNDLIAGLLVVIPLATTIWLSYVIANWAIKFLTQI
                     PKQINPFDGFDPIVTNLLNFSVGLTVPFVLILIIGLMARNIVGKWLLDVGERVLQGIP
                     LAGSIYKTLKQILETLFQDSQTKFRRVVMVEYPRQGVWSVGFVTGKVSDMIQVHHHKP
                     VLSVFIPTTPNPTSGWYAVIPEEEVITLSMSIEDAFKVLISGGIVSPNMNQNNSKTPI
                     SLSNAPVSIQKSIVESSVTED"
     CDS             663367..663963
                     /codon_start=1
                     /locus_tag="GM3709_576"
                     /product="RNA polymerase sigma factor RpoE"
                     /protein_id="BAQ63811.1"
                     /transl_table=11
                     /translation="MNVLANNPAEITDLELVQKCQQGDTNSFRLLYQRYQQKVRATLY
                     KLCGNELLDDLQQDVFFKAWKSLPKLRNCQYFSTWLYRICWNVAYDYGSAKKRDRDRT
                     EAHINQVKESLQTDLARSTNHHQTGLLQLHYQDLIQSGLQNLSLDHRAVIVLHDLEDM
                     PQKEVAQILSIPVGTVKSRLFKARKELRQFLEQQGVNL"
     CDS             663960..664313
                     /codon_start=1
                     /locus_tag="GM3709_577"
                     /product="hypothetical protein"
                     /protein_id="BAQ63812.1"
                     /transl_table=11
                     /translation="MTQNQSNPQDDDLVNFLKTYSPIPPKEDKPCEQLVMSSIISSTT
                     SPLLNSRWLRKGWVLSGTLITTLLILGGYLFNLNTRSTPQVATEMDQLEAFMIETWYD
                     SMAQESELNYVTVKD"
     CDS             664333..664839
                     /codon_start=1
                     /locus_tag="GM3709_578"
                     /product="hypothetical protein"
                     /protein_id="BAQ63813.1"
                     /transl_table=11
                     /translation="MNNRINFLLPLVTLATISFSSNVMALETVKEDSLSFDTSNPTIL
                     AQMGQRGKDKGDMLEKLNLSTEQQQQMQSIRTKYQPQMETLKQQMRTEKDKLRQMMTN
                     NDSQNNLRSQHSKITSLSQQMGDLRFQSMLEMREVLTPEQRQQWNQMMEEKKASWQER
                     RQQKQPQQ"
     CDS             complement(664904..665080)
                     /codon_start=1
                     /locus_tag="GM3709_579"
                     /product="sulfate permease"
                     /protein_id="BAQ63814.1"
                     /transl_table=11
                     /translation="MVGATGKVRNRLEKLGIAGLIPEYHWMNDRLPALQEGLAIVREK
                     QTLAYDNKKLGISD"
     CDS             complement(665239..666090)
                     /codon_start=1
                     /locus_tag="GM3709_580"
                     /product="formamidopyrimidine-DNA glycosylase"
                     /protein_id="BAQ63815.1"
                     /transl_table=11
                     /translation="MPELPEVETVCRGLNKATSGLTFIGVEVLLSRSLAYPKVDATFI
                     EGIKSRKIITWHRRGKYLLAQLSHGWLGVHLRMTGQLLWLTQDTSLNKHTRIRLFFPD
                     NRELRFVDTRTFGKVWFIPNDESPENIITGLQKLGYEPFSPDFSDSYLQSKLSKSRRH
                     IKTFLLDQSLVAGIGNIYADEVLFKSNIHPLTLACDLTFSQISALRLAIIEILENAIE
                     AGGTSFSDFLQITGVNGNYGGIAWVYGRKGLSCRICGTTINKMKLGGRSSHFCPQCQR
                     MNENFSL"
     CDS             complement(666125..666352)
                     /codon_start=1
                     /locus_tag="GM3709_581"
                     /product="photosystem I subunit IV PsaE"
                     /protein_id="BAQ63816.1"
                     /transl_table=11
                     /translation="MAIQRGSKVRILRKESYWYKDVGTVASIDKSGIIYPVIVRFDQV
                     NYNGFSGSAGGVNTNNFAENELEEVSAPAKK"
     CDS             complement(666457..666579)
                     /codon_start=1
                     /locus_tag="GM3709_582"
                     /product="hypothetical protein"
                     /protein_id="BAQ63817.1"
                     /transl_table=11
                     /translation="MRIYDRGAKSELEFYLVYEKIAIDMTKWVKHGSKINFVNQ"
     CDS             666830..666964
                     /codon_start=1
                     /locus_tag="GM3709_583"
                     /product="hypothetical protein"
                     /protein_id="BAQ63818.1"
                     /transl_table=11
                     /translation="MDQIEKVIEKLKEWTQKLIEALLGPQSEPEPELIPIPVRDRSRY
                     "
     CDS             667062..667469
                     /codon_start=1
                     /locus_tag="GM3709_584"
                     /product="3-dehydroquinate dehydratase II"
                     /protein_id="BAQ63819.1"
                     /transl_table=11
                     /translation="MGKREPSIYGHLTLEDINNMLEQEAERLNITLSCLQSNHEGVLV
                     DSIHNALNRHQGILINAGAYTHTSVAIRDALSGVAIPVVEVHLSNIYRREDFRHHSYI
                     APIAIGQISGFGAESYRLGLQALVNQLLIDNRG"
     CDS             complement(667578..667913)
                     /codon_start=1
                     /locus_tag="GM3709_585"
                     /product="hypothetical protein"
                     /protein_id="BAQ63820.1"
                     /transl_table=11
                     /translation="MISLIKIGVTISALMTSLFGGFAPAFSQNLPPSRENIQSSSFLI
                     ASIIDDAYAACSSQLAEYGVTVTGIVDSFSGKGGATLILSGYNSGGTSITARCTLTIP
                     SYQVDIEYL"
     CDS             complement(668072..668857)
                     /codon_start=1
                     /locus_tag="GM3709_586"
                     /product="hypothetical protein"
                     /protein_id="BAQ63821.1"
                     /transl_table=11
                     /translation="MSLSSTYSSIAIGLTLLLSPVTLIPPFSNSQVLAQNNQVNVLSQ
                     GKGTWKVGRKSPISVTSASVTLQTDNKAQITLFLQDNRTVRLDGNFTRQTATQGRINL
                     TNSGAATAQGSILLEYTKNNTIGLLNGQGSLDGQNFRMIFRGDQSSSKPNNTANLNIQ
                     QSGEGLFSLQSRPNQNITSVFINVDSNNRARISLLFKNGNSFNFEGRQTSRDAYSIRI
                     QVDRSGMADAIGFFIIELGARNSINNLIGQGTLDGQNFLANFR"
     CDS             complement(668935..669990)
                     /codon_start=1
                     /locus_tag="GM3709_587"
                     /product="alkaline phosphatase"
                     /protein_id="BAQ63822.1"
                     /transl_table=11
                     /translation="MFNSTLNLDLLPPITLYVNFIDGTIENDELIGTNDRDNIQGYNG
                     NDLILARNGNDYVDGGEGMDTIYGGEGNDVIDGNSDMDWLYGQSGNDTIKGGDRTDNI
                     SGGTGNDFIYGDSGSDKIQGNEGDDFLYGGNESDYIEGNEGDDFIDGGLGDDTLYGGI
                     FYTAGFTISDDDFILGGFGNDRIYAGNGNDWLEGGEGNDWLEGGGEGIEWLNGNKDDD
                     LIIGDAGNDTLLGGYGNDYLSGGSGRDILMGGSGIDRLRGGTEADRFIYTIAQNSNYG
                     HFIIEDFEDQIDTIVIENLSRKHLLTQMGSDTYIYHDTGNYSNRYDSADDLLGIVHNI
                     NTNQLNYSSYLNNGYFS"
     CDS             complement(670087..674016)
                     /codon_start=1
                     /locus_tag="GM3709_588"
                     /product="hypothetical protein"
                     /protein_id="BAQ63823.1"
                     /transl_table=11
                     /translation="MASTEFVVSVSFDIWSKLNILPLEVRTTFLKNFYLILADIDLNN
                     KLSSMLVKNPKVITSFPYDNSLEALVLLSNSQNNQILLKIINFTNVESKSNNLLTIKN
                     NIDTVIETLDILNKITLEKEDERISILAENNYQFNHQDFTYNDNDFIVHTSKYNTSEE
                     FYLVSGQQYNILNQNPNFPALITGNRMTGKTTIAIYSALNKAHFLSTTKEEKVLFLTD
                     NKFSVKETKKIINQYSFSDPINVYHYISLTKSIIEKYPLIFTYKFLAQRQVTLYKFRE
                     QFFNPKKIFTLKAEDLWQEIRQIIKGSNKIIGSGKSLISLEEYLALKNQSLLNPTIDF
                     KAIYNFATQYQDWLESQNYWDDLDLTNYLLSKFPDNYQGEYEGIYIDGINKFSELQLQ
                     FILKLLKVTDANNYFPQIFLVGENEVSLNSKNLIWSRIKKILVENYHKLSTWKQIREL
                     IEPHELTYNFSYCDNISKLGVTIANLSGKNLHHFSLYKSDYKPLIISDLTLEFLMSKN
                     YLNIDSAIVVFEEEERNRLNSIFPNDTHRIIHFSEIENLEFEQVLVWKMFTKISQLYR
                     NSLEDQELINVKYNHIYTCTNIAKKKLYFYDDSIDNIWSDSSINNLIDIGYETELESL
                     FDTKYSEIEIKIIANNYLKKGTDQAYQIISQIYQRYNDVIGAAKVEALLEEEQGNWGK
                     AGDIWSKLGIFDEAINCWNEVDKKLWLAKWGVLKTEEWQIRGLYFEQEKDYKLAKFCY
                     EKAKDFEGKLRCLEKDHQWELAGDECIAKNLTSQANKYYELADKYYREHDQATSAIKM
                     WTKLDKWDRVAIIWEDLQQWEKAGNCWQKQGNVQKAAFCWQKAEKWTAAQKCWEELGN
                     WQELALSYEQEENWDLAAKTWLKITETEKAALCYQKANQWHKAENIWQELGYWGFVAI
                     CLQQQNKWTEAAQAWSKTNPHELEALCHEQCQAWDKAEKCWLAAKNWTRIILACEKQE
                     KWQEAAESWENLGEWQKAGVAWEKIREIEKAGLCYEEGQYWQLAEKCWRELQRSDRTA
                     KVLEKQEKWTESAEIWEKLGEWQKAGHCREKLGEIEKAALCYEEGKHWRLAEDCWQKL
                     ENWERVENACKQQGTWQKAAYDWLKSNQIEKAALCYENCQDWERAAKYWQKSQNWEKY
                     GNACEQLQQWQLAASAYLRANKGEKAGLCYEKAEDLSNAEECWRKLWKWEKVAIVCEH
                     QQKWTDAAKAWLLVNEIERAGICYEKAQEWDKAEDCWRKISSWEKLAIVCEYQEKWEE
                     VAQLWQYLEKWDRAASACLKMEDFETAIKYYEKGGYLEEAKKCREKM"
     CDS             complement(674112..674528)
                     /codon_start=1
                     /locus_tag="GM3709_589"
                     /product="hypothetical protein"
                     /protein_id="BAQ63824.1"
                     /transl_table=11
                     /translation="MNKLKLQNKIYSFDNDDHAYFVTMIFVDGEVLTDFSYYATSLTQ
                     LSNSIVKDGEYFIITCWCGVPECAGIEQGIKVTHHQNTVKWTINQPQRQQFTFSTHDY
                     KTAISEGIKQIKEDLLIHRHTVQKLEIVPNQEEYNN"
     CDS             complement(674881..675303)
                     /codon_start=1
                     /locus_tag="GM3709_590"
                     /product="chorismate mutase II"
                     /protein_id="BAQ63825.1"
                     /transl_table=11
                     /translation="MENMHLTWEGSKKLMSNVRAIRGATTASANTMEAMRDAVRELLT
                     DIETRNQLKYEDVISVIFTVTPDLDAVFPAAIAREYHQWTNIPLLDLQQMQVKGSLEK
                     CIRVLIYINTSKPQTEMYHSYLRKAENLRPDLSLIHSQ"
     CDS             complement(675307..676128)
                     /codon_start=1
                     /locus_tag="GM3709_591"
                     /product="signal peptide peptidase SppA"
                     /protein_id="BAQ63826.1"
                     /transl_table=11
                     /translation="MIWPFKPSSTKKIARIEITGAIGSKTREQVLEALEVVEEKKFPA
                     LLLRIDSPGGTVADSQEIYSALKKLGEKIKIVASFGNISASGGVYVGVGANYIVSNPG
                     TITGSVGVIIRGNNLQKLLDKVGVSFKVIKSGPYKDILSFDRDLTNEEESILQQLIDS
                     TYEQFVQTVAEGRKLSVETVKSFADGRIFSGQQALELGLVDRLGTEKDAFRWACELVK
                     LNPDKTECQTIEQPKSFVDRFLNGRTQVKSGVGSAINWLEFELATNGQPLWLYRP"
     CDS             676352..677758
                     /codon_start=1
                     /locus_tag="GM3709_592"
                     /product="fumarate hydratase class II"
                     /protein_id="BAQ63827.1"
                     /transl_table=11
                     /translation="MTETNKDTRIEKDSMGEIEVKSDRYWGAQTQRSIHYFSIGEDKM
                     PLEVIKALAIVKKAAAITNNQLGVLSTEKTQLINQVADEIIEGKLDDHFPLYVWMTGS
                     GTQSNMNVNEVIANRAIEIVGGELGSKNPIHPNDDVNKSQSSNDVFPTAMNIAVSIAI
                     NERLIPKVTKLRDALEEKAEAWKEIIKIGRTHLQDAVPLSLGQEFSGYVGMLEDNLTR
                     INQALPGIYQLALGGTALGTGINAPIGFPAKSAQCIAELTGLPFITAPNKFTVMGAHD
                     AMVMLSSTLKTLACSLYKIANDIRLLACGPRAGFNELQLPENEPGSSIMPGKVNPTQC
                     EALAMVAVQVMGYDTAVGFAGASGILDMNVYKPMMVYNVLQSIKILSDSCNNFTDFTV
                     KDMTPNLPRINELVNQSLMLVTALSPKIGYDKASKIAHLAHKKHLTLKQATLELDYLT
                     AEEFDRAIDLRQMAYPHE"
     CDS             complement(677914..678852)
                     /codon_start=1
                     /locus_tag="GM3709_593"
                     /product="GTP-binding protein Era"
                     /protein_id="BAQ63828.1"
                     /transl_table=11
                     /translation="MSNLIESFLPIIPIASDEFKSGFVAIIGRPNVGKSTLMNYLVGQ
                     KVAITSPVAQTTRNRLRGILTTPEAQIIFVDTPGIHKPHHELGKVLVQNAISAINNAD
                     VVLFVVDASSSAGGGDRYITELLHKSKTPIILGLNKSDLQGEDREKLNESYQEICQEN
                     WQIVNFSAITGEGLDNLQQELITKLDYGPYYYPPDLVTDQPERFIIGELIREQILLST
                     KEEIPHSVAVTVEKMEESPKLTKIYAAISVERNSQKSIMIGHKGSMLKEIGSASRQQM
                     QKLLSGKVYLELFVKVEPKWRQSRLRLAEFGYQVDN"
     CDS             complement(678845..679969)
                     /codon_start=1
                     /locus_tag="GM3709_594"
                     /product="succinylglutamate desuccinylase/aspartoacylase"
                     /protein_id="BAQ63829.1"
                     /transl_table=11
                     /translation="MFPDYQLIKIQTLASGDILEIPTYTFEGKKGDKKVYIQANLHGA
                     EIVGNAVIYELIRFFSKLNNNDIQGKILLVPVCNPTGINQRNLFFSTGRYSPYDGYNW
                     NRIFWDYSHEKVNFDNFVAENINLNNQEIQANFLKDILNKFKEKIDNINLDRSISFSE
                     HYRNILQSLSLDANYIIDIHSSSVKAIDYLYCFDFRQNSADYFLFDYAILMNKYDGNA
                     FDEAFLNPWLILEKKFIQAGRNITFDVESWTLELGSGMTVNEESVTKGVRGIINYLCA
                     KNMLNLDLIIPSKTTKFVPKNTIKSYYAPQGGIIRNRRREGTSVKKGDILYQLLSFSK
                     GKVMPTIIEIKSADEGIIFDVSTNDTVNQGEYILGIFPHV"
     CDS             complement(680225..683176)
                     /codon_start=1
                     /locus_tag="GM3709_595"
                     /product="glycine dehydrogenase [decarboxylating]"
                     /protein_id="BAQ63830.1"
                     /transl_table=11
                     /translation="MLDLDNINSSPPSEDSLIASPTSHNALSKDKDIFKHRHIGIGEK
                     EQLLMLKKLGYGDLDTLIDSAVPQAIRLRNPLQLPSPQTEIEALATLKSIAQENKVYR
                     SYIGMGYYNCITPAVIQRNILENPNWYTAYTPYQPEIAQGRLEALLNFQTMIIDFTGL
                     EIANASLLDEATAAAEAMTMSYAVTKHKSNTFFVDRNCHPQTIEVIKTRAKYLEIELI
                     IDNPQTFDFETSIFGALFQYPASDGTIYDYTNVIEQIHQQKGLVTLAADLLSLALLKS
                     PGELNADIAVGNTQRFGVPLGYGGPHAAYFATKDEYKRQVPGRIVGVSKDVHGQPALR
                     LALQTREQHIRRDKATSNICTAQVLLAVIASTYAVYHGEEGIKNIALRVHKLTKILAK
                     GLEKLGYQIKSPYFFDTITIEIEDYDSVLSLAESNLINFRYDKNSIGISLDETTTLKD
                     VKQILAIFGQNELSIEHLAIDNLGIPSDMQRQSRYLTETVFNQYHSETELLRYLHRLE
                     SKDLSLTTSMIALGSCTMKLNATAEMLPVTWAEFNSIHPFAPLSQTQGYQTLFSQLEA
                     WLAEITGFAGISLQPNAGSQGEYAGLQVIRKYHDSRGDFARSICLIPESAHGTNPASA
                     VMCGLKVIPVKCDTEGDINIEDLKAKAEKYKDKLAALMITYPSTHGVFEEGIKNICGI
                     IHAFGGQVYLDGANMNAQVGLCRPGDFGADVCHLNLHKTFCIPHGGGGPGVGPIGVMP
                     HLVPFLPLSYQLSAISYQSLEISNSDSIGMVSAAPWGSASILPISWMYIAMMGSQGLT
                     DATKIAILNANYIAHRLAPHYPILFTGKSGLVAHECIIDLRPLRKTAQIEVEDVAKRL
                     IDYGFHAPTMSWPVAGTMMIEPTESESLAELDRFCDAMISIRQEISSIEMGTMDHEDN
                     VLKNAPHTAISLISEDWSHPYSREDAGYPDIFTKQHKFWPVVGRIDNAYGDRNLVCSC
                     IGMDQYNTKET"
     CDS             complement(683231..683542)
                     /codon_start=1
                     /locus_tag="GM3709_596"
                     /product="ABC-type dipeptide/oligopeptide/nickel
                     transport systems"
                     /protein_id="BAQ63831.1"
                     /transl_table=11
                     /translation="MESITLNFVSKETLFAVSLFPYLGFLWFLTKSQKMPKLALMGFY
                     LLLLFVAITIPAGIYAETHFHTSLANVDWLHGGAEFFLTLSNIFVVLGFRQVVIQKEK
                     E"
     CDS             complement(683766..684320)
                     /codon_start=1
                     /locus_tag="GM3709_597"
                     /product="alkyl hydroperoxide reductase subunit C-like
                     protein"
                     /protein_id="BAQ63832.1"
                     /transl_table=11
                     /translation="MKVSKYWAKIPIIISIILSLSFSFINPVLALGGVQPPLNQPAPQ
                     FTLPTNVGDGEISLTDYQGKWVVLYFYPKDFTPGCTLEAQRFQKDLSKYHSLNAEIIG
                     VSVDDVNSHQEFCDEEGLKYPLLADTDGKVSKSYGSWLAGFSMRHTYIINPDGVLIAQ
                     FLGVRPAIHSQEVLTKLQELQSYS"
     CDS             complement(684392..684841)
                     /codon_start=1
                     /locus_tag="GM3709_598"
                     /product="nucleoside diphosphate kinase"
                     /protein_id="BAQ63833.1"
                     /transl_table=11
                     /translation="MERTFLMVKPDGVQRNLVGEVIKRLENKGFTLVGLKLMSVSREL
                     AEKHYDVHKERPFFNGLVDFIVSSPVVAMVWQGEGVVASARKIIGATDPLAAEPGTIR
                     GDYGVNIGRNLIHGSDAIETAQREIALWFKEDELVSWENAMKPWLFE"
     CDS             complement(684970..685395)
                     /codon_start=1
                     /locus_tag="GM3709_599"
                     /product="hypothetical protein"
                     /protein_id="BAQ63834.1"
                     /transl_table=11
                     /translation="MKIHQQIIDIKTSGKCLHNITPQIKDVLNNSGIITGLATIFILH
                     TSASLIIQENADPDVLADLSIFFSKLVPENGYDYLHSSEGADDMPSHIRSILTSTSEN
                     IIIRQGKLLLGTWQGIYLWEHRTRSHFRQVAIHLQGVDY"
     CDS             complement(685528..685974)
                     /codon_start=1
                     /locus_tag="GM3709_600"
                     /product="pentapeptide repeat family protein"
                     /protein_id="BAQ63835.1"
                     /transl_table=11
                     /translation="MNKLLATTIAVISTFLVVNSANSENPNHRQQLLETNQCMGCDLK
                     GVDLQGEHLIGADLRNADLRNANLEGVNLEGADLDGANLQGADLSKAFLTNATMNNAN
                     LNSVDLTFAVIFDAQVYGATMNNMNIENASIFETNIGVGGEYPDNE"
     CDS             complement(686195..687136)
                     /codon_start=1
                     /locus_tag="GM3709_601"
                     /product="spermidine synthase"
                     /protein_id="BAQ63836.1"
                     /transl_table=11
                     /translation="MAGSQLNADVWISEYITPYDIYVHGITSILAHKKTPYQEMYVVE
                     SGVYGKALVLDGKWQSCTGDEFLYHEALVHPAMINHPNPENVLILGGGEGATTREVFR
                     WNAVKKAMMVDIDGDVVEACREYLPEMHQGSFDDPRLELVIGDAFNVLDTSEAKWDII
                     ISDLSDPIEEGPSFQLFTQEYFARLKNILRENGIVVIQAGPIAPANLHIHGRLVNTLK
                     AVFPNVHSYFAPTCTYGSSWGFAIASESTFDTRPDPEKIDILLEQKTTGDFRSFDGIS
                     LLGMLQTPGYVRQCIEKETEVYTITKPAKFFGKGVSN"
     CDS             687435..688124
                     /codon_start=1
                     /locus_tag="GM3709_602"
                     /product="hypothetical protein"
                     /protein_id="BAQ63837.1"
                     /transl_table=11
                     /translation="MNTSKPFILNPHLFKIFFFLSGSGFTLVILLGLFGIWKTGTDFI
                     QGITHLFHHEVTLPTTKNPHVILRQVQGVSELTTSIFVMDTIVPTSSNRKIGNWVVGE
                     TNLLYVARGEVKAGLDLSNLTAEDIVIQGDNIKIELPPVKILDEKIDLNQSQVYNYDR
                     GFLNLGPDVALDLQLKAQQETLTKIKETACQQKILNQANDKAVILITELMKNSGFATV
                     EVTTTPSNDCK"
     CDS             complement(688187..688396)
                     /codon_start=1
                     /locus_tag="GM3709_603"
                     /product="hypothetical protein"
                     /protein_id="BAQ63838.1"
                     /transl_table=11
                     /translation="MLENNPSSHKRKVSDQFPKEKSIKVFKRLIIITTVVFSFGGLGF
                     GFALRYSNIFQIHQSNNVPFTNFSD"
     CDS             688700..688903
                     /codon_start=1
                     /locus_tag="GM3709_604"
                     /product="expressed protein"
                     /protein_id="BAQ63839.1"
                     /transl_table=11
                     /translation="MDGFWENVLRYPRYMVSLILGIFFFLWEQIKPLFKNPVTATAIF
                     GLMIGAFSFLYFTLKAMLGLAPV"
     CDS             688959..689336
                     /codon_start=1
                     /locus_tag="GM3709_605"
                     /product="ribosome-binding factor A"
                     /protein_id="BAQ63840.1"
                     /transl_table=11
                     /translation="MANSRRVEKVSSLIKKEISQMLISGIKDDRVGAGMVSITEVEIS
                     GDLQHARVFVSIYGTSEAKKETMEGLKACTPFVRKALGQRISLRHTPEIRFIEDSSLE
                     KGDNLINLINRITPKEDSFFEEE"
     tRNA            689446..689519
                     /locus_tag="GM3709_t5"
                     /product="tRNA-Arg"
     CDS             complement(690780..692630)
                     /codon_start=1
                     /locus_tag="GM3709_606"
                     /product="hypothetical protein"
                     /protein_id="BAQ63841.1"
                     /transl_table=11
                     /translation="MAHVTIQCRLIASRDTRQFLWQLMAQKNTPLINEILLRIKQHPD
                     FPHWRTKKRLPKDFLARQIAELKNNYPFEEQPSRFYASVNKVIDYIYKSWFEVQKALD
                     WKLQGNLRWVEMLLPDTELIKHFDNSLESLQQQATLILDSIDSTVSHDRISTILFEKC
                     GKTKKPEIKSAIIYLLKNGCTIPKKPETTEKYQDLKRKVEIKITKLHRQIESRIPLGR
                     DLEDKKWLDTLITASTTAPIDQTEANTWFSILKQNQSSIPYPILYETNEDLKWSLNEK
                     NRLSIRFSGLGEHSFQLCCDHRQLPYFQRFYEDQELKKASKDQLSSALFTLRSAMILW
                     KEDEGKGELWDRHKLYLHCTFETRCLTAEGTSTIVEEKQKEVTKIIDLMKAKEELSDS
                     QQAFIRRKNSTLAKLNNTFPRPSKPVYQGKPNVHLGIAMGLEQPVTIAIVDIETDKVI
                     TYRNTKQLLREDYRLLRRRRIEKQKLSHQNHKARKRFNFQQKGESNLGEYLDRLIAKA
                     ILTVAQEYQVSTILIPRLRDMRSITEAEIQLRAEKKIPEYKEGQKKYAQDYRVQVHQW
                     SYGRLIENVKLICEKVGIVVVEAKQPKQGTLTEKALQLVLSATEKNLKKK"
     CDS             692694..693113
                     /codon_start=1
                     /locus_tag="GM3709_607"
                     /product="hypothetical protein"
                     /protein_id="BAQ63842.1"
                     /transl_table=11
                     /translation="MKERFFSSKQTSLITGCSLRQLQYWRDKEVIVPFIQGTGTGKTI
                     YYSPAELVEISIMVYLLSVGLSFEIGQIILSDLKEKERNFRNPDYKGRFMIIPRDGKM
                     SLLSYEREKAIELLDQGTSIVPLWLDRIHEQLKETLG"
     CDS             693219..693404
                     /codon_start=1
                     /locus_tag="GM3709_608"
                     /product="alkyl sulfatase"
                     /protein_id="BAQ63843.1"
                     /transl_table=11
                     /translation="MPSVFTIKLQNGLRKSLPFDDKRDFEEAKKGFIAAPSFKQIMAE
                     AGRDFGTQKNQKEGQIG"
     CDS             693548..694846
                     /codon_start=1
                     /locus_tag="GM3709_609"
                     /product="alkyl sulfatase"
                     /protein_id="BAQ63844.1"
                     /transl_table=11
                     /translation="MKINQTILLSLAIALFSAISSSVLASGGGGVVTDPGAIEGKHFA
                     PKGKMPSKFTIELQNGLRKTLPFDDKRDFEEAKKGFIAAPSFKQIMAEAGNVAWDMGS
                     YEFLLQGKDFDSVHPSLQRQAILNMAYGLYEVLPGKIYQVRGFDLANITFIKGDTGWI
                     VFDPLTAKETAQAALKFINEKLGERPVVAVVYSHSHTDHFGGVRGVVDEADVRSGKLQ
                     ILAPVGFMEHAISENVYAGNAMNRRLFYQYGVLLPRSPFGHVDQSIGKNTAAGNSGLI
                     PPTKYITKDIEEVTIDGVKMVFQNTPGTEAPAEMNTWFPQFNAFWAAENITGTVHNIY
                     TLRGALIRNPLEWSKQINNSLYLFGQQAEVMFSAHSWPRWGNDRIQEVMRTQRDIYAN
                     LNNEVLFLANKGVTINEVQNVYHPPQKSAKSMGGPQLSRI"
     CDS             695028..695654
                     /codon_start=1
                     /locus_tag="GM3709_610"
                     /product="alkyl sulfatase"
                     /protein_id="BAQ63845.1"
                     /transl_table=11
                     /translation="MEIVNKLVYAEPQNQAAKDLLADAFEQFGYQQESNSVRNSYLAA
                     AYELRSGIPTGKSAKSSGPDVIRAMPTNLWLDFLGIRLDSKKAEGLKFTVNLITPDND
                     EKYVVELSNSTLTNIKGFQAPNPDLTITINRTDLEAVMMGAATLDQQITSGKAKLVGD
                     RRPYDQLKNILVQFTPDFEMMPGTKPVKLAIPNPNPFEQEPLGDTTGG"
     CDS             complement(695886..696368)
                     /codon_start=1
                     /locus_tag="GM3709_611"
                     /product="hypothetical protein"
                     /protein_id="BAQ63846.1"
                     /transl_table=11
                     /translation="MDLQIQNWLFILVPYEGESISHFLGRFRRANSLSCGGLGQATGL
                     YSAIARWEKFRFNPPPSLKQLEKLSEIVQVEMATLQTMFPSAPMKMTPIRICSACYGE
                     NPYHQMSWQYKEIYRCDRHNLNILSECPNCAARFKFPNLWFEGFCHRCFTPFEQMPQS
                     "
     CDS             complement(696368..697195)
                     /codon_start=1
                     /locus_tag="GM3709_612"
                     /product="mobile element protein"
                     /protein_id="BAQ63847.1"
                     /transl_table=11
                     /translation="MEAKAIAQELGNIEIPEEKLQMEIERLNSKTLVSLEQVAKLHEY
                     FEGKRQSKQSCRVVGESRTGKTMACDSYRLRHKPIQKVGHPPQVPVVYIQIPQDCGTK
                     ELFQGIIEYLKYQMTKGTIAEIRQRAIKVLQGCGVEMIIIDEADRFKPKTFAEVRDIF
                     DRLNIPIVLVGTDRLDTVIKRDEQVYNRFRSCYRFGKLSGADFQNTVNIWEKQVLKLP
                     VASNLIQTKMLKLIAEATGGYIGLMDTILRESAIRSLKRGLNKITFEILKEVTQEFK"
     CDS             complement(697205..698872)
                     /codon_start=1
                     /locus_tag="GM3709_613"
                     /product="Tn552 transposase"
                     /protein_id="BAQ63848.1"
                     /transl_table=11
                     /translation="MTIENQISESQELISQLSPEEQAIADVIEDLVQPCDRKTYGAKL
                     KKAAETLNKSVRTVQRYIKEWEEKGLLAIKKGNRSDQGTYRIEKRLQDFIVKTYREGN
                     KGSKRISPKQVYLRTMAQAKEWSIDPPSHMTVYRILNPIIEEKENKKRVRNPGWRGTK
                     LAVSTRSGNEINVEYSNHAWQCDHTRADILLVDQFGQLLGRPWLTTVVDTYSRCIMGI
                     NLGFDAPSSQVVSLALRHAMLLKSYSSDYGLHEEWGTYGKPEYFYTDGGKDFRSNHLQ
                     QIGLQLGFTCHLRSRPSEGGVVERPFKTLNTEVFSTLPGYTGGNVQERSEDAEKDASL
                     TLRQLERIIVRYIVDNYNQRMDARMGEQTRFQRWDSGLLSIPDLLSERDLDICLMKQS
                     RRRVQKGGYLQFENLMYQGEYLAGYEGETVILRYDPRDITAILVYRNEGNKEVFLTRA
                     YGLDLETESMSWEDAKASAKKVRESGKNLSNRSILAEVKERHTFSDKKTKKERQRQEQ
                     EQVKPYIPSPVLKEVKEQTDKATDTDMSEEPIVEVFDYSQLQDDYGF"
     CDS             699563..700978
                     /codon_start=1
                     /locus_tag="GM3709_614"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BAQ63849.1"
                     /transl_table=11
                     /translation="MRKPLFCIWNNESIELRENQRNLAIQNLNLISERIIPIFDEATQ
                     TVANSLNIPVCCLGFLLGEEYQLKSVYGLSNLGLMNDLAKTRKIERQNTFATHVIDSH
                     NYLVIENTLCDPFFSQNILTQHYGIVSYLGVPLTIFNGLCIGCLEVIDTTARKFTLQD
                     INFLMITARWCVAEYERNELITPHNNFIKYCNNYQNFSSDILIDNVENFTSSPSLISS
                     NNINDSEKYIRQLSFQLLNKLTQKLSIPLTSVIGMSSVLKQEIYGKLNSKQLEYLQII
                     HDSGQEMVTLVDEITKLANIKTEINLEFVPVDLENLGKQVIKSLETFAVSREHSLRLS
                     IEPGEKIWKLDREKVKKTLYYLLITIIEGSRTGGEIQIHISQKMQTLKINCWVTHPWL
                     GDGISFEKINAYECALKNYDSSLLQNNIDKKTSSQNSYEYDLICLLFSTYLAHLQGGN
                     ISLQGSPESGYRFIISMPISK"
     CDS             701501..703363
                     /codon_start=1
                     /locus_tag="GM3709_615"
                     /product="acetolactate synthase large subunit"
                     /protein_id="BAQ63850.1"
                     /transl_table=11
                     /translation="MVASNIPSFKLSTDVVPIKCSGAFALIDSLCRHGVKHIFGYPGG
                     AILPIYDEVYRAEARGDIQHILVRHEQGAAHAADGYARATGKVGVCFGTSGPGATNLV
                     TGIATAHMDSIPMVIITGQVSRAAIGSDAFQETDIFGITLPIVKHSYVARNAQDIPRI
                     IAEAFHLASTGRPGPILVDIPKDVGLEECEYIPVYPGEVKLSGYRPTVKGNPRQINGA
                     VELISEAKQPLLYVGGGAILSKAHAQIQELAERFQLPVTTTLMGLGAFDEHHTLSVGM
                     LGMHGTAYANFAVSECDLLIAVGARFDDRVTGKLDEFASRAKVIHIDIDPAEVGKNRR
                     PEVPIVGDVRQVLEQILQRARELDLPAHDTLTKDWLARIDRWKQDYPLIVPHPEDALS
                     PQEVIVEIGRQAPHAYYTTDVGQHQMWAAQFLKTGPNRWISSAGLGTMGFGLPAAMGA
                     KVAVGEEEVICISGDASFQMNLQELATLAQYNIKAKTVIINNRWQGMVRQWQETFYGE
                     RYSCSNMEAGMPNFEMLAEAFGVKGMTISSRDELSGAIAEMLAHDGPVLLNVHVKRDE
                     NCYPMIAPGKNNAQMLGLPKKAPESLTKEIVICSNCGTRNPVDNSFCPECGTKL"
     CDS             703504..704673
                     /codon_start=1
                     /locus_tag="GM3709_616"
                     /product="ferrochelatase"
                     /protein_id="BAQ63851.1"
                     /transl_table=11
                     /translation="MVVTPERIIDNNSVVNSNDRVAVLLMGYGEVESYDDFANYNEQA
                     LNLLTAKFAPVPTWIYPPIAKLLAMFDLHEWSHQHGNFISPHNAIFERQRSNIEHHLQ
                     HTWGDRVRVFKAFNFCAPHLPNQVLEQIQAEGFDKVLIYPLLVVDSIFTSGIAVEQVN
                     QALAKPTNSEEHWIKGMRYLPSFYNEPKYINLLAKMVEREISHRLSSAYLPSEIGIVL
                     MNHGCPHEAKGFTSGIDESQKLYDLVRERLINRFPMISVGWLNHQTPLIKWTQPNAEL
                     AGRNLIELGAKALVFMPIGFATENHETLLDVEHIIESLQKKYPTVNYVQMECVNDNDE
                     FCAMAAEWANPQIESLLNDEAMVINPSLATASHSRGHHHDHHHHHHHSQEHHHHH"
     CDS             complement(704784..705608)
                     /codon_start=1
                     /locus_tag="GM3709_617"
                     /product="2-methyl-6-phytyl-1,4-benzoquinone
                     methyltransferase"
                     /protein_id="BAQ63852.1"
                     /transl_table=11
                     /translation="MGYFDTLIDKFGENPELEEAFGKHIHWGYWENPTKATGSLMDFA
                     IAANNLSKLVIKTAEISDGVTILDAGCGFGGTISLLNESFSNLNLYGVNIDNAQVERA
                     REVIKPQNNNNIQFINANACDLPDFKTLFDYSIALECIFAFPSREIFFQQVRKNLKSS
                     GKLIIVDFIINPQIRKFWAWFEGQILSRLITDTYGSKATNQVEFIGIKDYETIANKTG
                     FKLEKVIDINKNVQPTYPVINKLIIDNFNDLMTAKGLEIFSQLNLISYQILIFTTE"
     CDS             complement(705648..706379)
                     /codon_start=1
                     /locus_tag="GM3709_618"
                     /product="hypothetical protein"
                     /protein_id="BAQ63853.1"
                     /transl_table=11
                     /translation="MKAVVNFIFILLLSSGIFITINNSVKAKETNLPTLKVHPLPISL
                     QNWTSKIKEDYFSEIEPHLAGYLIWSDFPVKVYLQSPDQDLSPSGLTQFHQWQKAVRI
                     AIESWNIYISLTEVDNPENADILIYRRYPQFKAEINPQTGLYNLPRAKAATTTVKFYL
                     TDTKPPQLRHKMSIEVNPHQTFDYLVTNLTHELGHAIGIWGHSLNITDVMYHSHTREI
                     PVISPQDINTLKKIYQQPTRLGWNI"
     CDS             complement(706461..706694)
                     /codon_start=1
                     /locus_tag="GM3709_619"
                     /product="preprotein translocase subunit SecG"
                     /protein_id="BAQ63854.1"
                     /transl_table=11
                     /translation="MGVYQVVQIVWAVSAGLLTVLVLLHSPKGDGLGGIGGQAQLFSS
                     TKSAEATLNRVTWILSLTFISLTVVLSAGWLNN"
     CDS             complement(706814..708412)
                     /codon_start=1
                     /locus_tag="GM3709_620"
                     /product="2,3-bisphosphoglycerate-independent
                     phosphoglycerate mutase"
                     /protein_id="BAQ63855.1"
                     /transl_table=11
                     /translation="MTQTPISPVVLVILDGWGYREDSQDNAIALAKTPVMDSLLEVYP
                     NTLINASGRAVGLPNGQMGNSEVGHLNLGAGRVVPQELVRISDAVEDGSIFKDPVLEE
                     ICQNVIKSQGKLHLMGLCSDGGVHSHLDHLIGLLDLAKLQGVSEVCVHFITDGRDTNP
                     NDAVKYVRTIEEHIKKIGVGKIVTICGRYYAMDRDRRWDRVQKAYDLYTIDGTGDGRT
                     TIEVIEDSYKEGINDEFIEPTRIAEGAITEGDAVIFYNFRPDRARQICYAFTMDNFNG
                     FERQKIENLHFATFTQYDPNLPVKVVFEPQYLTNILGEVIANAGLKQFRVSETEKYPH
                     VTYFFNGGLEQPLEGEDRELVQSPMVATYDKAPAMSAMELTTVACDAITKGIYSLVVM
                     NYANPDMVGHTGKLDAAQTAIETVDTCLGKLLKAINQVGGTVLITADHGNAEYMKDEN
                     GNPWTAHTTNQVPFILVEGEGRKIIGHGGNVKLKENGKLADIAPTILDILQLPKPQEM
                     TGESLITKPEYEVKKSRTPISVAV"
     CDS             complement(708895..709944)
                     /codon_start=1
                     /locus_tag="GM3709_621"
                     /product="magnesium and cobalt efflux protein CorC"
                     /protein_id="BAQ63856.1"
                     /transl_table=11
                     /translation="MLTLFSIVIVVLLGSAICSLTETVILSVSDIKVKQWAQSKKTPA
                     LALLKIKKKMSRPIATIVMLNNIFNIVGSIIIGSLATEVLGNRLLGLFSALLTFLIII
                     FGEILPKTIGQRYADNLALLLALPTQFLTLILSPLVWLIEKITEPFTQGKVLPTTNEM
                     EIKLLTNIGSNEGVIEVNEAEMINRVFHLNDLSASDIMTPRIIITYLKGDLILKDCQD
                     VVIKSEHTRILVVQDSIDDVIGIAFKSELLAAIIQGKQEEKVANLTRTANFVPETIRA
                     NRLLKHFQEIRQHLMVVIDEYGGVSGVVTLEDVLEVLTGDIVDETDKIVSLREIARKK
                     RERLLISKGVGDMNN"
     CDS             complement(710036..710554)
                     /codon_start=1
                     /locus_tag="GM3709_622"
                     /product="acetolactate synthase small subunit"
                     /protein_id="BAQ63857.1"
                     /transl_table=11
                     /translation="MKHTISVLVEDEAGVLTRIAGLFARRGFNIESLAVGPTEQGNIS
                     RITMVVPGDEDTIEQLTKQLHKLINVIKVTDITKIPCVERELMLVKVSTNANTRGEIL
                     QIVQIFRARVVDMSDDSLTLEVVGDPGKMVAIISMLNKFGIKEIARTGKVALVRESGV
                     NTEYLKSLEAKI"
     CDS             710808..710990
                     /codon_start=1
                     /locus_tag="GM3709_623"
                     /product="Asr3886 protein"
                     /protein_id="BAQ63858.1"
                     /transl_table=11
                     /translation="MDFSIYDVINHTVILAQVIEDPDIIGQMSDAWKNFVETGQIWAL
                     LIGMFFGYTFANFTRF"
     CDS             711233..712627
                     /codon_start=1
                     /locus_tag="GM3709_624"
                     /product="argininosuccinate lyase"
                     /protein_id="BAQ63859.1"
                     /transl_table=11
                     /translation="MTKQQTWSDRFETSLHPVIAVFNASIGFDIELIEYDLTGSTAHA
                     KMLGHTGIITPEEAETLINGLAQIRQEYRDGNFNPGVDQEDVHFAVERRLTEIVGDVG
                     KKLHTARSRNDQVGTDTRLYLRDQIQQIQGLLRDWQQALLNHAEKHIETLIPGYTHLQ
                     RAQPISLAHHLMAYCQMAQRDWERLEQIYDRTNISPLGCGALAGTTFPIDRHFSAKEL
                     GFTSVYENSLDGVSDRDFAIEFLCASSLIMVHLSRISEEMILWASQEFSFITLKDNCS
                     TGSSIMPQKKNPDIPELVRGKTGRVFGHLQALLTIMKGLPLAYNKDLQEDKEGIFDTV
                     NTVKGCLSAMTILLSEGLEFRTSRLEEAVNEDFSNATDVADYLASKGVPFREAYNLVG
                     KVVKTSLAVGKLLKDLTLEEWQQLHPAFESDIYDAIAPKQVVSARNSYGGTGFEQIKI
                     AISNLKRKMFNNGQ"
     CDS             712905..713882
                     /codon_start=1
                     /locus_tag="GM3709_625"
                     /product="hypothetical protein"
                     /protein_id="BAQ63860.1"
                     /transl_table=11
                     /translation="MTNKTRTPLKSWWNRPLVGSVSLIERIVGALNPQPVPELALSLH
                     DTEWEELGKIVPTLTMLDNEQYTSEFLFYISIKNKLEQNLDDYKGLQKFIRIFSFAIK
                     NIHHFRVIRRIELDFQGRSQLELYNFVEEQLHVSYDPILFHQLVSNEIQELLEKILNE
                     PTQKALLAYKTALDAITQEEVGLNLLLLFKKYNIADYAIFSIVNDILKQLKKQDLDNL
                     KALVLIVKVNYDELEKLGQLIGIPNHEDKVITYAKIIQYIALSYRYENIVYRFQQLLE
                     NLQKWYKHYETVIDVRHQYPNHKYKISPKFMENIPGELIYLKYRDFIKI"
     CDS             714031..715020
                     /codon_start=1
                     /locus_tag="GM3709_626"
                     /product="hypothetical protein"
                     /protein_id="BAQ63861.1"
                     /transl_table=11
                     /translation="MDKQIENKIEPWWNKPLWGDKSMLEKIESIIHKPHDIVPQEVID
                     HHQRVFGELKLLTPIGKALDSDKFSNLEFLEFVKISSLFANEIGEYKGLRNYVALFRV
                     AVEAKNSFLKIEQIELSYRSSKQQQFYNFVFNLLEKQLSSEEFVISLEEKLAQILSEI
                     QTEEGKNALNIYAETFKTVARQDDLGLKLIFLFKKYQLEDFSLLRVMSDMVQYLLDRD
                     LGDFNDIVILVKANQKRFEQLGKIIELPLDKTRDEDYARMLQYIAMKQKHQVSYGQFQ
                     RLLEMMTQWTHFYLIIRDIRSHYSESEFTLPPEFKQSIPGLDIYLKYKTFLVK"
     CDS             715321..716439
                     /codon_start=1
                     /locus_tag="GM3709_627"
                     /product="twitching motility protein PilT"
                     /protein_id="BAQ63862.1"
                     /transl_table=11
                     /translation="MELMIEDLMEQLVELGGSDMHIQAGAPIYFRISGKLTPIGEEPL
                     NPQECQKLIFSMLNNTQRKTLEQEWELDCSYGVKGLARFRVNVYKERGCYAACLRALS
                     SKIPNFDQLGLPDIVKEMTDRPRGLILVTGQTGSGKTTTLAAMLDLINRTRAEHILTV
                     EDPIEYVFPNINSLFHQRQKGEDTKSFGNALKAALREDPDIILVGEMRDLETIALAIS
                     AAETGHLVFGTLHTSSAAGTIDRIIDVFPAAEQAQIRAMLSNSLLAVFAQTLAKKKNP
                     KPGEFGRAMAQEIMIITPAIANLIREAKAAQIYSAIQTGGKLGMQTMEQALAGYVKTG
                     IISIEEGLAKSSKPDELKRLLAGSGIDADMAMTGGKRR"
     CDS             716531..717745
                     /codon_start=1
                     /locus_tag="GM3709_628"
                     /product="type IV fimbrial assembly protein PilC"
                     /protein_id="BAQ63863.1"
                     /transl_table=11
                     /translation="MATFIVQVKDKAGNVLNERVVADSQDEARRILKKRFAAVGKIKK
                     AGMEFDMASIEAAMSKVTVKDKAIFSRQFAVLVNAGVAIIRTLTVLAEQSGNPKFKKA
                     LQTISSDVQQGTNLSEAMAKHPDCFDQLYVSMVEAGETGGVLDEVMNRLAKLLEDVAR
                     LQNQIKSAMAYPVTVGIFAVLAFLGMTIFLIPVFAGIFEQLGAELPALTQFMVDLSGF
                     LRSPKAVIPVFVIIGLVFAFKQYYKTPAGRIQIDTFALKAPIFGDLNEKSAVARFCRV
                     FGTLTRSGVPILQCLDIVQETISNKVISNAVGGAKDAILEGGMLSVAIAEKKVFPTMA
                     IQMMMIGEETGELDSMMMKVADFYEDEVEQAVKALTSVIEPLMMVGIAGMVGTILLSM
                     YLPMFAIFDQLG"
     CDS             717865..718440
                     /codon_start=1
                     /locus_tag="GM3709_629"
                     /product="type IV pilin PilA"
                     /protein_id="BAQ63864.1"
                     /transl_table=11
                     /translation="MSVKQSDYETVLGDYSSRDRIVSLLSQYRQYLEMIPSMRRPRDS
                     VISIPLPLAKVRNLRTVSGDNLSEVCLNEITPIPCDIAVLMCDPEWKIKMGVEILIFI
                     HRPEEDFSNLLRRWRQSQIYLHKEYEWVMPQTEEHMFSDLAEEIHPLFIVFPQTPDRI
                     KKGLSGASLPYIEYSCETITDNNNLHSFVNS"
     CDS             complement(718543..720027)
                     /codon_start=1
                     /locus_tag="GM3709_630"
                     /product="serine/threonine kinase"
                     /protein_id="BAQ63865.1"
                     /transl_table=11
                     /translation="MNNNLILSQYKIIDILTDLDYQKVYLTENIKQNNQLCIVKQYFL
                     NSFTDDAITKFIESRKKINDFCQNDSYFRCPPVIDIVKLNNQIMLVEDIIQGVSLKQL
                     IKNNRLWSESDTIENLKYTLESLNIFHQNNFLHGNINPENIIQLLMTNPVLLITNLDV
                     NIVDRGDLIETVTVEDRLYLSPEKIRGKLIYASDIYSLGMVIITMIIGKKIYELKEDE
                     EGKIIWEQEIKVNNKLVYILNKMIAPQISKRYQNIEEILIDINNYLSSVEQKSSGQNH
                     NQYSPTEIIIPTPLYQHSNTSLKNNLLRHNLSSDILRTIKTPQTIVIIITTFLIVAGA
                     FLKTYLYYRKVNNIITDLHTFYSEKKYDDCIALIDSDKVQSLSIVTKITEQFLDKCRL
                     GLAQTEANKNNYSEAIDIALKIAKNSQEYDQSLQYIDDWSGKIIEKARDIKENQNNLN
                     LALETLNKVPQSSSRKKEALDLSQKWKGKRNTVIPLCPGPLCPN"
     CDS             complement(720067..720354)
                     /codon_start=1
                     /locus_tag="GM3709_631"
                     /product="hypothetical protein"
                     /protein_id="BAQ63866.1"
                     /transl_table=11
                     /translation="MSESRSFVKSTSYDFEQEVLSRFRYFVAILPPECKIYRETWNYS
                     TVLCLNFEDCPHFLEVIKENTDVLISMVQRFSLATCILFRCGNQLRAWRRV"
     CDS             720623..720844
                     /codon_start=1
                     /locus_tag="GM3709_632"
                     /product="hypothetical protein"
                     /protein_id="BAQ63867.1"
                     /transl_table=11
                     /translation="MKINVKVKPNSKQQKIEENNEGVWIINLKSPPVDGKANQELISL
                     IAKQFKVKKSQVNIKSGLSSQHKVIEIIQ"
     CDS             720863..722389
                     /codon_start=1
                     /locus_tag="GM3709_633"
                     /product="phosphomannomutase"
                     /protein_id="BAQ63868.1"
                     /transl_table=11
                     /translation="MVNINWQKLQNGSDIRGVALTGVEGEEVNLTPDVVAIIGKAFTV
                     WLSQQQNKSISELTISIGRDSRLSGETLMNAIMNSIEQLGVIVYDFGIASTPAMFMST
                     VTDGFECDGGIMLTASHLPFNRNGLKFFTNKGGLEKQNITDILTLAQKNEFPINQGKG
                     CIEKRDFMSVYASQFVQKIREGVNHPHHFDTPLQGLKIIVDAGNGAGGFYATKVLQPL
                     GADIENSQFLEPDGNFPNHIPNPENKEAMMSICQAVINHRADFGIIFDTDVDRSAAVD
                     SQGKELNRNKLIALISAIILKEHPHSTIVTDSITSDGLTKFIEQELKGKHHRFKRGYK
                     NVINESLRLNQEGIESWLAIETSGHAALKENYFLDDGAYLITKLLIELAKLKLDNKDL
                     TALINNLEEPLESEEFRLIIKAENFKDYGTKVIEKLTEFSANQPDWKIIPNNYEGIRV
                     SCKLPEEKGWFLLRLSLHDPVLPLNIETNIQGGVNKIANRLVTFFNTFEELNLKDLLE
                     "
     CDS             complement(722513..723676)
                     /codon_start=1
                     /locus_tag="GM3709_634"
                     /product="cysteine desulfurase"
                     /protein_id="BAQ63869.1"
                     /transl_table=11
                     /translation="MSDILLHRQQFSGLENKYYFNFGGQGVLPRSSLKKIIDCYNYIE
                     QVGPFGVKINSWIQKNIQDTKNTIATEISVNPDTITLTENVTASCNIALWGIEWQEGE
                     EILLTDAEHPGVIASVKEISRRFGVKVVVCPIVTTLNEGNPINVIENHLTANTRLLVM
                     SHILWNTGQVLPLKEIVSLCHNYCHSRQKIQVLVDGAQSAGSLPLNLVDSQVDFYGCT
                     GHKWLCGASGVGFLYVRQDLISSLHPTFIGWRGLNYTQPDLPFNNDGSRYEVGTSAYP
                     LFSALQESIEIHQQWGTIEERYQRICELSGYLWSKLSKIDGIECLKNTPPASGLVSFY
                     LRNGQDANKIVKMLEEKGFYLRTLLNPYCIRACVHYLTLESEIDALVKTLSNL"
     CDS             723818..724147
                     /codon_start=1
                     /locus_tag="GM3709_635"
                     /product="CpeR homolog"
                     /protein_id="BAQ63870.1"
                     /transl_table=11
                     /translation="MSNVTLGEKVTSLSATKKLQVWIKSNHLICDGNFFVLETVEYSM
                     VERFEQYITILGGSLISVESRKKITIGNRRQVILYQAKASLHTPYHDLKEYWHKYGSL
                     STKFDRR"
     CDS             complement(724249..724890)
                     /codon_start=1
                     /locus_tag="GM3709_636"
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="BAQ63871.1"
                     /transl_table=11
                     /translation="MNISLADLRKNYTQGGLLEVEASLNPFEQFRNWFQQALSAEIIE
                     PNAMTLATVNQKGKPTARIVLLKNLDDRGFTFFTNYESHKGKNLETTPWASLVFWWGE
                     LERQVRIEGEVEKVTPEESDQYFCSRPIGSQFGAWASSQSQVIPNRDVLESNLKAVMQ
                     KYKDSSITRPPHWGGYRVIPHIIEFWQGRENRLHDRLCYRLENNEWIRERLAP"
     CDS             724990..726003
                     /codon_start=1
                     /locus_tag="GM3709_637"
                     /product="hypothetical protein"
                     /protein_id="BAQ63872.1"
                     /transl_table=11
                     /translation="MTNSTQNKNNTDNESRSWYSRPLWGNQSFMTWFQSILNGIFSRK
                     LEIPESTIAIYKDSFNSLKNISALARTVDNDKFNSREFISFLTLNRQFESNTGTYEGL
                     KYSIELLRVALETKESFLKIEATETRYRSYSQQEFYEYVYEYLQRDLTVSEFQELIQR
                     QLTDIIPKIKTDEGKAAIQSYVNQLDIVCKDKLGLKLLYLFKQYDMSNFALLRNVAEI
                     ADTFYDKDLDTLKEFMVVVQLNAELFLKLGQIIQVPVGKNKPETYASMLQYIALRNRH
                     QKSYGQFQQLLGLLKEWQKYYNPLITIRQQYSPKEYKQPVIFSDEIPGLAIYNKYCSN
                     LET"
     CDS             complement(726188..727183)
                     /codon_start=1
                     /locus_tag="GM3709_638"
                     /product="L-lactate dehydrogenase"
                     /protein_id="BAQ63873.1"
                     /transl_table=11
                     /translation="MFEQILIPNPSANIPSSLRPRKGVIIGLGQVGLACAYSMLIQDC
                     FDELILQDIAQEKLEGEIMDLSHGMPFLPPTDLKAGTVADVGQNADIVIITAGVAQRD
                     GETRLSLVERNINIYKNILKDVVKYCPDAIILVVSNPVDILTYVTLKITGFPSSRVIG
                     SGTVLDSARFRALIAQEMGIDARSVHAYIIGEHGDSEVPIWSCANIAGVKIVPNDWDS
                     LIETEQNKLSSIFSHVKNAAYEIIQRKGYTSYAIGLATTDIVKAILYSQERILTVSGL
                     MNGLYGIEDICLSIPRVINERGILKTVNLNLSVEEEKLLVRSATILKEIVNQVSF"
     CDS             complement(727267..727659)
                     /codon_start=1
                     /locus_tag="GM3709_639"
                     /product="1,4-dihydroxy-2-naphthoyl-CoA hydrolase"
                     /protein_id="BAQ63874.1"
                     /transl_table=11
                     /translation="MTKFTYQRKIYFADTDGAGVVYFSNLLSICHQAYEEYLTTLSIN
                     LSDFFANKLTAIPIIHAEIDFFKPLFCGDIIIIFLDRKLVNNKVFEINYEIYKENDLV
                     AKALTRHISIDPQTRKTQEIPLIIKNNL"
     CDS             complement(727827..729074)
                     /codon_start=1
                     /locus_tag="GM3709_640"
                     /product="hypothetical protein"
                     /protein_id="BAQ63875.1"
                     /transl_table=11
                     /translation="MMTYDLDVIVIGGGAAGFFGAINTAINNTNLKIAILEATNQLLG
                     KVKISGGGRCNVTHHCLNPTDLVNNYPRGGKELRSAFSRFQPQDTINWFESRGIKLKT
                     EADGRIFPVTDDSQTIIDCLVKTAQNLGIKILTKTPVKNIIKSELGFNILLKSEDILT
                     AKQILIATGSNPLGYEWAKKLGHSIQSPIPSLFTFKINDKRIKDLAGVSVNNAFLYID
                     IKQKKKLEQKGALLITHWGVSGPAVLKLSAWGARILYDNKYNLPLIINWLPEYNLESI
                     KQELFKIKDTVSKQKIINYSQFNLPKRLWQSLASHSLSNDDKIWADINKKEIDNLAIE
                     LTRGQYFIEGKGIFKDEFVTCGGVTLKELDFKTMMSKICPNLYFAGEVLDIDGVTGGF
                     NFQNAWTTGYLAGLSLAENNRII"
     CDS             729342..731933
                     /codon_start=1
                     /locus_tag="GM3709_641"
                     /product="DNA gyrase subunit A"
                     /protein_id="BAQ63876.1"
                     /transl_table=11
                     /translation="MTSIQERIVPTNLTNEMSRSYLEYAMSVIVGRALPDARDGLKPV
                     HRRILYAMYELGLMPDRPFRKCARVVGEVLGKYHPHGDTAVYDALVRMAQDFSMRNPL
                     INGHGNFGSIDNDPPAAMRYTECRLQSLATNGLLRDIEAETVDFIDNFDGSQQEPVVL
                     PARVPQLLLNGATGIAVGMATNIPPHNLGELIDGAVAMIHNPEITDLELMQYIPGPDL
                     PTGAQILGRQGIKDAYTTGRGSITMRGVANIETVSNKGRQDKEAIIVTELPYQTNKAA
                     LIEKIAELVNDKKIDGISDIRDESDRNGMRIVIELKRDAYPRVVLNNLYKQTAIQSNF
                     GANMLALVNNEPQLLTIRKFLEVFLEFRVETIVRRTRYLLRKAEERDHLLQGLLIALG
                     NLDAVIRIIRGAADTANAKQELVTNFELSETQADAILQMQLRRLTALEAEKIEAEHLD
                     LMAQITDLNDILARRERIFTIIEEELSEIKTLHATPRRTEIVQNDGDLGDIDLIANER
                     VVILLTNQGYLKKMLVNTFEAQNRATRGKSGAKIKDDDVVEHFLTGCDHDRVLFFSDK
                     GVVYGLSAYQIPSSSRTARGVPIVQLLPVASDEKITSVIPVSEFTDHEYLVMLTKKGF
                     IKKTALSAFGNIRSNGLIAISLEDNDELRWVRLATEDDSVLIGSRRGMAIHFHADNQQ
                     LRPLGRTAKGVKSMKLRSGDQIISMDILPSQIVANIAEAGENEEEDNIYSDDNEEILD
                     NDTSKNAPWALAVTTSGYGKRVPVSQFRLQRRAGIGVKAIRFRKPKEELAALHIVNGD
                     DEFMIITTRGIIIRCDVNAVSLQSRNASGVRVQKLDSDDAIAAIALVPPAGEEQEQEQ
                     EQEQEQE"
     CDS             732031..732843
                     /codon_start=1
                     /locus_tag="GM3709_642"
                     /product="UDP-3-O-[3-hydroxymyristoyl]
                     N-acetylglucosamine deacetylase"
                     /protein_id="BAQ63877.1"
                     /transl_table=11
                     /translation="MFSSFKLSGIGLHSGAKTTVKVSPAEKGKGRYFVRVDLPDKPII
                     PASIDCIATTTLSTELSNGEAKIRTVEHLLASLFACGVEDAEIAIDGYEVPLLDGSAQ
                     IWVNHIDNKSENPFRDITETITEEIWVRKGDAFCAVLPSPEIKFSYGVDYPYPVLQNQ
                     WYSWYPEREHFVTAIAPARTFGFADQIKQLQTAGLIKGGTLENALVCDDKGWLNPPLR
                     FENEAVRHKLLDLIGDLSLLGKIPRAHYLAYKASHQLHTELAKKIKLSQIRI"
     CDS             complement(732850..733419)
                     /codon_start=1
                     /locus_tag="GM3709_643"
                     /product="serine/threonine kinase"
                     /protein_id="BAQ63878.1"
                     /transl_table=11
                     /translation="MTDTDTRLTELETKVTELTNLVNQLQGQIILLPDVVRYGKLQQL
                     LQEGDIRSADEETTKIILEVAGKQRDNLTPDDVAKYPCNSLSVIDALWKKYSEEKFGF
                     SIQLKTYYQVGGNIDTLRTQDTKILVEFADSVGWLNEKKQARFEEYDSWNFSLSAPDG
                     CFPAHWWKSPYGLKMVTFFFSRLISCNLA"
     CDS             complement(733468..733995)
                     /codon_start=1
                     /locus_tag="GM3709_644"
                     /product="hypothetical protein"
                     /protein_id="BAQ63879.1"
                     /transl_table=11
                     /translation="MALKIIILGNSSSGKSSLALKLKQKFSLTHLDLDILAWEKQETP
                     VRRSLSSSMEDINHFINLNKNWVIEGCYGDLIAEILSYGNFLIFLNPDLNTCLNNAKN
                     RDWESHKYENLDDQNANLKMLETWIKDYFIRKDEFSFTNHQKLFRSFSGKKVEYNQNW
                     NEDLIRFIGEFNQDD"
     CDS             complement(734012..734956)
                     /codon_start=1
                     /locus_tag="GM3709_645"
                     /product="hypothetical protein"
                     /protein_id="BAQ63880.1"
                     /transl_table=11
                     /translation="MRIFITGASGCIGHYIADFLIQNTDHELFFLVRNPSKLKFNYND
                     REGIHIIQGDLAKILDYQELLSTINIAILAATCWGGEEESYQINVEANINLINSLNDD
                     NCQQIIYFSTASILNQNNQLLSEAGEIGTDYIRTKYQCFTKLSELKLYDKIITVYPTL
                     VFGGDENKPYSHLSAGLKDLPKLINLIRWFEADGSFHFIHAKDIAKVIIYLIENRNNL
                     DRSFEKKFVLANPSLKVNEAIKEISNYFGKKVYFQIPLSILLAKFFIKVFNVQMADWD
                     YFCLNYRHFVHKKFVNPKTFNLDSYAPNLTTLLAVSKV"
     CDS             complement(735049..736797)
                     /codon_start=1
                     /locus_tag="GM3709_646"
                     /product="arginyl-tRNA synthetase"
                     /protein_id="BAQ63881.1"
                     /transl_table=11
                     /translation="MIEKLRNIFTTALYQAFGGNITLIEPLVVPASNPKFGDYQCNVA
                     LSLAKTLQKPPRSIAQTIIDNINIDNFCEPLEIAGPGFINIKINPQYITQQINLVYQD
                     ERLGVIKTDKADTTIVDFSSPNIAKEMHVGHLRSTIIGDSIARILEFRGHQVLRLNHV
                     GDWGTQFGMLIAYLRIEKPEVLTTANAVEIGDLVTLYKQAKLKFDQDLEFQETARQEV
                     VKLQSKDPESIQAWQLLCEQSRREFEVIYQLLDIKLTERGESFYNPFLPKVIKDLETA
                     NILTENQGAKCVFLDGFVNKEGNPLPLIVQKSDGGYNYATTDLAALKYRINEDKATRI
                     IYVTDAGQSNHFAQVFQVAKKANFIPDNVDLVHVPFGLVLAEDGKKIKTRSGETIRLK
                     DLLDEAIDRAKKDLENRLEIEKRNEDENFVNLVSKIVGLSAVKYADLSQNRTTDYKFS
                     YDKMLALQGNTAPYLLYAYVRVQGISRKGNIDLNSLISDKNIILTEDGELILAKHLLQ
                     FNFIIQEVEKDLLPNRLCLYLFELSQKFNQFYDQCPILQAEEKVKLSRLVLADLTAKI
                     IKQGLYLLGISVLERM"
     CDS             737160..738296
                     /codon_start=1
                     /locus_tag="GM3709_647"
                     /product="urea ABC transporter"
                     /protein_id="BAQ63882.1"
                     /transl_table=11
                     /translation="MVSSTLSQIKQNKKQKLWIEIGVIVGVIILLSIILPITLSQFRL
                     QLLGRILALAIVGLGIDLIWGYTGLLSLGHGIFFALGGYAFAMHLKLQLPDGQLPEFF
                     NLYGVTELPLFWKPFYSFPFTIIAVVVVPAIVAGLLGYLVFRNRIKGVYFSILTQAAL
                     IVFFNFFNGQQKLINGTNGLKTDTEEIFGVLASSDTAQFAFYQFTILFLLLCYLLCRW
                     LTSGRFGRLLIAIRDDENRVRFSGYDPTWFKVVVFAVSGAIAGIAGALYTVQTAIITP
                     SIMEVAFSIEMVIWVAVGGRGTLVGAIIGTVLVRLGQSFLSEKFPDIWLFFQGALFLI
                     VVTILPNGIVGWWQNWAWLKLKSLLGLQSSLITYPSLEEVEEET"
     CDS             complement(738329..738700)
                     /codon_start=1
                     /locus_tag="GM3709_648"
                     /product="two-component response regulator"
                     /protein_id="BAQ63883.1"
                     /transl_table=11
                     /translation="MIKILVVDDNHTPREVICEALKQFNIQVKEAVNGVEATKIMEQE
                     QFSLVITDVVMPEMNGYELCRWIKTNPTTEKVPVIICSTKGEDFDIHWATRQGADAYI
                     IKPFKTMELLKTIKYLLKHNG"
     CDS             complement(738909..739898)
                     /codon_start=1
                     /locus_tag="GM3709_649"
                     /product="thiamine-monophosphate kinase"
                     /protein_id="BAQ63884.1"
                     /transl_table=11
                     /translation="MLKVKDIGEHQLLAIINQYCDQAKNGDDGAILDISTHKKLVVTT
                     DILVENVHFSDRTTPPHSIGYRAVAANLSDIAAMGGTPKAITVGLSLKKDTEISWIEA
                     VYQGMKQCLTHFNCTIVGGDITSSVVNTIAITALGEVHESEAIYRHTAQAGDLIVITG
                     SHGLARAGLEMLLYPEKYSHVSSKTKEKVILAHQYPQPRLDVIKTLANCKPYGKITGM
                     DSSDGLADAIIQICNKSKMGAIVNLRKIPIDSGILAMTDFDTALHWTLYGGEDFELIL
                     CVDSDIAYKLKQQLSQECQIIGEITTPCEIQLVDEQNVYSKLLLNQKNTYQHF"
     CDS             739954..740622
                     /codon_start=1
                     /locus_tag="GM3709_650"
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="BAQ63885.1"
                     /transl_table=11
                     /translation="MWENPPQKLILNNNDVHIWLLDINEFLSENIVSYFDILSSDEQE
                     KFNTFSRKLQGHRFLINRAYLRIILAQYLQISPQEILFNYSQKGKPSLNIKTNPEKIY
                     FNVSHKYNYTIYAIARKNLGIDLEKIDPQVNIQKIAQRFFCLEEYECLKQLNSQDKAK
                     YFFTLWTIKEAYLKSIGEGLSGGLNSIYINLLQQKLNYQLINYQEKKKLIAILKHGIY
                     LKTI"
     CDS             741053..741397
                     /codon_start=1
                     /locus_tag="GM3709_651"
                     /product="hypothetical protein"
                     /protein_id="BAQ63886.1"
                     /transl_table=11
                     /translation="MIKNKIDTFLWITIIFLGSCSQNKVFSQENDILTIATVQDLVNG
                     DLICYATLIDDNGQESTMGASFEICEKPDQYLNKKVKLTYELANINDCESNEPCGKTR
                     QELIIIEMETIE"
     CDS             complement(741410..742474)
                     /codon_start=1
                     /locus_tag="GM3709_652"
                     /product="hypothetical protein"
                     /protein_id="BAQ63887.1"
                     /transl_table=11
                     /translation="MSLLNNKSIINQSANCEDLLRKLPDYNGSKWLKRSLKTLAKIAK
                     KDKIDSLEWKILSATLKDLEKGFRVFSDYRQHRKITIFGSARTPINEPEYQLAKEFAQ
                     QVTTLGFMVLTGAGGGIMAAGNEGATSDNSFGLNVKLPFEQTPNSFINNDPKLIRFKY
                     FFTRKLFFLKESDAIVLFPGGFGTQDEAFETITLCQTGRQPPIPLVLMDKPNGKYWHS
                     WHNYVCDHLLEGGYVEPEDTKIYTITDNIQTACDTILQFYRVYHSCRYVKDLFVVRLN
                     YDLTSEQIELLNEEFKDILIKGKIEQISILPKEKQDIPYLPRIGFYLQSRKFSRLYQM
                     INLINTFPCENSPYCEPQFR"
     CDS             complement(742558..742872)
                     /codon_start=1
                     /locus_tag="GM3709_653"
                     /product="thioredoxin"
                     /protein_id="BAQ63888.1"
                     /transl_table=11
                     /translation="MTEVKEADFKEVVLDSELPVLVDFWAPWCGPCRMVAPVVEEIAQ
                     QYEGKVKVVKLNTDENPQIASQYGIRSIPTLMVFKGGQKLEMVVGAVPKTTLSNTLEK
                     HL"
     CDS             743820..744104
                     /codon_start=1
                     /locus_tag="GM3709_654"
                     /product="transcriptional regulator"
                     /protein_id="BAQ63889.1"
                     /transl_table=11
                     /translation="MEKNLQNLPSLKDLSRQLFINECKLKSGFKQLFKTTIYGYLHHK
                     RMVYAHSLLTQKKMKVTDVAHMCGYASLPSFSKAFKKYFGVNPKFDRIKK"
     CDS             complement(744183..744875)
                     /codon_start=1
                     /locus_tag="GM3709_655"
                     /product="hypothetical protein"
                     /protein_id="BAQ63890.1"
                     /transl_table=11
                     /translation="MVAQIQIPTNNEVEFIPKPDVSNLITEDDTPVDNFGSPKQQRFL
                     TNILYNARKEQVFLADANVGIYYNIGQPPIVPDFFLSLDVTTPPNLWEKNHRCYLVWE
                     FGKTPEVAIEIVSNKVGGELDEKLKIYQNMRVIYYVVYDPQKYLGEKVLRIFKLTGIN
                     YQEISETWLEGVNLGLTLWEGEFENFNGVWLRWCDENGNLLLTGDESAQKAEKELQEL
                     KEQLRQQGINLD"
     CDS             complement(744903..745322)
                     /codon_start=1
                     /locus_tag="GM3709_656"
                     /product="acetyltransferase"
                     /protein_id="BAQ63891.1"
                     /transl_table=11
                     /translation="MNTYALDSMGGGEELSHYVKSNLTIELAKRKSIHTILAFIDHKP
                     AGLIIAIEGFSTFACKPLLNIHDLIVSPNYRRRGISKLLLQTVEDIALELGCCKLTLE
                     VLEGNSIAKSAYRTFGFEGYQLNPDMGRALFWQKKLQ"
     CDS             745491..745745
                     /codon_start=1
                     /locus_tag="GM3709_657"
                     /product="RloF"
                     /protein_id="BAQ63892.1"
                     /transl_table=11
                     /translation="MQEYFSDNQIEEMVYRLGNMTLLEPNLNRQIGNKNYTLKKEIYQ
                     QSNYQLTKNIQAEEWNPESLHRRQIQLTKKAIQIRRSSFL"
     CDS             complement(745772..746956)
                     /codon_start=1
                     /locus_tag="GM3709_658"
                     /product="Methyl-accepting chemotaxis protein"
                     /protein_id="BAQ63893.1"
                     /transl_table=11
                     /translation="MKKYLLEYWIDSNKYSKAELENKFKNQSKFKQYIDDNNLIFNVS
                     KNKNYLVLSIHSTNTIIEKCRANLNFDRQYCFIVKDELADFVRLEAYPLLAEIELTLR
                     HFINEAMINVFGFDWWSLFIPNNTQKKIQNIENNEIEDYVNLQHPISFSFFDDLIGIF
                     TTKIQKWTPDSPIKVADLDELLSTSNDIKKLRQEIKNRQKTISFWDDVFSYYFEDQDS
                     WKELEKILQNFIIPARNRVMHYRLIALYELNKIKEFRDKLKHIINSAKTKLSDTEKEN
                     INMNAKTIIDKLIKQMNSQIIPPIPITQIIKPMNISIIPPIPIAQIIKPMNISIIPPI
                     PIAQIIKPVDIPIIPPIPIEKIINSNRQISDIVSQYQENMKKINDLQNQFKINNDRKP
                     LF"
     CDS             747352..747477
                     /codon_start=1
                     /locus_tag="GM3709_659"
                     /product="hypothetical protein"
                     /protein_id="BAQ63894.1"
                     /transl_table=11
                     /translation="MKSSWLWCRITLQSLWLISAINAETTIKQPQRVTDLEQKRS"
     CDS             complement(747501..748781)
                     /codon_start=1
                     /locus_tag="GM3709_660"
                     /product="TldE protein"
                     /protein_id="BAQ63895.1"
                     /transl_table=11
                     /translation="MLAEELLALTLKKGITDVEVYQVKSYSRPLSFEANRLKQIESAQ
                     TTGVALRLWHNGCPGLVVAYGDFNADDLILKAMAISELNEPEEPLLNDHNKLIYPNFT
                     QEPDLQSLISQGKNSIEHITDKYPEVIVNLDMEWEIETTTLVNSRGLYCQQTDNSYSA
                     SLGVELVRDEDFLGIYDGEYSHEFLDMTPMIDAILQRLQWAEKNTVLNTGKMPVLFTP
                     NAVVTLWETITEALNGKKILDKSSPWSESFQKQVISPCLNIRQQPDLQPYNCPFDDEG
                     SISQSLNLIQDGILTSFYTDKKTAKKLGLSNTGNGFRPSLGSYPTPDLINLVIDEGKF
                     SFGELINNMKNGVIIDQILGGGADISGDFSFNIDLGYRVTQGEIVGRIKDTMIAGNVY
                     QALQNVDLLGFDRVWSGSCYTPSMVINQLSLVSG"
     CDS             complement(748916..749713)
                     /codon_start=1
                     /locus_tag="GM3709_661"
                     /product="alpha/beta superfamily hydrolase"
                     /protein_id="BAQ63896.1"
                     /transl_table=11
                     /translation="MEWQEFSGSWVLIPENPIGIIHFLGGAFVATAPHITYRWLLENL
                     AKKGYIIIATSFLNTLDHKSIALNVQNRLENILYRLEYRESIELSYLPVYGLGHSMGC
                     KLHLLIGSLFEIERAGNIFISFNNYPLKQAIPFVENIIPSLRDNLKNYWKIDNNLEFE
                     FTPSPEETKIIVKENYQIRRNLLVQFNNDSIDETSTLKPILTDLFPDMVSVLTLQGNH
                     LTPLGQDIDWQVGDMFIDGIGQWFKDNFSQDLSNLYKEIYRWLNPLI"
     CDS             complement(749836..750165)
                     /codon_start=1
                     /locus_tag="GM3709_662"
                     /product="MG(2+) CHELATASE FAMILY PROTEIN"
                     /protein_id="BAQ63897.1"
                     /transl_table=11
                     /translation="MTTQKTGETSEIVRERVKKAREIAHNRFKGDRISCNAHMQSRHL
                     RKFCDLDETSRNLLEGAIRKLGLSARAMDRILKVSRTIADLAGDEHLKTNHLAEAIQY
                     RTIDRMQ"
     CDS             complement(750479..750820)
                     /codon_start=1
                     /locus_tag="GM3709_663"
                     /product="hypothetical protein"
                     /protein_id="BAQ63898.1"
                     /transl_table=11
                     /translation="MNDEELDRLSKLLMDLKGDKSLRQFAEELGSSYYALRTWIHKKN
                     IPTPQNLEKISNYMRIELNELFSIIKDKNLNNNFLKELPDNAKEAYPYLINLPKEEKL
                     KVAQKILNECV"
     CDS             751160..751345
                     /codon_start=1
                     /locus_tag="GM3709_664"
                     /product="hypothetical protein"
                     /protein_id="BAQ63899.1"
                     /transl_table=11
                     /translation="MTPKEQKRIQKNTHLLPSTVEKLRRLSYESGFSHGQIVDMAIAN
                     LSESYVFSKARNVGACE"
     CDS             751492..751737
                     /codon_start=1
                     /locus_tag="GM3709_665"
                     /product="hypothetical protein"
                     /protein_id="BAQ63900.1"
                     /transl_table=11
                     /translation="MSQNLQKIGLPNKDWDYYKLWNQVITISDSADELGLLVSQQEQW
                     DNSKNLMIINYLQAIINKGNEAIAELKRIERIEKLVA"
     CDS             751917..752987
                     /codon_start=1
                     /locus_tag="GM3709_666"
                     /product="hypothetical protein"
                     /protein_id="BAQ63901.1"
                     /transl_table=11
                     /translation="MITKNKGNEKFFKFTEKTAKMLRTANLSKNARNLWDYLVTKNPF
                     GDRDENLEYAEIQSIFKWAKHTYYRAKAELSSKGLIDFKNNQCQYRSTLKTKIAETVE
                     AVTKTVKELQNLSLSDKNCKSQDSQPLSVNDSKLSQTIQTYSDLSDQSEELKDDRKIK
                     ERQSEIGKVKREEIQEDDGLINEGIEKEEPLTFDKRLENEEFIRYAQGKLPKARDIKR
                     YLLTNDKTTGDKILERLWLEYQQWKTGKSNPNSTGNEYFDNLIEEYRKTKPWEEFNWE
                     TVNWEKLPCFNVWLEKAKICRDYTFTDDNSLGYTRNLRAVFYRWYEQFYSQKQESIPV
                     NSQAMGLINTFKQIMGGVNYAY"
     CDS             752977..754173
                     /codon_start=1
                     /locus_tag="GM3709_667"
                     /product="probable streptomycin biosynthesis operon
                     possible regulatory protein"
                     /protein_id="BAQ63902.1"
                     /transl_table=11
                     /translation="MPTKKEKIYPDLSLNPNNIAVGDTVLKDGQIGLVTDIVSNNGHK
                     VLQFWVKWAESTVTVPTPEIASSLQKIEPIPHDLVNTTFPDGSFVQSFIYREEQVKAI
                     IIKESGFFSLFSLDQLQSKINQSSQPTVNIYTLTIDPNLQQRVKLNQDTIYDYSIALS
                     EGEIFPPIIIWRCDDGQLYLVDGFHRVEASKLAKIEELPFIEKSGSYRDAMLFTISVN
                     ADHGLHRSNADKRKAVMTLLQDPEWSQLSTRELAKLAKVSHQLVHKIRIELETLDRRR
                     QNWQDIKDYEEGIRERETENSINNESKIQYPEDVIKFLDDEGNEEQSTKNSEKTVNIY
                     TNKIKEEKFTTPDIIPLNQDTYSLICDRHTIQALEKFMKAEGIESFPKALWKLLHLHH
                     LSKNSP"
     CDS             754318..754839
                     /codon_start=1
                     /locus_tag="GM3709_668"
                     /product="hypothetical protein"
                     /protein_id="BAQ63903.1"
                     /transl_table=11
                     /translation="MLTAESKEELYSLLTHRLDVSRTSVIKRLNKLNIKVKKDNEKSW
                     IEDKELDLLDQLNDFVANGGTMDQFLAENNIAIATVEKKSNEIKLEEEPVNIYTSDGI
                     IPQIAQLMGIAQERAGGILIAERVMTTQYLANPELLNDEIKARISHYEEKCVPAAIDA
                     EEFAQKLISEFTE"
     CDS             754849..755670
                     /codon_start=1
                     /locus_tag="GM3709_669"
                     /product="hypothetical protein"
                     /protein_id="BAQ63904.1"
                     /transl_table=11
                     /translation="MSIENYRKAELKKVISALLACESLLIIGEPGIGKSFFLQALTNQ
                     LVKDDYPHVVLPMGTVKQIMDTVGKKLAIDPETIEGKKKSIYMMMDDVINFCRSHPTI
                     FIVDDAQRYPPSIRLWLERLMLEVNCPLLLTATYPPARDIFLKLPRIELEPLKDKAIR
                     EIMKEKATFLEITLNNAQLAKLQASTGGNPMLAGRVVKEHYLGIKSEGLDHTQWIDGT
                     PYLMACLMLLVIIRFVGLGLNNTSLYLLGGVITTIVGVTRILIYSLPKKGTRLGQ"
     CDS             755692..756240
                     /codon_start=1
                     /locus_tag="GM3709_670"
                     /product="putative glutathione peroxidase"
                     /protein_id="BAQ63905.1"
                     /transl_table=11
                     /translation="MPLTAIHKSNDFNVIVSTLDYESADKIREAFAVGSLFCPFCDCP
                     MFPRSSVYKVPHFVHKRQNSCSSSGETYQHLFAKHKLAEQLREANPNDIITVEHRIPT
                     LLSYRIIDVAQNKNGYLIAHEIQLSPITVEELQQRVNDYTQQGIESIWYFGETNAKNK
                     AIKEYCYIKDVNAFILGFKTDY"
     CDS             756559..757143
                     /codon_start=1
                     /locus_tag="GM3709_671"
                     /product="hypothetical protein"
                     /protein_id="BAQ63906.1"
                     /transl_table=11
                     /translation="MDILIALFKNGDNSQRTKVNSWLNSHTRDKFSITLKDDFFLQYL
                     DQRDGRNTQHYWSISFNQSHSDKINQFIDFTNEWQGLTLRSLPELKLAQLLYEHHIPF
                     LSNTKGLVLPLPNTLSDTLLSGRVEYDFILLKPLLRIELDGQHHLNPQQRQLDISGDR
                     LLQSLNIPTLRFNATDILKNPQLVINEILSFCHL"
     CDS             757202..757447
                     /codon_start=1
                     /locus_tag="GM3709_672"
                     /product="hypothetical protein"
                     /protein_id="BAQ63907.1"
                     /transl_table=11
                     /translation="MPNLIFIKARGGLTTGEQLLQVINQNPNGCTIKYLSNSINRPVS
                     MINICLRQLISSKQITVQLRGMQRLVYPGSLYTKEIK"
     CDS             757771..758814
                     /codon_start=1
                     /locus_tag="GM3709_673"
                     /product="cell division protein FtsH"
                     /protein_id="BAQ63908.1"
                     /transl_table=11
                     /translation="MARGDTLRKLFNSFSNENKEELCAIATQLIEEEKEKNHLLLAHD
                     LERIMQKTISKQLASNNFYQEQYPEVPKDKETGLPLIEIQTYQFNWDRVVLSKKNLDI
                     LERIVIENRKVELLNSYNLKPTSKILFCGSSGCGKTITAKVLASVLEKPLIYVNLPSV
                     FSSYLGETAVNLKKIFDYIKIGEWVVLFDEFDAIAKDRNSDNEHGEIKRLVNSLLQLI
                     DNSQEDKSIFIAATNYESLLDKAIWRRFDEIIFFDKPDYKMRLSLLRKNLSSIKHSSL
                     EFNKIASQLKDATGSEIEKICFDAIKLVILNNQDILTSKDLEIAVKNHFQRMNIINKS
                     RQNEKYLDNIDDE"
     CDS             758807..761254
                     /codon_start=1
                     /locus_tag="GM3709_674"
                     /product="putative serine protease"
                     /protein_id="BAQ63909.1"
                     /transl_table=11
                     /translation="MSKLEHLELPKTEIEYTRKLNGGGTSHKRTNRSSHGTKLLNQLD
                     SISNRPEKEYSPFGINPKLIFKIKLRKDFNFSDEKVIKSGLNLVAKETKLKQAIIVFS
                     SDDNLKIFREKLQAYSGLVKDSYEYGYLDDIEDLVSLEARDKIGRLLQLKPLEKDELV
                     PLDLELWHTGNKTEMKDYIENLDSFLKDFKEYPNMKVTDKYIGNYICVARIKIRQEVL
                     EILLAEDAVKEIDRRSKPAFESYQEINIPLSKFPNVISPPVNNTGVLVIDSGVQRGHP
                     LIKNTLGDAEVFRDPEGTLINGNEDDCDRKTGGHGTGVSGIAIYGDINKCIKNQSFQP
                     EVWLFSARVTNENNEYDPDLLLDNQLEKAVDYFVGTYPNCKVINISLGDSNLIYQDGQ
                     KQFRLAAKIDELAYRWRNYNILFVISAGNFQYQPESNELLKTQYPQYLLDEKAKIIEP
                     ATAAIALTVGSLSMGKGSMTYSEDACRNTIAQIEGYPSPFTRIGFGVDGMIKPEFVDF
                     GGDLVLDRTNIIPNEPGASIVTLNKDFQANLLFKTFCGTSFSAPRVANLAAQLFTKFP
                     DATSNLIRALIADSAQLPQEIPNVFQGTTSKQEQNRLQIYGYGQPNFDRSAYSTKNQV
                     VLLEDNGIIPVGKFRIYEIPALPDNFLKIKGKRKISVTLAFDPPTRHTRGDSYLGITM
                     EFRLFKNIDKEILQTAFLKATQDEGTENLTEISIKNLKEEHGKNIDVNLSPTNKLRKK
                     GTLQKGVITISKNNWKYNKKPLYIVVICNRKWAKKDEIDTQRYALVASVTHSKEEVDL
                     YNQIRHQTRISQRVRIK"
     CDS             complement(761834..763795)
                     /codon_start=1
                     /locus_tag="GM3709_675"
                     /product="hypothetical protein"
                     /protein_id="BAQ63910.1"
                     /transl_table=11
                     /translation="MEINNISNQPEYISEKNKHIEQYLDYFSSQEKSTGFALLIKGEW
                     GSGKSWFINQYINKLKSNSSNKQNLYINLYGINNVSQIDDLIFAAVHPILSSKTAKIA
                     GKIVRGLLSKWVINTNWNQDSKPDGNVQPSLEKINIKDFFNQSLEEDSKYNLIIFDDL
                     ERCKIPIEELFGYINNFVDSEYLKVVIILNENKIEENNHDKYKNTKEKIIGQTLEMIS
                     DIDSALNFFIEELIQEEVKVYLKKNINTIEDIYIESDSHNLRILKQIILNFKRVFEKL
                     PEEAQKSSEFIHQILKVIIIFSLEINYGRLETKNIRLVPDAIYKTIAKDYHNRKNDNN
                     IKTNMNNIIDEKSIRLFLSFFDLEILDSENEHLQNIIWWQKFFHKGLIDQEGLEILWN
                     NSKYNNQNIPEWIKLYHWSNLEDEDFTDSFKSVIENLKKKHYKDLGVIKHIIGIFLCL
                     SENGFCKISKKNIINYGKKYLDHLYKNNLLDANFTYQLQIYNNLWYQSRDSQEFKEFS
                     KYVNKSINSAKKQNLPDEANNLLKLMEENFCAYIQAICSKNITNNDHKNYLDIPIFKY
                     IKPQEYFDIFIKKTNIDKQRCLWSLKNRYKSYNTESNLSSELDFIKDLKIIIDGYVIK
                     NPKKISSFILKSKSEKELKEIIDKLEQNI"
     CDS             complement(763941..768164)
                     /codon_start=1
                     /locus_tag="GM3709_676"
                     /product="superfamily II DNA/RNA helicases"
                     /protein_id="BAQ63911.1"
                     /transl_table=11
                     /translation="MLNQVILEITKNQRPYYHQQGNTIKGIDNQYWLIFKRRDADNLL
                     NNIVSFLGIFGKHSNYKLVRIDLNTAHVYYYTLKNENNLPNNTLLRTSKVEIIEKFLE
                     LENIKKEDSLLAGSFLELESKIRRRRKFNLPDDKDKYNDFITAYLERTKLYRRSTAYF
                     ESGVLKLYEEPLQHLVKNEGEIRLLMDWMGFCNVRDVKELKKLQNPEYRLPFVRQTLQ
                     QFLDSLDDSSLTSTEILAELVRLEVLKIKMVKMDTGRRAIYHKKTGILTDYLGNHIMH
                     EGSDNFTKAAHTRNAESVTFLYYSDSIDLEAITDTIEQFDEEWEDSDYILEFSQEFLD
                     QIIREKSKRLQAKKPVIDAITPHQLTAGETITVTITGNNLENVNSIVFPDNELIIVTI
                     KQQDKTKIITEFQVLAEHPHQQLTEIILSTDKPYLLELSQGIEIIQRIVIPDFPDIEG
                     FKEAVELILQGRHGQPEDFIYWLAQQKPHLLRVEDSDLLVEFVNDGILFEHQKSGSQH
                     CYRIMQDFGVAVCADAVGLGKTRLASAVAKLYQHNQGQVRIAIIASKKLHSNWEREMR
                     ELGFRKGDYELYNKNLMSRKNSNFLDDFNRYGGADLVIIDEVHEGIRNYNNHIHKTCL
                     RIRQQDIVDNRQRYYLLLTATPWNNRREDIYNILSPFLTRPEGFTDLGFPPELAHWFS
                     NREIGVENFTDNTPIFRNVYRELFLQRTRKMLRDATPDLNLYAKRIAEWLPVQFEAKT
                     ETALEQIFTQFENSLFIPFADPIRYFTDTVEQRSLLRNQRRMFLQRAESSMYALRRTI
                     KNFSDRIVLLQRRLESVTANGEGLKQFLLLHYDFITENEFNQDELEDNLLDFDNDDFW
                     EDEDDEVEIDNNQEERRQQLRTSINLATDNLTDERAIDIYQRILTDCESDKEQLIEIE
                     SLLKDEFITDHKRQIVTAKVKELVKSGYKVLLISTFADTVIDYYRYMAQDTVIISKGI
                     GMAMGGNKRYFTDNHIVKVNKHNLVKNQREKKGITRLELFRLFAPSANAKGNKPSLDE
                     EIAVLIGSETLSVGQNLQDADYLINIDLPWNPMTLEQRIGRIDRPKQHKSDYIYIYYA
                     NSESQLLRQASRLNNLHKKLVGDLAEDGQKIPEINDLTELGASVYGDTSFDDEILPGY
                     IDFIQSLVKVRKMEQDNIQEKTYNKQETAKDLYTENEILQSEELKKLVQRLGDDYIPN
                     PISLGKLNNSDSAHNLLALTINYFGPNNEPLPDKKEVIYWNNLTGEEDAYGKSIALSF
                     QTPEYHEVVSASVIIERANSLYEKLMGIKRDYEQNLEREDSTENINISSERVSRIQKR
                     IREMDSFPEGVNRKIVKEILNKLNQHKQNKQVQKLLKQFTDGDKSKLGNDDFINQLVD
                     ETNRLSLIDMEVIKASKLKLSLSALLMLI"
     CDS             complement(768166..771321)
                     /codon_start=1
                     /locus_tag="GM3709_677"
                     /product="hypothetical protein"
                     /protein_id="BAQ63912.1"
                     /transl_table=11
                     /translation="MMKKDLTPSQDLPTIPPALESLSSHGYSSMTQIELENNSKLLSH
                     RKYDEKAQKYIYGKWLSVDGLKYFLDTWQKNREDYEKYNGWVILPKKYRDRLWNYTKE
                     WIGLIFEQFNDLDAPSNLYLIYELNWRLEKILIPLTPLILVVNSSIEEKLTSIVEKFN
                     PYPELINFDNSTQNQEKDNKNNQEIITPDNEKYQGKDWDWNKITNAWVDLAFGLLKNA
                     REIQNKDDFELWRNRLKQIVSMDSVWHSRWIYEQCLYHLSRLEYDLVANLVEEWESNL
                     NLIPDFWEVKRASILAQIGELKEAKKITEKILTKIRFSIQPYEINYSLLSQEGWTMLL
                     NLEIKQQILFSQGKWEDIFEPDENRDRWETLNQYYCNPHIEIETLAQIVDRPPPQIRQ
                     QIEETRGFLPYEKFTTIRYGDDNSSLLSDLRPAFESIRILQEGGIPFSLNNIKGHQKH
                     IINASKWTLTYLPEFSLLTLIQLDDQKKIKDWLSFVDIALLPQEYIDNLFELLYGFFY
                     KVIEQLSNLRKNAIFTNEYLYSRLPVFTEVLSCLCIRLNNEQLKKVFNLAVKMYNIES
                     FRQIYAVHNLPCLLFKHLFYVLLSSDIINKLNTLLSLPMVGETGFVCSHPNIFKEPFY
                     YIEFPQDFTLDDNFDRTQWNEAIERLINVIQNDNGEARKRAISRLIQLYIIKGLTFEQ
                     ENLFAKALYSQRENNLPKDIDKIYRPYIILSLPEEQQGIAKDVISQSIIKNLENIKNF
                     RFNSNADFDQLNESLRNLFYASLPLNQKLEDNNKYINWTEDNIQYFFTIINDLWTDNK
                     SVFIKIYSQKNHLFRNLLLDVITQIDNCLSRVILPRLKNSEDNLKIQIKELIDDCKNN
                     KISMLSVFPIMLFIDENLDVNEIARKLIFALSSLDKNEINSAVNAIEIWLMFSHQEQI
                     KHPPENLLNELISKVIYYREAKFSLAVYTLGNMISMLPNILTQSQLESILIGLEYLLE
                     ETQLPDNWTWWKIFNYDINRKIDVKDIPQYMEYCSYLANCLYKYYQEIKKEEFIPEIL
                     NKWKDNSLNSVFPRVRKIWKN"
     CDS             complement(771324..772226)
                     /codon_start=1
                     /locus_tag="GM3709_678"
                     /product="USG protein"
                     /protein_id="BAQ63913.1"
                     /transl_table=11
                     /translation="MSKEITFSDQHHVEQIRRRLWCGREFGQASVMVGAGFSRNADPI
                     SSSVSTKFPSWWDLEKQMRDNLTHLPDSVLDNFDALELASQYENVFGRQQLEQFLIDS
                     IPDKQYDPSKLHKLLLSLPWSDIFTTNYDTLLERTFVPNKKFEIIYNPSDIPGRMKPR
                     IVKLHGSFESYRPFIFTKKDYQEYPRKFAPFVNLVQQSIMENAFCLIGFSGEDPNFLN
                     WIEWVRSNLGEYSPPIYLCGILNISDYQKGVLKQRKITTIDLSSLFPKDKYHDSNIRH
                     SKAIEWFLWNLKYGKSPNLKDWLK"
     CDS             complement(772234..775452)
                     /codon_start=1
                     /locus_tag="GM3709_679"
                     /product="adenine specific DNA methyltransferase"
                     /protein_id="BAQ63914.1"
                     /transl_table=11
                     /translation="MTITKTQLRSIITGTQQERVESLCQLLNYPVHQKDPQGSRFWYL
                     RPANAENDAEDTCPIAVSFYPELNELTSDNEVKQFFSSDEQDKVIRGHYIKSTAENQP
                     VMYLLFPSTDNGRTAFILPTESKLRQRSIQSFSYDDADLLARLGRLHLEQLVIANKII
                     EKPIAFVPQVDWIFYKPAVTAKELAEELAIVTQRIEQVIPSVYHSETEDGYLHKLLKS
                     FQKELLPNLKLNSDDEKEYSFADIYAQTIAYGLFTARVFSYVKNPKLDFYRQGAWDKL
                     PETNPFLRQLFKDISERKPEELGDELIDCITEAFAILRAAKMDAILADFRNKMNREDI
                     VIRFYEDFLKAYKPRMRERRGVYYTPEPVVSYMVRSVDELIKDKFNKPLGIADPEIMI
                     LDPACGTGTFLLWIFQLIHQRYQENPEALTEGLEDKSWSGYVTERLLPRIFGFELLVA
                     PYSICHLKLGLFLEETGYEFNSGKRLGVYLINTLEDIKLREEKEQLTLAIPHMEELIA
                     EEAKAGSKIKKQEPIMVIIGNPPYSGISENNNEWITNLIEDYKYINGEHFRERKHWLQ
                     DDYVKFIRFSQWRIDKSGQGILAFINPHTFLDNPTFRGMRWNLLSTFNDINVLNLHGN
                     SNRQEICPDGTPDKNVFDIRQGVSINLFIKNHIDKTELGQVKYSDLWGERDLKYNILL
                     KQSLKTSMLKSISFSNPYYFFIDRDETGREEYEKMLLINQIFLVYSNGIVTMGDSFII
                     AEKKEILEDRLIDFLQKNYKEIELKNKYNLGKNYAKWIIENKKLIEQHNKLFESFIKI
                     SYRPFDIKFTIFSNKLLWRWRFETMKNMLFGNNIAFHLCRQIISDEWKHILVFDNVID
                     DSCISNKSKERGYTFPLYLYPDTEKPQELQQEKRANFSPEFLNKIKSKLGYLPTSEAI
                     FYYIYAVFHSPTYRRRYAEFLKIDFPRVPLTSNKQLFTELSALGEQLVQLHLMTSPKL
                     DKLITTFIDKGDRTVASGYPKYIDGVVMINKKEGFEGINEKVWNFYIGGYQVCHKWLK
                     DRKGRTLSDDDILHYQKIIIVLSETIKLMTMIDETIPSFPIE"
     CDS             complement(775463..775942)
                     /codon_start=1
                     /locus_tag="GM3709_680"
                     /product="hypothetical protein"
                     /protein_id="BAQ63915.1"
                     /transl_table=11
                     /translation="MNIQDSNSNSTQDNLLIVNELKKVNQKLTEIQKDNSTNNINELQ
                     KQISRTQNSLIIVIGLFILGIAFNIFYANKQYSLLQILNSNNSQQLSELSELNKLNSQ
                     INSPEKYEYQVVSPSDYVFDEEMNKYGQLGWKATDCRRATSSFSSSASYECIMIRKK"
     CDS             complement(776062..776202)
                     /codon_start=1
                     /locus_tag="GM3709_681"
                     /product="hypothetical protein"
                     /protein_id="BAQ63916.1"
                     /transl_table=11
                     /translation="MSKRVYLTLTDKVHEILQQQAKSQGRSTANLAAYLVEKGIESLQ
                     KT"
     CDS             complement(776285..776443)
                     /codon_start=1
                     /locus_tag="GM3709_682"
                     /product="hypothetical protein"
                     /protein_id="BAQ63917.1"
                     /transl_table=11
                     /translation="MLGYFLIISSLLIVDRYLVTDSPNFPNLTEICIIDNEITTMSEC
                     YDIMINGL"
     CDS             complement(776466..776813)
                     /codon_start=1
                     /locus_tag="GM3709_683"
                     /product="hypothetical protein"
                     /protein_id="BAQ63918.1"
                     /transl_table=11
                     /translation="MKIDKCVCAVCRWHRCQFYSNSPHLVCVVHPSGVEDDCLDYRLD
                     PSYIYEEQWCPEGYVYYDDELIKLPDKPSIERQLWLLDNHPVFTGVCGNCGYHYPSHS
                     TSWDCPQCGTVYE"
     CDS             complement(776897..777013)
                     /codon_start=1
                     /locus_tag="GM3709_684"
                     /product="hypothetical protein"
                     /protein_id="BAQ63919.1"
                     /transl_table=11
                     /translation="MGNGSVSGFLLSSADTGRINKLSSNRIVINSLIMGINQ"
     CDS             777213..780059
                     /codon_start=1
                     /locus_tag="GM3709_685"
                     /product="serine/threonine kinase"
                     /protein_id="BAQ63920.1"
                     /transl_table=11
                     /translation="MLEISPNFSFLTVIDLAELATLAEKYYQSDDPNTSLIKSRQFIE
                     VCAKYVSAKIGIYEEIKKEKLIYIINTLHKEKAIYDRIYYLFNDVRKLANSEVHISPK
                     NSTTIENNNSNKANSSTALRCIKKIHKIAIWFHKVYCLDPKKPFQEPTYIVPPDPNDL
                     MKQLQEKIEELDRQNEEMKTKQVEVEIKQRKLELEKEQENLAHEKEEINNRIESNNLD
                     KELTRISQETILKPEVIRSNIKKAGEIDSQTILGTGENIESEESNKLTEGQILRHHYL
                     IATELSSGSFGTTYIAHDLDQPNQPICVVKQFTPQQSSDGTFSKALTLFNQEAETLQK
                     LGNHLEIPRLYAFFEENNNLFLVQEYIEGNTLRDELDTPWEEKEVIQLLKDILTPLVF
                     IHQNEIIHRDIKPENLIRRVVDNKIGVIDFGAVKQVLLEEKNKQATVIGTKSYMSPEQ
                     YMGTISYSCDIYAVGVIAIEAITGRKIPEGLSSKQYLEEITFISDGLKQILLKMTAFS
                     PENRYSSAQEVLDAIDIWEKQDDKTPTIINPPTPIIETPPVDKPKPEPPTVTPPTPVH
                     SWWQTIPKLWLIGGGVASVLLLGLFIKSLPYLTKTKLVQIELTLGTLWKPENLQGLIE
                     HVEDNSVPANYFDFLKGDKVKVLANGDISIPYTEAEKRIETKEWDIAFATSPILSIFA
                     KDQGYTHLAGMFPGSTHYQSGFFVRANSPIQSLNNINSNTRVALGGFNSASSFYLPVY
                     DLYGKTITADTGNRSQTIIELVKEGKADVGVAAIGDSIKKDDSDFRIIHVSRDIPGSA
                     VYASPSLSQKDRDNIQKLMLSASPEVQEKANYGEKPEADYTEFRKIITRVQEILVCSD
                     FTQNPVTLACTGNIQTIQGKINGVSIEGDNFILKVSGDGQIHNILIPVKMTTELFGSD
                     KLTDIQGKSVIVKSNQISGNSLKINQSEQVKVSE"
     CDS             780062..781576
                     /codon_start=1
                     /locus_tag="GM3709_686"
                     /product="two-component sensor histidine kinase"
                     /protein_id="BAQ63921.1"
                     /transl_table=11
                     /translation="MELTINKIKRISLITITVIVSTLLLNYSNYKRYYISIFAIQTVD
                     FNILSHILPAKLSLLLINNNQQEIDKIINSNYGLFGMVITDCKTDKLDCPEQTVLFST
                     KSWYQQYHLQDLNNRHFDFLRNPPPLLTEQFYRRISSKETELTGQNNQGEIIGRVYYV
                     RRQFPSFWTTQLAWIKKPFSFQDVKLLYTLTFTVITLIGILVYFILDRIEINNFLKEE
                     KYKSKLLETENELLRYRNFNNAFEQIIEQDFSSVIANKLQELDSLLKNILLRINSDAN
                     NIIHDIYKAPLLFNADSIPKYIKEIENNREQFNISDELIDLLKNLNNTIKTLKWVVEE
                     LRGISRIQSEATLIQEQIKYFQKNLPPSIQDWQIEFIYPDTDLWIDCNPWHLRSIIKN
                     ALYNSSSAMKKYRRQLKKEKVNFSGKIKVECKQENNLAIVQIEDNGSGIPEDIITRLY
                     ETPERLNQTAGNLSGNGSIIVSAYLSLHNGKVKKQNLNQGARVSFIFPLIKQEA"
     CDS             781577..782536
                     /codon_start=1
                     /locus_tag="GM3709_687"
                     /product="transcriptional regulator"
                     /protein_id="BAQ63922.1"
                     /transl_table=11
                     /translation="MAHILIVDDEAHIRSEWRTRLIQENHTFQEADGIDEAVEAINNS
                     QEQEPFDLILLDHSLGEELGLDLLDEVGKDYLQYRVLVITGHGTTSLAREYASIGAIG
                     HLIKPVSEAQFNTAIASALERRKIQVEEKEDWESAYAVLENLGIFESIEVLKSDSTKA
                     QEQYEILKSTYDQLLDDLKLAGGQEYAIANAYEKATQTLNDSDGSVEGIIPFLTKFKV
                     TKSFWSDVKTIFKKSRLYFFVLQSYLLRIAENPLAYRIKHLAGGADGHYEYRIGSEFR
                     LYFRKEADDIILERFANKNIQPEIIKFLNNTHETAFNSEQLIN"
     CDS             782547..783482
                     /codon_start=1
                     /locus_tag="GM3709_688"
                     /product="outer membrane lipoprotein e"
                     /protein_id="BAQ63923.1"
                     /transl_table=11
                     /translation="MKKIFYPLLALSFLSGTIVHRLPSIAFNEQSNVSQEQLNDQALL
                     GLNWVQQSGEYRALAYQAFNIAKMAFDSAKKERIENPTVIVDLDETILDNSPYQASLI
                     DTNEGFSSKSWNQWILAEETLAVPGAVEFINYVNTNGGKVFFVSNRNESTTKDSANND
                     LELATMRNMEKLGFQGVTEETLLLKGEFTNDGNTAKQWRMEAVTNKEADGVKRNIVIF
                     MGDNLNDFSEIDKNSNQVRKEFVDRTQLQYGLFTVNSEGFKPAYIVLPNPMYGDWENG
                     LYDAKRFGKNSIWDLNPEQKTILRKESLIKWDNNK"
     CDS             783485..783727
                     /codon_start=1
                     /locus_tag="GM3709_689"
                     /product="hypothetical protein"
                     /protein_id="BAQ63924.1"
                     /transl_table=11
                     /translation="MDITQLKQPVIGDVIKALRLELKLSQEKFASLLGISFVSLNRWE
                     NHKTMPSYLALQIINLHLEKLDDKSSQLIKKTLSIL"
     CDS             783747..783923
                     /codon_start=1
                     /locus_tag="GM3709_690"
                     /product="hypothetical protein"
                     /protein_id="BAQ63925.1"
                     /transl_table=11
                     /translation="MGKSIKSKHCYYCNNLVLIRYRIQYDDSKKWVMVCPNCWELLAR
                     DNKFYRYGGTWKAK"
     CDS             783945..784613
                     /codon_start=1
                     /locus_tag="GM3709_691"
                     /product="3-oxoacyl-[acyl-carrier protein] reductase"
                     /protein_id="BAQ63926.1"
                     /transl_table=11
                     /translation="MYKTIVITGVSKGLGRALTEKFISLGHTIIGCSRSQDSIEYLQQ
                     KYPQHYFSVLDVSDDEQVKTWVESFVNVPNLVINNAALINNPAPLWKISAEDFSYLID
                     VNIKGTANVIRHVVPLMIKQKQGIIVNLSSGWGRSTSPEVAPYCASKWAIEGLTKALA
                     QELPSGMATVAVNPGIIHTDMLNICFGEEASFYTPINEWVKQALPFLLKLSTKNNGQS
                     LTVS"
     CDS             784633..784980
                     /codon_start=1
                     /locus_tag="GM3709_692"
                     /product="hypothetical protein"
                     /protein_id="BAQ63927.1"
                     /transl_table=11
                     /translation="MSRIPEDSTREERIDFQIVVDAYDDEERRMGWYYYLQDNLNFPF
                     SAKWLNGKDRDVTVVDLSPEDDCLDNMFVEVEYDDDQFSVQLEDIEPIDVDEVTQTAI
                     DDWKYWVERGYEF"
     CDS             complement(784977..785165)
                     /codon_start=1
                     /locus_tag="GM3709_693"
                     /product="hypothetical protein"
                     /protein_id="BAQ63928.1"
                     /transl_table=11
                     /translation="MTWWSGKTRIWGGSFEYWLNLDIKRPWKDKLIIIDEGELTKPVI
                     TPDDPEQVYQILVNKTSS"
     CDS             785493..786512
                     /codon_start=1
                     /locus_tag="GM3709_694"
                     /product="membrane-bound metal-dependent hydrolase YdjM"
                     /protein_id="BAQ63929.1"
                     /transl_table=11
                     /translation="MKAISHSLTGVIATSFLISTNPIYLSIASIVALLPDCDTSTSTL
                     GRVYPFKFLAKWIEKRYPHRSITHSFLITGLIILLSSPLILINPILWKTICLSYFVGW
                     FGDVFTKSGVCAFYPSQARLIIPGNPRLRLSTNSPAEYWLISLFVIILIISFYLNNFG
                     SITNAFNNFLRLPSGAIEQIRKDISDSLITINIKGYHTITKEKINDDFEVIELLTSTD
                     FLGKKDNVFYRIGTSANVNINVSSMKIINQKPINIRSTEITIDDDYITEYLEEFSDSA
                     FITGNLFTEDWEDLIIPNRADIFNPIVLNIGGNLFLQSAQVKEVKQYLDDAFVTGTII
                     VRELE"
     CDS             786694..787233
                     /codon_start=1
                     /locus_tag="GM3709_695"
                     /product="nuclease"
                     /protein_id="BAQ63930.1"
                     /transl_table=11
                     /translation="MKIFKILLIISSLILFSCGQSEVKNTIVSNNLTTIKYPLYKVKQ
                     GSIYDGDTLRVISNNQELKIRFACIDTREIKQDGGIEDRDFLRSLLAKNNNQVMVHIT
                     DEDKYGRSVAELFLPNGKLVQEIQARAGQAFPYPLYKQDCPNWSKVEQAGLSAKKERL
                     GVWSTNNPEYPWNWRRKNQ"
     CDS             complement(787227..787526)
                     /codon_start=1
                     /locus_tag="GM3709_696"
                     /product="hypothetical protein"
                     /protein_id="BAQ63931.1"
                     /transl_table=11
                     /translation="MIINLIPLRVLSQELDEIVENAVINSPEVQLLEKKIEAIENKIK
                     EYPPLNYSSNPLINKLQSILFYFSPVYKLQQKQNELREELSAVKFGIQENTINSH"
     CDS             787652..788758
                     /codon_start=1
                     /locus_tag="GM3709_697"
                     /product="bipolar DNA helicase HerA"
                     /protein_id="BAQ63932.1"
                     /transl_table=11
                     /translation="MQSPPIKLRTNNDLISVNSLISSGIKLGHNCYWNPESLPNQHIV
                     TIGSSGSGKTQTLKAIAHSTHQYYPTVNIYIIDFHGDQEIEGETYVPLHMSSKYGINP
                     LIINPDPEGGGSNIQSLIVTTTIKQTLQLGSVQEGKLLLLLKELYQLHGIYQNDLTTW
                     SKEPPNFLDLEELIRKLAESGDKDAQKLELKLEATFQYGIFSRPQLPLLSGGGLLRID
                     LSKLPSYIGAIAGESFANQLLVNHKLMGEAEGLRTFIIIDEAKEMPKKDYSALSRIMA
                     DGRKFGLGLIVASQSERHLSADVIGNSATKIVLPVDQTEVKKVSNKFRFAEAKVSNLQ
                     PLHALIRMGKDAIESPIIPYYQRINDENTPSNIC"
     CDS             788896..789636
                     /codon_start=1
                     /locus_tag="GM3709_698"
                     /product="hypothetical protein"
                     /protein_id="BAQ63933.1"
                     /transl_table=11
                     /translation="MNTTTANIPAPEIKRKDKNQEQIERVKEVYELLWYAEEQHGLIT
                     YIDLANYVYEKTGKKISNRVIQRYKIDRSAQLKACGILIAEKKLIIKYLDNPKLLYPE
                     LLIKIKALKPNKVTKRYINILSWIVSIIIVTIGYFSYNYYINLSTQKDKMAVYNETKI
                     SLNNDYTISILNDINKPYSIISGYLFIDDLEDIKNINLMPKGIIIDTEKQLINIDDVP
                     MNQLISFLNGTYSKGQLVIKEIENENEI"
     CDS             789743..790720
                     /codon_start=1
                     /locus_tag="GM3709_699"
                     /product="liver stage antigen"
                     /protein_id="BAQ63934.1"
                     /transl_table=11
                     /translation="MEEDENQPKRLKIDISVSDPLDIKVREGQVIKKGEVISDKTQQR
                     KQLELQLKNTKLALANIKNSIILQPIEPQPVPPQQNLPSANFVEEETTVQSAELEYQQ
                     AQRTLSIALENDPLIAVKGKIQRNQSKVEQGKRELSNQIEKTGIIGNLKNLPPEVLTH
                     EQQKIKQKESELTQQQAEYDLVQAELNQLKENRKLELQSLQDKVSTARAKLELSQAKL
                     QKAKNDRALLEYNHSITVTRRIEEANQAQIAYNRQMQEYQQQVRDKEFKVTQLTDSIG
                     NIEDKLKQIAVVTSPYSGTIRKIKYEKQVDNSIRVTITLSTVNNSGTGN"
     CDS             complement(790841..791128)
                     /codon_start=1
                     /locus_tag="GM3709_700"
                     /product="hypothetical protein"
                     /protein_id="BAQ63935.1"
                     /transl_table=11
                     /translation="MPLASLLPENNNEVKLDIITTDKYSRKVSVVYLPNGEIVQEKQV
                     KEGWAFPYYPYSQDCPVWDKIMSAESIAIDRGVNIYSKGIEKPWEYRKRKN"
     CDS             complement(791281..791454)
                     /codon_start=1
                     /locus_tag="GM3709_701"
                     /product="hypothetical protein"
                     /protein_id="BAQ63936.1"
                     /transl_table=11
                     /translation="MIYNITQNYNKQDFYAINTKENIEKSKENISNFKELNKDNKNII
                     NIKENISNIKEIY"
     CDS             791551..792195
                     /codon_start=1
                     /locus_tag="GM3709_702"
                     /product="hypothetical protein"
                     /protein_id="BAQ63937.1"
                     /transl_table=11
                     /translation="MKKQGILALLSLLAFTPAVFANEIAVKEDNGDIYLSGLPSYQSI
                     QAVYNGIPKVQKKTSNECGFIKLTSSTSTPINLSSDSITFNSNSYALGSVPVSSALTC
                     SNGVLGGTVSGIVQKDGNAVYITGLSPYTDYQVGFNNIPVTRSIKANTCGIAKLSNTD
                     TYNNSAGTIVIKNRETGVTIGTLPAFASIPEAGGPVCRRGTGFFPVGFPTSSNF"
     CDS             792208..792360
                     /codon_start=1
                     /locus_tag="GM3709_703"
                     /product="hypothetical protein"
                     /protein_id="BAQ63938.1"
                     /transl_table=11
                     /translation="MINKLSFTLLFLALNLFCVSVNGQTVIEADTSTVNNPPSQTGGS
                     SGKPSR"
     CDS             792341..793078
                     /codon_start=1
                     /locus_tag="GM3709_704"
                     /product="hypothetical protein"
                     /protein_id="BAQ63939.1"
                     /transl_table=11
                     /translation="MGNLRDKGLNLLILAINFLFPNIVMAFPEVIGVKDDVVYFKGLN
                     PSSNYEAVQPKFVAERKVTADDCGIISLNRTDRYPIFARGNYNDVYLKEIDYWYWWTN
                     YNNSSDYPMLKCSKSGENFIVIGNIWESIDGTGNMSMTVHEDKVKIYHPQLIRPNQRV
                     TVQWFGEWDGTNYSGTNKINKIKADACGLAKLSIKDFKARATAWIPNQFNFSLQQNNN
                     NILSFDPVTTEISTVPFCKNGVLFEPR"
     CDS             793106..794980
                     /codon_start=1
                     /locus_tag="GM3709_705"
                     /product="hypothetical protein"
                     /protein_id="BAQ63940.1"
                     /transl_table=11
                     /translation="MTIRPPRTPTATNDQDRTLGNLLAYQPINNILGSVNNNDKDTYT
                     FTLTESVALDLNYTGANVTYTIYRINQTGAGSSGGSQGKILVKTGLTADDWQNLNLSS
                     GNYEIVFSTASTSFINFSFNLSALPYSTWMDDNDNQSFQVDQIWSGWREFIGQGDLSD
                     IHTINFNEGYRLQIVNSTANLNLTLKNNDGSIFAQINNIEGDYEWILPSNSTAKTLEI
                     TSNSDGYYSMALFEDYNYSPNPTTGLSLDWDNSNLDVNESTQSIELTNSWGWIYDAVN
                     EWDEIDTYRITPDSTGYYIISTIQRESDAIFSIVDPVTNEQIWQTDKTSYYYESSSEF
                     ERIELSSLLEGGKEYIFKVTDKSNSYHDDYYEVLFHKDIWRDNYFNISPEYAFDLTNY
                     EGMELRDINGWGNVSRNYNGVYYTEYYIDYFTIDFEGGLLELNLQQINSFNNHIALNI
                     LDENNNYIGSTADSKIFKLSTGTYQILISPGGTTIGDVGINYNLSWNNLGEAPQQLPD
                     IYETNDWDNPYDLTDLLTGGQFTVNANLNNDDDDFYKITNTNYTQLNLDLLFNVPDGD
                     YFIEIYDTNLDYITGYYDNNYSNNINLSIEQGDYYIGVYYNEQTFFEDNNYQLSIDLS
                     "
     CDS             complement(794977..795438)
                     /codon_start=1
                     /locus_tag="GM3709_706"
                     /product="hypothetical protein"
                     /protein_id="BAQ63941.1"
                     /transl_table=11
                     /translation="MKGFTLFEVVISIVIVGILVSVGVASLNRSERELKEDFNTLISQ
                     IRLAQELGNKRSQGCRVTTNPFTAIQPDGGNCYIEFPEIRDHVVVNNITLDFNFEGIL
                     PEDSEILIVESTKNNTKYCAMWGTLGIMRTGIIENGECINTENLKYDNNSY"
     CDS             complement(795503..796465)
                     /codon_start=1
                     /locus_tag="GM3709_707"
                     /product="hypothetical protein"
                     /protein_id="BAQ63942.1"
                     /transl_table=11
                     /translation="MSNQWGKGNKRSRYLSKIFIVLILLFPLNFQLWVNAEEEEIDDE
                     NMESVEEIKINENVLNSPDGLDKIIDAKINDDIWESLKGELPCVIADNSCINQLQNLA
                     VNNNYSVKTLEEKIAEVNERIESARSNNQQSILWSQLSP