LOCUS       AP014704             5348274 bp    DNA     circular BCT 16-MAY-2017
DEFINITION  Methylobacterium aquaticum DNA, complete genome, strain: MA-22A.
ACCESSION   AP014704
VERSION     AP014704.1
DBLINK      BioProject:PRJDB3341
            BioSample:SAMD00024788
KEYWORDS    .
SOURCE      Methylobacterium aquaticum
  ORGANISM  Methylobacterium aquaticum
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Methylobacteriaceae; Methylobacterium.
REFERENCE   1  (bases 1 to 5348274)
  AUTHORS   Tani,A. and Ogura,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2015) to the DDBJ/EMBL/GenBank databases.
            Contact:Akio Tani
            Okayama University, Institute of Plant Science and Resources; Chuo
            2-20-1, Kurashiki, Okayama 710-0046, Japan
REFERENCE   2
  AUTHORS   Tani,A., Ogura,Y., Hayashi,T. and Kimbara,K.
  TITLE     Complete Genome Sequence of Methylobacterium aquaticum Strain 22A,
            Isolated from Racomitrium japonicum Moss
  JOURNAL   Genome Announc 3, e00266-15 (2015)
  REMARK    Publication Status: Online-Only
            DOI:10.1128/genomeA.00266-15
COMMENT     ##Genome-Assembly-Data-START##
            Assembly Method       :: Newbler v. 2.7
            Genome Coverage       :: 47x
            Sequencing Technology :: 454 GS FLX; ABI 3730; Illumina PE
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..5348274
                     /culture_collection="NBRC:FERM BP-11078"
                     /db_xref="taxon:270351"
                     /mol_type="genomic DNA"
                     /organism="Methylobacterium aquaticum"
                     /strain="MA-22A"
     CDS             15..1517
                     /codon_start=1
                     /gene="dnaA"
                     /inference="similar to AA sequence:RefSeq:WP_012634292.1"
                     /locus_tag="Maq22A_c00005"
                     /note="441d0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="chromosomal replication initiation protein"
                     /protein_id="BAQ43525.1"
                     /transl_table=11
                     /translation="MRVDGSLAEGVGSGRGGNGDDGRTSGTADIAGAWQRVKRRLRAE
                     LGEDVFASWFARLELQDVSGGVARLTVPTRFLKSWIESHYIDRVLATFRSEADGIESL
                     EVGVRGAMAPARPGAAAAAKPAPAPRPAASAGLAAELPEPERQARGAAPEGDLGGAPL
                     DARLTFESFVVGRSNALAHAAAERVARHDGGPALYNPLYFHAGVGLGKTHLLHGIGHS
                     VKNAGRRVIYLTADRFMYGFVNALKTQSALAFKEKLRAIDVLILDDVQFIQGRSIQAE
                     FGHTLNALIDAGRQVVVAADRPPTELEALDERVRSRLAGGLVVEIGTLDEALRASILQ
                     SRLEAVRASHPAFEVGPAVAEYVAKAITANGRDLEGAVNRLLAHATLTGAPVTLDTAE
                     TAIRDLVKNREPKRVKIEDIQKLVASRYNVSRSDILSERRTAAVVKPRQIAMYLSKVL
                     TLRSLPEIGRRFGGRDHTTVLHAVRKIEKAIGEDTALCDEVELLKRMLQD"
     CDS             1695..2816
                     /codon_start=1
                     /gene="dnaN"
                     /inference="similar to AA sequence:RefSeq:WP_012330008.1"
                     /locus_tag="Maq22A_c00010"
                     /note="441d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="DNA polymerase III subunit beta"
                     /protein_id="BAQ43526.1"
                     /transl_table=11
                     /translation="MKVTVERAALLRSLGHVHRVVERRNTIPILSNVLLRSGPDGLQL
                     KATDLDIEVTETIPADVVDGGAITVPAHVIYDIVRKLPDGAQVSLETSGETGQMLIRS
                     GRSRFTLGALPEGDFPDLAAGELPHRFELPAADLKRLIDKTQFAISTEETRYYLNGIF
                     FHTIDAEGSLKLRAVATDGHRLARVQMEAPEGSGGMPGIIVPRKAVAEIQKLVEDGGE
                     TVGVEISSAKVRFSFSSGVTLISKLIDGTFPDYARVIPTGNDKRLTVERDQFAKAVDR
                     VSTISSERGRAVKLAMTDGRLSLSVNNPDSGSATEELDVDYESGPLDIGFNARYLLDI
                     TAQLDGDTALFRLADPGSPTVIQDREGAPALYVLMPMRV"
     CDS             3079..4224
                     /codon_start=1
                     /gene="recF"
                     /inference="similar to AA sequence:RefSeq:WP_012330009.1"
                     /locus_tag="Maq22A_c00015"
                     /note="441d0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="recombinase RecF"
                     /protein_id="BAQ43527.1"
                     /transl_table=11
                     /translation="MTEPDPLRVTRLIARDFRNHADLDLAVGRHFVALVGENGAGKTN
                     ILEALSLFAPGRGLRRADFAGMAREGGAGGFAVSLTLEGPNGDHRIGTAWEPPRGRDE
                     RGGRLCRIDGATAPSPTAFAEQVRVVWLTPDLDALFRGPAGDRRRFLDRLVLAVDAGH
                     GARVNAMERALRSRNRLLEERPDDGPWLDAVEREVAELAVAVALARRETVERLDSLIL
                     STRDEASPFPWAGVRLEGDIDDLVAVWPAVDAEDRYRAILRQNRFRDRAAGRTLAGPQ
                     ASDLVVRHGPKDVPAATASTGEQKALLIGLVLAHARLVTGMSGLSPLVLLDEVAAHLD
                     PRRRAGLFDALEALPGQVWMTGADPALFGELGERADMVQVAEGSVRV"
     CDS             complement(4231..4632)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012318129.1"
                     /locus_tag="Maq22A_c00020"
                     /note="441c0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="twitching motility protein PilT"
                     /protein_id="BAQ43528.1"
                     /transl_table=11
                     /translation="MFVDASAIVAILLEETGATDLTNQIDAASDPVTSTLAVFEAVTA
                     ISREAGLSVEDADRQVRGFMTIGRIGLVAVAEAEVNGALLAYARYGKGRGHPARLNLG
                     DCFAYACAAVRGLPLLFVGNDFSRTALPPTL"
     CDS             complement(4632..4871)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012251834.1"
                     /locus_tag="Maq22A_c00025"
                     /note="441c0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="transcription factor"
                     /protein_id="BAQ43529.1"
                     /transl_table=11
                     /translation="MSLNIRSQEVNRLADKLATMAGVSKTEAVRLALAAEIARREESV
                     PLVERIKPIQDYIASFPRTGLKADKAFFDDLNGEP"
     CDS             4958..6802
                     /codon_start=1
                     /gene="recQ"
                     /inference="similar to AA sequence:RefSeq:WP_012330010.1"
                     /locus_tag="Maq22A_c00030"
                     /note="441d0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="BAQ43530.1"
                     /transl_table=11
                     /translation="MTNRLDEARAALRKTFGYEDFRPGQAEVIGAVLDGRDVFAVMPT
                     GSGKSMTYQLPALVEESLTVVVSPLIALMHDQVKQMEAFGIAAGTLNSSVSESSARET
                     WRGIRQGSLRLLFVSPERLLMDGLIEALQGAGVRRLAVDEAHCVSQWGHDFRPEYRDL
                     ARAREALGDVQTVALTATADAATRADISERLFPRGRKPELFVHSFDRPNIRLTFAPKE
                     HPTRQLSRFLRPRKAESGIIYCSSRKRTEQIAEILQQDGFNALAYHAGLEQSVRMRNQ
                     DTFLQEDGVVVVATIAFGMGINKPDVRYVCHADMPSTIESYYQEIGRAGRDGLPADTL
                     TLYGLDDMALRRRQIDEKEVPDDRRRVERRKLEAMIGLCEGATCRRQSLLGYFGEQSE
                     RCGRCDLCRGGVSLIDGTVAAQKVLSAVVRTGQRFGAAYICDLVHGKESEQIRRNGHV
                     QLKTFGVGSDKPVAAWRAILRQLFAAGAVAENGDGYGGLSLTDKGEAILFGREPVQLR
                     PDPEPKAPKERRRATQDDDTLGLSDTDEALFQHLRGLRATLARQEGVAAYMIFPDRTL
                     IEMARAKPVDLWALRSVHGVGERKRHAYGQPFVEAVAEFLADAAKRAG"
     CDS             complement(6997..8031)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015821600.1"
                     /locus_tag="Maq22A_c00035"
                     /note="441c0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="GTPase RsgA"
                     /protein_id="BAQ43531.1"
                     /transl_table=11
                     /translation="MCRRVTDLPHSLPPAPLASLGWLTFFEEQREPHEAELAPVRIAM
                     VHRSRLSALSEAGSVELTLPVHTNTGDFAVGDWVLVDPRTRMLHRRLTRRTVLERRVE
                     GSRTLQPAAANVDTLFIVTSCNADFNQARLERYLALANQGGTNPVILLTKADMAADAD
                     VYHRQAAELQRGLDVVTVNPRLPEAARTLASWCGVGQTVALVGSSGVGKSTLVNTLAG
                     PGQARPQETGGIREHDVKGRHTTTARSLHAIAGGGWVIDTPGMRTLHVSGATEGIATL
                     FAEITELAHSCRFRDCTHAHEPGCAVQAAVADGTVNPERLTRWRKLLDENHDNTPAFT
                     GPRGRRSAGG"
     CDS             complement(8271..8573)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015928201.1"
                     /locus_tag="Maq22A_c00040"
                     /note="441c0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43532.1"
                     /transl_table=11
                     /translation="MTPAAAIDRARALLLAEGFSEVGQGTRGESFYFGLPGAEGQVRV
                     ANHARTPKQRLKHPEVVASLVVTGPLSEAALRERLSATLRDFRGRQERPTMAITPH"
     CDS             complement(8570..9340)
                     /codon_start=1
                     /gene="ftsJ"
                     /inference="similar to AA sequence:RefSeq:WP_012330639.1"
                     /locus_tag="Maq22A_c00045"
                     /note="441c0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ribosomal RNA large subunit methyltransferase E"
                     /protein_id="BAQ43533.1"
                     /transl_table=11
                     /translation="MSDRRGGGLRGDLKQRVKTGRGRTVSSKLWLERQLNDPYVARAK
                     REGYRSRAAFKLTEIDERFRLLKPGQRVVDLGAAPGGWSQVAAAKVGSHPGASAPRGR
                     VVGIDLLEIEPMPGVDFVTLDFLDPTAPGLLTEMLGGPADVVMSDMAANATGHKKTDH
                     LRIMGLAETALAFAREILAPGGTYLAKVLQGGTEGGLLTDLKRDFSNVRHVKPAASRA
                     DSSELYVLATGYRGAEATDGPYRETEDGGEEDEAGWRP"
     CDS             complement(9556..10665)
                     /codon_start=1
                     /gene="gppA"
                     /inference="similar to AA sequence:RefSeq:WP_015928204.1"
                     /locus_tag="Maq22A_c00050"
                     /note="441c0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="exopolyphosphatase"
                     /protein_id="BAQ43534.1"
                     /transl_table=11
                     /translation="MRDETAVSVPARAAEYAETARATAPPPDPAGVDPPRRPDRRAYA
                     ALDLGTNNCRLLIAEPAPYGFRVIDAFSRIVRLGEGLGTTDRLSDDAVERTVDALAVC
                     LGKMRSRGVVRSKSIATEACRLAVNGAAFVDRVHREVGLDLEVVDRRTEAYLAVTGCA
                     ALADRHAESVVIFDIGGGSTEIIWLDGSAALARSADPTLRIRAWDSLPVGVVTLAERY
                     GGADVTRPVFEGMVEEVADRLTKFALIAGAAAHAPNFHLLGTSGTVTTLAATHLRLPR
                     YDRRRIDGLWMRDREVTDAIDGLLSTRLSDRAQNPCIGRDRADLVLAGCAILEAIRRA
                     FPSERLRIADRGLREGLLMNMMREDGVWRRGGRPS"
     CDS             complement(10849..11712)
                     /codon_start=1
                     /gene="tauB"
                     /inference="similar to AA sequence:RefSeq:WP_012334239.1"
                     /locus_tag="Maq22A_c00055"
                     /note="441c0007"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="sulfonate ABC transporter ATP-binding protein"
                     /protein_id="BAQ43535.1"
                     /transl_table=11
                     /translation="MTAQVKTATAPLRRAEPAARPGPGAAEIAIENASKVFGTGEGAV
                     VALDGVSAAIPGGQFVCLLGPSGCGKSTLLNAIAGFSPLTGGSIRMNGRPVVDPGPER
                     GMVFQEYALFPWMTVEQNIRFGLDIKGVARSEADAVVARIAQKLGLSDFLGRFPKDLS
                     GGMRQRVAIARILALDPPVMLMDEPFGALDALTRRTLQDELLRIWAEYRKTIVFVTHS
                     IEEAIYLADRIVVLTYRPGRMKRDLIVPLARPRDTASAEFNALKRELAGLVMEEQQRF
                     TQAELTGSAVD"
     CDS             complement(11715..12527)
                     /codon_start=1
                     /gene="tauC"
                     /inference="similar to AA sequence:RefSeq:WP_012334238.1"
                     /locus_tag="Maq22A_c00060"
                     /note="441c0008"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="sulfonate ABC transporter permease"
                     /protein_id="BAQ43536.1"
                     /transl_table=11
                     /translation="MNRLSAFRGALLPVGLLILWEAASRAGLFSAVVLPPPSAVASRW
                     IASLVPALPYDPATQSYAAWLFSGELPHDAVASLGRVIAGFAIGVGLALPVGLLMGTS
                     DRLYALVNPLLQILRPIPPIAYIPLAIVWFGLGNPPALFLIALGTFFPVLVNTVAGVR
                     QVDSIYIRAARNLGANSWTMFRRVILPAASPFVLAGMRIGIGTAFIVVIVAEMIAVSD
                     GLGYRILEAREYMWSDKIIGGMLTIGILGLVIDGAMSRLNDHLLRWHRGLER"
     CDS             complement(12537..13520)
                     /codon_start=1
                     /gene="tauA"
                     /inference="similar to AA sequence:RefSeq:WP_015931611.1"
                     /locus_tag="Maq22A_c00065"
                     /note="441c0009"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="myristoyl transferase"
                     /protein_id="BAQ43537.1"
                     /transl_table=11
                     /translation="MLKRLAAVAAAALAAISGPAAAQDVVRLGNLKFAHYGAISYMKE
                     IAGKYNLKIDEKQFAKGADIYPAMAVDQIDIAASGADGAVAARGNGVKLLVVAGFANG
                     GVRILGRPDLGAKTLADVKGKKVAVVRGGTQDLMLLAELEKNGITWSERPGKDVQLVY
                     FNNYADLNQALAQKYVDVICQSEPQSTQAISNGWGYEIVKPYDTPVGVPYRPLVMTEK
                     MYTEKPEIAARVLKLFVEATKTFIEKPDLAEKYVRETVFKGQLSSKDFRDSMENADYT
                     YDMPAGHMQVTADLMHKYGLGKMVNPPKGDAEWVKLDLLEKAKAELGAKTN"
     CDS             complement(13693..14172)
                     /codon_start=1
                     /gene="cheY"
                     /inference="similar to AA sequence:RefSeq:WP_012330635.1"
                     /locus_tag="Maq22A_c00070"
                     /note="441c0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="response regulator receiver protein"
                     /protein_id="BAQ43538.1"
                     /transl_table=11
                     /translation="MIATPTFPDLSALVVDESLYIRRIVRDMLMRVGIKRLLEAPDGA
                     EALGVLAESKPDLVVLDWDLAILSGEEFIRLARTPATSPAPTVPIILMLAQPRRNVVD
                     RAINLGVNEIIAKPFSPKTLWSRLDEVINRPRPFSQVKSLLRPQPRLAAAAAVKGLL"
     CDS             14318..15028
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_019400194.1"
                     /locus_tag="Maq22A_c00075"
                     /note="441d0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="Ala-tRNA(Pro) hydrolase"
                     /protein_id="BAQ43539.1"
                     /transl_table=11
                     /translation="MSTTLLFRDDAFLREADARVVAADETGVVLDRTVFYAQGGGQPG
                     DRGRIVREDGRAITVADTVYGADKSTVLHKVAPTETLPRPGEAVRLVLDWPLRHARMR
                     VHTALHLLSVALPYPVTGGSIGDGEGRLDFDIPDAGLDKEEVTGRLREMIARDAAVST
                     RWISDAELLANPGLVKTMSVKPPMGSGRVRLVAIDGLDLQPCGGTHVARTGEIGSVTV
                     TAIEKKGKQNRRVRIALA"
     tRNA            complement(15079..15155)
                     /anticodon=(pos:complement(15119..15121),aa:Met,seq:cat)
                     /inference="profile:tRNAscan-SE:1.23"
                     /locus_tag="Maq22A_c00080"
                     /product="tRNA-Met"
     rRNA            complement(15200..15315)
                     /locus_tag="Maq22A_c00085"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /product="5S ribosomal RNA"
     rRNA            complement(15417..18227)
                     /locus_tag="Maq22A_c00090"
                     /product="23S ribosomal RNA"
     tRNA            complement(18497..18572)
                     /anticodon=(pos:complement(18537..18539),aa:Ala,seq:tgc)
                     /inference="profile:tRNAscan-SE:1.23"
                     /locus_tag="Maq22A_c00095"
                     /product="tRNA-Ala"
     tRNA            complement(18613..18689)
                     /anticodon=(pos:complement(18653..18655),aa:Ile,seq:gat)
                     /inference="profile:tRNAscan-SE:1.23"
                     /locus_tag="Maq22A_c00100"
                     /product="tRNA-Ile"
     CDS             18784..19041
                     /codon_start=1
                     /locus_tag="Maq22A_c00105"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43540.1"
                     /transl_table=11
                     /translation="MTPYEERTGEPIVLTNSILRKEVIQPQVPLRLPCYDFTPVADPT
                     VVACLLAVGAAPSGKTNSHGVTGGVYKARERIHRGMLIHDY"
     rRNA            complement(18830..20328)
                     /locus_tag="Maq22A_c00110"
                     /product="16S ribosomal RNA"
     CDS             complement(20733..21884)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015933655.1"
                     /locus_tag="Maq22A_c00115"
                     /note="105c0001"
                     /note="catalyzes the removal of N-terminal amino acids
                     from peptides and arylamides; generally Co(II) however
                     activity has been shown for some methionine
                     aminopeptidases with Zn, Fe, or Mnin Bacillus subtilis
                     the protein in this cluster is considered non-essential;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology. Start codon location
                     was manually corrected by using GenomeMatcher"
                     /product="ceramide glucosyltransferase"
                     /protein_id="BAQ43541.1"
                     /transl_table=11
                     /translation="MTGTGLAAIICLALTVINLASLAIALRRLGRPDPASAGLQDAPV
                     TVVRPVCGLETYSEETLGSGFRLAYPHYELIFCVARATDPIVPLVERLIAMHPGVPAR
                     LIVGDERVSDNPKLNNCIRGWDEARHDWIVLADSNVLMPEDYIQRLRAAWRSDTGLVC
                     STPVGTRPGSFWAEVECAFLNTLQARWQYVGEALGLGFAQGKSMLWYRPLLETQGGIR
                     ALAAEIAEDAAATKLVRAMGRKVHLVASPFAQPLGPRRGAEVWSRQLRWARLRRVTFS
                     LFFAPEIGTGAVIPMLAAYPAAGGGLAGLAAMLGTAAAWYGAEWRLAARNGWPWSWRF
                     PLACLARDLLFVPIWLAAWVARDIVWRGNAMEIRTKPARLVADAPAALP"
     CDS             22089..24176
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015933656.1"
                     /locus_tag="Maq22A_c00120"
                     /note="105d0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="peptidase S9"
                     /protein_id="BAQ43542.1"
                     /transl_table=11
                     /translation="MPHQPDPRPTLQAPDDDPYLWLEEVDGARALAWVEAQNADTLAA
                     YADGRYAADRDGLKAALDRPDKIPGVTRRGGLLYNLWQDAGHPRGLWRRTTEGEYRKA
                     DPAWEVLLDLDALARDEGQDWVWSGAASLPGSHARALVQLSRGGGDATVVREFDLETR
                     SFVADGFSLPEAKSIPVWLDPDTLLLASPLGGPEHATPSGYARTVRLWRRGTDPLDAP
                     VIFSAGPASMVAYGYPDREANPERLVFAERTGFFDGTIQLGDRTGPKTRLDIPTDADA
                     HWHRGFLAIRLRTPWAVGGTTHPADGVLGIGLDAFLEGARDFQVLFTPGPRRALQGFF
                     WTGGHLVLSILDDLKAVFPVFTPSPSGWAEGRVAGLPELGVVSVWSMDGEEEESNGDL
                     MVAANDPVTPSTLLTTRPDLAAPTLLKQAPALFEADGMVVTRHEAVSSDGERIPYVQA
                     GPAGETGEAPVHLSGYGGFQVTNLAGYSAVLGRLWLAKGGTRVVANIRGGGEFGTRWH
                     EAGRREGKALTHDDFAAVAADLVRRGVTTPGRIAAEGGSNGGLLIANMLTRYPERFGA
                     LFCTVPLIDMRRYTKLLAGASWIAEYGDPEIPEDWAFLQHISAYHVAEAGKPYPPILI
                     ATTRRDDRVHPGHARKMAAKLQALGYDARFYEPEAGGHSHGKNSAETAAFAALGAAFL
                     RRAIGWEPEVAGA"
     CDS             24380..25054
                     /codon_start=1
                     /gene="erfK"
                     /inference="similar to AA sequence:RefSeq:WP_012331736.1"
                     /locus_tag="Maq22A_c00125"
                     /note="105d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="uncharacterized protein conserved in bacteria"
                     /protein_id="BAQ43543.1"
                     /transl_table=11
                     /translation="MRAACLAVTLCVAGATLGAGEARAGILIAVDKATQRMTVTRDGR
                     ALYDWPVSTGMAGYNTPRGTFSPSRMAADYRSREWDDAPMPHAIFFTGRGHAIHGSGH
                     TGRLGTPASHGCVRLAPGKAATLFALVKAEGMGNTRVVIGGDETALAGRASPRREARR
                     DRLERDGFAQDGLYAQNGLYADAPVARPRRGRSADPWGDASWQPAGGAYPPAYGGTYY
                     TVVPGY"
     CDS             25165..25926
                     /codon_start=1
                     /EC_number="3.4.11.18"
                     /gene="map"
                     /inference="similar to AA sequence:RefSeq:WP_012752296.1"
                     /locus_tag="Maq22A_c00130"
                     /note="105d0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="methionine aminopeptidase"
                     /protein_id="BAQ43544.1"
                     /transl_table=11
                     /translation="MAMTVSSDDELEALRRIGRIVADALEAMGRAIEPGITTAELDRI
                     GRAHLERAGARSAPEAVYGFPGATCISVNEEVAHGIPGERRIAPGDLVNIDVSAEKDG
                     WFSDTGASFAVPPVTRAVERLCRDGRRAMWTGLRQVGTGKPLAGIGRAVGAFAQKNGY
                     TLVRNLASHGIGISLHEEPTEIATWPDASERRIMTEGLVFTVEPFLSLGADYAESGED
                     DPWTLYSRPRALTVQYEHTVVATRNGPLVLTMPGT"
     CDS             complement(26130..27044)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012330805.1"
                     /locus_tag="Maq22A_c00135"
                     /note="105c0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="bestrophin"
                     /protein_id="BAQ43545.1"
                     /transl_table=11
                     /translation="MIVRPRPGALAILFAWRGSILPQIAPQVTAITAVACLVVATEQG
                     WAHAIPLTAGIGPFTLIGLALSIFLSFRNNACYDRWWEARKVWGSLVVEARGLARLLG
                     ALLSEDDARRRRCLERLAGFAHALHARLRGQDDAAAAAPHLPQAERGRLASRASPADA
                     ALSGLAADLAGAMREGTLSDVSFGLLEQKLAGLSGVQAACERIQGTPLPFAYTLLLYR
                     TAWLYCLLLPFGLAASLGWGTPVATALVAYTFFGLDALGDELEEPFGSAANDLPLDAL
                     LRGIDGIVQDALGAPVPPPLSPERYWLR"
     CDS             complement(27181..27747)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_020093948.1"
                     /locus_tag="Maq22A_c00140"
                     /note="105c0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="polyisoprenoid-binding protein"
                     /protein_id="BAQ43546.1"
                     /transl_table=11
                     /translation="MIPFRLALALGLFAAPLAAQAADWTVDPAKSRIGFSGTQVGAPF
                     KGRFTRYDARIDFDPAKPDAGKAVVLIDLTSAETGDKQRDEALPQADWFNTSKDKQAR
                     FEATRFVAKGGDAYDAVGTLTIRGLRKDVTLPFTLTVSGGTAHAVGHLDLVRTDYGVG
                     QGSWANDSMVALQVGVDIDVTASAKSGG"
     CDS             complement(27744..28349)
                     /codon_start=1
                     /gene="cybB"
                     /inference="similar to AA sequence:RefSeq:WP_007565166.1"
                     /locus_tag="Maq22A_c00145"
                     /note="105c0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="cytochrome B561"
                     /protein_id="BAQ43547.1"
                     /transl_table=11
                     /translation="MHTVATPRRYTLVAIVLHWLIALGILVLLGLGLAMTRGPLSPMD
                     RFAFYQWHKSVGLTVLVLMGVRLAWRLFHKPPPLPAAMPKAERRAASAAHLALYSLLL
                     AMPLVGWAMVSASPYNIPTVLYGVIPWPHLPVLPELPNKASVEGVLKLVHSYGAWLLM
                     ALLLLHVGAALRHHLVLRDDTLWRMLPLVRRASAKPEVSSR"
     CDS             complement(28378..28992)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_010687543.1"
                     /locus_tag="Maq22A_c00150"
                     /note="105c0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="polyisoprenoid-binding protein"
                     /protein_id="BAQ43548.1"
                     /transl_table=11
                     /translation="MKLSVLALGLAAGLALAAPAVAQGAATRDPAQIQAGTYVVDPNH
                     TQALFTVNHFGFSPYTGIFSDVSGSLELQPAKPAESRLKVTVPVKSLYAPSQHLVDSL
                     KSDKWLDVAQFPEMTFTSTKVTPEGKDKAKVVGDLTLHGVTKPVTLEVTLVGAGANPM
                     NKKVTVGFEAKGTIKRSDFGVKTFVPAISDEVHLVLNGAFERKD"
     CDS             29118..30050
                     /codon_start=1
                     /gene="lysR"
                     /inference="similar to AA sequence:RefSeq:WP_012321319.1"
                     /locus_tag="Maq22A_c00155"
                     /note="105d0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BAQ43549.1"
                     /transl_table=11
                     /translation="MVAGSETFRGALSDVRAFCAVVDHGTVTQAAEILGETKGSISRR
                     VSRLERELGVTLLARTPRAVSATVEGLAFHAKAQESLALLDGALETARDARTLPRGHL
                     RVTTSIDFGIEVMPDLVASFRARYPQVTIDLLITDTRLDLAANRIDLALRLGSGEGQD
                     GGYRAPVLAHLMIGLYAAPAYLSARGAPATLDDLAGHDLILSRERLGAAPVRLSDGQG
                     REGHITARPAVRATDYATVLRLTRAGAGIGHIPSLVAAQALRDGALVPVLPDWASRGG
                     VLRAVSLAGRELPARVRLFRDHVRLGLAAMREAA"
     tRNA            30131..30222
                     /anticodon=(pos:30165..30167,aa:Ser,seq:gct)
                     /inference="profile:tRNAscan-SE:1.23"
                     /locus_tag="Maq22A_c00160"
                     /product="tRNA-Ser"
     CDS             complement(30550..31992)
                     /codon_start=1
                     /EC_number="2.7.7.13"
                     /gene="manC"
                     /inference="similar to AA sequence:RefSeq:WP_015927602.1"
                     /locus_tag="Maq22A_c00165"
                     /note="397c0001"
                     /note="capsular polysaccharide colanic acid biosynthesis
                     protein; catalyzes the formation of GDP-mannose from GTP
                     and alpha-D-mannose 1-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /product="mannose-1-phosphate guanyltransferase"
                     /protein_id="BAQ43550.1"
                     /transl_table=11
                     /translation="MAFENERSIHPVILCGGSGTRLWPASRESFPKQFIPLAEPERSS
                     FQATAARLGDPAVLARPTVVTANDARFLVAEQLAQGGIEADILLEPCRRDSAPAVAVA
                     ALHAAARDPQALVLILPADHAVGDDAAFVAAVRAAGAGARAGHVMTLGITPTNPSTAY
                     GYIQPGAPLAGAAGEGGACAVARFLEKPDAARAAALIADGALWNGGYFLFRADVMLDE
                     LEAHAPAVLAAARDALEGATRDLDFVRLDAEAFARAPQISIDYAVMERTERAGVLPVR
                     FPWSDIGTWGALWEVSDRDGDGNAVRGRVALRDTRDSLVHSSGGILTTVVGLEGVVVV
                     TTEDAVLVTGRTAGAEVKGLVEDLRRRGEPEADAHRLMYRPWGSYRRIDIGGRFQVKR
                     ITVKPGGRLSLQKHHHRAEHWVVVRGTAEVTVDGVVRLVHENEAAYLPIGCVHRLANP
                     GKIPLELIEVQVGSYTGEDDIIRIDDVYGR"
     CDS             complement(32376..32918)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927009.1"
                     /locus_tag="Maq22A_c00170"
                     /note="281d0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="cytochrome B561"
                     /protein_id="BAQ43551.1"
                     /transl_table=11
                     /translation="MTLRATYAPSQKALHWAVAALVLVLVPMALAMANWPDGAVKNAL
                     YEWHKSVGLTVLALALARLLVRAARGAPPFVAGLPAWQRRAARASHLALYVLIVLVPL
                     LGWAGTSACCAPVMLYFTLPLTLPVSGGMPVGEAILKVHQVAAFTLVALALLHAGAAL
                     HHHLVRRDGTLRRMGWGKAG"
     CDS             33100..34218
                     /codon_start=1
                     /gene="ribA"
                     /inference="similar to AA sequence:RefSeq:WP_012332227.1"
                     /locus_tag="Maq22A_c00175"
                     /note="281c0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="GTP cyclohydrolase"
                     /protein_id="BAQ43552.1"
                     /transl_table=11
                     /translation="MMSVTMKSSSILDPAAGRDQIDVERALAEIRAGRPVALRGRDPV
                     LALSAEALDDTTTALLAPLAGTGARLVLPAPRLRRLGVPGRTEPGAVALSALDPARIE
                     TLALRLDGRIDAPVAPASPGDEAALALMALAQVLPAVLVVPGEAAPPGTLSVEAGAVA
                     RYPARQAAALRPVSRAPVPLAGAPDSEFVVFRGGEGLRDQVAVVIGRPDLSEPVAVRL
                     HSACLTGDLFGSLKCDCGDQLRGTAGWMAQHGGGIVLYLDQEGRGNGLANKIRAYDLQ
                     ARGLDTYEADEALGFGLDQRRFDFAAAMLTALGVTRVRLVSNNPEKAASLEAAGLTVV
                     ETQRALGRITPENIRYLTAKRDRAGHALDLDAFACSEA"
     CDS             34358..34855
                     /codon_start=1
                     /gene="bfr"
                     /inference="similar to AA sequence:RefSeq:WP_017484938.1"
                     /locus_tag="Maq22A_c00180"
                     /note="281c0009"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="bacterioferritin"
                     /protein_id="BAQ43553.1"
                     /transl_table=11
                     /translation="MKGDAKVVEYLNRGLRSELTAVSQYWLHFRMLNDWGYIDLAKFW
                     RKESIEEMNHADRFVDRILFLEGFPNLQELDPLRIGQNVQEIIECDLAAEVEARSLYL
                     EAAKYCDSINDRVSKQLFEDLAADEEGHIDFLETQQELIRQVGLPLYAQRHIGGLEKI
                     EPEVE"
     CDS             complement(34889..35134)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012330633.1"
                     /locus_tag="Maq22A_c00185"
                     /note="281d0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="BAQ43554.1"
                     /transl_table=11
                     /translation="MIVCSCNVLSDGQVRACLNPGPGCPRTPAQVYACLGCSPKCGRC
                     ARTIRGILDRALADTHAACTTTCGAACTLKELEEAAA"
     CDS             35409..37970
                     /codon_start=1
                     /gene="baeS"
                     /inference="similar to AA sequence:RefSeq:WP_012330632.1"
                     /locus_tag="Maq22A_c00190"
                     /note="281c0008"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="histidine kinase"
                     /protein_id="BAQ43555.1"
                     /transl_table=11
                     /translation="MRGRDDRTMSRHVDSTEREAADRQGAAGRDSGRHDSGGLASGGR
                     DLAEQGLVDTGRLARTVCGTAYAMVLRPGVPACGPLPPGLIPDEAAILGRLAGDETIV
                     VADLTRDPRTAELSAVAGSPALRFLAGLVIAGRDGRPLGALCVLDTAARPDGLSAEAA
                     AALVALGRQAAREIGFHADLAAARADRDGLRSITEAAPALIAALDRDEICRFANGNFS
                     RWFGRAPAETVGRSLREILGEAAYAARRPFLARALAGETVSFEAPHPGADGRHALVRY
                     VPRRGPDGGIADLQLLGVDITAEKEARAALADSALKFRAIAESMPQMVWSTLPDGYHD
                     YYNPRWYEFTGMPEGSTDGEGWNAIFHPAEQPEAWRRWRHSLATGEPYEIEYRLRRRD
                     GVYRWVLGRAMPIRDPATGAIERWFGTCTDIDDQVRARETLSQRREALEAEVAERTAA
                     LAEANARLTAEIEERTRIEEALRQSQKMEAVGQLTGGIAHDFNNLLTGIVGSLDLMQT
                     RINEGRTQNLTRYAGLAMASAQRAAALTHRLLAFARRQPLEARAVDANRLVSSMDELM
                     RRTLGERVQLEVVVAGGLWLTLCDPNQLENAILNLCINARDAMPEGGRLTIETANAHL
                     DDAYVASEIGVRAGQYVCVSVTDTGTGMPPDVIARAFDPFFTTKPIGEGTGLGLSMIY
                     GFAKQSDGHVRIYSELGQGTTVKLYLPRHLGRIADEPAPTAGLPVPRAEHGETVLVVE
                     DDATVRALVGETLTELGYRVIEAPDGQTGLRILEAPGRIDLVVTDVGLPGLNGRRMVD
                     EALAARPRLRVLFITGYAENAAFGNGHLAPGMRMITKPFAIDAFAAKVRAMIEPG"
     CDS             38130..39881
                     /codon_start=1
                     /locus_tag="Maq22A_c27705"
                     /note="281c0007"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="signal transduction histidine kinase"
                     /protein_id="BAR47047.1"
                     /transl_table=11
                     /translation="MPQPPLRVFLALGLGTVGLVATLVLALVASRVASQRLEARIEAE
                     LADVAGMMAGRLDRGLFERWRDIVILAENDTIRDPAAPLARKRRVLWRAQETYPDYAI
                     IGLVGVDGRIQATSTGALEGAEAGHREYFTNGRHSPFVGDVHDVVLLATIDPHHDPAD
                     PPRVLDIAAPVRDDAGQLVGVVSGHLDWAWARAAEASLRETTGTPRDLAIMVLARDGT
                     VLLGPEGLRRTRVPAELPSVAGARDGRSGTETETWPDGRRYLTGFRPTRGYRDFPGLG
                     WTVLVRQDAGTAFASVTDLRRQILLWGLVVATVAAGIGWFAAGLLARPLRRLAIAASA
                     LGRGEAVTVPGSAVREAQAISHALTAAARALAREEEERRAADARQDLLIHELNHRVKN
                     TLATVQSMARQTARSAASLADFTGSFEARLLAMSQTHNVLTANHWEGAGLSGILSAEL
                     EPYAGGRADRIRLEGPPVSLTPAVALPLGMAIHELATNAAKYGALSAEAGQVAVEWSL
                     EGRAGTGTLVLRWRESGGPAVVPPSRTGFGTRLIRASLERELAGEVALHYAEGGLVCR
                     IAVPLAVSAQTARTEAA"
     CDS             complement(39904..40314)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015928208.1"
                     /locus_tag="Maq22A_c00200"
                     /note="281d0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43556.1"
                     /transl_table=11
                     /translation="MDYVCDVPGGKTWFRIETEAEAIRESALMGHAVEKHFRQAQSRA
                     EASYVPPAGGPFVEERIGLKGHLARTMPRFFTLRDAEGSGLATAMVPAGAGCPIVVGI
                     GNADPYVAHEEAIRGLGTHLGIPLERSRCYPYGR"
     CDS             complement(40421..40669)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012330627.1"
                     /locus_tag="Maq22A_c00205"
                     /note="281d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+. Start codon location
                     was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43557.1"
                     /transl_table=11
                     /translation="MIDHRRRLLSRAALAEEGRITLRRDPDRAWPGDHSRLCALANDG
                     DLLFLGEEPGPLPGGACAAWRITAQGRAALGESPSARP"
     CDS             complement(40969..41127)
                     /codon_start=1
                     /locus_tag="Maq22A_c00210"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43558.1"
                     /transl_table=11
                     /translation="MYSQLRRYGWRPLQAVGHVTLALALLVFGLACVGADLLGGWERA
                     AQLLSGQG"
     CDS             41451..44351
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_020096044.1"
                     /locus_tag="Maq22A_c00215"
                     /note="281c0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="predicted signal transduction protein
                     containing a membrane domain, an EAL and a GGDEF domain"
                     /protein_id="BAQ43559.1"
                     /transl_table=11
                     /translation="MHRAFVCLTAEHTAWAVPLAALVCWFSCHTALHLLEQARPEHGR
                     GSLGWLAGAAFSAGAGIWSTHFIAMLGYDPGVGVSYDPAITLAWLLASIASALAAFAL
                     LRRSRDRTRVIAASLILGLGIAAMHITGLRGVRIQGSFVVDPALAAAAIVAGMVLTYG
                     ALLALPRAADGGALPRARTSGAPPTGQRGRLVGASLLMASGITVLHFLVMAAVQVVPD
                     PQADAVVDSLPHAALAAVIAVVTLAVLGCAALALAADRLRKMNRVLSARTAALVASEE
                     RMRALTDTLPQMVWVMPPDGYTVYTNRRFQALFGPGVSSREQRFASHHPDGREAIAAA
                     WRIAEAEARTFETEARLKDLSGDYRWYKIVMVPVLHDGAVVEWIGTALDIDDMVLAHE
                     ALRESEERLALALDAGSDGLWDCDLRTGEAWTSDRWWQLLGYAPGELPSDTWTWRSLI
                     HPDDRAAVVGLLDRHLAGEIPVFECEHRLQRKDGSWGWFLTRAKVVSRGADGRAMRLV
                     GTHGDIGVRKEAERRIAHMAAHDALTDLPNRTLFRERLEGRLAEITETGGSCAVLCLD
                     LDCFKEVNDALGHLTGDALLQAVAERLGAGLAAGDLAARLGGDEFAVLVASVDGAGDA
                     TARAQAMIRAISRPVAIGDQSVEVGASIGIALAPAHGTDGETILRRADLALYKAKADG
                     RNAARAFETAMDAALAERRLLEADLRHALVRDELMLHYQPQVRSACGRLVGFEALVRW
                     SHPSRGLVPPGAFIPLAEETGLIVPLGEWVLRAACREAAGWAHPLKVAVNLSPRQFQQ
                     ADLPERVRAILAETGLPPERLEIEITETVIINDMARALTVLRRLKALGIGIAMDDFGT
                     GYSSLATLQAFPFDKIKIDRSFVSQLEQRPSAAVIVRAVLGLGRSLGIGVVAEGVETD
                     GQMRFLAEEGCEEMQGYLFGKPQPVERLAGLIARDAAWLRDAGENRMIAAGI"
     tRNA            complement(44523..44597)
                     /anticodon=(pos:complement(44563..44565),aa:Thr,seq:ggt)
                     /inference="profile:tRNAscan-SE:1.23"
                     /locus_tag="Maq22A_c00220"
                     /product="tRNA-Thr"
     tRNA            complement(44683..44757)
                     /anticodon=(pos:complement(44723..44725),aa:Thr,seq:ggt)
                     /inference="profile:tRNAscan-SE:1.23"
                     /locus_tag="Maq22A_c00225"
                     /product="tRNA-Thr"
     CDS             44979..45968
                     /codon_start=1
                     /gene="potA"
                     /inference="similar to AA sequence:RefSeq:WP_012634386.1"
                     /locus_tag="Maq22A_c00230"
                     /note="281c0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="spermidine/putrescine ABC transporter ATPase"
                     /protein_id="BAQ43560.1"
                     /transl_table=11
                     /translation="MDIELISLTKRYGDTVAVDGINLKIRSGSYCCLLGPSGCGKTTT
                     LRMIAGHETVSSGDVVIGPKAVGDLPPAERGTAMMFQSYALFPHLTCRDNVAFGLKMR
                     GVPKAERLKRAEAMLALVQMDHLAGRLPAQLSGGQQQRVALARALVTGPKVLLLDEPL
                     SALDPFLRVRMRTELKRLQGELGITFVHVTHSQEEAMALSDLVVVMNGGRIEQAAAPR
                     TVFERPATAFVARFIGGHNVIALPDRRVAVRADRMRLGPEAGPEAQSARVVAVEYQGS
                     TVHVSLEAPDLAAEAGAPLTAILSDHAFAASPFTLGDTVRVGWPAGEAHRLDA"
     CDS             45997..47280
                     /codon_start=1
                     /gene="potD"
                     /inference="similar to AA sequence:RefSeq:WP_012634387.1"
                     /locus_tag="Maq22A_c00235"
                     /note="281c0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BAQ43561.1"
                     /transl_table=11
                     /translation="MTDTKTPRLSRRTLLQGAGAAAGLAAGSGAITGFPAIIAAEPVT
                     LRYLGTAVNQSGDIARKVKEDLGITIEYIPVVTDEVSKRVVTQPNSFDIVDSEYFSLK
                     KLMPSGNLVGMDARRIKNADKITPVFTKGEVGGKKIGDQGTAPKKVFYLEGQTSTKFA
                     ASPTEWITLIPTTYNADTLGIRPDLIKRPITSWKELLNPEFKGKASILNIPSIGIMDA
                     AMVVEATGDYTYPDKGNMTKAEIDRTMKVLIEAKRAGQFRAFWQDFNESVNLMASGET
                     VIQSMWSPAVTKVRSQGVACTYQPLKEGYRAWATGFGLPKTLTGKKLDAAYDFINWFL
                     SGWAGAYLNRQGYYSAVLETAKAHMEPYEWAFWMEGKPAEKDIKAPDGTIMEKAGALR
                     DGGSFESRMGAVACWNSVMDENTYMVRKWNEFIAA"
     CDS             47277..48254
                     /codon_start=1
                     /gene="potB"
                     /inference="similar to AA sequence:RefSeq:WP_012334457.1"
                     /locus_tag="Maq22A_c00240"
                     /note="281c0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter permease"
                     /protein_id="BAQ43562.1"
                     /transl_table=11
                     /translation="MSTAAARTHALPEAAQAAPAPLPTPLPAPAGLAAATRRQRRLAY
                     WQAMPLGLIFLVFFLVPLALTLVVSFWEYNEYEIIPAFTLQNYADVFEGCLSGGDLCT
                     TFRTYLSTLKFCLLGWAATLTIGFTVAYFVAFHVRSTAMQTVLFLICTIPFWTSNVIR
                     MIAWVPLLGRNGLVNDTLMSLGVIRTPIEGLLYSDFSVVLAFIHLDTVFMIVPIFNSM
                     MRIDRSLIEAASDAGATPWQTLWNVIVPLCKPGIAIGSIFVLTLIMGDFVTVGVMGGQ
                     QIASVGKVIQVQMAYLQFPAAAANAVVLLGAVMVLIAALTRLIDLRREL"
     CDS             48260..49156
                     /codon_start=1
                     /gene="potC"
                     /inference="similar to AA sequence:RefSeq:WP_012334458.1"
                     /locus_tag="Maq22A_c00245"
                     /note="281c0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter permease"
                     /protein_id="BAQ43563.1"
                     /transl_table=11
                     /translation="MRRDGPRPFSFYVLAGFFGLFVLFLYGPTLTILALSFQGPQGGL
                     TFPMNGVSTFWFSRLWAGLGVVDIWAAFRRSLALGLVVMGLTVTIAFFAGLAFRKGFL
                     GQTPLFYVAVASLIVPSIVVSLGIGLEFRLIDEGIKALAARTGWGILQDHGTVMGLFT
                     SALGAHLTWTLPFGLLIMFAVFNRFNPAYEEAARDLGATGPQSLRHVVVPIILPSLVG
                     VALFGFTLSWDELARTSQAIGGRNTLPLELQGLTTTVTTPEIYALGTVTTGVSLLVIG
                     LSFGSFLAIQRRRARRVMVPGR"
     CDS             49334..49540
                     /codon_start=1
                     /locus_tag="Maq22A_c27710"
                     /note="281c0001"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="transposase IS4 family protein"
                     /protein_id="BAR47048.1"
                     /transl_table=11
                     /translation="MLAPLLPAPARTGRSWLWSQRAVLDGILYVLRTGCAWRDLPRLP
                     PGAPCTAGSCAGPKQACSSGWLMP"
     CDS             49513..49803
                     /codon_start=1
                     /locus_tag="Maq22A_c00250"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43564.1"
                     /transl_table=11
                     /translation="MFERLADALTLADRHGGCEHEESERGGCGGLVIAGQPAAATNPA
                     KGAHDHPASRLHRKARLSVLGLDDFDGDGRGRADPLTPVGAIGKAGARNGQN"
     CDS             complement(49702..50187)
                     /codon_start=1
                     /locus_tag="Maq22A_c00255"
                     /note="281d0001"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="transposase of ISMdi17, IS5 family"
                     /protein_id="BAQ43565.1"
                     /transl_table=11
                     /translation="MEVSSGSNLMTQEFHATVPVSWWHSDERRRHADCHPSGAVSQVS
                     CERPEDRPRVGCEAGLTGAILDAQAARSGGVGVEGVRGYDPAKRVVGHKRDALTDTDG
                     RLMMAAVSSADLHDSHGGRRAPARLASVLAVPCPCFADCAYRGERVGTAPAITVEIVE
                     P"
     CDS             49834..50067
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c00260"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+. Start codon location
                     was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43566.1"
                     /transl_table=11
                     /translation="MAVMQVGGRDGSHHQAAVGVGQRIAFVPNDALGGIIAAHALDTD
                     AARARGLRIQDGSCQTGLASDPWAILRPLARDL"
     CDS             complement(51236..51403)
                     /codon_start=1
                     /locus_tag="Maq22A_c00265"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43567.1"
                     /transl_table=11
                     /translation="MGEAKEEVLFHRFYEPGAEGAIDHLYGLGETEEFGVWIADIKSA
                     FVIHTPKSTKI"
     CDS             52137..53588
                     /codon_start=1
                     /EC_number="2.7.7.13"
                     /gene="manC"
                     /inference="similar to AA sequence:RefSeq:WP_015932704.1"
                     /locus_tag="Maq22A_c00270"
                     /note="397c0001"
                     /note="capsular polysaccharide colanic acid biosynthesis
                     protein; catalyzes the formation of GDP-mannose from GTP
                     and alpha-D-mannose 1-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /product="mannose-1-phosphate guanyltransferase"
                     /protein_id="BAQ43568.1"
                     /transl_table=11
                     /translation="MTFDKDCLIHPVILCGGSGTRLWPASRESFPKQFIPLAEPERSS
                     FQATAARLGDPAVFARPTVVTANDARFLVAEQLAQGGIEADILLEPCRRDSAPAVAVA
                     ALHAAARDPQALVLILPADHAVGDDAAFVAAVRAAGAGARAGHVMTLGITPTNPSTAY
                     GYIQPGAPLAGAAGEGGACAVARFLEKPDAARAAALIADGALWNGGYFLFRADVMLDE
                     LEAHAPAVLAAARDALEGATRDLDFVRLDAEAFARAPQISIDYAVMERTERAGVLPVR
                     FPWSDIGTWGALWEVSDRDGDGNAVRGRVALRDTRDSLVHSSGGILTTVVGLEGVVVV
                     TTEDAVLVTGRTAGAEVKGLVEDLRRRGEPEADAHRLMYRPWGSYRRIDIGGRFQVKR
                     ITVKPGGRLSLQKHHHRAEHWVVVRGTAEVTVDGVVRLVHENEAAYLPIGCVHRLANP
                     GKIPLELIEVQVGSYTGEDDIIRIEDVYGRDNS"
     CDS             53903..56923
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c00275"
                     /note="148c0011"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="predicted glycosyltransferases"
                     /protein_id="BAQ43569.1"
                     /transl_table=11
                     /translation="MHFITSGAKEGRWPHPLFNVSFYLQQNPSAATAFEEGLDPLSHF
                     IQVGARAGCSPHLLFDVPWYLQQNPSAAAALEAGLDPLSHFIQVGARAGCSPHLLFDV
                     PWYLQQNPSAAAALEAGLDPLSHFIQVGAREGYWPHPLFNLQWYLEINHNASNAARNG
                     IDPLTYYIENDYQHNRPCHNLFDMVWYKNLYISPANSEQNSIYHFIKTGAVCGNRPCR
                     FGFFNGQEKTIEIRRPEISASTLPLVSIIIVNYNGNKHLFDVICSLKNQTYSNYEIVF
                     VDNASADGSIDTIRSLAPDANIIELDKNHGFAGANNIGLEKSRGEYVVLLNNDTKVEP
                     TWLSELVLAAKKHPEAAAIASKILFWEKFSTLRITSKSKFSVSKLSLLASLKYKKVFV
                     EVGNDEGDIFNPLFIGNSYMLTLKIPVDIDFFCLEISGYEKNSSCTIESQYQKKNFAL
                     SDHSDRFDYKWSKYDKKYARYVVNNAGSYEPQWLKTGDRGFGEYDDVQHNIEQKIDLI
                     CGCSVLIKRYALGLDSLFIDDFVAYYEDSELSRRFRQNGFDLVYCPSSVVYHKHSATS
                     VEKSDFWIKYVQRNRIIYEYLFGDRMLRDHEFEKSMGDLNHYLNWMKSQVEKLTSIEQ
                     RTLNILPSVMDEARQLRSKFSNLLRIEDSSKRVGVYNKYWNTYGGGEAHALNFVSVLQ
                     QYAVVDLISEHDFEIETLSDYFSVNLTRTRKRIITHFDRNLTRDYDLFINTTYMSETP
                     SHAPASYFIVSFPSKTPSEEFLNSYKFIPNSKYTTSWMKKIWGENIRYQTTFPSVSKF
                     LIPSDPMVFDRKKKLLLSIGRFFVAGHSKNQLKIVEIFNKIISNEPNLSDWRLVLAGS
                     INDQEYFDKVTASAAGHNIEIIPNAPFKTVQSLYQEAFIYVHASGIGKDANLEPADFE
                     HFGMTVAEAASNGCIPVVYDAAGPAEIIDLLGHGFTYRTESEFYDRLVSAMKAYDVEE
                     SGSLPRRIGEAARQFHDTVQNSDIALEIDQILSR"
     CDS             complement(54062..54355)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c00280"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43570.1"
                     /transl_table=11
                     /translation="MIDFKIPLKIKKWMWPVTFAGADLNKMRERVEACFEGGRRARVL
                     LQIPGHVEQEVRRASRAGADLNKMRERIEACFEGGRRARVLLQIPGHVEQEVR"
     CDS             complement(55796..56056)
                     /codon_start=1
                     /locus_tag="Maq22A_c00285"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43571.1"
                     /transl_table=11
                     /translation="MSDDTLSSPGQVNRKIVAESLYFEIMLRYEIDHSVLLQNGNEVE
                     SMSLTAAIGIPILIVNADALARIFDPQKVRKFAAKLAGFVHH"
     CDS             complement(57209..57925)
                     /codon_start=1
                     /gene="sapB"
                     /inference="similar to AA sequence:RefSeq:WP_018263243.1"
                     /locus_tag="Maq22A_c00290"
                     /note="148d0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="methyltransferase"
                     /protein_id="BAQ43572.1"
                     /transl_table=11
                     /translation="MAIIQAFQAGEFLNSVLSLFCAFVLGTLIGAERQYRQRTAGLRT
                     NVLVAVGAAAFTDLGMRIGHADGAIRIVAYVVSGVGFLGAGVIMKEGMNVRGLNTAAT
                     LWCSAAVGALSGVDLAAEAALVTAAVLAGNTLLRPLVNAINRIPIDERDAEATYEVRA
                     TTDTDRLSEVRDLLVERLEAAHYPVSEVDVEERGEDEVEVVATLVSTAIEPEEIDAVI
                     ARLGAAEGIRRATWVVRTTD"
     CDS             complement(58025..58675)
                     /codon_start=1
                     /gene="mutT"
                     /locus_tag="Maq22A_c00295"
                     /note="148d0009"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="NUDIX hydrolase"
                     /protein_id="BAQ43573.1"
                     /transl_table=11
                     /translation="MRSLKALAGALTGWSERNGEPRRQVGVLPLRTLPGGEMQVMLIT
                     SRETRRWVVPKGWPMKGLKNYEAAAREAYEEAGLIGRVGRRALGSYFYQKRLKSRDTV
                     LCQVQVFRLEVRKQLKTWPEQHERDCRWFSVPDAAEAVTEAGLAALIRAAGADGAKAK
                     AKVKAAAHAGSAAKDAVAKDASAREASAKRPAAKASTSRESGGKGSAAKGPAGRAP"
     CDS             complement(58997..59458)
                     /codon_start=1
                     /gene="marR"
                     /inference="similar to AA sequence:RefSeq:WP_012332022.1"
                     /locus_tag="Maq22A_c00305"
                     /note="148d0008"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="MarR family transcriptional regulator"
                     /protein_id="BAQ43574.1"
                     /transl_table=11
                     /translation="MNSFEPVLSGVTALRLDNQLCYALYAASHRMTKCYRPLLERLGL
                     TYPQYLVLIVLWENDGLTVSDIGRRLRLDSGTLTPVLKRLEAAGFVRRTRRQADEREV
                     EISLTEEGHALEEQAVEVRRSIVETLQMTEGEIADLRARLDVLIATLGGEA"
     CDS             complement(59645..60010)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012332024.1"
                     /locus_tag="Maq22A_c00310"
                     /note="148d0007"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43575.1"
                     /transl_table=11
                     /translation="MMMSRTVKKPTDKPRNLPPIRVRKEPPTVSEAVAAAQDLADDVE
                     QQVEIAAGLIGLSPDEVRPHVLQAAQAQAAKPKAERSPERIISTGSGLRGPRTVIVER
                     RATRPMVERRIRPPLDGRR"
     CDS             60200..61180
                     /codon_start=1
                     /gene="spr"
                     /inference="similar to AA sequence:RefSeq:WP_015927820.1"
                     /locus_tag="Maq22A_c00315"
                     /note="148c0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="peptidase P60"
                     /protein_id="BAQ43576.1"
                     /transl_table=11
                     /translation="MVRHVLIPVGARSGLLPAARLERLAGTMTAPFSADAPLDPRLTP
                     ARPDLADERLRGRVAADRYVAGTTHRIRVPVAPLRRAPDPAAALDSEALLGEAATVYE
                     VRDGFAFAQLSADGYVGYLPAEALGPVDPAPTHRVSALRTFLYPAADLKRPVVGALSL
                     GARVAVAGREGAYARLADGRFAWAGHLAALDAVEPDVAATALRFLGVPYLWGGRSSLG
                     LDCSGLVQTALAAAGIAAPRDSDQQEAALGEAVPVTADLAGLRRGDLVFWRGHVGMML
                     DEARLIHANGHHMAVAIEPLAEAEGRIRAGRTGPGTGDGAIRAIRRTIAA"
     CDS             61403..62038
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018259747.1"
                     /locus_tag="Maq22A_c00320"
                     /note="148c0009"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="DNA uptake protein and related DNA-binding
                     proteins"
                     /protein_id="BAQ43577.1"
                     /transl_table=11
                     /translation="MLTGSAITRALVIVVLAAGLAGLWQVLMPRATGPHLSEPPKVDA
                     AKVDAAKGDPSRRVESGRSAAAPATGETADPVRSVYPGPRPAEPSPQRQPPAAEAMPA
                     PAPVPAPAPPVSTPAVPAPSAAPATMPASTPPPVFSPPSVATAEEPAPAPAGTVDLNT
                     ASVAELNGLGGGMIGKAIVARRPYASPGELLSKRVLSRATYERIKGQVTVR"
     CDS             complement(62049..62819)
                     /codon_start=1
                     /gene="kch"
                     /inference="similar to AA sequence:RefSeq:WP_012329771.1"
                     /locus_tag="Maq22A_c00325"
                     /note="148d0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ion transporter"
                     /protein_id="BAQ43578.1"
                     /transl_table=11
                     /translation="MTALIARLRALYEGDTDGAHRFRYALLAFDVATVAFVIATSFLP
                     LSPWVAVGDVVLGLGVLADFAGRLAISRAPAREFLRLGTWTDVVAIASFLAPMFVQGV
                     GFLRILRTLRLLRTYQLLDRLRRDSGIFRRHEEAILAATNLVVFVFVMTGVVYVTQAG
                     SNPAIGSPVDALYFTVTSLTTTGYGDITLPGPSGRLISVVVMICGVTLFFRLAQVVFR
                     PYKVRFPCPTCGLQRHEPDAVHCKACGTVLNIPDEGAD"
     CDS             63113..64309
                     /codon_start=1
                     /gene="nhaA"
                     /inference="similar to AA sequence:RefSeq:WP_007567458.1"
                     /locus_tag="Maq22A_c00330"
                     /note="148c0008"
                     /note="exports sodium by using the electrochemical proton
                     gradient to allow protons into the cell; functions in
                     adaptation to high salinity and alkaline pH; activity
                     increases at higher pH; downregulated at acidic pH;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /product="pH-dependent sodium/proton antiporter"
                     /protein_id="BAQ43579.1"
                     /transl_table=11
                     /translation="MSGRVPLPVRRPLSALRTMLHNEAGGGLVLMASAALALVVANSP
                     WAETYFAVLAAHLGPLSVLHWINDALMAVFFLLVGLEIKREMLDGRLRTWPDRILPGI
                     AALGGMLMPALVYVAVNRHSPETLRGWAIPAATDIAFALGVLALLGSRVPVSLKVFLT
                     ALAIIDDLGAVLIIAAFYTADLSLPMLGGAGLTLAVLYGMNKAGVARLWPYLLLGAVL
                     WVFVLKSGIHATIAGVLVALTIPLRLSVGKPDDPTSPLHILEHAIHPWSAFLILPIFG
                     FANAGVSLAGFSPAMLLDPVTLGVALGLFVGKQLGVFGFVLAVVRLGWAQRPAHATWL
                     QVYGVALLCGVGFTMSLFIGLLAFAASPALEAETKIGVLVGSLACMAAGALVLRLAPR
                     VPERRP"
     CDS             complement(64532..65494)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015931000.1"
                     /locus_tag="Maq22A_c00335"
                     /note="148d0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="cobalamin biosynthesis protein CobW"
                     /protein_id="BAQ43580.1"
                     /transl_table=11
                     /translation="MSDKIPVTVLTGYLGAGKTTLLNRILTEPHGKRYAVIVNEFGEI
                     GIDNDLVVGADEEVFEMNNGCICCTVRGDLIRIMDGLMKRKGKFDAIIVETTGLADPA
                     PVAQTFFVDQDVGEAATLDAVVTVVDAKWLSERLKDAPEAKNQVAFADVILLNKSDLV
                     DEAGLDSVERQIRALNPSAEIHRTQHCAVPLDTVLGRNAFDLARIIEIEPEFLEEGHH
                     HHHSDEIQSISARLPGAVDPNKFMPWISDLTQVQGPDILRCKGIVSFPDEPRRFVFQG
                     VHMILDGDLQDEWKPGDPRESRVVFIGRHLDPEAIRKGFEACRA"
     CDS             complement(65569..66387)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015930999.1"
                     /locus_tag="Maq22A_c00340"
                     /note="148d0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="creatininase"
                     /protein_id="BAQ43581.1"
                     /transl_table=11
                     /translation="MPARPWGDLTTEECRAGALRAAVAVLPVAAVEQHGPHLPLATDL
                     VIAEGYLARAVALVPDGLDVRVLPVQQVGLSPEHADFPGTLTLTPETALRAWGEIGDG
                     VARAGCRRLVVVSSHGGNSALVDLVALGLRSRHGMVAVTTAWSRFGTPPGLFPEDEMR
                     HGIHGGGIETALMLALRPDLVRRDAIRDFVPATREIERTYTHLRAGRPAAFAWHAQDL
                     NPAGAIGDARLGTAEAGRALLDHGARAFVELLRDVARFPLPSFPPPTLVSRGGE"
     CDS             66584..67165
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015930998.1"
                     /locus_tag="Maq22A_c00345"
                     /note="148c0007"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="MarR family transcriptional regulator"
                     /protein_id="BAQ43582.1"
                     /transl_table=11
                     /translation="MASGEQAVAVAGDTPRRAAKRLRPPGAKSVGWALMQAARLHRGR
                     IGDRLADLDLFAGQEQVVQALAAAGTMTMGDLAATLRVRPPTASKTITRLAAMGVVER
                     RTEAGDGRVVRVRLTEAGMAKAAAIEGIWDDVEAEMLDGFDGKERRRLRKLLRRAARN
                     LAEAAGLDAHDSDGEAEDDLDGLDAGDSSRDMD"
     CDS             70617..71303
                     /codon_start=1
                     /gene="fabG"
                     /inference="similar to AA sequence:RefSeq:WP_012332028.1"
                     /locus_tag="Maq22A_c00355"
                     /note="148c0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="short-chain dehydrogenase"
                     /protein_id="BAQ43583.1"
                     /transl_table=11
                     /translation="MAKLDRSALIVGASRGLGLGLTRAFLARGWAVTATARGEAPALA
                     ALTPVAPAIRRVDIDDDAAVARLRDELGSESFDVVFVVAGIADGAHVPLPEGDRATAL
                     KVYETNAVSPIRFAEAFAGRVAPGGLMVLMSSILGSVSLNEGGTWESYRASKAALNTL
                     ARSFSARHGDAPFGTVLMHPGWVRTDMGGPDADIDVATSADGMAAVIEGQLGQRGCVY
                     LDYRGETLPW"
     CDS             complement(71347..71970)
                     /codon_start=1
                     /gene="acrR"
                     /inference="similar to AA sequence:RefSeq:WP_015931021.1"
                     /locus_tag="Maq22A_c00360"
                     /note="148d0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="TetR family transcriptional regulator"
                     /protein_id="BAQ43584.1"
                     /transl_table=11
                     /translation="MRNEDRRDRLRMALIDAAEATIAADGLAALKARDLAKEVGCALG
                     AIYTAFPDLDALILTVNLRTLALFERAITEVTIAPPPTGAASPAERAAAADTLVRLAV
                     AYLHFAAENPARWRALFQHRITHALPDWYLVEQVRLFRYIETPLQVLRPGLGDRERAL
                     LARSLFSATHGLVSLGLDEKLMVLSEPVLRGQIEIVVGALGRGLAEG"
     CDS             72122..72856
                     /codon_start=1
                     /locus_tag="Maq22A_c00370"
                     /note="148c0004"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="phage shock protein A, PspA"
                     /protein_id="BAQ43585.1"
                     /transl_table=11
                     /translation="MLNLLSTLVRGASARATEDLHDQHAFLILEQQLRDAAAALDDSR
                     RALGRAIAQEAVDAKRQTALYARMVDLEASAVAALAGGREDLAREAAEALAEMEQEAL
                     TLETTRAAYAAEVAALRRAVRKGTHQFAELERGQRIARATEAVRRLRARRGQGTGSPA
                     ALAEAQATLRRLREAQAADAASDEAMAIIDAAAPESLCERLEEAGFSPRPRPSAGSVM
                     ERLRAKAQAKEQAKRQTEAQTEAGAA"
     CDS             72897..73169
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012334309.1"
                     /locus_tag="Maq22A_c00375"
                     /note="148c0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="YiaAB two helix domain-containing protein"
                     /protein_id="BAQ43586.1"
                     /transl_table=11
                     /translation="MTQQTTQHTSAWVAFTYASFIGAATMVAGGILFLPLDLWTKAYL
                     AMGVTMLVQSCITMVKTVRDVHEGKRLVNRIEDARAERLLMEMGKE"
     CDS             73315..76734
                     /codon_start=1
                     /EC_number="6.2.1.20"
                     /gene="caiC"
                     /inference="similar to AA sequence:RefSeq:WP_015931018.1"
                     /locus_tag="Maq22A_c00380"
                     /note="148c0002"
                     /note="Synthesizes thioester adducts of fatty acids
                     enzymatically to the phosphopantetheine group of acyl
                     carrier protein; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /product="2-acyl-glycerophospho-
                     ethanolamineacyltransferase"
                     /protein_id="BAQ43587.1"
                     /transl_table=11
                     /translation="MSGSLMASRRFAPLFWCQFFSAFNDNFLKNALVFLIMFGAGGVG
                     GGADGGSAALVTLAGAAFIAPFFFLSGLGGQLADRYDKAYVARRLKAAEILAAAVAVL
                     GFWLSSVPILFVALVLFGIVAALFGPIKYGILPDHLARAELPAGNALIEAATFLAILT
                     GTIAGGLAVTHGGAHAFGLLVMGFAGLCWLASLAIPTTGEAAPTLEVDRNVLRSTGSL
                     MRDLYEDTRLWRTGLITSWFWLVGAVVLALLPALVKRTFGGDETVVTALLALFSIGVA
                     LGSGLASWLCAGRIVMLPTPIAALIMGLVSLDLALVASASVPPPSPVGALEFLGSWRG
                     ARIAVDFVVLAAAAGLFIVPSFAALQAWTPKERRARVIAASNVLAAAFIVLGAVSLAV
                     LQKAGLSSAGQFLIVGIANLVAGVAVMAVLPTSGFRDFLSIVFRAFYRLEVRGLENIE
                     KAGPNAIIALNHVSFLDAGLALSLTEREPTFAIDHTIAQKWWVKPFLWLTRALPLDPT
                     KPMATRTLINAVKGGETLIIFPEGRLTVTGSLMKVYDGAGLIADKSGVPVVPVKIEGP
                     ERTAFSRLSRAQVRRRWWPKFIVTVLEPVRLEVDPALKGKARRQAAGAALYGVMSDLI
                     FRTAPIDRTVFDAVVEAAEREGGARVALEDPVTGTLTYRRLLMGARVLGAKLGPLAPQ
                     GRAIGVMLPNANAAAVTVLGVMSAGRVPAMINFTAGPANILSACKAAEVETIVTSRAF
                     VQKGRLDALLETLSQSLTIVYLEDVRSRVGRLDKLRGFLGWRQAIHPRKPEDPAAILF
                     TSGSEGTPKGVVLSHRNMLANAAQAQARIDFGRTDKVFNVLPVFHSFGLTVGLVLPLV
                     SGVPVYLYPSPLHYRIVPELVYGSNATILFGTDTFLAGYARVAHAYDFRSLRYILAGA
                     EPVKPATRKAYAEKFGLRILEGYGVTETAPVLALNTPMFNRFGTVGRVMPGMEARLEP
                     VPGVTEGGRLFVRGPNVMLGYLRAEKPGVLEAPAEGWHDTGDIVTIDADGFVTIRGRA
                     KRFAKVGGEMISLAAVEAVAAELYPDAASAVAALPDARKGERLVLVTEKKDATRAAFQ
                     ARARASGLSELAVPAEIVAVDALPQLGSGKVDFAAVTRLAAERTKPAEAAA"
     CDS             complement(76775..77578)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_016331921.1"
                     /locus_tag="Maq22A_c00385"
                     /note="148d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43588.1"
                     /transl_table=11
                     /translation="MLNVIKRSPSLYAAGRKARFALGSRLGARPVAGIGRAHYNDFML
                     TSTAPDRVASYTTGARQFVDILETALREAGRDWDSVGQALEIGCGYGRIVRELSRRLP
                     GNRIAVCDVIDEGARFTASEFGATQVPVMERAAVKPSAAYDLIYLLSVYTHLPRDFVV
                     SNLRDVARALKPGGVAVFTIHGQGSAETAERYEQYWLDKPGVLSAMAQAGYYYARYPY
                     YTDEYGLTWFTKDAVERLVAEAAPELEPVSYRPMQLDAHQDVYVYRKRG"
     CDS             complement(77809..79098)
                     /codon_start=1
                     /EC_number="2.5.1.7"
                     /gene="murA"
                     /inference="similar to AA sequence:SwissProt:B8IH95.1"
                     /locus_tag="Maq22A_c00390"
                     /note="148d0001"
                     /note="adds enolpyruvyl to UDP-N-acetylglucosamine as a
                     component of cell wall formation; gram-positive bacteria
                     have 2 copies of MurA which are active; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /product="UDP-N-acetylglucosamine1-
                     carboxyvinyltransferase"
                     /protein_id="BAQ43589.1"
                     /transl_table=11
                     /translation="MDRIHIVGGKPLHGIIPISGAKNAALPLMIASLLTGETLELSNV
                     PRLADVASLLRILGNHGVDHMVVGKRPGQTTEAGQTIRLTASNVIDTTAPYDLVSTMR
                     ASFWVIAPLLARFGEARVSLPGGCAIGTRPVDLLLMALETLGATIEIDGGYAVARTKN
                     GLRGGEIKFPKVTVGGTHVALMAAVLAHGTTVIENAAREPEVVDLAACLTRMGARIEG
                     AGTPRIEIEGVSRLSGARHAVLPDRIETGTYAMAVAMTGGDVTLENTRADLLHSALDI
                     LATTGTEVTPLDHGIRVRRNGHGIAAVDITTDPFPGFPTDLQAQFMALMTRAKGQSRI
                     RETIFENRFMHVQELARLGAKIRLEGDVAVVEGVERLKGAPVMATDLRASVSLVIAGL
                     AAEGETQINRVYHLDRGFEALEAKLVRCGAEIRRERV"
     CDS             complement(79211..79387)
                     /codon_start=1
                     /locus_tag="Maq22A_c00395"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43590.1"
                     /transl_table=11
                     /translation="MSGREDGRSGDGTREQRLKAALRDNLKRRKAQARGREAAEPGEA
                     PPDAPADRTGGDGR"
     CDS             complement(81433..82419)
                     /codon_start=1
                     /gene="hisG"
                     /inference="similar to AA sequence:RefSeq:WP_012332490.1"
                     /locus_tag="Maq22A_c00405"
                     /note="447d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="BAQ43591.1"
                     /transl_table=11
                     /translation="MANPVDGPLVLAVPSKGRLQENAAAFFGRAGLTLAQTSGARDYR
                     GRLKGVDGVEVRFLSASEIAGQLASGAAHLGITGEDLIRETLPDAAGQVELLTPLGFG
                     QATVVVAVPQAWIDVRSMSDLDEVASDMRVRHGKRLRIATKYVNLTRRFFAEHGVADY
                     RIVESLGATEGAPASGSAEIIVDITTTGATLAANALKILDDGVILRSEANLVASLAAS
                     WSETPRRAVQAVLGRISAEERARTTREVRAGMPASGEIDLAGLAALHEAELPYGAPEG
                     RGEIMLRCPSDAVFGLAEALVQAGAQAVSVRRIDYAFAAENPLVERLLGRLT"
     CDS             complement(82446..83594)
                     /codon_start=1
                     /gene="hisZ"
                     /inference="similar to AA sequence:RefSeq:WP_012332491.1"
                     /locus_tag="Maq22A_c00410"
                     /note="447d0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="BAQ43592.1"
                     /transl_table=11
                     /translation="MTGNGAAAPRPAAAHEALLALFEDRGYARVEPPVLQPVEPFLEL
                     SGEDIRRRIFITQDGAGAELCLRPEYTIPVGRHHRAVADGQAADYSYLGPVFRLRAAE
                     PDEFHQAGIESIGRTDVPAADAEILGLALDGLDRLGRGEGQVRLGDMGLITALLDALN
                     VQPAAKRRTLRAVAAGRSLDAVAAPVAVDAAHAGLLSAIQGQDPQGVRAFVEDVLAIA
                     GISRVGGRTAGEIAERFLAKAAAHAEGGAGLGARAREVLDAYLALTGDPDAAASAARD
                     LARRAGLDDPRLEAALALFEERNGFIAARGLPLERFVFTGSFARNLDYYTGFIFEVAD
                     GEGGESAAGIKPLVGGGRYDGLLQHLGSTYALPAVGCSFWLERLGGER"
     CDS             complement(84016..85551)
                     /codon_start=1
                     /gene="hisS"
                     /inference="similar to AA sequence:RefSeq:WP_015931421.1"
                     /locus_tag="Maq22A_c00415"
                     /note="403d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="histidyl-tRNA synthase"
                     /protein_id="BAQ43593.1"
                     /transl_table=11
                     /translation="MSKPAKAEKAATLKPRLPRGLVDRGPAEIAATNRMLDKIRESFE
                     LYGFEAVETPFIEYTEALGKFLPDLDRPNEGVFSFQDDDESWLSLRYDLTAPLARYVA
                     EHFDALPKPYRSYRAGYVFRNEKPGPGRFRQFMQFDADIVGAPTVAADAEICMMAADT
                     LEKVGIGRGDYVVKVNNRKVLDGVMEAIGLGGADQAGRRLIVLRAIDKLDRLGADGVR
                     LLLGPGRKDESGDFTKGAGLSDEAIERILRYVSFQASPTEGGDRLAFWEDFFGGWSEV
                     VGASETGRQGIAELHTIMKLCEAAGYGHDRVRADPSVVRGLEYYTGPVFEAELTFPVV
                     NEDGQTVRFGSVAGGGRYDGLVGRFRSEPVPATGFSVGVSRLFSALQVVRSPIVSGQA
                     APGPVVILVLDREETAAYQALVSSLRQAGIRSELYLGASGMKAQMKYADRRGAPCVVI
                     QGSDERARGEVQIKDLIEGAKAAEAIASNAEWKAARPAQLSVPVDEMVARVREVLARH
                     YGG"
     CDS             complement(85681..86916)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015931422.1"
                     /locus_tag="Maq22A_c00420"
                     /note="403d0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="polymerase"
                     /protein_id="BAQ43594.1"
                     /transl_table=11
                     /translation="MGTFVLPRRDLAAVPFLQLLRGFGHALMAAFIFFACFAFSDTSP
                     YDLVAIPTIVLWVLLGVRLYRGAVPLVLVLLVFVGATVVALMPYLDEELPPVWTVQLC
                     YLAVTGIFFTMFFSDESDRRVEAALKVYTASALFCGILGIGGYLELIGNDKLFSMYGR
                     ASGTFQDPNVFGSFLTLGAFYLMHDLLTGRARRPLLSGLGLAILLAGVFLSFSRGSWG
                     GTLAMGILLVVMLYRTSAPRLRRRIVLLAALTAGFGAVSLAGLLSVGDVGETFSKRAA
                     VTQDYDEGETGRFGNQLRGIGMLIEDPLGMGPLRWRRTFNLEPHNSYIGAFANGGWVA
                     GVAFVFLVLMTSRVGFRLMSQDTPYRRHAQIVVPALLMFFLQAMQIDMEKWRHVYMML
                     GMVWGLEAARVRWLASGEA"
     CDS             complement(87193..88221)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015931423.1"
                     /locus_tag="Maq22A_c00425"
                     /note="121d0016"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="predicted Na+-dependent transporter"
                     /protein_id="BAQ43595.1"
                     /transl_table=11
                     /translation="MLSRLRPDNFTLMIVGALILGSVLPVQDRAAEWLSLFANGMIAL
                     LFFLHGARIDRQTALAGLVHWRLHLVVFASTFVLFPILGLAAGLLSPALLTPALAAGV
                     LFLCVLPSTVQSSIAFTSVAGGNVPAAICSASASNILGMFITPLLVAVLLNSQGSHHE
                     FDWAAVGKIMAQLLLPFALGQLLQPRLGPWLTRHKPLTMVVDRGSILLIVYIAFSHAV
                     ATGLWSRTPLPALATMLVVDLVLLALVLAITTAASRLLGFSKEDEITIVFCGSKKSLA
                     SGVPMANVIFAGQDVGGILLPLMLFHQVQLMACAALARRYAARLQAPPAAGAIPVGAA
                     PAAKLAAR"
     CDS             88394..89245
                     /codon_start=1
                     /gene="lysR"
                     /inference="similar to AA sequence:RefSeq:WP_015931424.1"
                     /locus_tag="Maq22A_c00430"
                     /note="121c0016"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="LysR family transcriptional regulator"
                     /protein_id="BAQ43596.1"
                     /transl_table=11
                     /translation="MTRLVDPVLLRTLAAVVRSRSFSRAAEQLGLGQSTVSQHVQRLE
                     AQLGHRLVARDTHSVALTPEGETVLGFARTVLDAHERLERALAGGPVRGKVRFGASED
                     FVQSRLSDVLRDFREAYPSVDLELSVALTGFLNDALARGELDLVLGKRHVGETQGVLV
                     RRDRLVWVGLPTALPERGEPVALASFPAPSITRAIALAALTQEGRAFRVTCTCASLSG
                     LRAAALAGVGVMAQPRSLIPDGLQELAHPDLPRLADVEFVLSGPGLHREPSRALAHEI
                     LNADIWD"
     CDS             complement(89281..89601)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012332485.1"
                     /locus_tag="Maq22A_c00435"
                     /note="121d0015"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43597.1"
                     /transl_table=11
                     /translation="MKTVMTAALAALTLGLGVAPAFAQYGYGGYDDDRPRRRYEERYD
                     YDRPRVQRYDYDRPGYREYGGGRLGRICVTARGNCPTRPAPLNSSCGCEVPGFGFKRG
                     AIGY"
     CDS             89871..90320
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018260839.1"
                     /locus_tag="Maq22A_c00440"
                     /note="121c0015"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43598.1"
                     /transl_table=11
                     /translation="MELLKLAALDADDLAIISTHLQDAVLRTGDLAYLPRERRFALVA
                     RRFDWESPDGAPPRRRLTGLHFERVLAVRCRNIPRDEPDSPLELLAITFEPGEAPSGT
                     ATLVFAGGGAIRLELECIEAAMKDLGPVWQADSKPLHASHDRPLDAA"
     CDS             90417..91706
                     /codon_start=1
                     /gene="hisD"
                     /inference="similar to AA sequence:RefSeq:WP_015931287.1"
                     /locus_tag="Maq22A_c00445"
                     /note="121c0014"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="histidinol dehydrogenase"
                     /protein_id="BAQ43599.1"
                     /transl_table=11
                     /translation="MQRLDSRDPDFESHFTRLLSVKREVSEDVDAAVRDIIAEVVARG
                     DDAVIDYTRRFDRLDLTPDTIRVSAEEIEAATASCSAEALDALALAKARIETYHRAQV
                     PADHRETDALGVTLGWRWTAIESVGLYVPGGTASYPSSVLMNAVPAKVAGVPRIAMVV
                     PTPDGVTNPLVLAAAKLAGVDEVFRVGGAQAVAALAYGTATIRPVAKIVGPGNAYVAA
                     AKRRVFGQVGIDMIAGPSEVLILADSSANPEWVAADLLAQAEHDTAAQAILVTDSDAL
                     ADAVAAAVEGQLKTLRRAEIATASWRDYGAIVRVARLADAIPLVDRLAPEHLEIESHD
                     AEDLAARVRNAGAIFLGAHTPEAIGDYVGGPNHVLPTARSARFSSGLGVLDFMKRTSL
                     LSCTPEALRALGPAAVTLGRSEGLDGHARSVAIRLNL"
     CDS             91811..92299
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015931288.1"
                     /locus_tag="Maq22A_c00450"
                     /note="121c0013"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43600.1"
                     /transl_table=11
                     /translation="MASEAPDPRQRLAAVTLDEDSIGRGNPDQEHERAIAIYDILESN
                     TFRVANNDGGPYGLSLGLVENKLSFAISTADGQPVMTHLLSLTPFRGVIRDYEMICDS
                     YFKAIRTASPSQIEAIDMGRRGVHNEASELLRQRLEGKVEIDHDTARRLFTLIFALHW
                     KG"
     CDS             92304..92825
                     /codon_start=1
                     /gene="wzb"
                     /inference="similar to AA sequence:RefSeq:WP_012332481.1"
                     /locus_tag="Maq22A_c00455"
                     /note="121c0012"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="ArsC family transcriptional regulator"
                     /protein_id="BAQ43601.1"
                     /transl_table=11
                     /translation="MPEGPSADGAAPAGADPTKPDPSRPDPARLGRRVQSVLFVCNFN
                     AVRSACAEALARHYFGKSVYVQSAGVRGGEPADPFMIAALDEIGIDASRHRPRTLEEL
                     EEWEGLNFDLIVSLSPEAHHAALELTRTLAAEVEYWPTPDPTVGQGSREQRLDGYRDV
                     RDGLGYRIRQRLR"
     CDS             complement(92841..93161)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012332027.1"
                     /locus_tag="Maq22A_c00460"
                     /note="121d0014"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="branched-chain amino acid ABC transporter"
                     /protein_id="BAQ43602.1"
                     /transl_table=11
                     /translation="MIDALLAGPAGPWIAILALALVTYLCRASGVVLMSRVRLTPRVE
                     RGLRALPGSIVVATAVPTGLSAGLPGLLGLVTAAGVMALTRFELAAVLAGLGVVALGR
                     AVGL"
     CDS             complement(93158..93931)
                     /codon_start=1
                     /gene="azlC"
                     /inference="similar to AA sequence:RefSeq:WP_012332026.1"
                     /locus_tag="Maq22A_c00465"
                     /note="121d0013"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="branched-chain amino acid ABC
                     transporter/permease"
                     /protein_id="BAQ43603.1"
                     /transl_table=11
                     /translation="MSHGSSREPAAPQPSPLTASPSTSAAPFTRAGILRGIRLSLPLW
                     PSIAVFGGAFGAAAAQRGVTLAEAAGASALVYAGSAQMVTLEVWGQPWTLRALLAAMT
                     VTGLINARMILMGATIQPWMRGTPLWRTAMTLFVLVDASWLIGVRHRAEGGRDLGVLF
                     GAGIGLWPLWVASTVAGHLAGALVTQPRAYALDMILPVFFAAMLAPLWRGVRPALPWL
                     ASGLVALVVQRLVPGYAFIAAGAAAGLVTGLLVDDGAGR"
     CDS             complement(94053..94796)
                     /codon_start=1
                     /gene="crp"
                     /inference="similar to AA sequence:RefSeq:WP_015931003.1"
                     /locus_tag="Maq22A_c00470"
                     /note="121d0012"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+. Start codon location
                     was manually corrected by using GenomeMatcher"
                     /product="cyclic nucleotide-binding protein"
                     /protein_id="BAQ43604.1"
                     /transl_table=11
                     /translation="MAEFLIRKLENFSRLSAEDRRALDQAARQRTRQIRPRDDIVREG
                     DLPPGVNLILDGWACRYKTLEDGRRQIIAYLLPGDLCDHGVPILREMDHSIGTLTAVT
                     LAEITPETIRQLTAGHARLSQALTWESLVAAAIQREWTVNIGQRTAFERLGHLLCELY
                     LRLHAVGLTQGPTCELPLTQAEIADTIGLSVVHVNRTLQELRGAGLIALRGRELTLLR
                     LDALQRAVQFNPNYLHLDHEGRHLDANET"
     CDS             95170..95400
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c00475"
                     /note="121c0011"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43605.1"
                     /transl_table=11
                     /translation="MHDRSGGPVPAILPPPALRSTDGAGPFAAVLAPGLHAAFDGCLD
                     EALPADLSDLLGRLDRAAAGPRARTSDSFKRS"
     CDS             95409..95684
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012334296.1"
                     /locus_tag="Maq22A_c00480"
                     /note="121c0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43606.1"
                     /transl_table=11
                     /translation="MSEIAAETTRVVAFPQAVAASPVDENTASMIEVLQEQLRLAREG
                     KLRSVAVVSVSSDGGAVGTQWSCTHGDITSLIGKLTVLTHDMMAARK"
     CDS             complement(95812..96072)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018043877.1"
                     /locus_tag="Maq22A_c00485"
                     /note="121d0011"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="signal peptide protein"
                     /protein_id="BAQ43607.1"
                     /transl_table=11
                     /translation="MYDSWLRLGLDTVRLGLEAQTVVALRLAKLSLGGSAAQDEAHRM
                     VVEKVEAAAEAAVTLATGGTPERVVRDYRRKVRANAYRLSRD"
     CDS             complement(96175..96867)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012334297.1"
                     /locus_tag="Maq22A_c00490"
                     /note="121d0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43608.1"
                     /transl_table=11
                     /translation="MTRAALTAVLLAGLALSAGPARAAPEDAVPACAAPQAPEFAGGK
                     GFRLWVTRQGTMTWNNPLRPLSPEALQVLQVVIRNKLATAYGPDLSGLRRGPSPAALE
                     AQNGAPIRWSEALEGLPAALRILSEDDGQVLAELAFKACGDPPKVAMPKPAPVARGTA
                     KGRAAAKKDVKADPKVEAASADGAAADPSAEAPKAASKPAPRAPKPRRERAPDAPART
                     PGGLMLPQGAIP"
     CDS             complement(96864..97235)
                     /codon_start=1
                     /locus_tag="Maq22A_c27715"
                     /note="121d0009"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47049.1"
                     /transl_table=11
                     /translation="MEMVVILAAAAALVFAGVMLVFGRGRGRPPLRLPHEQELEDRGD
                     ELFRDFDQDLAGVFEQAAHQPEVPRAYERLEAPRPRPQGPMTIDHDPAEPGLPEPEPH
                     GSGPGARRPHPQPFERDGDSR"
     CDS             complement(97338..97595)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c00505"
                     /note="121d0008"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43609.1"
                     /transl_table=11
                     /translation="MMSIGAAVTAATTLVGQALPAGLMGERPRASATPGQAIAGFPAA
                     ASAGRAASEDALADGALLKAVEAGLREAGYLRGARAARLPG"
     CDS             complement(97658..97879)
                     /codon_start=1
                     /locus_tag="Maq22A_c00510"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43610.1"
                     /transl_table=11
                     /translation="MGAVHRVASSCGRITVRIARRAGSRLRAVTQGAFRIPATLYRGI
                     PPVARGGGGRVAGRSARDQKSPCGGPDNG"
     CDS             97865..100723
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018259743.1"
                     /locus_tag="Maq22A_c00515"
                     /note="121c0009"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="phosphoenolpyruvate carboxylase"
                     /protein_id="BAQ43611.1"
                     /transl_table=11
                     /translation="MDSPHRSGTQGLDAREADPREADALEADLLRLVEEARHQASQDP
                     FRNPVLTVALAISRRFDRGEIGEEDLGGLFVRLRAQALEARAARLRAYLGLGSEPDSA
                     AATEAVAGAALGDPEMTFDTARTRVERTRFAAVFTAHPTFGMPKAVARLLAEAASEPD
                     PAARRAPIAQAAALSARADPVITLNDEFDQARHAVQHGRAALDGLNEALLRAARERWP
                     DRWSELVPKPVVIASWVGCDTDGRTDIGWYDTLRYRLESKRTQFDRVLAQLPDDPAAA
                     PARRLAEEARAAVLRQLAVAPKLGDQPGLEAVHRFALALIIERDRAQTEAGPLLALLD
                     RAVLEAADDEARLGLCVLRAGVAAHGLQNGLPHFRLNASQVHNAVRRALEQDGDPTDP
                     AQRRSHLASINALLDTVAAVPVDFGALAAERASAARLMMTIAQILKHVDGTHPVRFLI
                     AETETGYTLLAALWLAQHFGIGDRVEITPLFETASALEQGVHVIEDALRSPHWRAYLK
                     RTGRLVVQFGYSDSGRYVGQLAATFWIERLRFRITELMAAHDLTDIELVIFDTHGESI
                     GRGAHPTSLSDRLAYLAPDHARRRNREAGIRTSLESSFQGSDGYLMFGTKALAEATVA
                     RIGEHVYSRLQPAPDPIYAEGDFATEFFTGVRQDMETLVNDPGYAALLGTFGPNLIDR
                     TGSRPVARQSDGGGPVAITHPRQMRAIPNNAILQQLGFLANSLHGVGRAAGRAPDLFV
                     EMRERSERFARAFRLVQEATAVGDLDVLRAYIDTLDPSVWLERARRATRDGRREEIVA
                     VAAALDRLNLAPHLRRLFGRLTQDHLMLHTVAPDLPEMTPRLALLHALRLALIHRIWF
                     LAVHIPGFRPQNGITREALIERILRLDVEGCLKLLDDIFPVTPDPTLGLNFGEPAGPR
                     GVGTYEAEHRTLFAPIRRLFGLVREISGMIQHEVGAFG"
     CDS             complement(100806..103538)
                     /codon_start=1
                     /gene="aceE"
                     /inference="similar to AA sequence:RefSeq:WP_015932247.1"
                     /locus_tag="Maq22A_c00520"
                     /note="121d0007"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="pyruvate dehydrogenase"
                     /protein_id="BAQ43612.1"
                     /transl_table=11
                     /translation="MSASAKPSPAVPVNENDRSTGQAILGPRGVADPDPAETADWLAS
                     LESVLRHGGAARARFLLDRLEQKAREIGIVEEAPPYSPYRNTIPLEKQPPYPGDLAVE
                     ERLTSIMRWNALAMVVRANMAYGELGGHVASYASAAEIFELGFNHFFQAGDATGAGAD
                     LVFFQPHSAPGVYARAFLEGRLSETNLKHYRQEIAGEGLCSYPHPWLMPEFWQVPTGS
                     MGIGPMNAIYQARFMRYLSDRGLADTAGQHVWGVFGDGEMDEPESIGALTLAAREKLD
                     NVTFVINCNLQRLDGPVRGNGQIIQELESVFRGAGWNVVKVLWGSEWDAIFARDTNHA
                     LLRRFAATVDGKYQTLGAKDGAYNLAHFFGEDEEVKALVSHMSDGDVDKLKRGGHDFR
                     KLFAAFAAAKATKGRPTVILAKTKKGYGMGGAGESRMTAHQAKKLDTDALKAFRDRFA
                     LPLTDAQVERLEFYKPDENSRELRYLRERREKLGGFLPKRRRTAAHVPVPDLSTYAAF
                     ALEADGKEMSTTTAAVRLFSSLIKHKELGPRVVPIVADEARTFGMANLFRQVGIYSPL
                     GQLYEPEDAGSMLYYKESRDGQLLEEGITEAGAISSWAAAATSYSVHGLAMLPFYIYY
                     SMFGFQRVGDLIWAAADQRARGFLIGATAGRTTLGGEGLQHQDGSSHLVAATIPNCRA
                     YDPAFAYEMAVILDHGARDMMERDVDAFYYVTAMNENYAQPSMPTGVRDGIIRGMYRF
                     AGYGNGEPAIRLLGSGAILPEVIAAAKILAEEWGIASEVHSVTSFSELARDAREVERS
                     NRLNPGLPPKRSLVEESLSGPAPVVAATDYVRAYPQLIATAIQARYVTLGTDGFGRSD
                     TRSALRAFFEVDRHHVAVAALAALADDGKLDRATVAEAVARYGLGANRPAPWTV"
     CDS             103832..104965
                     /codon_start=1
                     /EC_number="2.1.2.10"
                     /gene="gcvT"
                     /inference="similar to AA sequence:RefSeq:WP_012333308.1"
                     /locus_tag="Maq22A_c00525"
                     /note="121c0008"
                     /note="catalyzes the transfer of a methylene carbon from
                     the methylamine-loaded GcvH protein to tetrahydrofolate,
                     causing the release of ammonia and the generation of
                     reduced GcvH protein; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /product="glycine cleavage system protein T"
                     /protein_id="BAQ43613.1"
                     /transl_table=11
                     /translation="MTASLRETPLHALHGEAGARMVPFAGYSMPLHYPLGLLKEHLHT
                     RRAAGLFDVSHMGQIAVRARSGDPGEAARALETVLPIDILGLGVGRQRYGVLTLPGGG
                     ILDDLMLAHLGDHYLLVVNAANKAADLAHLLDAIGTACTVEPVERALLALQGPGADAA
                     LARHLPAVAGMRFMDARTIAFGGEEGVVVRSGYTGEDGFEVALPAASAVALARALLAE
                     PEVKPVGLGARDSLRLEAGLCLHGSDIGPETSPVEAGLAWAIPKVRRLGGDRAGGFPG
                     AERILAELEKGPARLRVGLKPEGRTPVRAGAALYAAADAAEAAGRVTSGGFGPSLEAP
                     IAMGVLPRALAVPGAQVFAEVRGQRLPCAVVPLPFRPAGFKRS"
     CDS             104984..105346
                     /codon_start=1
                     /gene="gcvH"
                     /inference="similar to AA sequence:RefSeq:WP_003603983.1"
                     /locus_tag="Maq22A_c00530"
                     /note="121c0007"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="glycine cleavage system protein H"
                     /protein_id="BAQ43614.1"
                     /transl_table=11
                     /translation="MLKYTDEHEWLRLEGDVATVGITDHAAGQLGDLVFIELPKVGAT
                     LTKGAAAAVVESVKAASDVYAPVDGEVIEVNEAAVSSPESVGTDPQGEGWLYRVRLSD
                     PSQLDGLMDEAAYRASLG"
     CDS             105429..108278
                     /codon_start=1
                     /EC_number="1.4.4.2"
                     /gene="gcvP"
                     /inference="similar to AA sequence:RefSeq:WP_017487236.1"
                     /locus_tag="Maq22A_c00535"
                     /note="121c0006"
                     /note="acts in conjunction with GvcH to form
                     H-protein-S-aminomethyldihydrolipoyllysine from glycine;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /product="glycine dehydrogenase"
                     /protein_id="BAQ43615.1"
                     /transl_table=11
                     /translation="MPMDKYDPYDFANRRHIGPSVDEIARMLEVVGADSLDALIDEIL
                     PAGIRQREATEFGAALSERRAIERLRATANKNTLLTSLIGQGYHGTTMPPAIQRNIFE
                     NPAWYTAYSPYQPEISQGRLEALLNFQTCVGDLTGLDIANASLLDEATAAAEAMGMAR
                     RIATAKPDIFFVDAQCLPQTIAVLKTRAEPFGWRIVVGDPFTDLDPASVFGAIVQYPG
                     VEGAAHDFTDVIAKLHESGAIAVVAADPLALTVLKPPGEMGADIAVGSMQRFGVPMGY
                     GGPHAAYMATRDAHKRALPGRIVGVSVDSRGNRAYRLSLQTREQHIRREKATSNICTS
                     QVLLAVIASMYAVFHGPRGLKAIAMRIHRDATRLAAGLNQLGFETHPDAFFDTITVTV
                     GPFQGVILKNAVANGINLRKVGNDRIGITVDERTRPDIIEAVWRAFGGDSLAYDESWP
                     EPRLPADLVRTSEYLTHPIFHMNRAESEMTRYMRRLADRDLALDRAMIPLGSCTMKLN
                     ATAEMLPISWPEFSELHPFAPKDQAEGYAEMIQDLSQKLADITGYAAISMQPNSGAQG
                     EYAGLLAIRAYHLSRGEGHRTICLIPSSAHGTNPASAQMCGMTVVVVGADRNGNVDVA
                     DFRAKAEKHGDNLAACMITYPSTHGVFEEAVREICDITHAHGAQVYLDGANLNALVGL
                     ARPGDIGADVSHINLHKTFCIPHGGGGPGMGPIGVKAHLIPFLPGHVETDGREFSVSA
                     APYGSAAILPISWSYCLLMGGRGLTQATRIAILNANYIAKRLAGAYEVLYTGTHGRVA
                     HECIIDARPLMKSAGISVEDIAKRLIDCGFHPPTMSWPVAGTLMIEPTESETKGEIDR
                     FCDAMLAIREEIRAIEEGRMDRADNPLKNAPHTVEDLIGPWERPYSREAACFPAGAFR
                     VDKYWPPVNRVDNAYGDRNLVCACPPVESYVKAAE"
     CDS             complement(108317..108598)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_019627407.1"
                     /locus_tag="Maq22A_c00540"
                     /note="121d0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="XRE family transcriptional regulator"
                     /protein_id="BAQ43616.1"
                     /transl_table=11
                     /translation="MSDDGFASVWDAIENTPAEAQTIELRSALMTALARHIRAKEWTG
                     AETARCLGTMEPRVVDRLRGKIDVFPLDDLVALLAAIGLHVELRVSDAT"
     CDS             108728..108970
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012778822.1"
                     /locus_tag="Maq22A_c00545"
                     /note="121c0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="transcription factor"
                     /protein_id="BAQ43617.1"
                     /transl_table=11
                     /translation="MALFVKDPVVDALAQELASLKRTTKTEAVRQALRGEIDREKDKF
                     DLVAQSIAFARGLREQAGPNPQPADKAFIDGLYEDP"
     CDS             108967..109365
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012778823.1"
                     /locus_tag="Maq22A_c00550"
                     /note="121c0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="twitching motility protein PilT"
                     /protein_id="BAQ43618.1"
                     /transl_table=11
                     /translation="MMFIDASALTAILAGEPDAASLVARLQQAHQRMTSPLVVWEATI
                     ALARILDLPLAKAQRAVRDYLALASIEVVAVPPRAADGAIEAFDRYGKGRHPAGLNSG
                     DCFAYACAQAYGMPLLFKSDDFPLTDIPAA"
     CDS             complement(109391..110104)
                     /codon_start=1
                     /gene="dnaQ"
                     /inference="similar to AA sequence:RefSeq:WP_015927975.1"
                     /locus_tag="Maq22A_c00555"
                     /note="121d0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="BAQ43619.1"
                     /transl_table=11
                     /translation="MLREIVLDTETTGTEAKTDRLIEIGCIELLNHIPSGREFHRYIN
                     PQRAVSEGAFRVHGLSDAFLSDKPLFAQILPDFLEFCGDATLVIHNAAFDVGFLNAEY
                     ARLGDKAPPPIELASVVDTLALARRKHPGAANNLDALCSRYGIDNSRRTKHGALLDSQ
                     ILAEVYIELLGGKQTTLGLTVEGNAGPAGPSLRAAPVEHGPRPTRSRLTEAELAAHAA
                     FTAGLGEKAIWREYVVEAG"
     CDS             complement(110154..110759)
                     /codon_start=1
                     /gene="coaE"
                     /inference="similar to AA sequence:RefSeq:WP_012330982.1"
                     /locus_tag="Maq22A_c00560"
                     /note="121d0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="dephospho-CoA kinase"
                     /protein_id="BAQ43620.1"
                     /transl_table=11
                     /translation="MSRPFVLGLTGSIGMGKSATAAMFRARGVPVHDADACVHALYGP
                     GGAAAAAIGDAFPGTLGADGAVDRAALRDAVLGDAQRLRHLESLVHPLVGAARDVFLA
                     AHAAAPLVVLDVPLLFETGGERHCDAVAVVTAPAEVQRARVLARPGMTEAAFAQILAK
                     QMPDAEKRRRADHLIETDRGFPHAEAQVDAVIAAAAARRAG"
     CDS             complement(110756..111619)
                     /codon_start=1
                     /gene="aroE"
                     /inference="similar to AA sequence:RefSeq:WP_012330983.1"
                     /locus_tag="Maq22A_c00565"
                     /note="121d0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="shikimate dehydrogenase"
                     /protein_id="BAQ43621.1"
                     /transl_table=11
                     /translation="MTTPHPRAFVVGHPIAHSRSPLIHGHWLAEHGLPGTYERVDVHP
                     DAFPEFVRSLHAAGFVGGNVTIPHKEAAFRLAEELTPRAGRIGAVNTLWFEDGRLHGD
                     NTDAPGFLAHLDASLGAGWPEATGVANGRAALVLGAGGAARAILVGLLERGLDRLIVA
                     NRSAERAEGLTALDPARITASSWDALPSLLPESGLLINTTALGMAGQDPLVLDLAPLP
                     AQAAVSDIVYVPLETPLLAAARARGLPAVDGLGMLLHQAVPGFRHWFGATPCVTPALR
                     ARIVADLESHG"
     CDS             complement(111863..112483)
                     /codon_start=1
                     /gene="maf"
                     /inference="similar to AA sequence:RefSeq:WP_012330984.1"
                     /locus_tag="Maq22A_c00570"
                     /note="121d0002"
                     /note="Maf; overexpression in Bacillus subtilis inhibits
                     septation in the dividing cell; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /product="septum formation inhibitor Maf"
                     /protein_id="BAQ43622.1"
                     /transl_table=11
                     /translation="MPHASSLWRGPAPLLLASTSPTRRALLESAGLTVETRAPGVDER
                     VVEAQAAGLSPENLAERLAAAKAAAVAGPSPGRVVVGADQVLDLDGTVFHKPADRAGA
                     AAHLARLQGRTHALHSAVALAVDGAVAEVFVVTARLAMRPLDEAGIKAYLDAAGPSVT
                     GSVGAYQLEGVGIHLFDRIKGDHSTILGLPLLPLLARLRGRGLLAF"
     CDS             complement(112488..113318)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927969.1"
                     /locus_tag="Maq22A_c00575"
                     /note="121d0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="phosphate kinase"
                     /protein_id="BAQ43623.1"
                     /transl_table=11
                     /translation="MVRSYFHLHLVSDSTGETLINVGRAAAAQYEGVSAIEHVYPLVR
                     SGTQLERVINEIEQAPGIVLYTLVGRELTERLEEACRATGSPLLSVLEPVHQLLQSYL
                     GTHSTARPGAQHMLNAEYFKRIDAMNFTLAHDDGNLPHDLNEADVILLGVSRTSKTPT
                     AIYLANRGLKTTNIPLIPGVPPPAILETLRQPLIVGLIASPERIVQIRQNRLLSLKAD
                     DSSSYVDRDAVANEIASSRRLFARNRWPVIDVTRRSIEETAAAIVDYYREHRLKFIAD
                     "
     CDS             113850..114938
                     /codon_start=1
                     /gene="hemE"
                     /inference="similar to AA sequence:RefSeq:WP_015927968.1"
                     /locus_tag="Maq22A_c00580"
                     /note="121c0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="BAQ43624.1"
                     /transl_table=11
                     /translation="MSGTAGAGKEAAERPILRVLDGEALSPPPAWMMRQAGRYLPEYR
                     AVRAEAGSFLDLCYNPDFATEVTLQPIRRFGFEASILFSDILVVPHALGQDVRFVEGE
                     GPRLDPMAGRTEFDALIEAGDPRIMRHLAPVFETVGRLRAELPSETTLLGFCGAPWTV
                     ASYMIGGRGTPDLAPARALAARDPALLDALIDRLVAVSTEYLVRQFEAGADAVQIFES
                     HAGSLPDVPAGEAGDALSRWSFRPIARIVSGIRARVPGARIIVFARGSGLDGHARVAD
                     ETGADAVGVDWAVDLKALRARLPARVVTQGNLHPETLIAGGAALDAAVDAILEATAGT
                     PHIFNLGHGITPQTPIPHVERMLARLRR"
     CDS             115266..115688
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018262436.1"
                     /locus_tag="Maq22A_c00585"
                     /note="121c0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="membrane protein"
                     /protein_id="BAQ43625.1"
                     /transl_table=11
                     /translation="MYLWIKAAHIVSLIAWMAAMLYLPRLFVYHAALPAGSATVETFK
                     VMERRLAKAIMLPGMIATWIFGIALMVMSEAYTQGWMHAKLALVLAMSGIHGWLSRMV
                     KDFAADRNVRSPKFYRVLNEVPTLLLILIVILVVVKPF"
     CDS             115700..116590
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012330989.1"
                     /locus_tag="Maq22A_c00590"
                     /note="121c0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hydrolase"
                     /protein_id="BAQ43626.1"
                     /transl_table=11
                     /translation="MAGFETQTLSFTLAGRALTLPVDRIGEGPPALLLPALSSISTRE
                     EMRPLATRLSTRHACLVPDWPGFGAQPRARVPLAPDTLHAFLDALLAPHGGAWQAPGP
                     YALGIAAGHAAGYLLAAAARHPGAFSRLVLVAPTWRGPLPTAMGEERRPLFGRLRRAV
                     EAPFVGNLLYRINVSTPIVSRMMQAHVYADRARVTPALLAEKRRVTHQPRARFGTAAF
                     VTGGLDPVRTRAEFHALFGPGLPPVTMLHPRGAPRRSGAEMTALAEAGLVRSVAIPGA
                     LAAHEECPEAVAAAILGAAA"
     CDS             116587..117378
                     /codon_start=1
                     /gene="pgpB"
                     /inference="similar to AA sequence:RefSeq:WP_015930285.1"
                     /locus_tag="Maq22A_c00595"
                     /note="215d0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="acid phosphatase"
                     /protein_id="BAQ43627.1"
                     /transl_table=11
                     /translation="MRTGRALLAGVRLLSAALVLSAAALAPAAAEPALRPYLADGALD
                     AAAILPPPPKPGSAAHAADAATYAATRALAGTPRWALATADIPSGIAALLGHFSCPAG
                     RRLDPARLPVLAGLLARVRRDVVTVVRDAKAHFARPRPHLGNDALLCGPRSRALDESL
                     AYPSGHATEGWTFGLVLAALMPERAAPVLARARVYGESRIVCGVHWASDVEAGRLAGS
                     ALFAALIGDAAFRVDLERARAEFAAAATIPPDPAVCAREDAASSP"
     CDS             complement(117519..118259)
                     /codon_start=1
                     /gene="terC"
                     /inference="similar to AA sequence:RefSeq:WP_012453583.1"
                     /locus_tag="Maq22A_c00600"
                     /note="215c0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="membrane protein"
                     /protein_id="BAQ43628.1"
                     /transl_table=11
                     /translation="MESLIQLAADPTAWAALATLVVMEVVLGIDNLIFISIITNKLPV
                     AQQSRARRIGIGLALILRLALLGTVAYIVHLTQPVFEIFGKGLSWRDMILIAGGLFLL
                     WKATKEIHHSLDPDPAEKTGGGASLGYAAAIGQILILDLVFSIDSIITAVGMTEHVPI
                     MVIAVLAAVTVMLVAADPLSRFIAANPTVVMLALGFLIMIGMTLIAEGFGAHVPKGYV
                     YTAMAFSAGVELLNILGRRAKKAKRTAA"
     CDS             complement(118273..119193)
                     /codon_start=1
                     /gene="lcb5"
                     /inference="similar to AA sequence:RefSeq:WP_015931427.1"
                     /locus_tag="Maq22A_c00605"
                     /note="215c0002"
                     /note="similar to YegS from E. coli; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /product="sphingosine kinase and enzymes related to
                     eukaryotic diacylglycerol kinase"
                     /protein_id="BAQ43629.1"
                     /transl_table=11
                     /translation="MSGAEVTRRALLVVNKKARNGGLDLEAVKGVLRRGGIEPVDPPP
                     GETDCKALIHAHAATCDMVILGGGDGTLNAAAQALTEAQLPLGILPLGTANDLARSLG
                     LPADPLEAAEVIASVPARPIDLGCVNGHYFFNVASIGFSADLAGELTADLKRRLGTVG
                     YAVAAFRLLRRSRPFTVYIEHDGTVETVRTIQVSVGNGRHYGGGMTVEENATVDDGLL
                     NFYSLEVAHWWRLLALLPALRRGTQGKAADVRAFQTTEVVLRTKKPRPVNTDGELTTY
                     TPAHVRVLRQAVQVHAPPPAAPTGRPSIFP"
     CDS             119259..119597
                     /codon_start=1
                     /locus_tag="Maq22A_c00610"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43630.1"
                     /transl_table=11
                     /translation="MRSCRVSTKAEKGSDIAVDASNRQRGPDPGSPSGGVAAALGKGC
                     VLARAARSQGRRRLGERAAGPGGAPFARDAGPIRGGPGTRAGMWAAWVAGRAQRPQWN
                     RNRGDERSPF"
     CDS             119626..120414
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015931426.1"
                     /locus_tag="Maq22A_c00615"
                     /note="215d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43631.1"
                     /transl_table=11
                     /translation="MLGPFRPLPTRPAAALLGLGASLLIVPAALAQGWVDPPARAGVA
                     PAPAPKVEPGPRVEAPPAKVQAKVQPTAPRRLAEEAHRPARSGLHAATEARRAARLAR
                     TERPLPVQIPAPAPVAVSDGQMRDWAVASQRLARDYLASISGPNGTTLADAPGFYGNQ
                     VVFHGRTMSVASLMSEKRRFVQRWPERRYRPRPDSLRTACSAGLALCQVRATVDFSAF
                     SPARGVRSQGTVDLELAVSLAGGRPVIVSENSRVVRREAVASRD"
     CDS             120603..121769
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015931425.1"
                     /locus_tag="Maq22A_c00620"
                     /note="140c0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43632.1"
                     /transl_table=11
                     /translation="MTTREQLQALIRAEIDRQRPVAVARRTLELLVEAAIRRLDAPPG
                     YQVVDRDGRPRTRTTAGEVQPLTLGDLVDELRRQHPTLFLPPAAAGPAASAPAARDWI
                     VVDPAPRPGTPAPARPDRTARLKETVRGLGARLRRPPPEPAPPEAAALPVAPPPPGAG
                     LKPGLARRQPVPGRGPARRPLYAALGALVLLGGAYAALRNPEPAADRAAIAQAQGQAA
                     TRTAEARPPARPDEPRGADRTVADKAAETKPAEAKPSEKAGEPKSAEARPGGKREPVE
                     TGAVTDGGPVAGVAEVVDTATLRLGGRTLRLSGVEAARGAQASDLSGYLAGRPVNCQP
                     NPGRTAWICTVDGHDLSEVVLYNGGGRATPEATADLVDAERHARTARLGIWARP"
     CDS             121945..122967
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927710.1"
                     /locus_tag="Maq22A_c00625"
                     /note="140c0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="MoxR-like ATPases"
                     /protein_id="BAQ43633.1"
                     /transl_table=11
                     /translation="MARGAEQAVARGTVGAMPPMPDDAGRARLHALRTGLEAGLIGST
                     GLVERLLIGLLTGGHLLIEGAPGLAKTRAVKRLADGLDTGFARIQCTPDLMPADLTGT
                     TVWRPDGGRFEFLAGPLFHSLVLVDEVNRAPPKVQSALLEAMAERQVTVAGTTHALPD
                     PFMVVATQNPIEHAGTFPLPEAQLDRFLLHVVVEMPDEASERRILDLVEGELTEDVAP
                     MPVRLTAEELRAARAAALKTHVSPALKDFLVRLVAATRGGPAAADLRGAIEHPVSPRG
                     TLALMLAGKARAYLHGRDHVTPDDVVALAPDALAHRLALTWRAAAEGQTTRALVAALL
                     DRVHPL"
     CDS             122982..123920
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012331317.1"
                     /locus_tag="Maq22A_c00630"
                     /note="457d0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43634.1"
                     /transl_table=11
                     /translation="MARPLPGSDPLKAPGIALEAAALMGLRHLARRGAGTATRVRAGL
                     PGGLVTRRRGRGTEPDDVRPFAEGDDVRHIDRNVTARTGSLHVRTHHEERDRAVVLVA
                     DFRPSMLVGTRRALRSVAAAEALALLGWRIVGDGGRVGLCVVAPEPAALPPAGGGRGM
                     AALCQALARAHESALLGPPDPDPPLGPVLERARALLPAGGHLVLASALDAPGEGFAEA
                     VAVLAERISVSLILVSDPFERAAPPGLYPYATPDGRRGTARPAKEPVRGPARARPAPE
                     ERVAPYTRFGVATLRVDSEMGPEGVAPLMERLDAVL"
     CDS             123907..124341
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927712.1"
                     /locus_tag="Maq22A_c00635"
                     /note="173d0014"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43635.1"
                     /transl_table=11
                     /translation="MPCCEVPPGALSALRGLHLPPDPGLVRPGVLAAVVAGLVLAGLV
                     AWLWPRWRARPVRRAALAELAAARALPPAERRLALARLSRRLARSLGVEGPAGLDAAL
                     RTDFFGRGPGRVLTEALYAPGPVPDLSAAEAGLARLVAGLRA"
     CDS             124347..125315
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927713.1"
                     /locus_tag="Maq22A_c00640"
                     /note="165c0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="von Willebrand factor A"
                     /protein_id="BAQ43636.1"
                     /transl_table=11
                     /translation="MAGLASLDFAAPLAALLLPLPLLAARFLPPRPGGSGALAVPASL
                     VAGLDRGGPLTVGVRGRAALTWLLWVALVVALAGPRLVLPGAALPASGRDIVLALDLS
                     GSMERIDFALDGRTSSRLAAVKRVGADFIRRRTGDRVGLVIFADQADVAAAPTFDTKA
                     VARALEEAQIGLVGRSTGIGDGLGLALKRLEALPGPSKVVVLLSDGANNAGQTTPRDV
                     AVLARELGVRVHTIALGPRDLADANGEQDVVDSEALRDVATTSGGRFFRVRTTDDLAG
                     VADSIDALEGGRDRAPPVPLRRDLWPWPGAVALLAALALLLTRRAA"
     CDS             125326..126246
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012331320.1"
                     /locus_tag="Maq22A_c00645"
                     /note="165c0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="von Willebrand factor A"
                     /protein_id="BAQ43637.1"
                     /transl_table=11
                     /translation="MTEAVTLLRPWWLLALPLLGLLAWRAAHRSAPLGDWVRAVEPHL
                     MAALAARGAVRPGRRGGQVLLVLAGALLALGLAGPALERRDVAGFRNLDATILCLDLS
                     RSVAEGGRLGEMRVLAQALAEAAGTRSVALVAYAGDAYLAATPTTDRDSLGTILFALD
                     GATVPDRGSHPARALALARRTLAEGAVVTGDVVLVSDGGGLDEAATREVAALAADGHR
                     LHTVLVTDPALPPDAPRPDGAGMARLATLGGGSAGSLDAPAPVLTAISETLARHLAEG
                     GYAVLAWRDLGRWLAGLALLPVLLLFRRSA"
     CDS             126246..127070
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012331321.1"
                     /locus_tag="Maq22A_c00650"
                     /note="165c0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43638.1"
                     /transl_table=11
                     /translation="MRIALLAAGGLVLVGLTIEPAALARLLLGAGMPGLAAAISDDPA
                     WRGTALYAAGRYREAAEAFAGSPYNRGNALALAGDLKGAMAAYDAALVRDPSDEDAKA
                     NRELMARLLDTPDAPGGRTAGEANAQADATTRYATKTESDANDAGTASTGEGLAGHRE
                     ASSAADSPGNSKAARTGKAEQRAVDPGRGQARGSASDAEGGGRQGGGNASVSEVVERE
                     VRRVSKSFEAREIRPDRHWLATLPDDPGRFVRLRILAEQTRRRADGTAVQPGSNPW"
     CDS             127064..128326
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018262206.1"
                     /locus_tag="Maq22A_c00655"
                     /note="165c0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43639.1"
                     /transl_table=11
                     /translation="MVTPSMVRGSVLALALAAPVLLAAPARALEDGDLTLTVTAETPG
                     SAEPYPREMVLLRIHGVYRAQIALEELRQPSLPHFGWTQLGRDRWSRTTIQGQEARSF
                     ERVVAVFPQGPGRFTVDPFVHRLTLVDNGERRVVEVRSPPLPIAVAAWQGPGGPDAAE
                     PWWLPARDLTVTDAWEPEPETLKLGEPARRTVTLEASGLTADALPPRPVLRTRGVLTF
                     AGPVERQTRITPAGPVARVTYRWDVRPGVPEPITLSAITIPWFDTKARVMREAEIPAR
                     IIGGRTAAVEAGPPPPPASPWRALAAGLAAFGVGLGAWRTFRRREAPAAPALRALARA
                     GRWRDPRAFHAAISEVARRDPARAALWRADPGTGPRLAALDAALFGDGRDTVPDLAGL
                     ARALARLHPPDAVPDALAPLDGPVRHAG"
     CDS             complement(128314..128550)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c00660"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43640.1"
                     /transl_table=11
                     /translation="MPRRDTLHFADFADTDERIEKGLRAFALAEAVGWSTVEARLSRY
                     GALPAGFFAAAGTAFHATRARLVAAEAGSVPQPA"
     CDS             128681..129235
                     /codon_start=1
                     /gene="fabG"
                     /inference="similar to AA sequence:RefSeq:WP_008655079.1"
                     /locus_tag="Maq22A_c00665"
                     /note="291d0013"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="dehydrogenases with different specificities"
                     /protein_id="BAQ43641.1"
                     /transl_table=11
                     /translation="MRPLVRAERRHPPPGMVAAVERVEEHRIDMGLGAGPLAVGQGEA
                     VARIDLDEDPPVDRSKRLRETREAGEPGPAQGRPVQGAERERRAGPGAPGEVAPGPER
                     AVRGEQREGVVPAGVAEEVVVGQGPLGEVARAPGQDLRLAARRGVVPREHARPDTRPR
                     HRCLLFRLSPKLHRVGRAAILSTV"
     CDS             129253..129615
                     /codon_start=1
                     /gene="arsR"
                     /inference="similar to AA sequence:RefSeq:WP_018044078.1"
                     /locus_tag="Maq22A_c00670"
                     /note="122d0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="ArsR family transcriptional regulator"
                     /protein_id="BAQ43642.1"
                     /transl_table=11
                     /translation="MSDGLQVMAEALVSPVRRKILAYLSASPLSAGEIAARFEISKPS
                     LSGHLSILSAAGLIVGARRGNRIEYSLVEDSLVNKLGALVQEVCPVAGPLRREARRKA
                     ARKDRSGGDDTPEEPQAG"
     CDS             129707..130945
                     /codon_start=1
                     /gene="argE"
                     /inference="similar to AA sequence:RefSeq:WP_012331732.1"
                     /locus_tag="Maq22A_c00675"
                     /note="122d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="allantoate amidohydrolase"
                     /protein_id="BAQ43643.1"
                     /transl_table=11
                     /translation="MTEISPRLGARVMALIDDLARHTDEPGRLTRLYLSPAHRATADA
                     VLGLMRAAGLSARIDAAGTVVGRVEGREPGLPALVLGSHIDSVVDAGRYDGPLGVAAA
                     LVVAEELRGAALPFALEVVAFGDEENVRFPTSLSTSKAWAGQYRFEWLEGRDAAGLTL
                     REALVTFGGDPDGIPALARRPEAVAGYLEVHIEQGPALEAAVQPVGVVSAIAGLTRAR
                     CTVTGEANHAGTVPMGMRRDALAAAAEMTLAVERLSEGMPGTVATVGALAVVPGAVNV
                     IAGQVDFSLDVRSPVDPDRHGLFAAIQAECRAIAGRRGVGFTSETFMDNPAVGLDPGL
                     QAALDRAARDLGFAPLRLPSGATHDAVAMAALGPSAMLFVRCRGGISHNPAESITLED
                     ADAATRVLLGTVRDLAGLPH"
     CDS             130966..132243
                     /codon_start=1
                     /gene="dadA"
                     /inference="similar to AA sequence:RefSeq:WP_007566457.1"
                     /locus_tag="Maq22A_c00680"
                     /note="122d0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="BAQ43644.1"
                     /transl_table=11
                     /translation="MQQDERTADIVVVGGGMVGLSSAIALKDSGLDVVLCDPGEARAR
                     TSYGNAGVVSRGSIFPMSSPALWGKLPAYLRNADAGLRLRHLHLLRVMPWAAHFLASA
                     RTSAWRRAAAALAPLTDAAYPEHRRLADRAGVPHLLRESGWVKLYRTEEAFAGAALER
                     EILAHHGVPFEIHDGAGIQALEPALIRPFARAMLLPETGAVGDPGGLVEASEKLFAGL
                     GGRILRTTVSRLEPEAEGWRVVHPGGTVRARRVVLATGAAANELSRPLGYRFAFAAER
                     GYHRHYALQPGSPALTRPVYDTGAASILSPMGEGRVRVLSGVEVADRHAEPDYRQIEA
                     AAKEAAGTVRLGQPLDNRPWLGSRPSTPDGLPVIGPAPRHQGLIFAFGHGHIGLSTGP
                     ITGRLVADLATGRTPSVPVAPFAPGRLLGWPRP"
     CDS             complement(132293..133159)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927977.1"
                     /locus_tag="Maq22A_c00685"
                     /note="122c0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="GntR family transcriptional regulator"
                     /protein_id="BAQ43645.1"
                     /transl_table=11
                     /translation="MAEIRDCPGPAPHPRGPTRFTVPAGAVDTHAHVIGLPPAYPFVA
                     ARSYTPPQAAAGSYLAMLDATGMTHGVLIQVSVHGTDNRLMVETLRAHPRRLRGIAVV
                     PLGLPETELASLKEAGVVGLRLNVLYGGGVGFEAVEAYGALCREMGWHLQFLIDARSL
                     PPLAGRLSRLPVPFCIDHMGHFPTSCGVGDEGFRTLVSLVRDGAWVKLSGAYRNSVAG
                     PPYADTVPFARALHQAAPERCVWGSDWPHVAHWGPMMNVRDLLDLLAEWVPDEADRHR
                     VLVENPARLYGF"
     CDS             complement(133152..134438)
                     /codon_start=1
                     /gene="proP"
                     /inference="similar to AA sequence:RefSeq:WP_015927978.1"
                     /locus_tag="Maq22A_c00690"
                     /note="122c0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="MFS transporter"
                     /protein_id="BAQ43646.1"
                     /transl_table=11
                     /translation="MPTPARDAVAVEDASLTAFYRDMTPPERHTFWACAAGWALDGMD
                     FMIYPLVIGTIIKLWSVDAGTAGLAATVTLLASALGGWLAGYLADRIGRVLTLQITIL
                     WFSFFSLLCAFAQDFSQLLIARALLGLGFGGEWAAGAVLMGETIRAQYRGRAVGSVQS
                     GWAIGWGMAVLSQAVLFSVLPPETAWRWMFVIGAAPALLVFYLRRYVEEPRVAVESRA
                     RAAATGDRPAIWEIFSGPLLRTTILASLMSAGCQGGYYAITTWLPRFLTTERGLSIVS
                     STGYLAALIAGSFAGYLAGAWLADRLGRRPLFLIFSLGAIAVILVYTQLPLSNAVLWV
                     LGFPLGFFASGYFSGMGAFLTELYPTRLRGSGQGFCYNFGRGIGALFPALVGYLSASM
                     SLASAIAIFAAAAYGVFFLTAYALPETRGKVLHADG"
     CDS             complement(134600..136558)
                     /codon_start=1
                     /gene="atoS"
                     /inference="similar to AA sequence:RefSeq:WP_015822826.1"
                     /locus_tag="Maq22A_c00695"
                     /note="122c0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="histidine kinase"
                     /protein_id="BAQ43647.1"
                     /transl_table=11
                     /translation="MFASARRSGTAAKLDAIERSQATVAFDLDGRILEANGNFLGLMG
                     YALDEVRGRHHRLFVDPAEAAEPAYAAFWASLRRGEFQSAEYRRLAKGGREVWIRASY
                     NPVLDARGRPIRIVKFALDITAEKQAAIDSAGQITAINRSQAVIHFAPDGTILDANPL
                     FLTAMGYDLAEVRGRHHRLFVTEAEAASPAYREFWAGLARGEYHGGEFKRRGKDGGDV
                     WIQATYNPILDATGRTLKIVKYATDITAAKQHAADTAGKIEAALRSQAVIEFAMDGTI
                     LEANGHFLKAMGYGLDEIVGRHHRMFVSPDQAASPGYAEFWAGLRAGRYASAVFQRLG
                     KGGREVWIQATYTPVLDIDGRPCKVIKFATDVTHSMTVRARAIAAAERTLSRVQAVSV
                     ATEEMHRTSTAIATQMDRSRHAVDEIQERMGAAGTATGRLDEAAQAMNGVVEAITAIA
                     EQINLLALNATIEAARAGAAGRGFAVVASEVKNLAGQARAATDRISGEIGAMQVVSRE
                     VAEALGSIRGAVDAVQGFIAETTSASERQRATTGEVSHNVQTTAAGVADLAGSLDEWL
                     VGVEERRIGDRVRTSKPGEVTVPAGPGPEETLPCILLNLSETGAKLGLARPMRLPARI
                     LLRIEGGPARPCEVVRQRGVEIGVRFMA"
     CDS             complement(136798..138939)
                     /codon_start=1
                     /gene="baeS"
                     /inference="similar to AA sequence:RefSeq:WP_010684642.1"
                     /locus_tag="Maq22A_c00700"
                     /note="122c0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="signal transduction histidine kinase"
                     /protein_id="BAQ43648.1"
                     /transl_table=11
                     /translation="MSDPLAFLAGGGRAAEMIRARDWTGHPLGGPETWPDSLRTAVSL
                     ILNSPESMILAWGPDLHFFFNETYFPLLGPRLDWAMGERFDRVWADGWDQARPIIEDA
                     FAGRSRRFVDLPWKLDTDRGEADTWWTFSYSRVLDGEGRVAGLFILTNETTAQVTATR
                     RLRESEALARQNIERVQLALSAGAIIGTWFWDLPTDRFTVDEAFARSFGLDPVLGREG
                     LSLEQVIETVHPDDRAGLIAAIDAVVIRGGAYAHQYRTRRADGHYYWLEANGRVDHAP
                     DGTPLSFPGVLIDVNERRAVAAERDRATTMLRALTETLEQRVAAQTAELMRAEEALRQ
                     SQKMEAVGQLTGGLAHDFNNLLAGISGSLELMQARLQQGRLKEVDRYVAAAQDATRRA
                     AALTHRLLAFSRRQTLDPRPTDVNRLVAGMEELIRRTVGPAIEIAVSGPADLWTVLVD
                     PPQLENALLNLCINARDAMPDGGRIGIETGHLSLDEAAARAHEMPPGDYLSLAVADTG
                     TGMAPEVVRRAFDPFFTTKPIGQGTGLGLSMIYGFTQQSGGQVRIASEVGRGTAVTLL
                     LPRHHGASEAEAVRAPRREAPRAERGETVLIVDDEPTVRMLVTEVLEDLGYTAIEAAD
                     GAAGLRVLQSDARIDLLVTDVGLPGGMNGRQMADAGRVLRPGLKVLFITGYAENAALG
                     TGQLEPGTAVLTKPFVVEALALRIRRMIEQG"
     CDS             complement(138932..139270)
                     /codon_start=1
                     /gene="argE"
                     /locus_tag="Maq22A_c00705"
                     /note="84d0016"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="acetylornithine
                     deacetylase/Succinyl-diaminopimelate desuccinylase and
                     related deacylases"
                     /protein_id="BAQ43649.1"
                     /transl_table=11
                     /translation="MMKWAIRSVLPWRRTVGARQPGPILPKAWPIRHHRGASARRAPN
                     GFAESAAPSDKTRTLRAGASLAPTSLRGARNRPSTLTGAITRRREPASQGARSPKVPE
                     VPGERRDADE"
     CDS             139254..140909
                     /codon_start=1
                     /gene="dak1"
                     /inference="similar to AA sequence:RefSeq:WP_012319842.1"
                     /locus_tag="Maq22A_c00710"
                     /note="122d0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="dihydroxyacetone kinase"
                     /protein_id="BAQ43650.1"
                     /transl_table=11
                     /translation="MAHFINDRAALVAEAVDGLVRASGGRLARLDGDPAIRVVLRAGW
                     TANRVALVSGGGAGHEPAHAGFVGRGLLTAAICGDVFASPSVDAVLAGILAVTGPAGC
                     LLIIKNYAGDRLNFGLAAERARALGLAVETVTVADDVAIPGAAQPRGIAGTLLVHKVA
                     GHAAEAGRPLAEVAAAARAAAAGIRSLGIAVSGCTLPGGTAESRLAPGEAELGLGIHG
                     EPGIERIALPPAADLAGLMTARLAGTLPADGPLALLVNNLGGTTALEMQVLARAVLAT
                     TLGARVRLLLGPAAAMTALDMHGASLSLMPLDADTEVALTAATDAPTWPLAVPVVAPA
                     TRPLPDRLARQGQEPVPSHDPAVAGAITAVCTALAAAEADLNALDARVGDGDTGTTFA
                     TAARAVLAERDRLPQVEPSALCHALSDRLARVAGGSSGVLMSIFFAATGSALAEGAGW
                     PAALTAGAARLQAHGGAKPGDRTLLDALVPALDALAAGGLAAAARAAEAGAAATAGMT
                     RAGTGRSSYLAAADLAGVEDPGAVAVARAFAALTGTAGRPAPA"
     CDS             complement(141456..142031)
                     /codon_start=1
                     /locus_tag="Maq22A_c00715"
                     /note="122c0005"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="Ros/MucR family transcriptional regulator"
                     /protein_id="BAQ43651.1"
                     /transl_table=11
                     /translation="MDETANTHDHIVTLTADIISAYVSSNHLQGAELPKLIADVFGAL
                     NEVAKGGKAAAEPAHPKATPAEIRRSISHDFLVSFEDGKSYKTLRRHLTLRGLTPEAY
                     RQKWGLPHDYPMTSASYSEQRSELARSLGLGQQRRRSAVRVEAGTDDAAEGHDAEPAD
                     ATDIPDADVDAAPEAEAPVESKPRRGRRGNA"
     CDS             142255..142467
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015926917.1"
                     /locus_tag="Maq22A_c00725"
                     /note="122d0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ferredoxin"
                     /protein_id="BAQ43652.1"
                     /transl_table=11
                     /translation="MRVVVDLNRCQAYAQCCYAAPERFVLQGDEILAYDPAPPAAERA
                     AIDRAVQACPVRAIRVEHDETAERAA"
     CDS             142464..143747
                     /codon_start=1
                     /gene="hcaD"
                     /inference="similar to AA sequence:RefSeq:WP_019904174.1"
                     /locus_tag="Maq22A_c00730"
                     /note="122d0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ferredoxin reductase"
                     /protein_id="BAQ43653.1"
                     /transl_table=11
                     /translation="MRDGTIVVAGASLAGLRGAEALRRGGFSGRLILVGDEPHLPYDR
                     PPLSKHVLTGEVAAGATTLPGVGALDAEWRLGTPAAGLDRAGRSLLLADGTRLPFDRL
                     LIATGARARPWPQADEARLAGVHTLRGRDDAAVLAAGLGARPGRVLILGAGFIGGEVA
                     SSIRALGLPVTVVDPEPAPLARALGSVLGGFMAGRMEASGVDLRPGTRVARLEGDEAG
                     RVRRAHLAEGGTIEADLVVVALGAVRNTGWLAGSGLSADEGGLSCDGACRVLDEAGWP
                     DDAIFAAGDVARFPHPLYGGRPVALEHWGNAVAQGAHAARAMLDGPDAAGAYAELPAF
                     WSSQFGLNIKSLGLLEGADAMVIVQGDPGTGRFLAVYGHEGRTIAAVAVNAGRWLPAY
                     EAPIREGAPFPPITGGADQPAPAPFPPGLPSMQAA"
     CDS             143772..145019
                     /codon_start=1
                     /gene="cypX"
                     /inference="similar to AA sequence:RefSeq:WP_015926919.1"
                     /locus_tag="Maq22A_c00735"
                     /note="122d0007"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="cytochrome P450"
                     /protein_id="BAQ43654.1"
                     /transl_table=11
                     /translation="MTDTDGTLFAQVRDPENRADPYPLYTRLRAQPVARQDDGTWVAS
                     GYAAIRALLHDPRVSSEDLPPAEHPATGNPIKDFFVNPIKDWITDRHRPFIFRDPPDH
                     GLLRRQVMGQFTVARVRGMKRRTEALVDECLRARAGATRFDLVDDLAYPLPVTVICEM
                     LGVPREDEARFHAWATQLATALEPESRNDEDLRARNTETFDAIAAYMRDLIREKRRAP
                     ADDMLSGLATTKDAQAGRMSDPDLVATAILLLIAGHETTVNLITNGMLTLLRHPDELA
                     RLRADPERAPRVIEELLRYEPPVHFRTRLTRAPIPVGDVTIPEGVPLVLLFAAGNRDP
                     ARFPDPDRFDPDREDNQHFGFGGALHYCVGAPLARIEAEAALTALVARLREPRLVEDP
                     PPYRAGASLRGPERLLLDIRGIA"
     CDS             145083..146648
                     /codon_start=1
                     /gene="hcaD"
                     /inference="similar to AA sequence:RefSeq:WP_008827829.1"
                     /locus_tag="Maq22A_c00740"
                     /note="122d0008"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="BAQ43655.1"
                     /transl_table=11
                     /translation="MAEGGGKTGKTDDKPDFARGIPAGDLPEGAMIEGTLGEDKVLLL
                     RRDGAVTAIGARCTHLGAPLAKGIVAEGEIRCPWHHARFSLETGEAVGAPAFAPLPCY
                     RAEERDGRITVTGRREAASRPEGAEPAKAPPGKVVIIGGGAGGHACAEWLARAGHGAA
                     VTLVSDDPDPPYDRTFCSKQYLSGKAPREKTMLAPDGFYGGEGPRLLRDRVVSLDLGA
                     EEIVTAGGERLAYDALVIATGAAPQKPDLPGFDRPEVHTLRSLKDADALIAAAEKARS
                     VAVVGASFIGLEVAAAMIAREKSVTVVAPDAVPLAKVLGEAVGRFVQGLHEEKGVTFR
                     LGRKVEGFDGTALTLDDGSRIEADLVVLGTGVSPRVDLAAAAGLALAQKDDGGGIAVD
                     AHLATSAPGIYAIGDVASYPDPRSGRPLRVEHWVHAQRQGQHVARTLLGETAPFTETP
                     FFWSGHYATSLRYVGHAGSAEEPRIEGEVGKGDFAVTYREDGRDAALATCKRDTRSLE
                     VEAAWDREARAAV"
     CDS             146752..147246
                     /codon_start=1
                     /gene="marR"
                     /locus_tag="Maq22A_c00750"
                     /note="122d0009"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="transcriptional regulator, MarR family"
                     /protein_id="BAQ43656.1"
                     /transl_table=11
                     /translation="MPSEDSPGLARLEGLIGYTLRRAQVAVSRSFVELFADLDVRQSQ
                     LGVLTVIEGSPGARPSQVGAAIGIKRANIGPLLDALETRALVRREPDPTDRRSQSLFL
                     TEAGEALMAELHRREAAHEERIAAFLNPDERTMLLDFLRRLEQGAREVVGDLAGDEGA
                     EEAD"
     CDS             complement(147250..147708)
                     /codon_start=1
                     /gene="fcbC"
                     /inference="similar to AA sequence:RefSeq:WP_014131480.1"
                     /locus_tag="Maq22A_c00755"
                     /note="122c0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="predicted thioesterase"
                     /protein_id="BAQ43657.1"
                     /transl_table=11
                     /translation="MTPPQDSTSDHEGFTHARTLTVEWGHCDPAGIVFNPRFFDFFDW
                     STALLCEAATGLPKAGMLARYDLLGIPLVETGARFLKPSRYGDAVEIVSTVVDVGRSS
                     FAVRHRLLKDGELAVEGRERRVWAGRHPDDPARMKAAPIPEELVRRFRGE"
     CDS             complement(147705..149510)
                     /codon_start=1
                     /gene="caiC"
                     /inference="similar to AA sequence:RefSeq:WP_011665196.1"
                     /locus_tag="Maq22A_c00760"
                     /note="122c0007"
                     /note="Catalyzes the reversible hydration of unsaturated
                     fatty acyl-CoA to beta-hydroxyacyl-CoA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology. Start codon location was
                     manually corrected by using GenomeMatcher"
                     /product="acyl-CoA synthetases (AMP-forming)/AMP-acid
                     ligases II"
                     /protein_id="BAQ43658.1"
                     /transl_table=11
                     /translation="METHRFTARDDGSLVVTATAALPPYPERLTAHLVRHAAEAPDRP
                     FLVRRGQGGTEPLTYGAALRAVERIAAALLARNLSAERPVMILSGNGFEHALVSLAAL
                     HVGIAVAPVSPAYSTVSQDHARLRAIVDLLTPGLVFAAEGATYAAAIAAAVPAGTEVV
                     IGDDAAIGRPATPFADLMQAHDPDSVAAAQAAVTPDTVGKLLFTSGSTGVPKAVVNTH
                     RMLAANQAMLQARFPALTAEPPVMVDWLPWHHTFGGNHNFNLVLANGGTLHIDEGRPT
                     PSGIRETVRALREVAPTLYLTVPKGFEALVPHLRDDAELRHNFFSRLQVTFFAAAGLP
                     QPVWDAIDDLARRTIGRTVPMVTGLGATETAPLALVTDDRPARAGQVGLPAPGVELKV
                     APVGTKREARVRGPNVTPGYWRRPDLTAAAFDDEGFYRLGDALMPVDPDDLLRGFTFD
                     GRLNEDFKLTTGIWVSVGPLRAAFLDAFQPLVRDVAIAGEARDEVTALVFPDIAACRA
                     LCGETGDDERVLAHPALRRDFARRLTAFAARATGSSNRIARLLLLAEPPALDRDEVTD
                     KGSINQRGVLRNRAEAVERLYAAPPSPAIIVPETA"
     CDS             complement(149516..150730)
                     /codon_start=1
                     /gene="livK"
                     /inference="similar to AA sequence:RefSeq:WP_015932814.1"
                     /locus_tag="Maq22A_c00765"
                     /note="122c0008"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter permease"
                     /protein_id="BAQ43659.1"
                     /transl_table=11
                     /translation="MPRRPIRRLAPALAALLSLLAPAAAAERPVKIGVLNDMSGPYAD
                     YQGQGSVIAAQLAIEDFAAKAGRPVELVSADHQNKTDIGASIARRWFDQDGVDLIVDV
                     PNSAVALAVANLAREKNKVFIGSGAGTAELTGKQCSPNTVHWTYDTWSLGHALAKALV
                     QQGGKSWYFLTADYTFGKDLEGSAAEEVKAMGGSVKGGSRHPLGTSDFSSFLLQAQAS
                     GADVIGLANAGDDTSNALKQAAEFGIAPGQRLAGLILNITNMPALGLKATQGVYIVTP
                     YYWNLDDGTRAFAARYAARHPRHAMPNDMQAGVYSAVEHYLKSLGTVKDAGDGRAVVA
                     AMKAMPTDDPIFGKGRIREDGRKLHPMYLLETKTPAESKGGWDYFKPVRTVPAEEAWR
                     PLAEGGCPLVKG"
     CDS             complement(151218..152009)
                     /codon_start=1
                     /EC_number="4.2.1.17"
                     /gene="caiD"
                     /inference="similar to AA sequence:RefSeq:WP_008354750.1"
                     /locus_tag="Maq22A_c00770"
                     /note="122c0009"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="enoyl-CoA hydratase"
                     /protein_id="BAQ43660.1"
                     /transl_table=11
                     /translation="MGEDLSGLGTESLVVTRRDAVAIVTLNRPHKRNALDDGMVLGLE
                     RIARGLPDDVRALVIAAEGPHFCAGLDLAELTERDAPAGMLHSRMWHRAFHEIEFGRV
                     PVVAALKGAVIGGGLELALSAHLRVAESSAFYALPEGQRGIFVGGGASVRLPRLIGVS
                     RMRDMMLTGRVHDAESGERLGLSHYVVAPGEGLERAIALAARAAENAPLTNYALIHAL
                     PRIAEADPATGYLTEALMTAVAQSDAEAKRRLSEFLEGRAKKVRE"
     CDS             152146..153117
                     /codon_start=1
                     /gene="fadB"
                     /inference="similar to AA sequence:RefSeq:WP_014251982.1"
                     /locus_tag="Maq22A_c00775"
                     /note="122d0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="BAQ43661.1"
                     /transl_table=11
                     /translation="MNHASGQAGAYRTAIGRVAVIGTGVIGASWVSQCLARGLAVVAT
                     DPAPGAEAALRETVARHWPVLEQIGLSPGASPERLTFVAGPEEAAADADFVQENGPER
                     LEIKHETFARLDAAAAPDVVLATSSSGLTPSAIQTACRHPGRVVLGHPFNPPHLVPLV
                     EVLGGEKTDEGAVAAAMAFYQNLGKRPIRLRRELVGHVANRLQAALWREAFHLVGTGA
                     ATVADIDAAIAHGPGLRWALMGPCLLNHLSGGSKGLAHTLDHLGPLMEAMWADLGDPR
                     LTPELKATLVEGLEQALDGRDRDAMVAQRDRLLVDLVRQKREAPDLP"
     CDS             153147..154028
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015932812.1"
                     /locus_tag="Maq22A_c00780"
                     /note="122d0011"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="3-keto-5-aminohexanoate cleavage protein"
                     /protein_id="BAQ43662.1"
                     /transl_table=11
                     /translation="MTKVIVTVAPTGGMASKAQNPNLPTQPAEIAESVHKSWKEGAAI
                     AALHARRPDDEATCNAEIYRDINRRIRERCDIILNNSTGGGSSGDMLVPRPDGLFESS
                     FEERLKGCEAGAEMATFDGMTFADVHGGREILVVTTPSRCEALAKRMQERGIKPEWEV
                     FGPQHILQDVTRLIEKGYDKPPYYINMVLGADKGFQGAMPYSHDILAAMIRMLPPQSI
                     FCVSGIGPAQLPATTQAILLGGHVRVGLEDNNYYSRGQLATNEQLVARTVRIIKELNH
                     EPASPAEARDILGLKAV"
     CDS             154043..155266
                     /codon_start=1
                     /gene="livK"
                     /inference="similar to AA sequence:RefSeq:WP_015684212.1"
                     /locus_tag="Maq22A_c00785"
                     /note="122d0012"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter permease"
                     /protein_id="BAQ43663.1"
                     /transl_table=11
                     /translation="MRALRSALLAGLIALAPAAGRAAEGAISGDVVKIGVLADMSTAM
                     SGNYGTGSVTAARLAVEDFGPTVLGRPIEVVAADHQSKPDVASTLARRWYDVEGVDMI
                     TDLGNSAVALGVQALATEKGRLALITGSGSTVITGAQCSPNGALWVIDTHALSRAIAK
                     PLVEAGEKTWFYVVADITLGKSFVADVTPVVTGGGGKVAGQVFHPLLSPDLSSQILQA
                     QASGAGVIALFNVGGDAINAVKQASEFGVLGGRQKLAGFYMTAVDVHALGLAAAGGLY
                     LAEAFYWDQDDAARAFAKRFYARQKAMPNSYQAGVYSAVMHYLKAVRTAGTDAAAPVM
                     AAMRAMPIEDVMTHGGRLRPDGRVIREVSLFRVKRPEESKGEWDVMARVATLSGDEAF
                     RPLSESDCPLVRGKP"
     CDS             154459..155742
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_019460762.1"
                     /locus_tag="Maq22A_c00790"
                     /note="122d0013"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical UPF0311 protein RPA1785"
                     /protein_id="BAQ43664.1"
                     /transl_table=11
                     /translation="MLAERRALGHRHPCPLPRHRQAAGGGGGEDLVLRRRRHHARKVL
                     RRRRDAGGDGRRRQGGGPGLPPSALARPVVADPAGASFRRRGDRALQRRRRRDQRGQA
                     GLRVRRAGRASEARRLLHDGGRRPRARARGRRRPVPGGGVLLGPGRRRPRFRQALLRA
                     PEGDAEQLPGGRLLGGDALPESRQDRRHRCGRTGHGGDARDADRGRHDPWRPPAAGRA
                     GDPRGLALPGQAPGGVEGRVGRDGAGRDALRRRGVPAALRERLPAGEGQAVTRAMTTI
                     PAPALEHVFDARILVAVPCEIGETVAGSRRVIAITGGIVSGPGLAGRVMPGGADYQTI
                     AGDGLTQLHARYVIEAEDGARIYVENTGLRFGPPEALERLRRGEPVDPALIYFRSAPR
                     FETAAPRLAWMQTSLFLATGARAPDHVALSVYRVA"
     CDS             complement(155747..156814)
                     /codon_start=1
                     /gene="atoS"
                     /inference="similar to AA sequence:RefSeq:WP_015824853.1"
                     /locus_tag="Maq22A_c00795"
                     /note="122c0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="PAS/PAC domain"
                     /protein_id="BAQ43665.1"
                     /transl_table=11
                     /translation="MSASIGGTGRPADPTSHDFMHLIEAFGLTGAWRWDFGTGRQVWS
                     SGLYRLLGLPEGEAASYERLLGLVHPADRDVLEDAAQIVQTGIFGSHTVRLIRPDGTA
                     RTVVSRGEVFFSAEGRPVSVTGVLLDVTDRERLAELHRLEQQRRASLAQQAQVFIYSE
                     ASLPPTEYGPDFLALVGLGREDVRANWLSPIVPEEWARWAEELPRLAAAGRTFSIAPT
                     LRLAAGGRAPFHLTMVPLREGAADQMGWTIVITPHDGGTAATPCGPLPRQVEQAIQGC
                     HLRAARGFLDWTLNDLARASGLSLSTVRRLEEESEGPTSRSRPHALAALRKAGIVFTL
                     VEGGTVAVARSGEGEVAPPAA"
     CDS             157140..157592
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018647704.1"
                     /locus_tag="Maq22A_c00800"
                     /note="122d0014"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43666.1"
                     /transl_table=11
                     /translation="MAWMGTKTKLLHTDDRAINIFSFVVENGKPRLLLRAHAPTYLVV
                     RGCHPGSLPSTPGLTMRPAIFDPFGERLDLRPVSEAACTAGPRRRRTRRIVGAVLFWA
                     LAAGLITARGAFFDPSTAFGPDAQARVAAQAVGPTQNLAAASDASVLR"
     CDS             157765..158481
                     /codon_start=1
                     /gene="msrA"
                     /inference="similar to AA sequence:SwissProt:B8IJD1.1"
                     /locus_tag="Maq22A_c00805"
                     /note="122d0015"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="methionine sulfoxide reductase A"
                     /protein_id="BAQ43667.1"
                     /transl_table=11
                     /translation="MRRPRLRGCKAPFRDRSDPMLFFRKRAEMPAPDQILPGRPTPLP
                     TADRHFVNGHPLKGPYPPGIETVVFGLGCFWGAERKFWQLGDGVFVTAVGYAAGTTPN
                     PTYEEVCSGMTGHNEVVLVAYDPAAMPFASLLKTFWESHDPTQGMRQGNDVGTQYRSG
                     IYLSDATRLAEAEASREAYGGALKARGFGPITTEIRDGGPFYFAEEYHQQYLAKNPGG
                     YCGLGGTGVSCPVGVGVAAE"
     CDS             complement(158605..159525)
                     /codon_start=1
                     /gene="mepA"
                     /inference="similar to AA sequence:RefSeq:WP_015927843.1"
                     /locus_tag="Maq22A_c00810"
                     /note="122c0011"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="peptidase"
                     /protein_id="BAQ43668.1"
                     /transl_table=11
                     /translation="MPIRRTAVLTVLLTLAAPALAQDRGTLHPKPLPPLANPDDPSTP
                     AKALFGRATTPAALPPQAIGGYARGCVAGAEALPIDGDTWQVMRLSRNRNWGHPRLVA
                     FLEKIAAEAPRRAGWPGLLVGDMSQPRGGPMLTGHASHQLGLDADIWLTPMPDRRLTR
                     AEREEMSATNVVRSDRRDIDPSVWRPEHLRLIKMVSREPEVARIFVNPAIKLALCREA
                     GSDRSWLTKVRPIYGHNYHFHIRLDCPAGDAACHDQDPPPSGDGCGPELDYWFSDAIL
                     NPKPRPPGKPRPPMTLAGLPDACRTVLKAR"
     CDS             159442..159633
                     /codon_start=1
                     /locus_tag="Maq22A_c00815"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43669.1"
                     /transl_table=11
                     /translation="MQGAAILREGGSGEREEDRQDGGAANRHGAKLALRSASGNPPPG
                     SAIRRSGTGTGARAPALPR"
     CDS             159676..160089
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927842.1"
                     /locus_tag="Maq22A_c00820"
                     /note="122d0016"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="photosystem reaction center subunit H"
                     /protein_id="BAQ43670.1"
                     /transl_table=11
                     /translation="MTTVAPTIGDRSDMGSQTTTQTNALIASDRVEGTAVRRPNGDSI
                     GRIERLMIEKASGKVVYAVMSFGGFLGIGEGYHTLPWSTLRFAPEMDAYVVDLTEEQL
                     RAAPPASAEGNDPSFDRGWEEHVHQYFKATPYWSV"
     CDS             complement(160201..160590)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927841.1"
                     /locus_tag="Maq22A_c00825"
                     /note="122c0012"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43671.1"
                     /transl_table=11
                     /translation="MGTRKERRSRWFLAALGLAVAAGPVAAQRAKAPGKPAPDKAAVP
                     TKVVACASLANLRILMTETAGDSAAIKARLADPKADHLGCARFGPDRVEGNAERVVVG
                     GTAYDCLKVKESSLCRWALSGVPAEAP"
     CDS             complement(160605..161018)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927840.1"
                     /locus_tag="Maq22A_c00830"
                     /note="122c0013"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ubiquinol-cytochrome C reductase"
                     /protein_id="BAQ43672.1"
                     /transl_table=11
                     /translation="MAHWLYKSEPSVWSWDDQVAAGEAGTYWNGVRNHVARKNLEAMR
                     LGEQGFFYHSNEGKAVVGIVEVIRTYYPDHTDETGRFGMVDLKAVVALPQPVTLEAIK
                     AETALREMVLVNNSRLSVQPVSESEWALVRRMGGL"
     CDS             161271..161906
                     /codon_start=1
                     /gene="rhtB"
                     /inference="similar to AA sequence:RefSeq:WP_009806812.1"
                     /locus_tag="Maq22A_c00835"
                     /note="122d0017"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="putative threonine efflux protein"
                     /protein_id="BAQ43673.1"
                     /transl_table=11
                     /translation="MIDWTWLLSTSAFAVAMSATPGPNNTMVVASGATYGFARTMPHM
                     LGIAAGFPVMLIMLGTVGLPLLADPRVHAVLKWVGAVYLLWLAWKIATADPDPATESV
                     ATPGAATLVTSGRPLGVLQAALFQWVNPKAWIIAAGALAAYTTDADGASLAATLVLAL
                     VFGLVAVPCVALWTLIGVGTARLLRSRRSVRLFNLAMAGLLVASLVPVLAE"
     CDS             complement(162000..162497)
                     /codon_start=1
                     /gene="secB"
                     /inference="similar to AA sequence:RefSeq:WP_015927704.1"
                     /locus_tag="Maq22A_c00840"
                     /note="122c0014"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="preprotein translocase subunit SecB"
                     /protein_id="BAQ43674.1"
                     /transl_table=11
                     /translation="MADSPVPNGNGGAAAQPDDLTPTLNALAQYAKDLSFENPNAPRS
                     LQPQQQGPQINIQVNVNAKQLAEEDFEVDLRLEGDAKIGAEVLFAFELTYSGIFRLRN
                     IPQDQMHPAVMIECPRLLFPFARQIIADAVRNGGFPPLYIDPIDFVGLYRQKAAEAQV
                     QGGTA"
     CDS             162976..163713
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927705.1"
                     /locus_tag="Maq22A_c00845"
                     /note="122d0018"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="calcium-binding protein"
                     /protein_id="BAQ43675.1"
                     /transl_table=11
                     /translation="MNGSMMQDSLDLTTLIFLGLAVFVIWKLRSVLGQKTGSERPPFN
                     PLARREEPPPAATREGDNVVRLPGAGAERAAAAPVATAVPRNWKGVVEPNSPAARGLD
                     LIIQQEPGFDPRGFTDGAKLAYETIVTAFAKGDRKTLKTLLSREVADGFERAIQGRER
                     AGQTVETTFVSIDRAEIVGVDVRNRVAQVTVRYLSKLITATKGPQGQVVDGSPEKVVD
                     VTDVWTFARTLGSRDPNWQLVATEAGQ"
     CDS             164056..165162
                     /codon_start=1
                     /gene="mltA"
                     /inference="similar to AA sequence:RefSeq:WP_015927706.1"
                     /locus_tag="Maq22A_c00850"
                     /note="122d0019"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="transglycosylase"
                     /protein_id="BAQ43676.1"
                     /transl_table=11
                     /translation="MLEPVALDALPGFGDDDLTAALAAFRATCRPDQPQAPVLAEAAP
                     DAPRQDLAAACAAAAAVPSEGAREFFLRRFAAYRVLRPARETPAERRAGFLTGYFEPE
                     LDGSPVPTPDFTVPALARPDDLVSLEPGETRPGLDPSLRAARREGDALTPYPDRAAIE
                     DGALGPRTRPLVWLRDAVDLLVLQVQGSGRVRLPDGRSVRLAYDGRNGLPYTSVARLI
                     VTSGHLPLEGLTLERWTGWLRAHPAIARDLIRRNASYIFFRLDDGAPETGPRGAAGAP
                     LTAGRSLAVDATLWRYGLPFWLDGALPEPEGGSVPLRRLVIAQDTGSAIVGPARGDLY
                     LGTGARAGATAGLLRDPARFVVLLPKPDAPGAAP"
     CDS             165159..165776
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012331309.1"
                     /locus_tag="Maq22A_c00855"
                     /note="122d0020"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="BAQ43677.1"
                     /transl_table=11
                     /translation="MTEPRRPRRVRRLTTEESRLWAEISRLIVPLRGRAPVPVAPSPP
                     PVSVPTPAPAPTVPPPPQFVRPAKVARPAPKGASKSASPPPPPAPVLPPLAPLERRVR
                     TGLRRGSRSVDAAIDLHGMRQSEAHAALIGFLHRSRASGHAVVLVVTGKGGGGDDPYA
                     ERGVLRRSVPHWLRLPELRPLVVGFEEAAHHHGGGGALYIRLRRR"
     CDS             166075..167388
                     /codon_start=1
                     /gene="rho"
                     /inference="similar to AA sequence:RefSeq:WP_012331310.1"
                     /locus_tag="Maq22A_c00860"
                     /note="122d0021"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="transcription termination factor Rho"
                     /protein_id="BAQ43678.1"
                     /transl_table=11
                     /translation="MIEDTLAPIETPAAPAMREVKLQDLKSKTPTELLAFAEEVEVEN
                     ASTMRKQELMFAILKQLAAKDVEIIGAGTVEVLQDGFGFLRSSDSNYLPGPDDIYISP
                     TQIRRFGLRTGDTVEGPIRGPKDGERYFALLKVNTINFENPDKIKHKVHFDNLTPLFP
                     TQRFKLELAEPTRKDFSPRIIDIVAPIGKGQRALIVAPPRTGKTVLMQNIAQSITLNH
                     PECYLIVLLIDERPEEVTDMQRSVKGEVIASTFDEPATRHVQVAEMVIEKAKRLVEHG
                     RDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLSI
                     IATALIDTGSRMDEVIFEEFKGTGNSEIILDRKVSDKRIFPAIDITRSGTRKEELLVP
                     PDALKKTYVLRRILNPMGVTDAIEFLLDKLRQTKSNGDFFDSMNT"
     CDS             167772..169085
                     /codon_start=1
                     /gene="thdF"
                     /inference="similar to AA sequence:RefSeq:WP_015927735.1"
                     /locus_tag="Maq22A_c00865"
                     /note="122d0022"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="tRNA modification GTPase MnmE"
                     /protein_id="BAQ43679.1"
                     /transl_table=11
                     /translation="MLAPDTIFAPATGYGRTAVAVVRISGPQAGPALAALIRTPLPPA
                     RRLVLRTLREPETGELLDQALVAWLPGPGTATGEDMVELHLHGSPAVRAAALRSLGAR
                     PGLVPAEPGAFTRRAFLNGRMDLTAVEGLADLIEAETEAQRRQAVRQLDGALGRAVER
                     WRDTLLDVLAGTEAALDFSDEGDVDDEALTASGRIEAARVRDEIRAVLADGRRGERLR
                     EGFTVVLAGAPNAGKSTLLNALARRDVAIVSEVPGTTRDAIEVRCDLGGLPVLLVDTA
                     GLRETSDAIEVEGVARSRRRIEQADLVLWLREPGGAEPPALPVPLRMVSTKRDVPGDR
                     TEGEIAISARTGDGLDRLLTEIEREAATSLGSGDALVTRERQRLALEACMRYLDRVAV
                     HGNTLPAELVAEDLRLAVRALGEVAGRVGVEEMLDRLFAGFCIGK"
     CDS             169181..171061
                     /codon_start=1
                     /gene="gidA"
                     /inference="similar to AA sequence:SwissProt:B0UJI8.1"
                     /locus_tag="Maq22A_c00870"
                     /note="122d0023"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="tRNA uridine
                     5-carboxymethylaminomethylmodification protein"
                     /protein_id="BAQ43680.1"
                     /transl_table=11
                     /translation="MHRDDSSFDVIVVGGGHAGAEAAAAAARYGARSALVTHRRDRLG
                     AMSCNPAIGGLGKGHLVREVDALDGLMGRVADRAGIQFRLLNRRKGPAVRGPRTQADR
                     KLYARAMQAALAETPNLTIVDGEVADLTVVDGRVAGAVLTDGRALPCRAVVLTTGTFL
                     RGLIHIGEVTMPAGRIGEAPALGLSATLDRYGFALGRLKTGTPPRLDGRTIDWHGIDK
                     QAADDEPVPFSTLTTRITTPQIECGVTRTGQAAHDLIRANLHRSAMYSGGITSRGPRY
                     CPSIEDKVVRFGDRDGHQIFLEPEGLDDPTVYPNGISTSLPEEVQHGIVRLLPGCERA
                     VILRPGYAIEYDYVDPRELDPTLQTRRIAGLFLAGQINGTTGYEEAAGQGLVAGLNAA
                     RLAGQADLAVFDRAESYIGVMIDDLVTHGVSEPYRMFTSRSEYRLSLRVDNADERLTG
                     RGIGLGCVSAGRAAHYAARQDALAQARRMLDDLSLTPSEAERHGIVLNRDGIRRSAFQ
                     LLSYPEIGWERLAAVWPQLAAIPPALAERVCTDATYAVYLDRQKADIAAFRRDEAVTL
                     PDHLDYGGIAGLSNELRLKLDKVRPLTLGQAARIEGVTPAALTLLAAHARRTPSLQVS
                     AE"
     CDS             171058..171699
                     /codon_start=1
                     /gene="gidB"
                     /inference="similar to AA sequence:SwissProt:B8IHZ7.1"
                     /locus_tag="Maq22A_c00875"
                     /note="122d0024"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="16S rRNA methyltransferase"
                     /protein_id="BAQ43681.1"
                     /transl_table=11
                     /translation="MKTSAVGRDAVLRQAGVSRETAEALDLYVAQLTRWQSIKNLVGP
                     STLAEVWTRHVADSLQLMALAPDATRWLDLGSGAGIPGLILAIAGRDRPGFHVDLVES
                     NGRKGAFLQETARLTGAAAKIHVARIETVIGGFTETQIVTARALAPLSQLLAWTAPLL
                     KNGATGLFPKGRDVLTELTEAEERWRFAADLIPSRTDSDARIVCISSVSGLLP"
     CDS             171696..172544
                     /codon_start=1
                     /gene="soj"
                     /inference="similar to AA sequence:RefSeq:WP_015927732.1"
                     /locus_tag="Maq22A_c00880"
                     /note="122d0025"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="chromosome partitioning protein ParA"
                     /protein_id="BAQ43682.1"
                     /transl_table=11
                     /translation="MIAESPEAQAGDSARPLRIIALANQKGGVGKTTTAINLGTALAA
                     IGERVLIIDLDPQGNASTGLGIDRRQRRLSTYDVLAGEAPLAEAVQATAVPRLSLVPS
                     TMDLLGLEMAMASAADRAQRLRRALEPLDRGEMPEDQRFTYVLIDCPPSLNLLTLNAL
                     AAAHAVLVPLQCEFFALEGLSQLLRTVEQVKGALNPRLAIQGVVLTMFDPRNNLSAQV
                     VADVREFMGDKVYETMIPRNVRVSEAPSHGKPVLLYDLKCAGSQAYLRLASEVIQREG
                     RLPAAA"
     CDS             172571..173479
                     /codon_start=1
                     /gene="spo0J"
                     /inference="similar to AA sequence:RefSeq:WP_018262195.1"
                     /locus_tag="Maq22A_c00885"
                     /note="122d0026"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="chromosome partitioning protein ParB"
                     /protein_id="BAQ43683.1"
                     /transl_table=11
                     /translation="MKGMAEEGARPRLGRGLAALIGDFGEDIPAATEKPKAGQRRVPI
                     EFLRPNPRNPRRHFAETELEELSASIRTRGVIQPIVVRALANLPDAFEIVAGERRWRA
                     AQRAGLHEVPVVTVEIDDRTSLEFAILENVQRADLNAIEEAAGYERLMSEFRYTQTEL
                     AEIIGKSRSHLANTLRLLQLPPSVQEHVVAGSLTAGHARALLSVKDPEGIARRVIEDG
                     MTVREVEALAAGEQAGTGPRPGRPRKAAVEKDADTRALERRLEDALGVVVSIDAKGGG
                     GEVRLRYASLDQLDGLCRRLEMQIGE"
     CDS             complement(173625..174653)
                     /codon_start=1
                     /gene="holA"
                     /inference="similar to AA sequence:RefSeq:WP_015927730.1"
                     /locus_tag="Maq22A_c00890"
                     /note="122c0016"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="DNA polymerase III subunit delta"
                     /protein_id="BAQ43684.1"
                     /transl_table=11
                     /translation="MTAVKAGEVEGLLRRGPDPRIAVILVYGPDTGLVAERARLLAEK
                     AVDDPADPFALVKLDGDVLAGDPGRLVDEAATVGLFGGKRAVWVRSGSRNYAPAVEAA
                     LKQEGADTRIVVEAGDLAKSAPLRVVCERSPRALAIPCYADDAGTLADLIDRTLRADN
                     LRITRDARDLLAAGLGGDRRASLGEIEKLALYARGQGEIGIEDVEAIGSDVSGLMLNT
                     LVDAAFAGRVAETERSYRRFQIEGMDASVMLGAALRHALTLLATRLDGEGKSPGAMVA
                     GWRGLHFRRQRIVETQLARWSPASLRRAVTLLQDAVLGARRAGGDFSHAIAADLFLRL
                     ASEAARRG"
     CDS             complement(174661..175209)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927729.1"
                     /locus_tag="Maq22A_c00895"
                     /note="122c0017"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="predicted secreted (periplasmic) protein"
                     /protein_id="BAQ43685.1"
                     /transl_table=11
                     /translation="MTGFMAGSTVKTARNLTLVATLALGLSACFRPLYGPTASGAPLS
                     AVLASIQVDPAKTAQGQERLGHYLRSELVFDLDGSGQPSDKKYRLTLTASETVQTPIV
                     SSITGRAESATLLGTAAYKVQTLSGDRTLTEGVAQGTATYDRSSQRFASLRAARDAEI
                     RLAKLLSEQIKTRVAAILATQP"
     CDS             complement(175469..178060)
                     /codon_start=1
                     /gene="leuS"
                     /inference="similar to AA sequence:RefSeq:WP_015927728.1"
                     /locus_tag="Maq22A_c00900"
                     /note="122c0018"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="leucyl-tRNA synthetase"
                     /protein_id="BAQ43686.1"
                     /transl_table=11
                     /translation="MAERYNAKDSEPHWQQVWAEREIFRTRNDDPRPKYYVLEMFPYP
                     SGRIHMGHVRNYAMGDVVARYKRAKGFNVLHPMGWDAFGLPAENAAMQNKVNPRDWTY
                     ANIATMRTQLQSMGLSLDWSREIATCDPEYYKHQQRMFLDFLKAGLVSRRTAKVNWDP
                     VDHTVLANEQVIDGRGWRSGALVEQRELTQWFFKITDFAQDLDDRLDTLERWPEKVRL
                     MQRNWIGRSEGLELRFALETAPEGAASEVTVYTTRPDTLFGAKFLAVAADHPLAAAVA
                     RDNPALQDFIAECRRMGTAQAAIDTAEKLGFDTGLKVRHPLDPSWTLPVYVANFVLME
                     YGTGAVFGCPAHDQRDLDFANKYGLGNTPVVCPPDQDPASFTITDTAYDGDGRMINSR
                     FLDGMDTDTAFKTVADRLEAETLDGASVGKRRVQFRLRDWGVSRQRYWGCPIPVIHCD
                     ACGAVPVPVADLPVRLPEEVSFDVPGNPLERDAAWRNVPCPSCGKPARRETDTMDTFV
                     DSSWYFARFTAPWLEDAPTDKAVADHWLPVDQYIGGIEHAILHLLYSRFFMRAMRQTG
                     WAGVDEPFAGLFTQGMVVHETYRDEAGAWVQPVDVRIVSEDGARKAFHVKTEAPVTIG
                     AIEKMSKSKKNVVDPDDIIASYGADTARWFMLSDSPPERDVIWTEDGVQGASRFVQRV
                     WRMVGEVAEGGAEPAGTANQAVLKAAHKALAAVGEDIERLRFNRCVAHVYELANSLQE
                     AVAAERGHAPSPALREATLILVQLIAPMMPHLAEACWTALGQDGLVAEAGWPEVRGDL
                     LVEDSVTLPVQINGRKRADVTVPRDADQAAVQAAVLALEPVQRALEGKPPRKVIVVPL
                     RIVNIVV"
     CDS             178222..178926
                     /codon_start=1
                     /locus_tag="Maq22A_c00910"
                     /note="122d0027"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="alanine racemase domain protein"
                     /protein_id="BAQ43687.1"
                     /transl_table=11
                     /translation="MIDPQTVTSNLAEVRSAIARAAEDSERDPAGVALIAVSKTVPPE
                     GIQPALESGQRCFGENYVQEAKAKWPALRESCPDVELHLIGPLQSNKAREAVELFDVI
                     HTLDRTSLAAALGKEIRRSGRHPRLLVQVNTGEEPQKGGVAPGAVEAFLAECRDVHGL
                     TVSGLMCIPPAEDPPSAHFGLLAAIARRHALPLLSMGMSADYPAAIQMGATHVRVGSA
                     IFGARQPKDAAEDEKG"
     CDS             complement(178937..179137)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927726.1"
                     /locus_tag="Maq22A_c00915"
                     /note="122c0019"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43688.1"
                     /transl_table=11
                     /translation="MLDAYTATEIVRARQIHAVEGPRGTLWNGSARYRDGLPNSPVLL
                     TDEDRVRFLEQAREEIRCLHAN"
     CDS             complement(179313..179846)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927725.1"
                     /locus_tag="Maq22A_c00920"
                     /note="122c0020"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="L,D-transpeptidase catalytic domain protein"
                     /protein_id="BAQ43689.1"
                     /transl_table=11
                     /translation="MKRTTLSHLRVRPNPLDRRRGTLIAGPVLIPCALGKGGQRQVKR
                     EGDGASPRGTFRLRGGFYRPDRLGTRPPTALPLRAIRPGDGWCDDPRDRRYNRPLALP
                     APGISAEAMWRDDGLYDLVIDLDYNRGPIRPGHGSAIFLHVARPGFRPTEGCVALRRP
                     DLVRLLRRLGPGTRLTI"
     CDS             179958..180614
                     /codon_start=1
                     /gene="dnaQ"
                     /inference="similar to AA sequence:RefSeq:WP_015927724.1"
                     /locus_tag="Maq22A_c00925"
                     /note="122d0028"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="DNA polymerase III"
                     /protein_id="BAQ43690.1"
                     /transl_table=11
                     /translation="MPEPTPSPVPDWLCWLPPRLVALDVEATGLSAGDRMVSVGAVAL
                     ATASLAAGRPEIVCHHLVVDPGRTSHPAALAVHGYDDWLLRHQDPAALHLPALAQVLA
                     GADLVVAHNAAFDLGLLNREMALAGLPPVAPRVYCTMEAYRRRGEKGRAALDAVCRRI
                     GLARSGARHGALEDAWLALRAYLWLQACPVAVARPELAAPSNLRPVPPRPEGPLPPRG
                     "
     CDS             180784..181470
                     /codon_start=1
                     /gene="ompR"
                     /inference="similar to AA sequence:RefSeq:WP_012331332.1"
                     /locus_tag="Maq22A_c00930"
                     /note="122d0029"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="regulator"
                     /protein_id="BAQ43691.1"
                     /transl_table=11
                     /translation="MSNAHRLLVVDDDPTLRDTLTEQLALSDAFDVVTAETAQGAMER
                     VAAERIDLVVMDVGLPDLDGREAVRQMRHGGFRGPVIMLTGQASDADTVQGLDAGAND
                     YVTKPFKLAVLLARIRAQLRQYEASEDAVFQIGPYTFRPGAKLLVGERGSKLKLTEKE
                     TAILRFLYRAGRQVVGRDTLLAEVWGYNAQVTTHTLETHIYRLRQKIEPNPATASILV
                     TEGGGYKLLP"
     CDS             complement(181491..182648)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012335699.1"
                     /locus_tag="Maq22A_c00935"
                     /note="122c0021"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="alanine racemase"
                     /protein_id="BAQ43692.1"
                     /transl_table=11
                     /translation="MGGEARPETDEAGGARSGDRAMIPLSLREEIARRYGTPAVVVDL
                     DRVERNIARLQAACDAAGLANRPHIKTHKSPVLARMQIAAGARGITCQKLGEAEVMAA
                     AGIDDILVSYNLVGPHAVGRLGRLLRESPVRLTVAADNPVTVAGLEEAARAGGRTLDV
                     VVECDTGRKRAGVETPGEAVALARDIAARPGLAFAGLLLYPPAGAAAGAQAFLDEAKA
                     GLAAHGLEARIVSTGGTPNLPELGEIRGATEHRAGTVIFNDRMMMEAGVAGLEECALA
                     VLARVVSRAGPERGILDAGSKTLTSDTGGGLDGFGLLPDHPGARIHAFAEEHGFLDLS
                     ACTDRPPVGTLVEVVPNHVCVVVNMVDTLVTVRGGAIVGTLPVAARGLITS"
     CDS             182809..184350
                     /codon_start=1
                     /gene="pleD"
                     /inference="similar to AA sequence:RefSeq:WP_012454476.1"
                     /locus_tag="Maq22A_c00940"
                     /note="122d0030"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="response regulator containing a CheY-like
                     receiver domain and a GGDEF domain"
                     /protein_id="BAQ43693.1"
                     /transl_table=11
                     /translation="MHPRARRRGPAASRMLAGSIVAVTLVIGAASGLTVMQMRRSAWE
                     QVGRVSQNLLEAVEHMVDRNIEFYDLSIRAVVDGLQNPAIDESPPELRQLALFDRAAT
                     ANGLGAILALDPQGQAFADSASAVPRAQAYPSADFFLVHKQREDVGLYIGKPFRMAPD
                     GRWVIPLSRRLAYADGAFAGVVMGTIDIGYFNGLFARLSIGDQSRIAFFRESGELLVR
                     SPVVESMIGQNLSFLAHFRRFFEGNAGQFVATGHPDGVEALFTYCRVGHHPLVATAVV
                     PTEVITALWRPKAVAIGVLVAILCGGMIALTLRLQRELERRSRAETLALDANRDLARL
                     AHTDGLTGLPNRRHFDEAFARAQEQDMGRGQAPRRATFSLVLLDADRFKVYNDTYGHL
                     AGDEVLRTVARVLQRQIRGPAEIACRIGGEEFAVLLPGVSRAEAVARAERIRLAVARL
                     LIPHAGNEGGGVTVSLGVAEAGPGESGGRCFAAADAALYEAKRRGRNRVMAAPADDAT
                     SAQVA"
     CDS             184518..184970
                     /codon_start=1
                     /gene="crp"
                     /inference="similar to AA sequence:RefSeq:WP_015927722.1"
                     /locus_tag="Maq22A_c00945"
                     /note="122d0031"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="cyclic nucleotide-binding protein"
                     /protein_id="BAQ43694.1"
                     /transl_table=11
                     /translation="MALDDDIAILAAAPLFGLMDRDALRLISFAAERRRLAPGAVLFS
                     RGAPADGGFVVTSGIVVLEPRSPHGAPVEAGPSALIGQTALFLPLERPSTARAGDEPV
                     EVMVVTQALMRRVLEVFPDAAAVIHDALADELAALTRTFAGSRAADPA"
     CDS             185037..185882
                     /codon_start=1
                     /gene="dapD"
                     /inference="similar to AA sequence:SwissProt:B8IHY5.1"
                     /locus_tag="Maq22A_c00950"
                     /note="122d0032"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="2,3,4,5-tetrahydropyridine-2,6-carboxylateN-
                     succinyltransferase"
                     /protein_id="BAQ43695.1"
                     /transl_table=11
                     /translation="MSHADLARTIEAAWEDRAAVGADTRGPVREAVDAALALLDSGQA
                     RVAEKAEGGDWHVNQWLKKAVLLSFRLNDMALIEGGPGGGGWWDKVPSKFEGWDAARF
                     RAAGFRAVPGAVVRRGAHIAPGVVLMPSFVNLGAHVGEGSMIDTWATVGSCAQIGKHC
                     HISGGAGIAGVLEPLQANPVIIEDNCFIGARAEVAEGVIVGEGSVLSMGVYIGASTKI
                     IDRATGEVTYGRVPPYSVVVSGTQPGKALPDGTPGPSLYCAVIVKRVDAGTRAKTAIN
                     DLLRD"
     CDS             complement(185943..186806)
                     /codon_start=1
                     /gene="panC"
                     /inference="similar to AA sequence:RefSeq:WP_015927720.1"
                     /locus_tag="Maq22A_c00955"
                     /note="192c0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="BAQ43696.1"
                     /transl_table=11
                     /translation="MTPPPSPSAVLRLGDVAALRAQVRAWRNAGETVALVPTMGALHE
                     GHLALVRQAQARCRRVVVSIFVNPTQFGPNEDFSRYPRVLEDDIALLAETGADAAYLP
                     DVATMYPPGFATTVTVEGLTDVLCGPVRPGHFAGVATVVTKLLLQALPDVALFGEKDF
                     QQLQVIRRAARDLDVPVAIEGVPTVREADGLALSSRNRYLSDEERRAAPTIHAVLQRV
                     AAAVRGGAATAPALAEGRAALEAAGFGPVQYLSVNDAESLAPLERVAGPARVLVAAYL
                     GRTRLIDNVAV"
     CDS             complement(187107..187445)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927719.1"
                     /locus_tag="Maq22A_c00960"
                     /note="192c0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43697.1"
                     /transl_table=11
                     /translation="MGHSVRLLAGAIVLGLAGTAMAADMPEPGYWPEPRRVPGPVPAP
                     RYFPRGDSDASLGTRGDPGCQGFVPTNAPGDPTYVGSPFGIGKPSYYGFPPPRGVDDP
                     YGRRLSRGCW"
     CDS             complement(187509..187979)
                     /codon_start=1
                     /gene="ebsC"
                     /inference="similar to AA sequence:RefSeq:WP_015927718.1"
                     /locus_tag="Maq22A_c00965"
                     /note="192c0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="prolyl-tRNA synthetase"
                     /protein_id="BAQ43698.1"
                     /transl_table=11
                     /translation="MSKTTRATQVLARAGIPHTVHAYDYDPEATRIGLQAAEAMGVSP
                     GEVFKTLMAAVDGKPVCVLVPSDREVSLKKLAAAFAGKSAAMMRPPEAERLTGYHVGG
                     ISPLGQKRAVPPLVDAAALALPEIFVNGGQRGLQVRVRPDDLVRVLQARTEAVT"
     CDS             complement(188020..188919)
                     /codon_start=1
                     /gene="penP"
                     /inference="similar to AA sequence:RefSeq:WP_015927717.1"
                     /locus_tag="Maq22A_c00970"
                     /note="192c0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="beta-lactamase"
                     /protein_id="BAQ43699.1"
                     /transl_table=11
                     /translation="MSDLALSRSATGLTRRAALIGAALATCAVRGAAAMEDAAARLAQ
                     LERRDGGRLGVEVRDTATGRRFGHRADERFPMCSTFKAIAAAAVLARADKGQDDLNRR
                     ISYGRDDLLSYAPVTSKNVETGMTLAELCAAAVVWSDNTAANLMLATMGGPAGITAFA
                     RAHGDGVTRLDRTEPTLNTAIAGDPRDTTTPAAMVGLLDNVLLGQALSAESRGKLVGW
                     MHESPTGLKRVRAGLPEGWRTADKTGTGDNGTANVVALIHRPDGAPILAAVYLTGSPA
                     EPAARDTLHAEVGRLIARSFPGA"
     CDS             complement(189124..189345)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012317283.1"
                     /locus_tag="Maq22A_c00975"
                     /note="192c0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43700.1"
                     /transl_table=11
                     /translation="MSTSTKTDAADRHHGGPGSSHQRPDRPDPTAQAGPAPGEATSDS
                     RSHVSGGGGERDRHHAHDPDGKGRSPRSH"
     CDS             complement(189367..189552)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012334856.1"
                     /locus_tag="Maq22A_c00980"
                     /note="192c0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43701.1"
                     /transl_table=11
                     /translation="MTASPPPVPPANRSDKGPGSAERAPTETGAKDTGQTRDPDKIGQ
                     SGNAKVNTTHQGHQQDR"
     CDS             complement(190335..191048)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012330443.1"
                     /locus_tag="Maq22A_c00990"
                     /note="192c0007"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="Asp/Glu/hydantoin racemase"
                     /protein_id="BAQ43702.1"
                     /transl_table=11
                     /translation="MIRLGMLTPSSNTRLEPATADLLHAAPGITAHFSRFRVTEITLS
                     AAGLGQFDEAPILSAAGLLADAKVDAIAWNGTSAAWLGFARDEALCARITDVTGIPAA
                     TAVLGFRDAFTRAGIRRVGLVTPYTGDVQARIQANWEAAGFDCTAERHCGLSDNFSFA
                     EVPASEVAAMARAVAAEGAQAVAIVCTNMAGAAMVEELEAELGIPVFDSIAVTLWAAL
                     RAAGADPGRITGRGGLFRL"
     CDS             complement(191048..191818)
                     /codon_start=1
                     /gene="tauB"
                     /inference="similar to AA sequence:RefSeq:WP_012330444.1"
                     /locus_tag="Maq22A_c00995"
                     /note="192c0008"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BAQ43703.1"
                     /transl_table=11
                     /translation="MSAIDLADVQKVFRDRDGRDLVAVDRTRATIEAGEFVCLLGPSG
                     CGKSTLLNMIAGFEAPSTGEVRVAGRRVERPGADRGVVFQQPTLMPWLTVIDNVAFHL
                     KLKGMGKAERHERAKTYIDLVGLTGFERHYPAELSGGMSQRVGIARALLMNPAVILMD
                     EPFAALDAQTKIEMQEELVAIWQRVGATVVFVTHSVDEALVLASRIAVMSRRPGRIRE
                     FIPFDLPRPRDVTSPDFNDMKRRVLGMIREESTRKAAA"
     CDS             complement(191850..192713)
                     /codon_start=1
                     /gene="tauC"
                     /inference="similar to AA sequence:RefSeq:WP_018262783.1"
                     /locus_tag="Maq22A_c01000"
                     /note="192c0009"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter permease"
                     /protein_id="BAQ43704.1"
                     /transl_table=11
                     /translation="MASATETAPLAPATPAPARRLPRRLVAFAERAALPLLLVAGWEA
                     FARSGVLPAALLPAPSAVLHALGDWLFGIDESTQTYSGHWVADALASLTRVAAGYAIA
                     AVSAVLIGVAIGWWRLVERTVEPTLQMLRPIPPVSWIPLAIIWFGIADKPAIFLVFLG
                     AFFPVLMNTIHGVRGVDRNLIRAGAMMGASERQLLTDIVLPAALPSIFSGLRIAIGSA
                     WMLTVTAEMVAVKSGLGYVLWDSYYFLRYDIVLAAMISIGLLGYLSDLGLKALMASVL
                     HWQKGTTVQGR"
     CDS             complement(192697..193707)
                     /codon_start=1
                     /gene="tauA"
                     /inference="similar to AA sequence:RefSeq:WP_018262782.1"
                     /locus_tag="Maq22A_c01005"
                     /note="192c0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BAQ43705.1"
                     /transl_table=11
                     /translation="MRRSLGPLLAAALWSVTPGFLAPASAQEAPVKVGYAKCAHCLPV
                     ALLPGLAKGATIEATGFNSGNDVLTALIAKSLDVAQVTYLHYVTALDKGFDIVAVAGE
                     VNGGSECLSSKALNLTADDWGGFKAAVEKAKAAGTPLKVAASRGNAQDIHMRGAFLKQ
                     GINPNKDVQFVNIPNPSDHLAAMQRGEIDMVCSVEPFASQIRMAGAAVRFVLPYDQAA
                     GNLTNLIVTRSDVIAKNRAGVQAVVDADVALVEKLKADKGVWVDVINQKTGLSKEVAA
                     AAIENAEPDYRMHRAKTLAIAAMMRDLKYIGRDVSADVEKHMDFSFLEAATRKTRDGL
                     GY"
     CDS             193953..194672
                     /codon_start=1
                     /gene="gntR"
                     /inference="similar to AA sequence:RefSeq:WP_018262781.1"
                     /locus_tag="Maq22A_c01010"
                     /note="192d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="transcriptional regulator"
                     /protein_id="BAQ43706.1"
                     /transl_table=11
                     /translation="MDPVRRPRGRPRKPVLLEPEALSPRRGLHDQAVERLRALIVAGT
                     LPAGSALVETELSAALGISRTPLREALKLLAVEGLVELRPNRSPLVAELRPDAVSELF
                     EAIAAIERAAAELAALRATAADLSGLRRLQAEMEVHHAAGDLAPYFALNQRIHALIVA
                     CARNGPLREAHAALHARAEIARRRALDSRARWDESVAEHRAILDALEARDAAGAGRLL
                     AEHVGHTGTALLAGLARPAAA"
     CDS             194713..195456
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012330448.1"
                     /locus_tag="Maq22A_c01015"
                     /note="192d0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="Asp/Glu/hydantoin racemase"
                     /protein_id="BAQ43707.1"
                     /transl_table=11
                     /translation="MRLLLLNPNTSRDVTELMRATAAAVAAPGTEILTATAPRGVPYI
                     ATRAEAQIGGAIALEMLAEAAPVDAAIIAAFGDPGLSGARELFDHPVIGLAEAAMLTA
                     CTLGRRFGLVTFARALVPWYEETVAAHGLERRCAGVRALEGRFSALSAVQDEKEGQLL
                     ELARAMVEEDGADVLIFAGAPLSGLGPRVRERLPVPVVDQVVAAVKLAEAVAAQRPRK
                     ATAGTFRRPDPKPSTGLAPALAARIGRTD"
     CDS             complement(195476..197746)
                     /codon_start=1
                     /gene="tar"
                     /inference="similar to AA sequence:RefSeq:WP_012330719.1"
                     /locus_tag="Maq22A_c01020"
                     /note="192c0011"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="chemotaxis protein"
                     /protein_id="BAQ43708.1"
                     /transl_table=11
                     /translation="MSAMLTIRTKLISTLGLFLIPIALLSGLFVIQSRKDIDFASREQ
                     AGVAYLQTAWPILRAATLSRIPAATTGDDWAAFEAAHARHDPVMGTGEAARDLALARG
                     KDPAAIVEAARTLVTKIGDGSNLILDPDLDSFYVMDAVAVRLPDLLQQAGTLAALAVE
                     LRGKPALTPGDAARFLIEQGKLRATAEGLQASLKAASKANADGTVEGALAAPATAVVA
                     AFEALDRPVAALAEAHAAGRQTAADLALFQRAATDLVARADRLWADGAVALDRLLAAR
                     VAGLQNRLVVALGIAGSVTVLAFLLAFLLTRSVVQGLAGLDRRVRALADQSLDADVPE
                     AGGRDEIAALARAIVHFRDRTAESIARASDDEHRRAMIEQERRFMAQLADRIRDTVGG
                     GVRHFQEVAVTMQDASAGVQDHATDTRERLSRSVEDLNGTAAEVAGAASAVTQLSASI
                     GEIAGQAAQSTAAMQDARAQAAAARTLAVQLSELSDRIGSITGLIHSIAGQTNLLALN
                     ATIEAARAGEAGKGFAVVAAEVKSLAAQTTRATEEIDRQVGSLRAASGSVLGAVDGIA
                     TTVGTIADIGTSIASAVEEQNAATGEITQMMQTVANRTQTVITGIAVLPGLARETDAL
                     ATRLAAMASDLSGEAGLVNGEINHLLVEIADRRGGERFPAAAEVGVTVAGRHHRSTLQ
                     DVSATGARLTAFGTPLPVGTAVTIELGGASHQARVIWSDEGQFGITLSSGPLDARTLC
                     ALKAPGAAAAPTRKAA"
     CDS             complement(198041..198739)
                     /codon_start=1
                     /gene="cynT"
                     /inference="similar to AA sequence:RefSeq:WP_015933673.1"
                     /locus_tag="Maq22A_c01025"
                     /note="192c0012"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="carbonate dehydratase"
                     /protein_id="BAQ43709.1"
                     /transl_table=11
                     /translation="MADDLSFPPALADGYRAFLDDRFVREQDRYASLAEGQSPEILII
                     SCCDSRVSPEVIFDARPGELFVVRNVANLVPPFETGGEYHGTSAALEFAVQALKVKHI
                     VVLGHARCGGVRAFADDAAPLSPGDFIGRWVSLIRPAAEALGDEPRGPDYLEQLEFAT
                     VTNSLKNLMTFPCVKILVERGKLQLHGAHFGIATGQLRVRDPETGEFRLAEPGRAAAQ
                     TKLIRCQDEAGSGG"
     CDS             complement(198778..199305)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015933672.1"
                     /locus_tag="Maq22A_c01030"
                     /note="192c0013"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="NUDIX hydrolase"
                     /protein_id="BAQ43710.1"
                     /transl_table=11
                     /translation="MTDASADLPTRDIARALVLDPAGRLLLIAYEASRDVDPGRPGDR
                     TFWFMPGGGIEPGETPEEACRRELEEEIGVQDAPLGPQVARCDGAFTLFNKSRFARER
                     YFVVRLPDDKVDTSRLAETEDNPVYGTRWWPLDELAATHERVEPRGLADLAKRLVAGE
                     TIPEVVTLSWGPGAA"
     CDS             complement(199302..200036)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015933671.1"
                     /locus_tag="Maq22A_c01035"
                     /note="192c0014"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="NUDIX hydrolase"
                     /protein_id="BAQ43711.1"
                     /transl_table=11
                     /translation="MPWVAGVDGCPGGWVAVFGPSDGHDPEKIRARVLPSLEAICDAP
                     EAPAIVAVDIPIGLPDRVGPGGRTAEVLVRALLGPRRASVFPTSARSVVYAPDYTAAI
                     ALSRRPETQPFAPSPPANAIFPRIREADGLLRARTELQARVYEVHPELAFQGLNGGTP
                     LPEPKRKPAGAALRRDLLARAGLPADLPVPKGAKPDDLLDALAAFAVARAIAKGRGVP
                     YPDPPERDAHGLTAAIWTLPHSEAPR"
     CDS             complement(200282..201562)
                     /codon_start=1
                     /EC_number="1.4.99.1"
                     /gene="dadA"
                     /inference="similar to AA sequence:SwissProt:B8IJ86.1"
                     /locus_tag="Maq22A_c01040"
                     /note="192c0015"
                     /note="catalyzes the oxidative deamination of D-amino
                     acids; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="amino acid dehydrogenase"
                     /protein_id="BAQ43712.1"
                     /transl_table=11
                     /translation="MRVLILGGGVVGVTSAYYLAKAGHEVTVLDRQPGAGLETSFANA
                     GQVSPGYSAPWAAPGIPVKAMKWLMMRHRPLVLWPSLEPKLYGWLAKMLANCTEDAYR
                     RNKGRMVRLAEYSRDVLRDLRTETGITYDHREKGTLQLFRTQKQLDHVGDDTGVLDEY
                     GVPYEVLDPAGCIAAEPALARVGGSFVGGLRLPGDETGDAHLFTQRLAAICESMGVTI
                     RYGATITSLRQEGGRIVGVGLAGTGSAGGEVLTADRYVAAMGSYTPMMLKPLGIELPV
                     YPVKGYSLTLPVTNAEAAPVSTVMDETFKVAITRLGDRIRVGGTAELAGFSQALRGPR
                     RATLERSVLDLFPQGGDVSQAKFWTGLRPMTPDGTPIVGATAYDNLYTNTGHGTLGWT
                     MACGSGRLLADLIGGRAPEIDHQDLAESRYAKAA"
     CDS             201733..202182
                     /codon_start=1
                     /gene="lrp"
                     /inference="similar to AA sequence:RefSeq:WP_015927800.1"
                     /locus_tag="Maq22A_c01045"
                     /note="192d0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="transcriptional regulator"
                     /protein_id="BAQ43713.1"
                     /transl_table=11
                     /translation="MAGRDEIDARILRVLRDDGRISNADLAAKVGLSPSACLRRLRLL
                     ESNGTIRGYTAVIEADEREHHMVVLTQITLERQTEESLNRFEAAVRRCPEVRDCYLMT
                     GLSDYLMRIEVSDAGDYERLHKEVLSRLPGVARIQSSFAIRTVVGRG"
     CDS             202313..202600
                     /codon_start=1
                     /locus_tag="Maq22A_c27720"
                     /note="192d0005"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="uncharacterized protein conserved in bacteria"
                     /protein_id="BAR47050.1"
                     /transl_table=11
                     /translation="MRVISNKSLVDFATLHPAAAKPLQAWRKIVESNTFSSFSGLKST
                     FNSTDRVGAFYIFDISGNKYRIVASIHFNTQKLFIRHVFTHKEYDAWNACP"
     CDS             202582..203007
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018440869.1"
                     /locus_tag="Maq22A_c01050"
                     /note="192d0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="Predicted transcription regulator containing
                     HTH domain"
                     /protein_id="BAQ43714.1"
                     /transl_table=11
                     /translation="MECLPLSRDDVATLSHHFAVITRKIPLHPIADDAQYEAAIEAMN
                     GLIDAGAGDDCHALAPLLGLLGVFIADYEDAALPRPDVPPAEVVRLLMDQHGLKQGDL
                     PEIGSQGVVSELLSGKRELNRNQIARLSERFGVSPATFF"
     CDS             complement(203015..203710)
                     /codon_start=1
                     /gene="gntR"
                     /inference="similar to AA sequence:RefSeq:WP_007854771.1"
                     /locus_tag="Maq22A_c01055"
                     /note="192c0016"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="transcriptional regulator"
                     /protein_id="BAQ43715.1"
                     /transl_table=11
                     /translation="MNAVFAGAQRLRDRSRHAAPQVFDLIRDKIVSLDLAPGTVLSRP
                     ELQASFGLSATPIRDALLRLQEEGLVDIFPQSSTVVSRIDLAAARQAQFLRRAVEQEV
                     VRTLARAPDRALVARLQAFVAEQALFAEAGDFARLSASDEAFHRALCEAAAVPDLWDL
                     IRRRSGHIDRLRRLHLPVEGKAQQIVADHRRIVAALAEGEPEAAQEALRDHLSKSIAL
                     GDEIRARWPAYFA"
     CDS             203883..204902
                     /codon_start=1
                     /gene="tauA"
                     /inference="similar to AA sequence:RefSeq:WP_011083213.1"
                     /locus_tag="Maq22A_c01060"
                     /note="192d0007"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BAQ43716.1"
                     /transl_table=11
                     /translation="MIHSPTRRALAAGFLAAGLLASGSARAQQKSDVAITRQPGIIYL
                     PTHVIEKQGLIEKHAERLGVPGVKTKWLTFTGGGSQTDALLAGNVDIVNTGTGNLLLL
                     WDRTRGGVKGIVATSALPLLLVSRDPKIRTIKDIGPGDKVAVPTVKVSTQAILLQMAA
                     GEAYGADQSGRLDANTVQLGHPDAAIALANPTHEIKTHFAAPPFQYVELRTVPGAHIV
                     ARSPDIIGGPLTQGQFFTTTKFADANPKIVQAVRAASEEAQAFIRQDPAKAVEIYREV
                     TGDKTSAEDLLSYLAEPGMMEFNLQPQGTMRFAEHLGRIGTLRTKPKAWTDYYLPVAH
                     DLSGS"
     CDS             204932..205696
                     /codon_start=1
                     /gene="tauB"
                     /inference="similar to AA sequence:RefSeq:WP_006612087.1"
                     /locus_tag="Maq22A_c01065"
                     /note="192d0008"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter"
                     /protein_id="BAQ43717.1"
                     /transl_table=11
                     /translation="MTALLDVRGVTLRYKTPNVLVTATERVSFRVETSDRFVLLGPSG
                     CGKSTLLKAVGGYLHPSEGEIRIKDRVVKEPGADRMMVFQEFDQLLPWKTVLENVTFP
                     LLNARKMSRRAAEERARAYIEKVGLTRAIDSYPHTLSGGMKQRVAIARGMAMEPDILL
                     MDEPFAALDALTRRTCQDELLQLWEETKFTVLFVTHSIAEAIKIGNRILLLSPHPGRV
                     KAEVRDVDKVSSQDGSAGQLEQQIHDLLFSDEPAHH"
     CDS             205720..206607
                     /codon_start=1
                     /gene="tauC"
                     /inference="similar to AA sequence:RefSeq:WP_018456627.1"
                     /locus_tag="Maq22A_c01070"
                     /note="192d0009"
                     /note="catalyzes the formation of 3-methyl-2-oxobutanoate
                     from 2,3,-dihydroxy-3-methylbutanoate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology. Start codon location was
                     manually corrected by using GenomeMatcher"
                     /product="ABC transporter permease"
                     /protein_id="BAQ43718.1"
                     /transl_table=11
                     /translation="MSSTTSITTGSPMPARIIMSEAAPAADGAVERQLGTAEILWNSG
                     FVRKTVIIVVLALVWEIYARFLDNPLLFPTFSDTVTTLWQQTLDGTIPNRALTSIKVL
                     LMGYVAGILLAATLTMVAISTRIGTDFLETMTAMFNPLPAIALLPLALIWFGLGNGSL
                     VFVLIHSVLWAVALNTHSGFRGVSNTLRMVGRNYGLKGLPYVTKILIPAAFPSILTGL
                     KIGWAFAWRTLIAAELVFGVSSGAGGLGWFIFENRNLLDIPAVFAGLLTVIIIGLVVE
                     NLIFRTLERRTVQKWGLQH"
     CDS             206712..208508
                     /codon_start=1
                     /EC_number="4.2.1.9"
                     /gene="ilvD"
                     /inference="similar to AA sequence:RefSeq:WP_007002551.1"
                     /locus_tag="Maq22A_c01075"
                     /note="192d0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="BAQ43719.1"
                     /transl_table=11
                     /translation="MARDPLPPPELEPGAVPDGPQAVRREPSSLRSARWFGPADLRSF
                     GHRSRAMQMGYAPEEWTGKPVIAILNTWSDLQPCHAHFKHRVDDVKRGILMAGGFPVE
                     LPAISVSESFVKPTTMLYRNMLAMETEELLRSHPVDGAVLMGGCDKSTPGLLLGATSM
                     NLPAIYIPAGPMLRGNWQGKVLGSGSDSWKYWDELRAGKITDQDWLGIEGGIARSYGT
                     CMTMGTASTMTAIAEAVGMVLPGGSSIPAADAGHIRLSSESGRRIVDMVWEDLTPQRI
                     QTREAYENAIAVAMAMGCSTNAIIHLIAMARRAGHAIGLDDFERYSRIVPVIGNVRPS
                     GSTYLMEDFFYAGGIRALMNEIREHLHLDCLTVSGRTLGEVIEGAKVHNADVIRPLSN
                     PVYGQGSLAVLKGNLAPSGCVIKPAAMDQRFLKHSGPALVFDDYPSLKRAIDDENLDV
                     TADHVLVLRNAGPQGGPGMPEWGMLPMPKKLLKEGHRDMLRLSDARMSGTSYGACVLH
                     VAPESFVGGPLALLRTGDIVSVDVEARAIRMEVSDEELAQRRAAWTPPAPRYERGYGV
                     MFSRHIQQADEGCDFDFLRTEYGAPVPEPAIY"
     CDS             complement(208512..209297)
                     /codon_start=1
                     /gene="iclR"
                     /inference="similar to AA sequence:RefSeq:WP_007253624.1"
                     /locus_tag="Maq22A_c01080"
                     /note="192c0017"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="transcriptional regulator"
                     /protein_id="BAQ43720.1"
                     /transl_table=11
                     /translation="MSTDVSGETARSRLFVHSVEKCFSVLEAFHGVRALSLQEISERS
                     GHDKSTCQRMVHTLAQLGYLDQCATTRRYALADRVLDLSYAFLRHHPLIERATPILMD
                     LRRTCDARVDLSLFSQSSLVYALRLQARAEHYYTNLVGRRIPLFCSAGGRAVLAVLAE
                     PEARALVTAEDRRPLTRFTRTGIEDVMTAVAEARRDGYAVAAHEVIEDEVVVAVALTD
                     AARRPFGALHVAGEAGRWGDPDEIARILPGLMRAAALVGGAPA"
     CDS             209329..210684
                     /codon_start=1
                     /gene="proP"
                     /inference="similar to AA sequence:RefSeq:WP_007435158.1"
                     /locus_tag="Maq22A_c01085"
                     /note="192d0011"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="major facilitator transporter"
                     /protein_id="BAQ43721.1"
                     /transl_table=11
                     /translation="MQRIAWQYERAGNRMDGTVATIGAGQVRAGIDPRARRAIAAACI
                     GNMLEWYDFGVYAFLAGAISAAFFPSSDPTASLLATFAAYGVGFLARPFGGAVIGRLG
                     DRRGRKVALVLTLLMMALGTIGLGLLPTYAQIGIAAPALLVALRILQGIAAGGEWGAS
                     TAFIIEWAPEGRRGLFGSFQQVSTASGILLGSGVAALLTSLLTPEAMLAWGWRIPFLL
                     GASLLVVGILIRRSVDETPVFEDQVARKDAAPVAPAQESGPRLGLRAFGFTIFWTVSY
                     YMLLSYMPTFTQKFGALTASQALWSNTIGLVAMVLAVPVFGHVSDRVGRKPLLIASAV
                     AAILLSYPLFRIIAGGAGFLTVVAIQVVFGLIVALYSGPGPAAISEMFPSHLRSTWMS
                     IGYTLAVAVFGGFAPFVATWLIAVTGSPLAPGALYLIPMAVLTLVVVARMPETGKSRL
                     A"
     CDS             210700..211617
                     /codon_start=1
                     /gene="cda1"
                     /inference="similar to AA sequence:RefSeq:WP_007671290.1"
                     /locus_tag="Maq22A_c01090"
                     /note="192d0012"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="polysaccharide deacetylase"
                     /protein_id="BAQ43722.1"
                     /transl_table=11
                     /translation="MTAPMTAPSSTDLKPWQWPEDHWRRRVAKVRAGRSLAPAWPDGK
                     RCAVALSFDVDHETNELRDGGKSLGRLSWGQYGHRQGMPRILELLAEHDVPASFYVPA
                     VVAMLYPDEQRGVVAAGHEIGIHGWIHELNSILPAEAERDLMLRSADALERITGTRPV
                     GLRTPSWDYSDATLAIIREMGLLYDSSLMADDTCYELMEDGAPTGIVEVPVEWIRDDA
                     PYFMMSRFEGLRPHIGPEDVLAIFMREFEGAYREGGLFQLTMHPHIIGYRSRLWIVEE
                     LIRAAKAKGDVWFATHADIAAHAATALRS"
     CDS             211629..212759
                     /codon_start=1
                     /gene="argE"
                     /inference="similar to AA sequence:RefSeq:WP_012330840.1"
                     /locus_tag="Maq22A_c01095"
                     /note="192d0013"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="acetylornithine
                     deacetylase/Succinyl-diaminopimelate desuccinylase and
                     related deacylases"
                     /protein_id="BAQ43723.1"
                     /transl_table=11
                     /translation="MIPVPAPADLAPALDRLRRLVLCETPSYAPEALAAGLALMRAEL
                     AADGLAVAPETADLAAAGAVRATYDRGGTLDGPPILILGHLDTVHPVGELAANPWRID
                     GDRAFGPGILDMKGGIVLALGALRRAEPHLARPVEVLITTDEEIGSPRSRGLIEARAK
                     AAACILVPEPARDNGGLVVGRHAILRFALAATGRPAHAGRDPARGDSAIHRLARAVVA
                     LEGRSVPGASLSVGVIGGGLWVNCVPERAAAEMLCVAADDARRDEILRIVAGEADDRL
                     AIELASERPLWRTGPGDRALYGAAQAIAAELGIAVSPEVSGGGSDGNFTGALGRPTLD
                     GLGPCGAGLHAHDEHLDLASLGPRIALMANLLVRVGHLPTGD"
     CDS             complement(212943..214115)
                     /codon_start=1
                     /gene="rfaG"
                     /inference="similar to AA sequence:RefSeq:WP_018261705.1"
                     /locus_tag="Maq22A_c01100"
                     /note="192c0018"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="glycosyl transferase family 1"
                     /protein_id="BAQ43724.1"
                     /transl_table=11
                     /translation="MLPSLTVPAGRPLPHRGAPVLHLFMTVDAVGGIWQYGLDLAEEM
                     TRRGVAVTLAVLGPEPSQDQMRAARAIRGLDLRPLGVSLDWTALTRREVEATAAIVAR
                     EAERAGADLIHLNSPALAALAEFCAPVIAVAHACVATWWAAMRPGPLPPDLAWRANLV
                     AEGYRRVDALLSPTRAFAEATAATYGISPPRVVPNGRRKPADRGQRTPAGAAASPFAF
                     TAGRLWDEGKNARTLDRAAARMRLPLLAAGDLKGPNAAQFAPEHLRSLGRLSDQDVAR
                     WLAGSPIYASAARYEPFGLGVLEAASAGCALVLSDIPTFRELWDEAAIFIAPDDDAGF
                     AHAIEMVAADPAIRARLGAEARARAETYTVEAMTAGVLEAYRAVLTGPPLRAGMPA"
     CDS             complement(214100..214363)
                     /codon_start=1
                     /locus_tag="Maq22A_c01105"
                     /note="192c0019"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="radical SAM domain protein"
                     /protein_id="BAQ43725.1"
                     /transl_table=11
                     /translation="MIAHGATRLDEVVPRAPRVALCACVRADDPVRLRPSSPYDRRPW
                     RARDGRARKGARVPHRGRFDRSGDIPSAAPAPLRELEAACCPA"
     CDS             complement(214685..215062)
                     /codon_start=1
                     /locus_tag="Maq22A_c27725"
                     /note="192c0020"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47051.1"
                     /transl_table=11
                     /translation="MPWLRYPAGGHGAIGLNDARTMTPGRASRFPDTTETSRRRAGGV
                     ARAGARILVAHRTAFGPPAAHPADRLARRPGSPASGRLAVSSGRHHARNVIRFPKTAR
                     FRRMVTTRPCITVMATEPLVSFV"
     CDS             215137..217062
                     /codon_start=1
                     /gene="mdoH"
                     /inference="similar to AA sequence:RefSeq:WP_018262190.1"
                     /locus_tag="Maq22A_c01115"
                     /note="192d0014"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="glucosyltransferase"
                     /protein_id="BAQ43726.1"
                     /transl_table=11
                     /translation="MSLAPPSHDAVPVAPGADPASPQEAAALRWRRLALAVPTVATAL
                     ALAAAAAASIGVPDGPLEAAVLGLFCLAMAWQSYIAWQYLYGAIAAGLGPRVMSAVER
                     QAADLAPQASGRSRTAAVVAIHAEDAGAVFAAIRVMARSLARAGGDGRDLDIFVLSDT
                     RDPEIAAAEERELARALAWRETAGPGLPAIRYRRRQDNTGRKAGNIGEFCETYGHAYD
                     FIIVLDADSLMTGAAMRRLVRLMEENPRVGLIQTVSYAAGRDTLFARIQQFAVRLYAP
                     LSIRALETWQGPDGGYWGHNAILRIAAFAANAELPVLPGRPPLGGEILCHDTVEGAFL
                     RRAGWELRLLPEEPGTWEEMPTNLTDLLGRERRWCQGNLQHLGVIGMPGLTAGSRWHL
                     GAGILSYLASPVWVAFLALGTWQAIRSGDLGLLAYGLTGEGPAAAVLAALSVAVLALP
                     KLLSLGHVLLSPERRAAFGGTRRLLIGAALEQALWVLLWPVLTLFNAGAVLSTFAGRV
                     VRWETQARDDRRVPWSEACRLQADALVAGGLLAAALVYAGDPLLALWMAPVALGLLGS
                     PALSVLTSRADYGHAARRRGLFLTIDDTAQAPELRDLAAARAAPPLPARPPVRGEAPV
                     WLATATDDAKASRAREI"
     CDS             complement(217279..217734)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012331346.1"
                     /locus_tag="Maq22A_c01120"
                     /note="192c0021"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43727.1"
                     /transl_table=11
                     /translation="MPAALPFALLGAHLVLVAADGPPRLDIEHTCNSPGRSSVSQEAG
                     SDGCLRSERSAGDELRKRWGQFSGPAKTQCSQQSRAGGFPSYVEMLTCLELASGAVPV
                     TSPTNRATVGQGSPATTGSVRGRPQERADSLTAEPSPSQRTDPLKVLGK"
     CDS             complement(217853..219004)
                     /codon_start=1
                     /gene="metC"
                     /inference="similar to AA sequence:RefSeq:WP_015927737.1"
                     /locus_tag="Maq22A_c01125"
                     /note="192c0022"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="cystathionine gamma-synthase"
                     /protein_id="BAQ43728.1"
                     /transl_table=11
                     /translation="MSSAPRHWSKKSLAAQALGHVDPITKAVVPPIHVATTYIRDPDN
                     QYSSGYVYGRPDNATVREAEAVIAMLEEAEAGALLFSSGMAAATAVFGALDPGDHIVA
                     PTVMYWALRRWLTEEATRWGLKVDFVATDDLDALKAAVRPGQTKLVWLETPSNPLWTV
                     TDIAGAAEIAHAAGARLAVDSTASSPVVTRPLSLGADVVMHAATKVLNGHSDVIAGAL
                     AGARADEFWARIQRIRSGNGAILGPFEAYLLMRGMRTLHVRIATQMANAAELAQRLSA
                     HPAVARVLYPGLATHPGHAVAARQMTGFGTMLSIRVAGGEAAAIATAARVALWKRATS
                     LGGVESLIEHRASIEGPTTPCPPDLLRLSVGIEDVDDLFADLDQALRQD"
     CDS             219108..219638
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018262187.1"
                     /locus_tag="Maq22A_c01130"
                     /note="192d0015"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="tryptophan-rich sensory protein"
                     /protein_id="BAQ43729.1"
                     /transl_table=11
                     /translation="MPPTATLPHPEPARPVLSPLPRLAAAIVPVAAVAVVGSLATSPN
                     IPTWYASLAKPGFTPPNWLFPVAWTILYALIAVSGWRLLGTAPATGSLRRTRTLALWA
                     FFVQLALNGAWTPVFFARHDPAGGLVVVIALLIMILWTIRLVLPLDRLAALILVPYAA
                     WVSYATALNAAIWWMN"
     CDS             complement(219841..220821)
                     /codon_start=1
                     /gene="qor"
                     /inference="similar to AA sequence:RefSeq:WP_008838240.1"
                     /locus_tag="Maq22A_c01135"
                     /note="192c0023"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="NADPH:quinone reductase and related
                     Zn-dependent oxidoreductases"
                     /protein_id="BAQ43730.1"
                     /transl_table=11
                     /translation="MATTRSVVITEFGPPQVMTLQSRDLPAPGAGEAQLRQTAIGFNF
                     IDVYQRRGAYPLERPTGLGFEAAGVVEAVGPGVVDVKPGDRVAYMNAGVGAYADRRTV
                     PAEKLVRLPGSVSDEAAASLLFKGMTAQYLLRKTHAVQPGDLLLVHSAAGGVGQILTR
                     WATALGAKVVGTTGSPEKREAALAAGCAAVIDLNQPDWPKAFLEATGGAKARVVYDAV
                     GKDTLLKSLDCAAPFGLVVSYGAASGPSPAIDPELLNKKGCLFLTRPSVFPHNADPAT
                     FRANAADLFDAIGRGHVAVDVGARFPLERVVEAHEAAEARKVTGAIVLVP"
     CDS             complement(221038..221418)
                     /codon_start=1
                     /gene="cheY"
                     /inference="similar to AA sequence:RefSeq:WP_012332068.1"
                     /locus_tag="Maq22A_c01140"
                     /note="192c0024"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="MFS transporter"
                     /protein_id="BAQ43731.1"
                     /transl_table=11
                     /translation="MARILLVDDEEPIRGFLKRGLEMDGHTVVTAIDGSDGLDRLAEG
                     AFDLMLTDIRMPLMDGIALSLAAKRDYPDLIILLMTGFADQRERARGLDAIVADVLTK
                     PFTLADMRATVSRTLRAAGAVVAR"
     CDS             complement(221596..222186)
                     /codon_start=1
                     /gene="hpt"
                     /inference="similar to AA sequence:RefSeq:WP_012332067.1"
                     /locus_tag="Maq22A_c01145"
                     /note="192c0025"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="BAQ43732.1"
                     /transl_table=11
                     /translation="MTPSLPRVRVLFDESAIAQRNEEIARAIASQPLENLLVVAVLKG
                     SFMFAADLIRALHRAGLAPQVEFIHLSSYRAATVSSGQVAILRDVESEVRGRDVLLID
                     DILESGRTLVYAKDLLMARGARRVLTTVLLEKPGKRAVTMDADYVGFTCPDVFVVGYG
                     MDVAHAFRQLPFVGLVDYGDGEPDLFDTGSDGTAIA"
     CDS             complement(222200..222934)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012332066.1"
                     /locus_tag="Maq22A_c01150"
                     /note="192c0026"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43733.1"
                     /transl_table=11
                     /translation="MLIVCPACASEYTLDADKIGPAGRTVRCAACREPWFVAAPAAEP
                     TLSPPGEAVFTAAAASGPSEGKAGNRSARRREPAEGARSGRIRRLAVAGAALAACAVA
                     AAALMPAGRAGLVRALPQTARLYAAIGLPVNLRGLTFRDVAAYQVPDASGSGRLVVEG
                     DVVSAAREAVAVPPLSLELRDDHGQVVYRWRAEAPRERLEPEESARFRAELPGASAKG
                     RQVLVRFAAVDSHDSAVSLKAPTNPK"
     CDS             223093..223812
                     /codon_start=1
                     /gene="ftsE"
                     /inference="similar to AA sequence:RefSeq:WP_012332065.1"
                     /locus_tag="Maq22A_c01155"
                     /note="291c0029"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="cell division protein FtsE"
                     /protein_id="BAQ43734.1"
                     /transl_table=11
                     /translation="MDARTDRGTGNSLLGGMDEPVVRFENVGMRYGVGPEVLSDISFT
                     IAPHSFQFLTGPSGAGKTTLLRLILLSARPSRGLVSVFGEEVSGISSGALTSLRRRMG
                     VVFQDFRLLDHLTTYENVALPLRVQGRAETSYRAEVVELLRWVGLGERMHVLPPLLSG
                     GEKQRAAIARALIARPELLLADEPTGNVDPQLGRRLLRLFVELNRLGTSVLIATHDFA
                     LMDLVDARRFILGNNRLRIEG"
     CDS             223831..224790
                     /codon_start=1
                     /gene="ftsX"
                     /inference="similar to AA sequence:RefSeq:WP_015927857.1"
                     /locus_tag="Maq22A_c01160"
                     /note="291c0028"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="cell division protein FtsX"
                     /protein_id="BAQ43735.1"
                     /transl_table=11
                     /translation="MSEGATLERAPRRAAPAADLPPTLRRNAPLVPTDTSAGRALAAV
                     IAILTFLAALCAGGAEIVATSAAQWQGSVAQEVTIQVRPGPGRDTDADVAKAAALASA
                     TPGIAATRPFTKTESERLLEPWLGSGLDLGDLPVPRLITVRLGSGTPDLGDLRRRLAD
                     ALPGVASLDDHALWLSRLSTMANTVVGVGVAIVGLVLVATGLAVTFATRGAMAGNREV
                     VEVLHFVGADADFIAREFQRRFFRLGLRGGAIGAAAALAVIGAGGALARVWRAGPAGD
                     EIEALFGGFAIGWRGYASVVLIGVIASVVTAVVSRLTVRRFLD"
     CDS             225030..225779
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927856.1"
                     /locus_tag="Maq22A_c01165"
                     /note="291c0027"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43736.1"
                     /transl_table=11
                     /translation="MTTRTGDVVGWSWSGGGSEGPPPPRRSLRRRLALGAAGFGLAGG
                     LALGLGFLAFVAGLARSERLPLGPSDGIVALTGGAQRIEDAMDLLAGGYGRRLLITGV
                     NERTSREEIARLNPGQQHLIACCVDLDYRARNTIGNAIEIRRWMRENGFQSVAVVTSN
                     YHMPRTLVELDHALEGGHRVVPHPVVSEGIDPDQWWRHPASARLLASEYAKFLVAWVR
                     TRFETDPEHSSAAVLVSRGHPVKVVAEPLVR"
     CDS             complement(225893..226210)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927855.1"
                     /locus_tag="Maq22A_c01170"
                     /note="291d0056"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43737.1"
                     /transl_table=11
                     /translation="MRTSLLAAACLLAAAAPARAVDGTCARDLLVAQSSQKTAIERLE
                     MLGDSDADRCRGWRQHVDTMRRAATVYGRCLSGGERSERLAQVQGSEKEFSEMLRTRC
                     KGR"
     CDS             complement(226222..226686)
                     /codon_start=1
                     /gene="ptsN"
                     /inference="similar to AA sequence:RefSeq:WP_015927854.1"
                     /locus_tag="Maq22A_c01175"
                     /note="291d0055"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="nitrogen regulatory protein"
                     /protein_id="BAQ43738.1"
                     /transl_table=11
                     /translation="MPLLEFLKPEAVLPALRAQGKKQVLQELAAQAARHLPGLDEREI
                     FETLLQRERLGSTGIGEGVAIPHGKLPGLDTLFGLMARLERPVDFEALDGQPVDIAFL
                     LLAPEGAGADHLKALARVARVLREPGIIDRIRAARDADALYALLTQSPAQAA"
     CDS             complement(226777..227388)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927853.1"
                     /locus_tag="Maq22A_c01180"
                     /note="291d0054"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="sigma 54 modulation protein/ribosomal
                     proteinS30EA"
                     /protein_id="BAQ43739.1"
                     /transl_table=11
                     /translation="MAALRVSGRGVDLGEALRTRVEERISAALAKYFDGAYHGHVTVA
                     RDGAAYRTDCVLHLPSGITLEASGTAHDAHASFDQTAERIEKRLRRYKHRLKAHPNGH
                     AKEVGLDGGLPGSLPGREAVMEAAYSVFEAPEEDTGEHPPIIAESTRTLHRRTVSEAV
                     VELDLTGVPVLVFVHAGTERVNVVYRRGDGAIGWIDPPERGTP"
     CDS             complement(227529..229109)
                     /codon_start=1
                     /gene="rpoN"
                     /inference="similar to AA sequence:RefSeq:WP_015927848.1"
                     /locus_tag="Maq22A_c01185"
                     /note="291d0053"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="RNA polymerase sigma54 factor"
                     /protein_id="BAQ43740.1"
                     /transl_table=11
                     /translation="MGLLQRLEMRQGQALVMTPQLLQAIKLLQLSHLDLAAYVDAELE
                     RNPLLERAEAEAPEIGDSRGEGHGEAAEAGRDGGDGDGFDADFGGDGAAEPWLSHDLN
                     PSRSEIEGDLGTRLDNVFPDEGPAGREAPVGSEGLSLTPAPWGNAGGSFDGDAPDFEA
                     TLTSESSLHEHLSAQLDLATRDPVERLVGGFLVDAIDEAGYLREDLPGLAERLGVAMP
                     VVERVLALVQGFDPSGVGARDLAECLAIQLREQDRFDPAMQALVSRLDLVAKRDLASL
                     RRLCGVDDEDLADMLSELRRLDPKPGRAFGAGPVEVLVPDVFVRAAPDGSWLVELNSE
                     ALPRVLVNQSYYATVTRGPQTETDKAFLSECLQTANWLTRSLEQRARTILKVASEIVR
                     QQDGFFVNGVAHLRPLNLKTVADAIGMHESTVSRVTSNKSIGTSRGTFEMKYFFTAAI
                     PGAAGAAAHSSEAVRHRIKQLIDGEANDVLSDDALVQRLRGEGVDIARRTVAKYRESL
                     RIPSSIERRRERAAMPAR"
     CDS             complement(229414..230289)
                     /codon_start=1
                     /gene="yhbG"
                     /inference="similar to AA sequence:RefSeq:WP_012332053.1"
                     /locus_tag="Maq22A_c01190"
                     /note="291d0052"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BAQ43741.1"
                     /transl_table=11
                     /translation="MTFPSALPLQAQTVPTQAMPTVSRLGRLFGRGRKVEAVAAEPDG
                     ASATFGGPGILAVAGLKKSYGARTVVHDAGLTVRNGEAVGLLGPNGAGKTTIFYMITG
                     LVSADRGTISLDGHEITRLPMYQRARLGIGYLPQEASIFRGLNVEDNIRAVLEVVEPD
                     RKTRERKLDSLLEEFNITRLRKSPSIALSGGERRRCEIARALASSPSFMLLDEPFAGI
                     DPIAVGDIQELVMHLKGRGIGVLITDHNVRETLGLIDRAYIVHSGRILTEGTPEEIVA
                     DEDVRRLYLGEDFRL"
     CDS             230533..231777
                     /codon_start=1
                     /gene="gatA"
                     /inference="similar to AA sequence:RefSeq:WP_015931094.1"
                     /locus_tag="Maq22A_c01195"
                     /note="291c0026"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="amidase"
                     /protein_id="BAQ43742.1"
                     /transl_table=11
                     /translation="MLSLLDLCARIDSGRLTPEGAVGLVREAIAAREPEIGALVCVDP
                     APAIPTTGPLAGIAVGIKDIIDTADLPTAMGSPIYAGWRPRADAPVVARLKSLGAVPL
                     AKTTTTPFAFLDPTATRNPHHPGHTPGGSSAGSAAAVAAGMLPLALGTQTGGSIIRPA
                     AFCGVVGVKPSFRLLPTVGVKCYSWALDTLGLFAASVPDAAHALALLADRPAIAAHAD
                     AGALRIGIVRQDFCAAPDPEAEAALARAARAAERAGARVRDYALPARFGEAFAAHAAI
                     QDYEVRQSLAWEYATHRDALPPRLRAALDAAQGIETAAYDAARRTAHHARRGLKEVFS
                     EDGLDAILTYAAPGAAPAGLDQTGDSRFNRLWTLMGVPCVTLPVDRTSAGLPVGVQVI
                     TRFGDDGRALAAAGLIERALRD"
     CDS             complement(231787..234537)
                     /codon_start=1
                     /locus_tag="Maq22A_c27730"
                     /note="291d0051"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /note="predicted signal transduction protein containing a
                     membrane domain, an EAL and a GGDEF domain"
                     /product="predicted signal transduction protein"
                     /protein_id="BAR47052.1"
                     /transl_table=11
                     /translation="MRRVGPTTDMMPPAPALRGRSFRMVAASAGLLAAIIAVGSGLLV
                     RDLHDQAVADTERNLTGLSTILADQAERSLQAIELVQETVIGEFKAAGVSRPEDYVAQ
                     AKRPALHEALRTRIAALPQANAVTVIARDGTLLNFSRYWPIPAINIADRDYFRMLADD
                     PERDRAISRPFQNRGDGAWTIYIARKVRAPDGAFLGLVLGAVELGYLERLYAAIVPAS
                     DYVISLFRDDGTLLVRHPQRDGSVGRTFLNAAALRIALTTPAGGVLRTVSPIDGHDRI
                     AATRPLARYPLILSVSRTTEAGLAAWRQQAWLIGAGALVLDLGLAGMVLLGLRQARAQ
                     ARLTESEAARAAAEARERGEQELNAQQAQFRIALDHMTQGLCLFDRDDRLIVMNARYA
                     QMHAVPNALRRRGTPVAALLEHLGRDGGPANALVTACSRTAGGAPAAIAAGVSASHTC
                     DLPDGRAIAIVHVAVPGGGWLGTHEDVTEQRRAEQRIAHMAGHDALTGLPNRARMQER
                     VDAALAGRAADEAVSVLCLDLDGFKDVNDTYGHAVGDELLRQVGLRLKEAVGVTALVG
                     RLGGDEFAVMRCAPSHPAGIAALAERIVRLLRVPFEVQGHEVGIGTSIGIATTETGEV
                     TTAELQRRADVALYQVKASGRNGWRFFDPAMDADLQRRRQLGADLRSALTEGQLDLHY
                     QPIVAADGALRAFEALLRWRHPREGFVSPGEFIPIAEATGQIRRLGAWALARACADAA
                     AWPPDLKVAVNLSPVQFVGDALVEEVAQALAASGLPAERLELEITESVLLQDDAATLA
                     ILHRLRALGVSTAMDDFGTGYSSLSYLRRFPFDKIKIDQSFVRNLGHEAGSSEIVRAA
                     VGLGKTFGMIVLAEGVETEEQAAILREAGCDELQGYLFGRPCPVAELRGSAPAGPGRA
                     AA"
     CDS             complement(234683..235969)
                     /codon_start=1
                     /gene="dadA"
                     /inference="similar to AA sequence:RefSeq:WP_012333370.1"
                     /locus_tag="Maq22A_c01205"
                     /note="291d0050"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="BAQ43743.1"
                     /transl_table=11
                     /translation="MTEPFPLGPALWAATAPPPPATAPLTESGRADVVVIGGGFCGLS
                     TALHLAEAGLKPVLLEAREIGFGGSGRNGGQVIPGLKHDPDELVAMFGPERGERLAAF
                     GAGTADAVFDLIDRHRMDVPRTRTGWIQGAHTDEGLAQAERRAEQWARRGAPTRLLDK
                     AEADRLIGSERYRGGWLDGRGGAVQPLAYARGLAKAALAAGAVLHTDTPVTGLSRRGT
                     TWTVRTGRGPSLTTERVVLCTNGYSGDLWPRLRQTIIAANSFQVATVPLSDNLRRTVL
                     PEGQVSSDTRKLLLYFRLDHTGRLLLGGRGPFREPRGAADWAHLERIVPKLFPQLAGI
                     DFDHRWCGRVAVTRDYLPHLHAPEPGLLIDIGCQGRGVGLQTRMGQAIARFVARDDAD
                     ALPVAPSPITPLPLHGLHRLYAAAVVAWYRLQDGGL"
     CDS             complement(235984..236715)
                     /codon_start=1
                     /gene="glnQ"
                     /inference="similar to AA sequence:RefSeq:WP_015929044.1"
                     /locus_tag="Maq22A_c01210"
                     /note="291d0049"
                     /note="similar to ATP-binding component of ABC
                     transporters; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /product="glutamine ABC transporter ATP-binding protein"
                     /protein_id="BAQ43744.1"
                     /transl_table=11
                     /translation="MIVLDDVRKSFGALPVLKGITARVDRGEVVCVIGPSGSGKSTVL
                     RCINGLESYDGGTITVNGQRVDRSDRSIRAVRVQVSMVFQRFNLFPHRTALENVVEGP
                     IYVKGEPRREATERGRALLARVGLAGKEDAHPPQLSGGQQQRVAIARALAMRPDAILF
                     DEPTSALDPELVGDVLGTMRGLAEEGMTMVVVTHEMGFAREVADRVLFLDGGVIVEEG
                     AAREVLGRPQQPRTQDFLRRVLNPL"
     CDS             complement(236712..237365)
                     /codon_start=1
                     /gene="hisM"
                     /inference="similar to AA sequence:RefSeq:WP_015929045.1"
                     /locus_tag="Maq22A_c01215"
                     /note="291d0048"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="amino acid ABC transporter permease"
                     /protein_id="BAQ43745.1"
                     /transl_table=11
                     /translation="MDGFLSDAREFLPILLQGVWLTILITAGSLVVSTALGLVWAMMR
                     VSGVRALSFFAATFINVIRGIPIIVQLFYIYFVLPDYGLSFSAVQAAVLGLGLAYSAY
                     QAENFRAAIEAIDKGQVEAAQTIGMGWGLTMRRVLLPQALRTALPPYGNVMIMMLKDS
                     SQASTITVAELALQGKLVASATFKNTSVFSLVALMYLTLSLPLILIVRHFEKQARRR"
     CDS             complement(237382..238155)
                     /codon_start=1
                     /gene="hisJ"
                     /inference="similar to AA sequence:RefSeq:WP_015929046.1"
                     /locus_tag="Maq22A_c01220"
                     /note="291d0047"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BAQ43746.1"
                     /transl_table=11
                     /translation="MKRLMMAAGAALVLAGALSRPALAQETVRVGSTPTGVPFTFLDT
                     KTNTIQGVMVDVITAIGKEAGFSVQIEPFQFSTLIAALTAKKIDVISAAMFITPPRQE
                     VIAFSAPVYTYGEGLVVPKADTKAYTAFADLKGETVGAQVGTAFVDALKKSGQFGEVK
                     VYDTFPDMLRDVNAGRVKAIFADAPIAAYNLKSGNFPNAHLVASYKPVVVGSVGIGLR
                     KDDKALLAKIDAGLSKIKENGELARILEKWGLQPSVNPS"
     CDS             238261..238887
                     /codon_start=1
                     /gene="hipB"
                     /inference="similar to AA sequence:RefSeq:WP_012333366.1"
                     /locus_tag="Maq22A_c01225"
                     /note="291c0025"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="Predicted transcriptional regulators"
                     /protein_id="BAQ43747.1"
                     /transl_table=11
                     /translation="MKQATAGPRNGQGARQAAGPIAADLAVGQRLRALRQARNLSLKA
                     VAAATGLSIGYLSQVERGLSSPSLRVLTGVADLLGVGLGALFDGPGAGGAEGFVTRAG
                     ERAALTLWRAGITKQLLTQGDGALSLFLMQLAPLAGTGDEPLVHDGEEAGLVLEGALV
                     LTVEGTTVELQAGDSFRFASRRPHRYRNPHPDRPAAVLWVNAVPRAGA"
     CDS             239536..240126
                     /codon_start=1
                     /locus_tag="Maq22A_c27735"
                     /note="291c0024"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47053.1"
                     /transl_table=11
                     /translation="MSISLRIVGIFYNRSDIPDRGKQTVKDVLDYAVKNSRPPNLPSD
                     NFKYIVSSTAAPAGANAKPSVSAFFANYTDSFASPTSGLKYPRGEYFLSESLVENPSY
                     VVWQFYVFSANGVPIIPNPRISSFVDVQVPDGGRVVWRLVKVLSAPNLVPTVYRTAFG
                     LGDPKQAVVAPGAGVPAGTSPGHADAGSSLAGAAQS"
     CDS             complement(240307..241311)
                     /codon_start=1
                     /gene="tauA"
                     /inference="similar to AA sequence:RefSeq:WP_015927762.1"
                     /locus_tag="Maq22A_c01235"
                     /note="291d0046"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="BAQ43748.1"
                     /transl_table=11
                     /translation="MQRRSFLAGAAALALAPAAPARADTVKVRIGVGGKPLLYYLPLT
                     IAERKGYFKEEGIEAEINDFGGGARSLQALIGGSVDVVTGAYEHTIRMQAKGQDVRAV
                     CELGRYPAIVIGVRKDLAGTVKSAADLKGRKIGVTAPGSSTSLTAQYAMIKAGLKATD
                     AALIGVGGGAGAIAAMKKGEIDAISHLDPVIAKLEADGDITVLIDTRTEAGTRALFGG
                     PNPAAVVYTKQDWIEHHPAATQKVVNAFAKALKWIVAASPEEIADTVPPAYHFGDKPL
                     YVQAVKNSLESYSRTGIPTQEGMASVLELVRTLDPDLQGAKIDLATTVEDRFVKRAMG
                     "
     CDS             complement(241340..242137)
                     /codon_start=1
                     /gene="tauC"
                     /inference="similar to AA sequence:RefSeq:WP_012331365.1"
                     /locus_tag="Maq22A_c01240"
                     /note="291d0045"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="ABC transporter permease"
                     /protein_id="BAQ43749.1"
                     /transl_table=11
                     /translation="MNRPVNRLGLLALQILVGLIGLAIWHVLTVYPILGAPKQIQFFF
                     STPVEVLKRTWMEMTNPEIWGHLWITLQETVLAFVFGAAGGIAFGFLFARNALLAAVF
                     DPYIKAANALPRVVLAPIFALWFGLGIWSKVALGFTLVFFIVFFNVYQGVREVSPVVL
                     NNARMLGMSERGLLRHVYWPSALTWMFSSLHTAVGFALVGAVVGEYLGSSAGLGYKIH
                     EAESVFDVTGVFAGMLILTVFVVVIDTVVTLIENRLLVWRPQAGGQG"
     CDS             complement(242174..243049)
                     /codon_start=1
                     /gene="tauB"
                     /inference="similar to AA sequence:RefSeq:WP_015927760.1"
                     /locus_tag="Maq22A_c01245"
                     /note="291d0044"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="mannosyltransferase"
                     /protein_id="BAQ43750.1"
                     /transl_table=11
                     /translation="MVGQRAAEGRKGGRSGMRLVGGTALAHGDAVRLDDVSIAFTLKG
                     GRRYVAVEGIDLGVRPGEFVAIVGPTGSGKSTLLNAAAGLLKPASGGVAVFSSALSGL
                     NARAGYLFQADALMPWKTALDNVAVALEPQRVPRAEALARARDWLGKVGLATFVDRYP
                     HMLSGGQRKRVALAQMLIRDPEILLMDEPFGPLDAQTRQIMGNLLLELWAANRKAVMF
                     VTHDLEEAIALSDRVVVLSAGPAARIVGEFKVDLPRPRDISEIRLEPQFHALYKEIWS
                     CLRVEVSRAYASGPA"
     CDS             243289..243771
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012331370.1"
                     /locus_tag="Maq22A_c01250"
                     /note="291c0023"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43751.1"
                     /transl_table=11
                     /translation="MSAALAFSLPVDRRQSPTALGVQRGVRRLFAELGFVTIPEFTLA
                     NGRRADLIALGTCGKLTIIEIKSSVADFRADRKWPDYRDFCDRFYFAVPETLPVEILP
                     DDTGLIVADAFGAAILRDPPEHPLAGARRKAVTLRFAHAAAGLLHALADPGSIREGAL
                     "
     CDS             complement(243842..244339)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_007561924.1"
                     /locus_tag="Maq22A_c01255"
                     /note="291d0043"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43752.1"
                     /transl_table=11
                     /translation="MTQRWARTALATSLLTGGAMATAPALAAPAAARAELPSEACKKT
                     EDGFGEFLNAIASDPALRAAYSASPIAERDLRDPARPVARPGEPFRVTIVDNMWFYDE
                     PGRSTAKLARIKLTFKIDGNRMRLGFVKAKFSPEDDLIRTFGAPEAYVFEHIQGCWRL
                     VEHLR"
     CDS             complement(244668..245351)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012333040.1"
                     /locus_tag="Maq22A_c01260"
                     /note="291d0042"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="pilus assembly protein PilZ"
                     /protein_id="BAQ43753.1"
                     /transl_table=11
                     /translation="MASVGASAMGSAAEGTPSGTAVRPASVIARALSLRAMSEQRRHT
                     RVAVALLGRYMLSDRQEYPCQTIDMSPGGVRLTCAVGGTVGERIVIYLEHVGRIEGTV
                     ARILPDGIAVTINATTHKRDKIASQLTWLANRTELGLPEDRRHERVVPRRALTTLHLE
                     GGREIAARIVDISLSGAAVACEVDLPLDTSLTVGRTPGRVVRRFKGGAAIEFRLPLSP
                     DRFDENLVL"
     CDS             complement(245429..246034)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015931590.1"
                     /locus_tag="Maq22A_c01265"
                     /note="291d0041"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="PAS domain-containing protein"
                     /protein_id="BAQ43754.1"
                     /transl_table=11
                     /translation="MKHPTSRMLHAYWNGLRGARAAPERGEIEPGEIRHVLADSLILE
                     IDAASQAATVRLAGTRLCALFGAELRGLSFGGLWGEAPAADPWRLVEVVIQETAGVVV
                     GLVGVTEAGETLDLELLLLPLRHRGKTQARVIGSLSPAVIPTWLGLRPIVALRTVSLR
                     ILTGEANAAIAAPLAAPPPAANDEPGPERRKRFVVHHGGRA"
     CDS             complement(246080..246400)
                     /codon_start=1
                     /locus_tag="Maq22A_c27740"
                     /note="291d0040"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47054.1"
                     /transl_table=11
                     /translation="MPLSPKRMIATAASRPRAERRQDRDDAGRIRLSPLCMRAGLGRL
                     DAPSQPQSAIVLHNRPGVGQTQQRGAGNPNRTLRSRTPRVRHRVCSTESAAPVAVPRW
                     DNLR"
     CDS             246508..247320
                     /codon_start=1
                     /gene="glpG"
                     /inference="similar to AA sequence:RefSeq:WP_012333038.1"
                     /locus_tag="Maq22A_c01270"
                     /note="291c0022"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="peptidase S54"
                     /protein_id="BAQ43755.1"
                     /transl_table=11
                     /translation="MDATPDLPRPPRVPVFNMPAVVTASVGILVLIHAVRQVLPDVWD
                     ITLLLDLALIPARWTLALDPGRAADVLRAAAEGDAGGVELRKAFAAYLVADADGMPWT
                     FITYALLHGSWAHVLLNGVWLAAFGSPVARRCGAWRYGVIALAATAAGGLLHVLIDPL
                     STVPLIGASAGVSGLMAAAVRFAFHPPEPAGAAAVPWQRPVPTRLQTIPELFRNRSAV
                     VFLVIWFVTNLLFGLAALPLGLSDAPVAWDAHLGGFVVGFLLLPLVERIGRR"
     CDS             247456..247887
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015931588.1"
                     /locus_tag="Maq22A_c01275"
                     /note="291c0021"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="inosine-5-monophosphate dehydrogenase"
                     /protein_id="BAQ43756.1"
                     /transl_table=11
                     /translation="MTVARILSQKGRTVVTVQPHRTLAEAAALLTEKGIGALVVSDAG
                     QTVLGILSERDIIRAVVRGGGAALEAPVSRHMTAKVICCSRASAVDEVMELMTDGRFR
                     HVPVVEDGRLVGLVSIGDVVKHRIESVEAEHQAMREYIATA"
     CDS             complement(247906..248958)
                     /codon_start=1
                     /gene="rssA"
                     /inference="similar to AA sequence:RefSeq:WP_015931587.1"
                     /locus_tag="Maq22A_c01280"
                     /note="291d0039"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="NTE family protein rssA"
                     /protein_id="BAQ43757.1"
                     /transl_table=11
                     /translation="MMWDGIALFSGAPVRRSADGVLGAAGVPPLREPERPRRAKVGLA
                     LGGGAARGWSHIGAIEVLQEAGIPIDVVAGCSIGAAVGACHAAGKLGELRDFALTLTK
                     RRVMGLLDFHISGSGLIAGERLRRLLERDLGSARIEDLPLTFAAVATELGTGHEIWLT
                     RGGLVEAVRASYALPGIFDPVKIAGRWLMDGALVNPVPVTAARALGADVVLCVNLNGD
                     MRVRGTVIQSHGAEGADAVMEAAAEAAGAPAEEARRWPLIGGRRAKPKPRPESGAPSG
                     IASVMVDAFNITQDRISRSRLAGDPPDVMINPKLAQMGLFEFHRAEECIELGRQATRR
                     MLPEIHEMIAAAVAPA"
     CDS             complement(249108..249599)
                     /codon_start=1
                     /gene="lrp"
                     /inference="similar to AA sequence:RefSeq:WP_006612058.1"
                     /locus_tag="Maq22A_c01285"
                     /note="291d0038"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="AsnC family transcriptional regulator"
                     /protein_id="BAQ43758.1"
                     /transl_table=11
                     /translation="MTDPLTLDGFDLKILAALQEDGRLGNQELAERVHLSASQCSRRR
                     LRLEERGVVRGYRAELAPEPLGLAVTVFTKVALATHNRDNARRFAELVRGLDCVLEAH
                     VMTGDSDYLLKLIVPDLKALSAVINDVLLPHESVAHVHSAVVLDTLKEAAALPLPRGP
                     SSA"
     CDS             249721..250851
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_014439129.1"
                     /locus_tag="Maq22A_c01290"
                     /note="291c0020"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="4-hydroxyphenylpyruvate dioxygenase"
                     /protein_id="BAQ43759.1"
                     /transl_table=11
                     /translation="MGPYPHDAPAAQVTAANPMGTDGFEFVEYAHPEPQALHDLFRAM
                     GFAAVARHRTKAITVYRQGDVNYLVNEEPGSHGHLFVAAHGPCAPSMAFRVVDAKAAY
                     ERALAHGAEPADPAEGSKTLDVPAIKGIGGSLLYFVETYGRKGSPYEAEFDWLDARDP
                     RPEGLGLFYLDHLTHNVHRGRMGVWAGFYEKIFNFRQIRYFDIAGKQTGLFSKALTSP
                     DGKIRIPINESADEKSQIEEYLHAYNGEGIQHIACGCRDIYATIEALRAGGVAFMPAP
                     PSVYYRRVEKRLPGHGEPLERMERNGILIDGEGVVEGGMTKILLQLFSANAIGPIFFE
                     FIQRKGDDGFGEGNFKALFESIEEDQIRRGVLADHGPRDAAA"
     CDS             251111..252838
                     /codon_start=1
                     /gene="mdlB"
                     /inference="similar to AA sequence:RefSeq:WP_015950773.1"
                     /locus_tag="Maq22A_c01295"
                     /note="291c0019"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="multidrug ABC transporter ATP-binding protein"
                     /protein_id="BAQ43760.1"
                     /transl_table=11
                     /translation="MLKAFLAYYRPYRTLFLVDFGCAILSGLLELGFPMAVKAFVDVL
                     LPRQDWSLILLAAAGLALLYVANAGLMVVVTYWGHVLGINIETTMRARAFDHLQTLSF
                     RFFDNQKTGHLVARVTKDLEEIGEVAHHGPEDLFIAVMTLFGAFGLMLYVHPPLALMT
                     AAILPVIAFVTVRYGGRMTQNWQAQYGRVGAFNARIEENVGGIRVVKAFANEAHERRL
                     FAADNERYRATKLDAYRIMAASLSLNYLGMRLVQIVVLLGGAAFVVRGDLSPGGFIGF
                     LLLVGVFYRPLEKISAVVETYPKGIAGFRRYMALLATAPDIVDRPGAVPAPPLRGEIR
                     FEGVRFGYGDGREVLSGVDLAVRAGETVAFVGPSGAGKTTLCSLVPRFYEVEGGRITL
                     DGHDIRDLTLASLRGQIGIVQQDVFLFAGTIRENIAYGRLDASEDEIRTAAHRARLDT
                     LIATLPDGLDTVVGERGVKLSGGQKQRLAIARVFLKNPPVLILDEATSALDTQTEREI
                     QQALAELTQGRTTLVIAHRLATIRHADRIAVVSGGRIVEQGSHDALVAADGAYTRLHA
                     AQGGAMAAE"
     CDS             complement(252882..253184)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018261329.1"
                     /locus_tag="Maq22A_c01300"
                     /note="291d0037"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43761.1"
                     /transl_table=11
                     /translation="MIPTLDLLPAAESRAPAPAAAPAADLLAHVLRDLALSYEAECPG
                     GFARFRQGLTVEMLAVIARFSGPATSDEAALALARQVHETLLDVEEDVWALHTSAH"
     CDS             complement(253583..254350)
                     /codon_start=1
                     /gene="fabG"
                     /inference="similar to AA sequence:RefSeq:WP_014188804.1"
                     /locus_tag="Maq22A_c01305"
                     /note="291d0036"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="BAQ43762.1"
                     /transl_table=11
                     /translation="MRFRDRAILVTGASRGIGAAIATAAAAEGAIVIVNYRSDAAGAE
                     AVADRCRALGGQALPVAADVTDPAAVAELAARIGEEVGRLDAVVNNAFAPYRFDPDHR
                     IRFRDLPWEAYQRQFDGTVRGTYQVVHALLPLLTRRSGASIVNLASDLVARPSIPYHD
                     YTTAKAALVGFSRNLAAELGPVGVRVNCVAPGLVVPTQASRDTPEAVRDALIAQTPLR
                     RLATPQDVAGPVLFLAHDDSRFMTGQVLTVDGGLVMG"
     CDS             complement(254347..255384)
                     /codon_start=1
                     /gene="tauA"
                     /locus_tag="Maq22A_c01310"
                     /note="291d0035"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="ABC-type nitrate/sulfonate/bicarbonate
                     transport systems, periplasmic components"
                     /protein_id="BAQ43763.1"
                     /transl_table=11
                     /translation="MKLPRCLHALPFLALAALALAGLSPPAAAEGLDKVTVGGWSQPI
                     SEITNLLAEPDHGLFKARGIALDYVPGNGGGSAIQAVLAGQADIAFTDPASFYLALDK
                     GADLVAVYDIYPQNVFNVVSPKSRGIRTIADLKGKRVGVYSLASGTRQHLLLLLATAG
                     LKETDVTVEVTGLLNFAPLIQGQVDATAATDTGLLVGRAKGLGEVDVIEVRDHLNLPS
                     DIFVVTRKDYEARKPLLKRFLAAYRDSAAWMIARPDEAARLAVTRAINGRDEAINREV
                     IRLRNLSSVSPTTEREGLGHFDLPVLQQGADTFRRLGLVARALDMGQVVKTDLIPVRE
                     SAASPAKEGTP"
     CDS             complement(255390..256139)
                     /codon_start=1
                     /gene="tauC"
                     /inference="similar to AA sequence:RefSeq:WP_014188802.1"
                     /locus_tag="Maq22A_c01320"
                     /note="291d0034"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter permease"
                     /protein_id="BAQ43764.1"
                     /transl_table=11
                     /translation="MRPRLVSALLLVVLLCAWEAWCRAGGVSALVLPPPSSVAETLWG
                     EAVSGRLWPHLRATATEMALGLAAGTGLGLGAGILLAEWPALHRVLHPYVLASQLVPK
                     LALGPLLILWFGFGLTPTVVITALICFFPLLENTLTGLDQVDGGKRELFRMLGASRAR
                     TLWRLKLPSALPVILAGFRVAIVLALVGAVVGEFVGGRQGLGAAIIAAQSTMDSSLIL
                     AMFVVITALGMAVYEAARTLESLILRRYPRG"
     CDS             complement(256136..256927)
                     /codon_start=1
                     /gene="tauB"
                     /locus_tag="Maq22A_c01325"
                     /note="291d0033"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="ABC-type nitrate/sulfonate/bicarbonate
                     transport system, ATPase component"
                     /protein_id="BAQ43765.1"
                     /transl_table=11
                     /translation="MPSDAALALTGVRYRFPGDAAATVDGVDWAIPPGAVHCLLGRSG
                     CGKTTLLKIAAGLIVPDEGQVRVGGTIVRGPAPRIGFVFQAPTLLDWLSVLDNVLLPV
                     SLKRRPREADRKAARDLLATMGLGSLAGRHPATLSGGQQSRVAMARALIGAPDLLLLD
                     EPFAALDALTREELQDDLLHLCAARGTAALFVTHDIAEAAYLGDRVGVMAAGRLVHEA
                     AVPLPRPRPPGIRYTAAFGGACRSLRAAMDAPAMDAPSPAAGCAA"
     CDS             complement(256917..258374)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_014198029.1"
                     /locus_tag="Maq22A_c01335"
                     /note="291d0032"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="acyl-CoA reductase"
                     /protein_id="BAQ43766.1"
                     /transl_table=11
                     /translation="MSAVEEAGYLPGPFAGLAGRQVVVHRAWGETVAVALPVLDEAQA
                     RSLCAHIRARARDTLRGMETARIVAAIDRASACLLDRTHPSRRKAEALLPVVTGYDPE
                     TVRLGLTRYLKTFRRPQLLRFLAEDFSDPGVLDGFRPAVKGGFVRARGPDLLLHVWAG
                     NVPALPLWSLVAGLLVKAGSIGKLASAEPLTAGWFAQAVAEADPELGECLAMTWWKGG
                     EGGVEATFLEAADCVMAYGGDATLSALRARVPVSTRFLPHGHRIGFAMIGREALDSRR
                     AAAAAQAAAQDVVRYEQQGCYAPQMLFVERGGPVAPDEFARHLAHALAALAARHPRRH
                     LDPGEGAAIAAWRSGHEMRALDDAGTVLLGDPEDSWSVVHLDAPVPLSPSGLNRTVAV
                     VAVDDLAEVPALVAPHRAYLQSAGLAAAPARLFSLAEDLAAAGVTRIAALGRMTAPEA
                     GWHHDGRFSLLDLVTVTEIEASAEAAADDVAPYAE"
     CDS             complement(258386..259483)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_014198028.1"
                     /locus_tag="Maq22A_c01340"
                     /note="291d0031"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="long-chain fatty acid--CoA ligase"
                     /protein_id="BAQ43767.1"
                     /transl_table=11
                     /translation="MGREVAVMSQAEIVEALIDFIGRPGADEAEFEAMALRLFAHQYA
                     HNAPYRRFAQARGRTPLAVRRWRDIPAVPIKAFKDLTLSCCPADEAERVFMTSGTTGS
                     GRGRSYHPTLAVYDRSMLEGFAARVMRGRDTIRMGFLFPDEAALPNSSLAHYLALARE
                     RFGTPDSAVFVGPGGLDLDGLLAALAEAETSGEPYALLGATYAFVPVMDALAPQGRRI
                     ALPSGSFLFDTGGFKGQSREIEPDAFYDGLSQTFGVPREACLNMYGMTELSTQFYDDG
                     NAACPPVKSGPHWIRSRVVDPLTGRDLPEGETGVLVHHDLAHFNSVSAILTEDAGVIV
                     PGGFQLLGRVEGSASRGCSVAVAEFLAAAQG"
     CDS             259498..260067
                     /codon_start=1
                     /locus_tag="Maq22A_c27745"
                     /note="291c0018"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47055.1"
                     /transl_table=11
                     /translation="MPGVRSCAKRRLAAAPSWRRHGGRAGPASLRRHDPDQVHRVTAA
                     PGRVRAGGISASSRGSPGKVGQWGVGGRVSSGGPTVRDSYKICGIRFRRGRHKIVWDD
                     HAMAEDADTCELWANRVWTSIDLSRALTMPSGRRMRCRECHGAVRAHKVGRDGMRAHF
                     EHLIGHPGCSIGHYFRDGTPQTRHPKALT"
     CDS             complement(260083..260691)
                     /codon_start=1
                     /gene="acrR"
                     /inference="similar to AA sequence:RefSeq:WP_010629848.1"
                     /locus_tag="Maq22A_c01345"
                     /note="291d0030"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="TetR family transcriptional regulator"
                     /protein_id="BAQ43768.1"
                     /transl_table=11
                     /translation="MSMEADWVAGRRAQMMEETRARLIQAARQAFATKGFAASSMDDL
                     TAAAGLTRGALYHNFGDKKGLLQAVVDRIDAEMAARLAVVGERAESPWQGLLDEYRAY
                     IEMAVEPEIQRIVLLDGPAVLGDPSTWPSQNACLAETTRRIRALVAEGAIPPVDPEAA
                     ARLLNGASLHAALWVAASDAPEATLAKALDAFRRLAEGLAIG"
     CDS             260781..261191
                     /codon_start=1
                     /gene="tdcF"
                     /inference="similar to AA sequence:RefSeq:WP_020096193.1"
                     /locus_tag="Maq22A_c01350"
                     /note="291c0017"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="putative translation initiation inhibitor, yjgF
                     family"
                     /protein_id="BAQ43769.1"
                     /transl_table=11
                     /translation="MAQTRSTRDAIVPPGRQALYDKHRYSAAIRSGDLLFVSGQVGSR
                     EDGSPEPDFEAQVARAFARLDAVLDAAGCTFDDVVDVTTFHTDPEAQFDAVMRVRDRV
                     IGAPPYPNWTAVGVTWLAGFAFEIKAIARIPARG"
     CDS             complement(261157..261909)
                     /codon_start=1
                     /gene="gntR"
                     /inference="similar to AA sequence:RefSeq:WP_007668751.1"
                     /locus_tag="Maq22A_c01355"
                     /note="291d0029"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="transcriptional regulators"
                     /protein_id="BAQ43770.1"
                     /transl_table=11
                     /translation="MSNAPQAPDRTKGLRRVVRSTLAGQLTSEIRAAILDGQFPAGGQ
                     LNEMALAGQFGVSRGPVREAIQRLVQEGLLRAEPHRGVFVLDLADDDVVDIYFTRKSL
                     EIAAIRRVMTEPRRTALARELRELTDRMAVLLGTGDWAEIADLDLHYHRRIVEEARSE
                     RLSRSYDTLQAETRLCLRLMMAGYRQNRALIEEHERLAHFIGEGDPDETEAEMDAHFG
                     DPVRILERGRTAMREAPDLPGLSRAPESARSP"
     CDS             complement(262499..263218)
                     /codon_start=1
                     /gene="fhuF"
                     /inference="similar to AA sequence:RefSeq:WP_007558166.1"
                     /locus_tag="Maq22A_c01360"
                     /note="291d0028"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="iron reductase"
                     /protein_id="BAQ43771.1"
                     /transl_table=11
                     /translation="MIGEVAPHVPASLETYRGGVADGTGGTPLTALHDPAVFDATLSA
                     FEAGLGVAPGTTDRRALVSYWSQFYLAPLATPVLTALVRLRRPLPLAFATTNLELDAA
                     GRPARFLVRPGPAPCCADGLAGLVEDHLRPFVELCRAQCGIAPRVIWGNAAVILDYVA
                     RELGEPETMACPEVATCLGWCGTPCPRLHPLAQALCGAPGERSGGRRRRTCCLRQRLP
                     GVPSCGALCPAEGCGSCGCGP"
     CDS             complement(263215..264453)
                     /codon_start=1
                     /gene="proP"
                     /inference="similar to AA sequence:RefSeq:WP_010686566.1"
                     /locus_tag="Maq22A_c01365"
                     /note="291d0027"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="MFS transporter"
                     /protein_id="BAQ43772.1"
                     /transl_table=11
                     /translation="MTHSLAVREARGTLAALRPLAPFFCLYVTFGATLGFLSGGAPLI
                     LRARGLDLAGVGLLQIINLPVGLTFLWAVLLDRVRLPFLGRRLGWIVAAQGLTVGLLA
                     ALSLGEHWPLGALLALAVAACACVATMDIALEALVVETVPAERRAFVASAKLCGASLG
                     GILGVGVLVGSYDVLGWRAAVLACALLDALCLLPILAYPEARLQGAGGCRERHAGSLA
                     RLRALAGRIAALGAYFAAAYLIGGPNTLALLDLGVPLTRVGLLTGTVLPAVNLVMALM
                     AGGLAARFGTVRLVVLGGAGVLAAGGLMAAACLLRSEGLAVAATILNFVFGGFLGVPV
                     FNMIYRWSEGPRPATDYALLFGAAFFAAMPLRVAAPALAGWAGWPGYFAATLPLYAAA
                     LAWLAVTIARTLRADRERIR"
     CDS             complement(264515..264850)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c01370"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43773.1"
                     /transl_table=11
                     /translation="MRGAGSPGANSIVGGTGGIALTLSGHEHTAHLVGPPLITAVAGR
                     SDFKIAQNERLPDFGQSPVRDPTVRGSNGAGPALDALRPGRSAAPRPVRPPLRRRTRP
                     RKLQVTAAK"
     CDS             complement(265111..267114)
                     /codon_start=1
                     /gene="tar"
                     /inference="similar to AA sequence:RefSeq:WP_012319509.1"
                     /locus_tag="Maq22A_c01375"
                     /note="291d0026"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="BAQ43774.1"
                     /transl_table=11
                     /translation="MPSFLARVADRPIGSRINLGFGLVLLLLCGITTFNGFGLHRLGG
                     AVSEVAAAAGASDALSEFANGVADVELQATRYLRAPGGAELVAARGAYKALRERFERV
                     EALIGDDAAALKREIASLEANFNEVVSSTRQREAGLGGLTAATARLTNFTNTLTTQMA
                     AAADPSSDVALRLQQAVQSLAASARRYAQRPNSGEADILAAEQERVRRGMAELKAGPP
                     VGATARELASGLTAAVERLLTTSDAAATAAQAFDRNVATWIRTAGEASTAAASLRTRM
                     LASRNGQIQSAQQAVAQSQTVGALVSMLALALGVAAALWLGRSISRPLLTLDRSVQAI
                     AAGDLAVAVEGRERRDEIGALARALDVFKANALARRELESQNAAEQSARQRRADRVDG
                     LVRDFQRKVAQSLEIVTSAATELDSTARVMTQVADGTNGQALASSAAAEETSVNVQTV
                     AAAAEEMVASLREIERQVLRSNEVAAHAAHEAEATGGAMAALGEAADQIGAAVTTIAS
                     IAGQTNLLALNATIEAARAGEAGRGFAVVAAEVKTLAGQTARATEEISGQIAAIQGAS
                     ARAAEAIRRIGTTIGAINEISGTIATTVTQQTAATTEISRNAGEAARGTQDVSANVAR
                     VLASSGETGSAAAQVLAAAAELAVQSLTVKQEVDTFLDNIQAA"
     CDS             complement(267330..268325)
                     /codon_start=1
                     /gene="dctP"
                     /inference="similar to AA sequence:RefSeq:WP_018262742.1"
                     /locus_tag="Maq22A_c01380"
                     /note="291d0025"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="TRAP-type C4-dicarboxylate transport system,
                     periplasmic component"
                     /protein_id="BAQ43775.1"
                     /transl_table=11
                     /translation="MINRRHVLAGCGATLSTLGLPKPARATGRAKVMRLVITNALASQ
                     TGQGATVFAERVAASSGGRLRVEIYPAGVSGGELETTQDVAKNALELSIVSSVGFAIV
                     APKLGVFDIPFLFRDVAHARAVLDGPVGQKALMEVEAGGLVGLAWSENGLRHLTTASV
                     PVRSPKDLSGLKIRVPQSVAMITGFKALGADARPLAFPDLYGALSAGEFQGQENPLGN
                     IAGANFDRVQRYLSLTGHIYSAAMLIMSRQAYDLLSEDERTMVRAAARAATQAARETG
                     DRNEARLTAELGKRGMTVIADVDRAAFATAIRGADAQFETEYGKPLLEAIRAVRS"
     CDS             complement(269012..269467)
                     /codon_start=1
                     /gene="cheY"
                     /inference="similar to AA sequence:RefSeq:WP_012319064.1"
                     /locus_tag="Maq22A_c01385"
                     /note="291d0024"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="sensory transduction regulatory protein"
                     /protein_id="BAQ43776.1"
                     /transl_table=11
                     /translation="MSGLPGCRVLLVEDESLVAMMAEDMLLDLGCEVVVAMRLEQALA
                     QARTQPFDLAVLDVNLGEARSYPVADLLRQTGVPFLFATGYGRRGVDPAYQAAPVMQK
                     PYRMAELEALLAGLLVGGAAEPATTECRPACRCREPEDGASQFRADPAP"
     CDS             complement(269464..270579)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012319065.1"
                     /locus_tag="Maq22A_c01390"
                     /note="291d0023"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="histidine kinase"
                     /protein_id="BAQ43777.1"
                     /transl_table=11
                     /translation="MTDARQPLRSPAAAATALPTLRRGDQLFETERRLNAVLDNASVS
                     IFLMDDRQHCIYMNRAAEQLTGWTLTEVLARDCPLHDIVHHTYPDGRPFPLHECAIDR
                     AFPENNQERGEEVFVHRDGHFYPVGFTASPIRDDAAQVIGTIIEVRDISEEKAAAERQ
                     RLLIDELNHRVKNTLATVQSIAAQTFRGRAEGAARDLFEARLSALSTAHDVLVADNWE
                     SASLRGVIERVLAPLPADRLQLDGPDARLHPKVAVSLGMALHELAANALQHGALSVPE
                     GRVVMGWALAAGEDGRQRLDLDWREAGGPAVAPPARRGFGSRLVERQVPLEFGGSAEI
                     AYAPGGVICCMRIPLTPPGWDGQALVQGRDPAGGAPR"
     CDS             complement(270671..271036)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015933084.1"
                     /locus_tag="Maq22A_c01395"
                     /note="291d0022"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43778.1"
                     /transl_table=11
                     /translation="MPAKLVALVREAAAGARAIARAYPEGCSAAALPWVVVKRFDEDV
                     RGHVERDPRIEDERDRVLIAAVTLAETASDEVEPPERERLVKAINDLEWVTLSRGIAN
                     RAAAVLGYGEAGARLRDAR"
     CDS             complement(271114..273081)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018259954.1"
                     /locus_tag="Maq22A_c01400"
                     /note="291d0021"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43779.1"
                     /transl_table=11
                     /translation="MTGIKRAATVALLGGGLAAGPAAAEVTRFETVATEAPAFQGRAF
                     GERGQARKITGRATIALDPADPRNAVIADIALAPRNPDGKVEATADVVLLRPERPNGL
                     LLVEIPNRGRKLIGPLVEGTSTEASGRLERPDDAGRGFLLSRGYTLAWIGWQGDIAPG
                     NGKAGAPMGIRLPVLAGVTGPSREEWSFENTTSPVEAPLTWPAADLDPSKARLTVRAR
                     PEDPRETPPGLSFRFVGPTRIAITRPEGFDASALYELIYTARDPAVTGLGLAAIRDVA
                     TFLRHDASDRNPLATDGRSTIDRAVGFGISQSGRVLRDLLYLGMNEDEHGRMVFDGMM
                     PHIAGSRRSFTNARFAQPGRNPGPHLDRYYPADQFPFAYATTTDALTGKRDGLFLRCR
                     ITSTCPRLMHVDSEYELWGSRGALVTTDTRGADLAQPPEVRVYMVTGAPHFAAPDAKT
                     ASDPGCALPVSPVHAGAASRALLVALESWIADGVAPPESRYPSRADGTLGAPAHLYPP
                     IPGLPYAGLYNPAQWVEPGAGPLDPPVVRATYPLLLPKVDPDGNTLAGIRLPLIEAPR
                     ATYTAWNPTRGSAAATLCNQKGGVLPFAATKAARAPDDPRPSLEERYPEAGAYAAAVR
                     AAAVRMAAERTLLPADADEMAREAAEDRLAR"
     CDS             complement(273186..273896)
                     /codon_start=1
                     /gene="mutT"
                     /inference="similar to AA sequence:RefSeq:WP_015927666.1"
                     /locus_tag="Maq22A_c01405"
                     /note="291d0020"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="NUDIX hydrolase"
                     /protein_id="BAQ43780.1"
                     /transl_table=11
                     /translation="MTGVTLTPARAVAARMIAHDWAWARDNRAAIAAHWERRRAARPA
                     MFNGTVLLLRRWTLADGVLDLELFEAEFAALLALKDWGFPDGEVLNVFAAAVPRTRDG
                     AFLLGEMGPHTAAAGRVYFPCGTPDPTDIAPDGRVDLAASALRELREETGLVAPEGPE
                     PGWVIVRDGGLMALLRPVPLAEDEAQVRARIAAHLAAEAEPELSGIVAVRTEADLDPA
                     RMPGFARHYLEAVLAGTA"
     CDS             complement(273893..274795)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012331373.1"
                     /locus_tag="Maq22A_c01410"
                     /note="291d0019"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="phenazine biosynthesis protein PhzF"
                     /protein_id="BAQ43781.1"
                     /transl_table=11
                     /translation="MPARRYATLDVFTETALAGNPLAVVLDAEGLDEAAMQAIAREFN
                     LSETVFVMPPAESRHRARLRIFTPTQELAFAGHPTVGTAVLLALSDERAEVADAVAFG
                     LEEEVGVVPCVVEAGEGRGRARFRLPRLPESWGEEPDATALAGALGLSPAEIGFARHR
                     PSRYSAGTPFHLVPVRNLDALARARASAASLAEALGPGAKVFLYTGETGDPAHDFRAR
                     MFAPAAGIVEDPATGGAVAAFAGALMQFEPLGSGTHDLRIAQGFEMGRPSEILLQLTI
                     EDGALRAAEIGGGAVLVSEGVLHL"
     CDS             274945..275949
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_007565187.1"
                     /locus_tag="Maq22A_c01415"
                     /note="291c0015"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43782.1"
                     /transl_table=11
                     /translation="MPHALTPETGARFAALTLGHVTREYPNKPDHTLAGPEDARTPAA
                     LHPVFHGSFDWHSCVHGYWLLARVLRLFPEGPQAPAIRALFDRQLTPEKVAGECAYLE
                     APTARGFKRPYGWAWALKLADELARLPEPRWARALAPMAEIFARRFRDFLPLSPYPVR
                     VGTHFNTAFGLRMAADYADGTGDTALTDLLRATALRWYGEDADCPAWGEPSGDDFLSS
                     ALIEAECLRRLLPADAFAPWFDRFLPRLAERRPETLFRPATVTDRSDGKIAHLDGLNL
                     SRAWCLRALAGALPDGDPRSPVLREAAEAHLAAALPHLADDYMGEHWLASFALLALEA
                     "
     CDS             complement(275954..276802)
                     /codon_start=1
                     /gene="pdxK"
                     /inference="similar to AA sequence:RefSeq:WP_015927764.1"
                     /locus_tag="Maq22A_c01420"
                     /note="291d0018"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="pyridoxamine kinase"
                     /protein_id="BAQ43783.1"
                     /transl_table=11
                     /translation="MNVLSIQSHVAYGHVGNASAVFPMQRLGVEVWAVHTVQFSNHTG
                     YGAWRGRVFDGPAIEELVEGIAERGVLPTCDGVLSGYMGSADIGTAILRAVERVRAAN
                     PAALYCCDPVIGDVGRGVFVRPGIPEFMRDHAVPAADIITPNQFELDYLSGIETRTLA
                     DAKAAVAAVQASGPKVVLVTSLHTEETPGDSIDMLAGEAGRFWRLRTPRLSLGVNGAG
                     DATAALFLVHYARTRSAGEALGASAASIFGLLRRTEEAGAREILTVAAQEEFVAPSRT
                     FPVEAV"
     CDS             277014..277538
                     /codon_start=1
                     /gene="dedA"
                     /inference="similar to AA sequence:RefSeq:WP_015927763.1"
                     /locus_tag="Maq22A_c01425"
                     /note="291c0014"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="cytochrome O ubiquinol oxidase"
                     /protein_id="BAQ43784.1"
                     /transl_table=11
                     /translation="MDFESLRTTVLDFVRDHQAWAPVITGIIAFCESLAVLSLLVPAT
                     VILIGIGALIGSGAIPFLPVMVGAAIGAILGDWVSYEVGRYYKDGAKRMWPLGRYPEM
                     VQKGEAFCQRWGAWAIVVGRFIGPARAVVPLIAGVALLPRLPFWLANVSSAFLWAFVW
                     LAPGAGLIDWLRRA"
     CDS             complement(277635..278318)
                     /codon_start=1
                     /locus_tag="Maq22A_c27750"
                     /note="291d0017"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47056.1"
                     /transl_table=11
                     /translation="MGDVGHALVLGELEHDPPVREPDPPRRLERRPDAGRRLVDGVRQ
                     EVDRQPHVAGRKQPAGQLDRLGAAGLVEAVAVVVVDLAEDVPGALALGAAHQRLVAPD
                     LVPLDVDDGVKGHREGEGKRFTAPALPTSAPLGHRTAPDPPVDTLPGLSSCKVKPVAP
                     GRDSTICFVRSRGEVTRRGLRHVVARIPRPARQRRSRQRAGWHRIGHFRSPGRLSRSS
                     SDVVWAMSS"
     CDS             277911..278678
                     /codon_start=1
                     /gene="rtn"
                     /inference="similar to AA sequence:RefSeq:WP_007568463.1"
                     /locus_tag="Maq22A_c01430"
                     /note="291c0013"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="diguanylate phosphodiesterase"
                     /protein_id="BAQ43785.1"
                     /transl_table=11
                     /translation="MTERSGCGQCRSGEPLPFAFTMAFHPIVDIERNEVWGYEALVRG
                     TEGQGAGYILGQVNDDNRYRFDQACRTKAIELAGGLFPAGDVRLSINFLPNAVYEPAA
                     CIRATLEAARRIGFSHRRIMFEFTENERMTDVAHVQRIVADYRQRGFLTALDDFGAGY
                     AGLGLLARFQPDLIKLDMELIRGIADSPARRAIVSGVIGIARTLGVAVIAEGIETEGE
                     LSALREAGITLFQGYLFARPAVAALPELSPAGMQQAA"
     CDS             282082..282318
                     /codon_start=1
                     /locus_tag="Maq22A_c01440"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43786.1"
                     /transl_table=11
                     /translation="MSRSVNESVLRIETVIASGLPTAKVGRRAGAGNRGAAGQAESPV
                     GGRHAERMAPLAVPALDTVWRAGGNERLMTGQAR"
     CDS             282315..283784
                     /codon_start=1
                     /gene="cls"
                     /inference="similar to AA sequence:RefSeq:WP_015928036.1"
                     /locus_tag="Maq22A_c01445"
                     /note="291c0012"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="phospholipase"
                     /protein_id="BAQ43787.1"
                     /transl_table=11
                     /translation="MSDEHPVTGEPAALAPARETLFQPGRTCWCVARAERVAVMVDSA
                     EYFARLEEALRQAQSSILIVGWDFDGRIRLRHDASPEESPPLGPLLRDLAARRPDLQV
                     RVLVWSVATLHGPGAALPLLFGAEWESHPRVELRLDTHHPLYAAHHQKLVCIDDRIAF
                     AGGIDLTVGRWDTPAHEAGDPLRTNPDGELYPPVHDLQMAVDGEAAARLGEIARERWR
                     AATGEVLEPVRGAAPVWPPDLAPLFTDMPVAVARTMPLQGDEPSVEEAAALTAASLAA
                     ARKTLYLEAQYLTADFVADALAAHLTAEEGPEIVVVITRRSHNFTERVAMGTPRDRVL
                     RRLRAVDRFGRLLVAYPVVPGAQGADETDEAGDCEIEVHAKLVIVDDGFLRIGSSNLN
                     NRSVALDTECDLALEARTPEERRAILSLRDRLAAEHLGVAPEVLAEAAERDGLIAAIR
                     RHMGGPRSLRVCEVPEEEGLLDPLVSSELLDPERPFGTG"
     CDS             complement(283738..284754)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018262569.1"
                     /locus_tag="Maq22A_c01450"
                     /note="291d0015"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="membrane protein"
                     /protein_id="BAQ43788.1"
                     /transl_table=11
                     /translation="MTTPHDHDTRDKTSGRRRFWTILATLVSVVLGGYLLYRTLSGYS
                     PGQLVDAVRAVPASRLLAAGGFAAASYLCLTGIDWLALRAAGTPLPYRRVALAAFISL
                     SLGHSIGFAGLSSGAIRYRFYTRWGLGTADVAKAVLFCGVTVAVGLMALGAVAVLVHP
                     GLAREVTGLGTGAVLAAGLACAAFVAGYLGLAAWWRKPLTFRRWSIEMPPLPLAAAQV
                     ALGAVNFALVSACLHQVLMAVSDVGYLAVASVFVIANAAVLITHVPGGVGVIESVVVH
                     LLPKTDVIGPLIAFRCIYFLIPLALGLVAFAATEAVFRWRDAGRADAATPSRTAARGR
                     AARS"
     CDS             complement(284751..285518)
                     /codon_start=1
                     /gene="elsH"
                     /inference="similar to AA sequence:RefSeq:WP_012330867.1"
                     /locus_tag="Maq22A_c01455"
                     /note="291d0014"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="endonuclease"
                     /protein_id="BAQ43789.1"
                     /transl_table=11
                     /translation="MLRVLTYNVRRCLGGDGRIDPARIAAVIAACRADVVALQELDVG
                     RARSGGIDQAEAIAARLGMRSHFHPALRVMEELYGDAILTALPCRLVRAEGLPERAGR
                     EPRGALWAAVAVGDAEVQVVTTHLGLGRHERAAQTDALLGPRFLGDPACRDPVVLLGD
                     FNALPGSAVHRRLSERVPDAEGSVRRAWARPTFPARLPLLRIDHVFVSRGVAVREVRR
                     VQGRLARTASDHLPLVADLDLAPAVAPRHTALREEPA"
     CDS             complement(285612..286406)
                     /codon_start=1
                     /gene="fabG"
                     /inference="similar to AA sequence:RefSeq:WP_017487467.1"
                     /locus_tag="Maq22A_c01460"
                     /note="291d0013"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="dehydrogenases with different specificities"
                     /protein_id="BAQ43790.1"
                     /transl_table=11
                     /translation="MDLRIGGRTALVTGATAGIGLAIARRLAAEGATVVLPGRNRDKL
                     DAAARSIAAEPGATPPRTVQADPATAEGAAALIAAVPEVDILVNNLGIYESKAFEAIT
                     DADWHRLFEVNVVSGARLAQAYFPGMLARNSGRIVFVSSESGLVPPPDMLHYAVSKTA
                     QLTIARGLAQRTRGTGVTVNSVLPGPTRSEGIVDFLKSVASDPDAPAAALEEEFFRVH
                     RPLSLLARMIEPDEIAGLVAYLASPLAAATNGASLRVEGGIVPTIA"
     CDS             286515..287411
                     /codon_start=1
                     /gene="lysR"
                     /inference="similar to AA sequence:RefSeq:WP_020095931.1"
                     /locus_tag="Maq22A_c01465"
                     /note="291c0011"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="LysR family transcriptional regulator"
                     /protein_id="BAQ43791.1"
                     /transl_table=11
                     /translation="MDNRLGEMEAFVEVARRASFAAAAKALRRTPSAVSRAVARLEAR
                     LGVALIRRTTRSMTLTPEGELYLRRAAELIAEFAAIEDGFGREAAVPTGLLRVNASVP
                     FGTKVILPVLPRFLAEHPRMRVDLALTDDVVDLVEARADVAIRIGPLRDTSLRARRLG
                     RSRLAVVASPAYLARAGTPAHPDALADHNCLAFSFRRSLDTWPFLVDGAVSQRPVRGN
                     FLGNSGEVVRRMALGGAGLARLARFHVEDDLLAGRLVPVLEAFSPGDAEDIHALYAGQ
                     ERLSRRIRCFVDFLAAHAALRD"
     CDS             287550..287723
                     /codon_start=1
                     /locus_tag="Maq22A_c01470"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43792.1"
                     /transl_table=11
                     /translation="MMSSWFSRLAAALRGLLPGRPQPDPGTWILLGDGRGVSWSGDAK
                     APALTGPTPPPAR"
     CDS             complement(287692..288633)
                     /codon_start=1
                     /gene="lysR"
                     /inference="similar to AA sequence:RefSeq:WP_015927035.1"
                     /locus_tag="Maq22A_c01475"
                     /note="291d0012"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="LysR family transcriptional regulator"
                     /protein_id="BAQ43793.1"
                     /transl_table=11
                     /translation="MALDLGPRRRLPPLNAVRAFEAASRHATFHEAGDELGVSAGAVA
                     QQVKILEGWFGLPLFRRLPSRGVALTPAGQRFAAAAGEVLDQLAEASARLQRLGRDHV
                     LTVSTTHSFASLWLIPRIGSFRARHPDLDVRVVANNRLVDFARDDADLAIRHGRGRYP
                     GLRSDLLMHDVVFPVCSPHLRDGSPPLRTPEDLARHTLLHDDDPIDLEAVGWPQWLAA
                     AGVPGIDASRGPRFTHTFMVLQCATAGGGVGLATRVLGGDLVAGIGQGATGLVRPFPD
                     EVASPYGFFLVTPTETDAPKVASFRAWITAQAEEWGR"
     CDS             288757..288987
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012332198.1"
                     /locus_tag="Maq22A_c01480"
                     /note="291c0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43794.1"
                     /transl_table=11
                     /translation="MTSLVAGRGNLRLVPTLRLAPARRRDPVALIERLELWADRRRER
                     RALIACPDGLLKDVGLSRADAMREADKPFWRD"
     CDS             289074..290012
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012252193.1"
                     /locus_tag="Maq22A_c01485"
                     /note="291c0009"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter permease"
                     /protein_id="BAQ43795.1"
                     /transl_table=11
                     /translation="MQTVANRPMTPAEWGLLLGLSVLWGGSFFFVGVALSALPPLTLV
                     VLRVGLAAAILAAVLRLRGLPMPRGAATWRAFLGAAFLNNAVPFCLIAWGQTHIASGL
                     AAILNATTPLFGVVVAHLLTTDERLTAHRLAGVLAGLAGVAVMIGPSLLAGLGAEFLA
                     QGAILLAALSYAFAGIYGRRFKRMGIPPLAAAAGQVTAATALLLPVALVVDRPWTLAL
                     PPVPVVAAVVGLAALSTALAYVIFFRLLASAGATNLMLVTFLIPVSALILGALVLGEP
                     VVGRQLLGMALIGAGLVAIDGRLLHRRKAEAVPGRS"
     CDS             complement(290071..290706)
                     /codon_start=1
                     /gene="pncA"
                     /inference="similar to AA sequence:RefSeq:WP_012452416.1"
                     /locus_tag="Maq22A_c01490"
                     /note="291d0011"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="amidases related to nicotinamidase"
                     /protein_id="BAQ43796.1"
                     /transl_table=11
                     /translation="MSKPYNRLDLDQAVVLLVDHQAGLMSLVRDIDPDRFKNNVLAVA
                     DLAAYFKLPTILTTSFEDGPNGPIMPELKAKFPDAPFIARPGQINAWDNPDFVAAVKA
                     TGRKQLVIAGVVTEVCVAFVALSAIAEGYEVFAVTDASGTFNPLVRDGAWNRMSAAGV
                     QLVNWFAVACELHRDWRRDVEGLATLLGDHIPDYRNLMTSYAALRPQAPVA"
     CDS             complement(290892..291773)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_004272752.1"
                     /locus_tag="Maq22A_c01495"
                     /note="291d0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="AraC family transcriptional regulator"
                     /protein_id="BAQ43797.1"
                     /transl_table=11
                     /translation="MVIGMDRPPTPDLVADTLAWIEGRLDERLTLARLADRAGLSPYH
                     FSRLFTARMGLAPMAHVRARRLVRAARRLAAEPGLRLVDLALESGFESQEAFTRAFRR
                     HFGTSPGRFRRGLAPPDGDPPMPHPAERSRAVARLPGLVTRDAFTVAGPTRRFDPATA
                     ATIPDLWSHLIQALPFVDGQVPSWSTYGVVWSADRQEGSFDYMAGVGVRADGPLPAGF
                     VRKTIPAATYAVFRITLDGTALPPQVKGAMATIWGELIPASGLAVADSPDFELYDGRF
                     APDRPGTVIDVHVPVVA"
     CDS             292019..293206
                     /codon_start=1
                     /gene="paaK"
                     /inference="similar to AA sequence:RefSeq:WP_015927050.1"
                     /locus_tag="Maq22A_c01500"
                     /note="291c0008"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="AMP-dependent synthetase"
                     /protein_id="BAQ43798.1"
                     /transl_table=11
                     /translation="MPDIETRDPAALFARLPAALAAALKAPAYATHLAGIDPAAVTDR
                     AALARLPVLRKGEMPARQREALPFGGFVPGAAGGFARLFTSPGPIFEPQRSGEDPWGG
                     APALRAAGFRAGEVVLNTFGYHLTPGGFIFDTAARALGCAVIPAGPGNTEQQLDLIEA
                     YRPAGYVGTPDFLKVLLDSGQTAGRDVSSLTKALVSGAAFPPSLQAEFRERGIAAAQA
                     YATADVGFIAYETPGEPGLLVADGLILEIVRPGTGDPVPEGEVGEIVVTVLDLDRPLI
                     RYALGDLTAALPGGARIRGWMGRADQAAKVKGMFVRPEQVAEIARRHPELGRLRLVVT
                     RAGEADAMTLRAEAGSTDTALAEAVSETLRAVTKLRGTVEVVAPGSLPNDGKVIADER
                     PVG"
     CDS             complement(293287..294963)
                     /codon_start=1
                     /gene="tar"
                     /inference="similar to AA sequence:RefSeq:WP_012452675.1"
                     /locus_tag="Maq22A_c01505"
                     /note="291d0009"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="chemotaxis protein"
                     /protein_id="BAQ43799.1"
                     /transl_table=11
                     /translation="MFVLTLPRKFALLIALAATSLVALGGIALNHQYEAMLAQRIERL
                     SLITEAAANLVERYRQKAVKGEITEAAAREAALADIAAMRHGRDNYLFVNDSAGTVIA
                     HPAAKVVGRNLMGVTDPTGFRYVADVMPRARRDGAATFRYTWIPEGETAAVPKIGLFR
                     LYAPYDFYIGTSDYVSDLRAMVVAQAERLALAALVIVLVLGGASLMIVRSIVRPMERL
                     RAAMTALSEGRTDLAVPETGRRDEVGAMARTVLVFRDNAIERERLRGESDAEELRRMR
                     RAAALDALIRGFEDAITGVVGTVATAVRDLRGTAETMTATARETAVQSTTAATAAEQA
                     SSNVGTVAVAAEELGASVQEIGRQVDSSARLARSAVAEAGQTAHQVRALTEATARIGD
                     VVGLISSIAAQTNLLALNATIEAARAGAAGRGFAVVAAEVKELAGQTAKATEEITSQI
                     AAIQASTGQAAGAIGTITARIEEISGVATSIAAAVEEQGAATQEIVRNIAQAADGTGE
                     VTGNIAGVAGAAEATGAAASRVLASASDLSRQSEAISAEVDRFLAQVRAA"
     CDS             complement(295169..295858)
                     /codon_start=1
                     /locus_tag="Maq22A_c01510"
                     /note="291d0008"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="transcriptional regulator, TetR family"
                     /protein_id="BAQ43800.1"
                     /transl_table=11
                     /translation="MARIAGSSGPRTEEAIRRAGLSLIATHGYAAMSLRQLAAEVGIQ
                     QGSLYNYFRNKQEFLFDLIRGHMLDLHAALDAALLAEGSAEARLTRFTEFHVAYHVAR
                     PQEVFICYSELRSLEPDNLAAVVAMRRDYERKLGDILDHGRATGEFRLADTRMATLAI
                     LAMLSGICTWYKPGGRLSTDGLQQIFTGMVLALAHGETQALAHGEMQGEVAEPVAVPV
                     RRRGPLRAGVG"
     CDS             296050..296859
                     /codon_start=1
                     /gene="livG"
                     /inference="similar to AA sequence:RefSeq:WP_015927052.1"
                     /locus_tag="Maq22A_c01520"
                     /note="291c0007"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter"
                     /protein_id="BAQ43801.1"
                     /transl_table=11
                     /translation="MAETLAVRQISLRFGGVKALTDVSFAVEKGELFSIIGPNGAGKT
                     SMINCISGRYKPSEGQILLDGRDITKATPNQRPKLGIGRTFQNLALFHHMSVLDNILV
                     GRHHLMRNNFVTGSLYWLPGVRSEELAHRRRVEEIVDFLDLQAYRKAPAGTLSYGLRK
                     RVELARAMALEPKLILLDEPMAGMNLEEKEDMARYIVDLNEEFGMTVVMIEHDMGVVM
                     DISHRVMVLDFGRRIALGRPEAVLADPHVRKAYLGEDDDEPATLEPARAAS"
     CDS             296856..298790
                     /codon_start=1
                     /gene="faa1"
                     /inference="similar to AA sequence:RefSeq:WP_015927053.1"
                     /locus_tag="Maq22A_c01525"
                     /note="291c0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="AMP-dependent synthetase"
                     /protein_id="BAQ43802.1"
                     /transl_table=11
                     /translation="MTTDFAAIAQAADTFPKLLRRNAAAHPDEVALREKIFGLWRPTT
                     WGEYHARTRAFALGLSDLGIDGGDVVGLIGDNRPDWVAGEIAAHALGALSLGLYRDAL
                     EDEVQYLLAFAEVKAVIAEDEEQVDKLLNLADQVPSLRHIVYCDPRGMRKYDDPRLIS
                     AAALAARGEAMHAADPGLYDRMVDATDAEAVAILCTTSGTTARPKLAMLSGGRVLRHC
                     ARYLAADPKGPQDDYVSVLPLPWIMEQVYTLGQALLSRMKVNFVEDADTLMHDFREIA
                     PTFVLFAPRVWEAVAADVRARMMDASPFKRALYERGMKMGLAALDQGTHSAAAEALLF
                     RALRDRLGFTRLTSAATGGAALGPDTFRFFRAMGVPLRQLYGQTETLGAYTLHRGKTV
                     DFDTVGVPFDDSIEIRVLDPDRNGIGEVLARHANMFHGYYKAGPDTPSDVRDGWMHTG
                     DAGYVDRKGELVVIDRIKDLAVNIHGERFSPQYIENKLKFSPYVAEAVILGAGREYLA
                     ALVCIRYAVVAKWAEKNRIAFTTYSDLASKPAVIELIRREVEKVNAGLTDVQRVAKFV
                     LLYKELDADDGELTRTRKVRRGVINEKYADLIDTIYAGAPSYRVDTVIRFQDGTTQRI
                     RTTLPVIDLTAAPAILAAAE"
     CDS             298818..299711
                     /codon_start=1
                     /gene="livH"
                     /inference="similar to AA sequence:RefSeq:WP_015927054.1"
                     /locus_tag="Maq22A_c01530"
                     /note="291c0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter permease"
                     /protein_id="BAQ43803.1"
                     /transl_table=11
                     /translation="MNTHLLLQLVVNGLIVGALYGVVAMSFVLIYKASQVVNFAQGEF
                     LLIGAWVCWWLLTTYQLPFLVGMGITFAFMLVFGIAIQVVVLRPLIGEPIISVIMVTI
                     GLSIFFQALCKWLFGVFAQPFPPIFQTQSVSFLGLEIQTVYLMSLGISVAMMAGFAWF
                     FQYSKHGLAMRATAFNQQVAQSLGISVRNGFALAWAISAVVSSVAGIVVGIVNGVSSA
                     LSLYGIKVFPAVILGGLDSVVGAVIGGLVIGVLENVAQYVDGQYLHWGNLYEIVPFYV
                     LVVILMIKPYGLFGTRDIERV"
     CDS             299711..300784
                     /codon_start=1
                     /gene="livM"
                     /inference="similar to AA sequence:RefSeq:WP_012332175.1"
                     /locus_tag="Maq22A_c01535"
                     /note="291c0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter permease"
                     /protein_id="BAQ43804.1"
                     /transl_table=11
                     /translation="MATQSLIPAGDYRTTYAADTTIFPTAGSRYAVWAGLALLCCAPL
                     VLDRYWLSLLIQIGYFAVAALGLNILVGFTGQISIGHAAFFGFGAFASAWLSNNYGIP
                     VFFAIPLAGVMTTAVGLIFGLPAARLKGLYLAIATLAAQYILQDFFARANWFTGGVAG
                     TAADPFSILGFSFDTDHRYFYVVLAYLVLTFVLATNLMRSRDGRALVAVRDHYLSAEM
                     MGINLTRYRTLSFGLSAFFAGIGGALYAHYLQFVSVEGFGILLSIQFLGMIIIGGLGS
                     IMGTLMGTAFMVLVPEAMGWITDAVRGSALDRALSLKDNLSFLREMAIGLVIVLFLMF
                     EPDGLAHRWRQIKAYWKLYPFSH"
     CDS             301145..302416
                     /codon_start=1
                     /gene="livK"
                     /inference="similar to AA sequence:RefSeq:WP_012332174.1"
                     /locus_tag="Maq22A_c01540"
                     /note="291c0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="BAQ43805.1"
                     /transl_table=11
                     /translation="MLRLSLASAAILALAVPALAAEIPIGHLADQSGATSDVGVPYAQ
                     GVADALAYVNRKGGIKGEKMNVESVDYGYQVPRAVALYKKWTGGRDKVAAIQGWGTAD
                     TEALSAFVTKDEIPYISGSYAAQVSDPTGASGKAKAAPYNFFYGPSYSDALRAMLMWA
                     ADDWKAKGKTGKPKYVHMGGNHPYPNSPKEAGEAMAKDLGFEVLPAIVFALAPGDYTA
                     QCLTAKNAGANYAYLGNTGGSNISLLKSCKSVGTDIQFMGNVWGMDENAAKAAGEAAN
                     GVVFPVRTAAVSGSTAPGMAMAAEISKVSDAAGTAYRPVHYYTGICAALYMTEALAWA
                     KDNGGLAGPNVRKGFYQKKDWVPAGMEGVCVPSTWSPTDHRGMMEVHIYRAKVSGPTD
                     GALPDLIKAGTIKLEPVKTVTLPRKSEWQGW"
     CDS             302569..303405
                     /codon_start=1
                     /gene="livF"
                     /inference="similar to AA sequence:RefSeq:WP_015927057.1"
                     /locus_tag="Maq22A_c01545"
                     /note="291c0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="branched-chain amino acid ABC transporter
                     ATP-binding protein"
                     /protein_id="BAQ43806.1"
                     /transl_table=11
                     /translation="MSQVMTLERPTSDAAPAPLLSLRNVEVVYDDVILVLRGLSLDVP
                     AGSITALLGANGAGKSTTLKAISGLLRSEDGEVTRGEIVFDGARIDGIEPDRIVRRGI
                     FQVMEGRRIVSDMTPMENLRLGAFSRRDREVGQDLERVLTYFPRLKERTGAAGYLSGG
                     EQQMLAIGRALMARPRLILMDEPSMGLSPLLVKEVFSIIRQINRDLGVTILLVEQNAR
                     AALSVADRGYIMEQGKVVLDGTVEELRTNEDVKEFYLGGAGDQRKSFRNLKSFKRRKR
                     WI"
     CDS             complement(303469..304335)
                     /codon_start=1
                     /gene="citE"
                     /inference="similar to AA sequence:RefSeq:WP_015927049.1"
                     /locus_tag="Maq22A_c01550"
                     /note="291d0007"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="citrate lyase"
                     /protein_id="BAQ43807.1"
                     /transl_table=11
                     /translation="MRSLLFVPGDSPRKQEKGLEVGADALILDLEDSVALPEKGKARE
                     VAAGFLARMRAVAGRPKLYVRVNALDTGLTEDDLAAVMPHAPDGIMLPKAEGGPSVAQ
                     LGARLAVHEAEHGLPDGATRILPIATETARAVFALQSLPGASRRLSGVTWGAEDLSAD
                     LGAETNRGEDGAWTGPFQLARNLTLMAAAAAEVDAIDTINALFRDLDGLARECRAARR
                     DGFTGKMAIHPAQVAVINDAFTPTDAALAQARKVVAAFAQAPGMGVVGIDGEMFDRPH
                     LRRAERLLARQA"
     CDS             complement(304739..305233)
                     /codon_start=1
                     /gene="maoC"
                     /inference="similar to AA sequence:RefSeq:WP_009764269.1"
                     /locus_tag="Maq22A_c01555"
                     /note="291d0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="dehydratase"
                     /protein_id="BAQ43808.1"
                     /transl_table=11
                     /translation="MSTIPASTHPRGGLYFEDFEVGATLRHRLTRTVTQMDNMLFSNM
                     TLNPQPLHIDAHFCATETEWGKPLMNSLFTLGLMIGISVNDTTVGTTIGNLGMTETRF
                     PAPLFEGDTVSVTTEVAAKRESRSRPTAGIVDLVHRAYNQDGILVAECRRQAMMRKRP
                     VAEA"
     CDS             complement(305230..307176)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012332185.1"
                     /locus_tag="Maq22A_c01560"
                     /note="291d0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="carbamoyl-phosphate synthase subunit L"
                     /protein_id="BAQ43809.1"
                     /transl_table=11
                     /translation="MTTRRLASVLVANRGEIACRVIRTARALGMRTIAVYSEADRDAM
                     HVALADEAFLLGPAPAADSYLRIDRIIEAARASGAESIHPGYGFLSERPDFADACTQA
                     GIVFVGPPASAIRAMGLKDAAKALVAEAGVPVVPGYHGARQEADFLAAEAASIGYPVL
                     IKAVAGGGGKGMRRVEGPEGFSDALASAQREAQNAFGDPRVLVEKYVLSPRHVEIQVF
                     CDSHGNAVHLFERDCSLQRRHQKVIEEAPAPGMPDEVRTAMGRAAVEAAKAVGYVGAG
                     TVEFIADGREGLRPDGFWFMEMNTRLQVEHPVTEAITGHDLVEWQFRVASGEALPVDQ
                     AGLAIHGHAVEARLYAEDPDHGFLPSTGPLRALTLPSGEGIRVDTGVRAGDRVTPFYD
                     PMIAKVIAHGATRDEALDRLAGALGRTLVAGPKTNVAFLKALAESQDFREGRFDTGFI
                     DRDLAALTAPSPHRDAAIRAGLRALVAREAPAGTGSPWDAADGFQLGEARRQVFPFVL
                     EGEPAEAVLHWGPTGLAVEYGAAGPEPDGVTVVEAPPGVLVLAEGRQIALSPPDPFAV
                     DLDHIDQGGTIKAPMHGRVVAVLVAPGDTVVRGQRLAVVEAMKMEHALTAPRDGTVAE
                     VLAEAGQQVAEGARLITLTTEDAA"
     CDS             complement(307184..308791)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927046.1"
                     /locus_tag="Maq22A_c01565"
                     /note="291d0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="methylcrotonoyl-CoA carboxylase"
                     /protein_id="BAQ43810.1"
                     /transl_table=11
                     /translation="MPVIPTSADLASGAAEQNRAAWGELRSALKSHRAKAAAGGPARA
                     RERHVARGKLLPRDRVLRLLDPGSPFLEVGGLAANGMYGDDIHAAGVITGIGRVAGRE
                     VMVVCNDATIKGGTYYPLTVKKHLRAQEIALQNRLPCLYLVDSGGANLPQQTEVFPDR
                     EHFGRIFYNQAQMSAAGIPQIACVMGSCTAGGAYVPAMSDESVIVRRQGTIFLGGPPL
                     VKAATGEVVSAEDLGGADVHARLSGVADHYATDDAHALAILRRIVGGLNTVKRPDLDI
                     AASVEPAYGAGDLDALVPTDLRKQYDARELIARLVDGSEFDEFKRLYGTTLVTGFARL
                     HGMPVGILANNGILYSESALKGAHFIELCCQRRIPLVFLQNISGFMVGREVEAGGIAK
                     NGAKLVTAVATAAVPKLTVIVGGSYGAGNYGMCGRAYSPRFLFAWPNSRISVMGAEQA
                     ASVLATVKRDNIEAGGGAWSPEEEEAFKAPIRAGFEEEGSPYYATARLWDDGIILPEE
                     TRRVLGLSLSACLNAPVPETRFGLFRM"
     CDS             complement(308803..309975)
                     /codon_start=1
                     /gene="caiA"
                     /inference="similar to AA sequence:RefSeq:WP_015927045.1"
                     /locus_tag="Maq22A_c01570"
                     /note="291d0003"
                     /note="catalyzes the formation of 3-methylbut-2-enoyl CoA
                     from 3-methylbutanoyl CoA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /product="isovaleryl-CoA dehydrogenase"
                     /protein_id="BAQ43811.1"
                     /transl_table=11
                     /translation="MIPNAAREFNFGLGETAEAIRDSVRSFAQEKIAPRAEEIDRTNT
                     FPRDLWPEMGALGLHGITVEEEYGGLGLGYLAHCVAMEEVSRASASVGLSYGAHSNLC
                     VNQITRNGSDAQKRKYLPKLISGEHVGALAMSEPGAGSDVVSMRTRAEKRGDRYVLTG
                     SKMWITNGPIAETLVVYAKTDPAAGPRGITAFLVEKGMKGFSTAQKLDKLGMRGSDTC
                     ELVFEECEVPEENVLGQVGRGVNVLMSGLDYERAVLAAGPLGIMQACLDVVIPYVHER
                     KQFGQAIGEFQLVQGKLADMYVSTNAAKAYVYAVAQACDRGETTREDAAGAILYAAER
                     ATQCALDAIQLLGGNGYINDYPTGRLLRDAKLYEIGAGTSEIRRMLIGRELFNKSA"
     CDS             complement(310424..310981)
                     /codon_start=1
                     /gene="ruvC"
                     /inference="similar to AA sequence:RefSeq:WP_015927041.1"
                     /locus_tag="Maq22A_c01575"
                     /note="291d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="Holliday junction resolvasome, endonuclease
                     subunit"
                     /protein_id="BAQ43812.1"
                     /transl_table=11
                     /translation="MSEPIRILGIDPGLRRTGWGLITVTGTRLAFVASGTVTSNGDDD
                     LATRLCSLHEGLTKVVATMLPDEAAVEETFVNKDAQATLKLGHARAVALLVPALAGLP
                     VAEYAANLVKKTVVGAGHAEKDQVGAMVRFLLPKATADTADAADALAIAITHASHRAS
                     RARAATHAAAAGPGAGRIARAVARG"
     CDS             311176..311931
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018387701.1"
                     /locus_tag="Maq22A_c01580"
                     /note="291c0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="predicted permeases"
                     /protein_id="BAQ43813.1"
                     /transl_table=11
                     /translation="MSLDPAALLPLDARTATLFLAALVGGLVRGFTGFGFAMVFVPVA
                     AAAVGPAAAVGLIWVVDAPFSLWFGARSAPRAVWREVVPLLIGSTLLLPVGVQLLTHL
                     DPALTRWITACAILLALAALVSGWRYKGEPSLPLSLATGGASGLASGFAALGGMPLAV
                     FWLASQRASARQVRDNLMAYFGLSTLVSGVVFTATGVLTGPRFAEAVPLLLPYGVGLW
                     IGSHGFRHASDRTFRVIVYAVILVAVCLALPLR"
     CDS             complement(312030..312881)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_014189685.1"
                     /locus_tag="Maq22A_c01585"
                     /note="291d0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43814.1"
                     /transl_table=11
                     /translation="MKDFPAAYQVSEGSALSVDRPFYERIAAETGGRTLVDAFTVPIR
                     TGRAWSVPAGHVFRIVAPEGPQVGDLNIWNRHDPRERLWAARTRQLQGAHVTTFDRLW
                     STLPFLRPLVTITADTLAHYGTDEYGGRVHDLLGTRCDPYVNKLLTGQDFHFHCHSNL
                     TRAVMPFGLTEFDVHDVLNVFQVTGLNHDDLYFMRDCPAKAGDYLEFFAEIDLLCALS
                     TCPGGDLSVPLWGPDARDPIEVCRPLAVEVYRLAPELTEGWRSPEVAPYRGQHGLHAE
                     KGWWDKA"
     CDS             complement(313173..316664)
                     /codon_start=1
                     /EC_number="1.2.7.8"
                     /inference="similar to AA sequence:RefSeq:WP_012332193.1"
                     /locus_tag="Maq22A_c01590"
                     /note="451d0010"
                     /note="Catalyzes the ferredoxin-dependent oxidative
                     decarboxylation of arylpyruvates; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /product="indolepyruvate ferredoxin oxidoreductase"
                     /protein_id="BAQ43815.1"
                     /transl_table=11
                     /translation="MGSPATTPSLRSVSLDDKYDLSRDRVFVTGTQAVIRMLLMQQAR
                     DRAAGLNTAGFVSGYRGSPIGGLDQNLVRAKKVLDQAGIVFQPGLNEELAATALWGAQ
                     QAEMRGEGRYDGVFGLWYGKGPGVDRSGDVFRHANMAGTSRHGGVLALMGDDHTAESS
                     TVAHQSEFHFVDVMSPILNPAGVQEILDYGLYGYAMSRYCGTWVAFKCIKENIESTAS
                     VDARLDRVKIVLPDDFLMPPGGLNIRTPDGILEQEARLQDFKRDAMMAFVRANGLNRI
                     VLSGGRQPKIGIITVGKSYLDVRQAMDDLGLDEVKANDMGLRLYKVACPWPLSRRELA
                     EFADGLDLVMVVEEKRSLIEVQLREELYGSANQPVCIGKRDEAGHWLFPVKGALDPND
                     IAVALGERLLRYHRNDDLAGRVARLKGAQERLAQTVDIAARVPHFCAGCPHNSSTRVP
                     DGMRAYAGIGCHYMAQWMDRETDGFTQMGGEGANWIGENAFSKRGHVFQNLGDGTYNH
                     SGSLALRWAVDTGTTITYKILFNDAVAMTGGQPHEGGLTVDRIAAQVRAEGVERIALV
                     TDEPDKYPSTVSWPHGLTIHHRDELDAVQRELAAVPGVSVMIYDQTCASEKRRRRKRN
                     AYPDPDKRVIINELVCEGCGDCSVQSNCVAVQPVETEFGRKRRIDQSSCNKDFSCVKG
                     FCPSFVTVHGAKPRSKPAGVPVATEASPDAGIPEPAIPAIDGTYNLIVTGVGGTGVVT
                     VGAILGMAAHLEGKGLGMIDMAGLAQKGGAVFSHVRLANHQEDIHAIRVGAGAADLVL
                     GCDLVVSGNRKVLSAIAKGRTHLVVNTAEVMPGEFTRRPDFSLPAERIKRAIREAAGA
                     EHADFTDATSLAVSVLGNALAANMFMLGFAWQRGRVPLSRDALLKAIELNREAVAMNR
                     AAFAWGRRAAASPETMRAVEAPAPDLAPDLDGVIAKRVAFLTAYQDAAYAERYAKAVS
                     AVRVREATIVPGQSALTDAAARSLFRLMAYKDEYEVARLYTDGSFQAQVQRTFEGDDL
                     RYEFHLAPPLLARRDPATGRPRKMTFGPWMMTAFGMLARMKRLRGTALDPFGYTRERR
                     EERRLVQDFEARLTEIARDLTPANHAAAVGLAGLPQRIRGYGPVKARNLEAVRDEEAA
                     LLARFRSQEAPLATAAE"
     CDS             complement(317235..318167)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_007118077.1"
                     /locus_tag="Maq22A_c01595"
                     /note="451d0009"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="amidase"
                     /protein_id="BAQ43816.1"
                     /transl_table=11
                     /translation="MTHRLPASPETCRWGYLDATVPPVLTIRSGERVTIETVSGGPDA
                     LPPEGFHVPPELRAIHAAETGIPSGHILTGPVAIEGARPGDVLEVRILDVSLRQDWGY
                     NRHRPLAGTLPDDFPAFHHMTLPLDRERLTARMPWGLEIPLAPFFGVMAVAPPPAWGR
                     CTSIVPRAFGGNLDNKELVAGTTLFLPVLAEGALFSCGDGHGAQGDGEVNVTAIETAL
                     SGTFELVLRRDLPLAYPRAETPTHVITMGLDPDLDRCAERALREMIDLVVGRVGITRD
                     EAYALCSIAADLRVTQTVNQHKGVHCMLRKDYLI"
     CDS             318418..319878
                     /codon_start=1
                     /gene="ssnA"
                     /inference="similar to AA sequence:RefSeq:WP_012333388.1"
                     /locus_tag="Maq22A_c01600"
                     /note="451c0023"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="cytosine deaminase and related metal-dependent
                     hydrolases"
                     /protein_id="BAQ43817.1"
                     /transl_table=11
                     /translation="MRTLAARHGFDAQGAVRDLAITIADGRIAALEAAAAPGAAAAPG
                     AAAVSEDTVVLPALANAHDHARPLRPSSVGGFNKPLETWLHRLALLAPVDPYLATLAP
                     LARAALGGQGAVMIHQVRPTGLTDYPTEAEAMARAARDVGVRIALGIGLRDRNPLVYG
                     DHAAVLDALDPATRAEIESRFLSPMAPLAEQLARVEATADAVGGPMVDVQYAPNGPQW
                     GSDGLWEAVAEASARTGRRVTTHLFETRYQRDWADRTYPGGLVRRWREIGLLSPRLTL
                     AHCVHARPDELEMIAEAGCVIAVNTSSNLALRSGIAPVAEMVRRGCRVALGLDGQAFD
                     EDDDALRELRLLWSLHGGWGFDAEIAPRRALAMALETGRIAVGAPEGGRIAVGAPADL
                     LVLDRAALDEDALAEVDPLDLLFARATKRHVRELIVAGRTVVRDGVVLGVDLDGAHRA
                     LRDACRAAMPARAGLWRAMPGFEAAVAGYYRRLGCC"
     CDS             320050..320973
                     /codon_start=1
                     /gene="paaX"
                     /locus_tag="Maq22A_c27755"
                     /note="451c0022"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="phenylacetic acid-responsive transcriptional
                     repressor"
                     /protein_id="BAR47057.1"
                     /transl_table=11
                     /translation="MSDARGSSADRNGEARGAALVSRLVDAVPLRSGGFIVTLYGDVV
                     EPRGGRLWMGNIVETCRMVGISETLVRTAVSRLVAAGQLTGERQGRRSFYQLTAAARR
                     EFLSAARTLFEPQPETGWLLVWLGAEPDGEAGPALERAGFVRLGPQWLLGPDHHRPAD
                     PALVVFEVGPKADRAAGSRLADLVAAHWDLAAFEAAYVAFLATFAGIDEALAAGLCPT
                     DAEALQLRLLLVHAYRHAALRDARLPAATLPPDWSGHRARRLFADLYLRLSPAADRYV
                     GQHLLAGDGPLPARTAETLGRTASLTRVRDA"
     CDS             321218..322219
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015929941.1"
                     /locus_tag="Maq22A_c01610"
                     /note="451c0021"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="phenylacetate-CoA oxygenase"
                     /protein_id="BAQ43818.1"
                     /transl_table=11
                     /translation="MYAQLVKTDSTHVRGRDEMSAEERAFQERIDRGEKIEPKEWMPE
                     GYRKTLIRQIGQHAHSEIVGQLPEGNWITRAPTLERKAILLAKVQDEAGHGLYLYCAA
                     ETLGVSRDELMERLHAGTMKYSSIFNYPTLTWADMGAVGWLVDGAAIMNQVPLQRTSY
                     GPYSRAMIRICKEESFHQRQGYDLMMRMARGTPAQKHMAQDALNRFWYPALMMFGPSD
                     KDSVHSAQSMAWKIKMNTNDELRQKFVDQTVPQAEHLGLTVPDEGLRWNEEKGGYDFS
                     EPDWNEFYEVIAGNGPCNRERLGARVKAWEDGAWFRDGLKAHADKQVRRSAMAVAAE"
     CDS             322273..322557
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015929940.1"
                     /locus_tag="Maq22A_c01615"
                     /note="451c0020"
                     /note="with PaaBCDE catalyzes the hydroxylation of
                     phenylacetyl-CoA; involved in phenylacetate degradation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /product="phenylacetate-CoA oxygenase"
                     /protein_id="BAQ43819.1"
                     /transl_table=11
                     /translation="MSSEWPLWEIFIRGQHGLNHRHVGSLHAPDAALAIKNARDVYTR
                     RNEGVSIWAVRSSDIVASSPSDKGPLFEPANSKVYRHPTFYDIPDEVGHM"
     CDS             322554..323420
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_011537331.1"
                     /locus_tag="Maq22A_c01620"
                     /note="451c0019"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="phenylacetic acid degradation protein"
                     /protein_id="BAQ43820.1"
                     /transl_table=11
                     /translation="MMSSLPDVMTKDAAALAAAAAAGAHPAPEAARDAPLAPARAALF
                     EFLTRMGDNTLVLGHRLSEWCGHGPVLEEDIGVANIALDLIGQTQFWLGLAGEVEGRG
                     RTADDLAFLRDVWDFRNVLMVELPNGDFGQTVMRQFLFDAWHVAMLRALTASSEPRVA
                     EIAAKAIKEAHYHLEKSADLVVRLGDGTEESHRRMQAALDILWPYAGELFLSDAADAT
                     LADAGIAPDPASLRAAFDGTVLPVLAEATLAVPPGSFAQKGGRRGVHTEHLGRMLAEM
                     QFLQRAYPGATW"
     CDS             323427..323951
                     /codon_start=1
                     /gene="paaD"
                     /inference="similar to AA sequence:RefSeq:WP_014765659.1"
                     /locus_tag="Maq22A_c01625"
                     /note="451c0018"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="phenylacetate-CoA oxygenase"
                     /protein_id="BAQ43821.1"
                     /transl_table=11
                     /translation="MQAHARPAPDEIRGWLAAVPDPEIPVISVVDLGIVRDLTWDGDT
                     LVVTVTPTYSGCPATAAINVAIETALHEHGIARVRIERSLTPPWTSDWIGEAAREKLR
                     AYGIAPPIDGTAADGRLLGRVGRLAGGSNLAVACPRCGSNRTERVSQFGSTPCKASWR
                     CTDCLEPFDYFKCI"
     CDS             324161..325237
                     /codon_start=1
                     /gene="hmp"
                     /inference="similar to AA sequence:RefSeq:WP_015929937.1"
                     /locus_tag="Maq22A_c01630"
                     /note="451c0017"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="phenylacetic acid degradation protein"
                     /protein_id="BAQ43822.1"
                     /transl_table=11
                     /translation="MARFYPLDVAEVRRETRDAVVLTLRPRDGDADAFAFTQGQYLTF
                     RRAFDGVELRRSYSICAGRDEGALKVGIKRVEGGAFSTWANQELRPGDVLEAMPPMGT
                     FHAPIEPEVAKHYLGFAGGSGITPVLSILKTVLAREPRSRFTLVYANRQVSSIMFREE
                     LDDLKSAHLGRLSVVHVLESETQEIDLFTGRVDADKCAALFRLWIDVGSVDTAFICGP
                     EPMMLAIAASLREHGLSDAQIKFELFASGQPGRARARAAGTAASAAEAQCEATVTLDG
                     ATRTFRMPKQGESLLDAALANSLDAPYACKAGVCSTCRAKVLEGEAEMITNHALEDYE
                     VRQGYILTCQCYPTTDRLVVSYDQ"
     CDS             complement(325424..326980)
                     /codon_start=1
                     /gene="cccA"
                     /inference="similar to AA sequence:RefSeq:WP_018043246.1"
                     /locus_tag="Maq22A_c01635"
                     /note="451d0008"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="gluconate 2-dehydrogenase"
                     /protein_id="BAQ43823.1"
                     /transl_table=11
                     /translation="MRRQPVTRRLLTALAGSGALSLAAGAALAQPAGSDLVEKGRYLA
                     TAGDCVACHTAPGGKPYAGGLYINFPGGIGKLATPNITPDKETGIGSWSDDDFKRAMH
                     QGITKSGSYLYPAFPFPWYTRLSDEDVQAIKAYLFSLEPVNAPRKPTDIAFPFSIREG
                     LLAWRLAFFTEGRFKPDPQASEQVNRGAYLVGGPGHCGACHNGSKLVGASQWSGYLEG
                     GTIDGWYAPNLSGDDKEGLGKWSEDQLFTYLKTGAAPGRAGVVAGPMRQVIEESLSKM
                     TDEDVRAIAVYLKTLAPKPTYTPDVKSDFKQASAPGADVYLNRCVACHRPDGQGQPGA
                     IPALAGNGAVLAKGPETVIRVILGGLDAKGEYAAMPAVGVGMTDADVAAVTNYVRQTF
                     GNEAPPTAEPGQVASLRAETQSMLAGNAPCETVSNPTLVEALKSVDAAGQLKDLKAEQ
                     MLPRVSALLPALRQAAPQASSADLVNGLTATFCQVADHKATGLDWPTTIGSFAGVVYG
                     QVKNPSRVEK"
     CDS             complement(326998..327261)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012333489.1"
                     /locus_tag="Maq22A_c01640"
                     /note="451d0007"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43824.1"
                     /transl_table=11
                     /translation="MPDLLTSGHIVDVALLIVAAEAGYLALWRRGPGRTALLINLASG
                     ACLMLALRLVLAGAPGFWLAAALAGAGAAHVADLWLRLRSAAP"
     CDS             complement(327509..327985)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018260069.1"
                     /locus_tag="Maq22A_c01645"
                     /note="451d0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="tryptophan-rich sensory protein"
                     /protein_id="BAQ43825.1"
                     /transl_table=11
                     /translation="MSGGWTPIVVAALAAIVVAAAGAWLTALGPWYRSLRVPSWKPPD
                     WAFGPVWTTIFTLTAIAGVLAWNAAPDGRERTWLIAAFGVNGLLNIAWSGVFFRLRRP
                     DWALVEVAALWLSVLGLIVVVGRHSGLGAVLLLPYLAWVGIAALLNRSIVRLNGPF"
     CDS             complement(327982..329160)
                     /codon_start=1
                     /gene="fixC"
                     /inference="similar to AA sequence:RefSeq:WP_012333491.1"
                     /locus_tag="Maq22A_c01650"
                     /note="451d0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="geranylgeranyl diphosphate reductase"
                     /protein_id="BAQ43826.1"
                     /transl_table=11
                     /translation="MDETILDAVVVGGGPAGATAAMDLARLGRRVVLLDRAGRIKPCG
                     GAIPPRLIRDFAIPDELLVAKIRSARMVSPKDRAVDMPVGEGFVGMVDRGPFDEWLRV
                     RAALAGAERVTGTYLRLSRAGDGPVTVRYRDAAGAEASLRTRLVIGADGANSAVGRQE
                     VPAHARMRQVFAYHEIVRTPPGGGVEATRCDVYYQGVLSPDFYAWIFPHGDTLSIGTG
                     SARKGFSLRGAVGRLRAATGLDRGETIRREGAPLPLKPLARFDNGRDVLLTGDAAGLV
                     APASGEGIYYAMFGGRLAAQAAHDFLATGNPRALGQARRRFLRTHGRVFWILRLMQSV
                     WYRNDALRERFVSICRDPDVQSLTWDAYMNKELVRAKPAAHARIFFKDLAHLFRWVSP
                     "
     CDS             complement(329255..330592)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012333492.1"
                     /locus_tag="Maq22A_c01655"
                     /note="451d0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="bacteriochlorophyll synthase"
                     /protein_id="BAQ43827.1"
                     /transl_table=11
                     /translation="MSATTGFGWGTIVRLGLVQTALGAIVVLITSTLNRVMVVELALP
                     AALPGGLVALHYAVQILRPRWGYGSDLGWRRTPWIVGGMALLALGGLGAALGTALVAG
                     QPALGFVVLVLSFLAVGIGVGAAGTSLLVLLSTGVAPHRRGAAATIVWIMMIAGFVVT
                     APTAGHLLDPFSGERLVAVSGGVSLIAFLVALAAVWGVEPARAPAAPQPPGPARPFAR
                     VLAEVWAEPEARRFTVFVFLAMLAYSAQELILEPFAGLVFALSPGATTKLSGLQNGGV
                     LAGMILVALVTANGRGKLASLRLWTVAGCLGSAAALAAIAACGLAGPGAPLRTCVAGL
                     GLFNGMFAVAAIGSMMALAGHGGAPDGESRHGTRMGVWGAAQGIAFGLGGFLGAAGVD
                     LARLAFGTVVPAYATVFITEAALFLVAAGLAAQIGRPARDPRPLEGLSVRHAV"
     CDS             complement(330589..331521)
                     /codon_start=1
                     /gene="ubiA"
                     /inference="similar to AA sequence:RefSeq:WP_018260067.1"
                     /locus_tag="Maq22A_c01660"
                     /note="451d0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="bacteriochlorophyll/chlorophyll a synthase"
                     /protein_id="BAQ43828.1"
                     /transl_table=11
                     /translation="MSTEPLLKPLPKPPLLAKPSAVPEPGALLELLKPITWFAPMWAF
                     ACGVVSSGVPVQGRWPVILAGILLAGPLVCATSQAANDWFDRHVDAINEPDRPIPSGR
                     MPGRWGLFVALAWTLLSLAVAALLGPWVLGAGVFGLALAWAYSAPPLRLKRNGWWGNA
                     ACGLCYEGLPWFTGAAVMAGALPDGRIVLVAALYSLGAHGIMTLNDFKSMEGDRRTGI
                     RSLPVQLGAGRAARLACLVMAAPQVVVVAALAAWGMPWHATLVAALLAGQGVLMRRFL
                     SDPHRWAAWYNGTGTLLSVLGMLTAALALQGGAA"
     CDS             complement(331603..333027)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018260066.1"
                     /locus_tag="Maq22A_c01665"
                     /note="451d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="Fis family transcriptional regulator"
                     /protein_id="BAQ43829.1"
                     /transl_table=11
                     /translation="MLRDAVSRLDPRMTGSLVAAASDVSLVVDGDGVIRDAAFGADGL
                     SEEAGETWLGRRWIDTVTVESRPKVLRLIEDAEPGAVTRWRQVNHPSAQGGADVPIRY
                     AALRVPDDDRIIVIGRDLRALSALQQRLTDSQQALERDYARLRGAETRYRVLFQLAGE
                     PILIVDAATRRIGEVNPAAARLLGRAVKRVVGRDLVDLFEPESARAVQALLVGLRLTG
                     QAEDLAARLAQRRGEARVSATLFREEAGTSVLVRLSPLAPVESPAALRSGALDVIEAM
                     PEGFVVTDRDRRIIGVNAAFLDLAQLATEHQAKGESLDRWLGREGTEIAALFTTLAEH
                     GAVRHFATVVRGEFGAVDEVEVAAVSVPGGDRPCFGFTLRSLPRRVAAAMPGSLPGGR
                     ELPRSVEHMTELVGRVSMKALVRETTDLIERLCIEAALRITHDNRASAAEMLGLSRQG
                     FYAKMRRYGLGDLDGSEEPDDADA"
     CDS             complement(333107..333823)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018260065.1"
                     /locus_tag="Maq22A_c01670"
                     /note="451d0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="cobalamin-binding protein"
                     /protein_id="BAQ43830.1"
                     /transl_table=11
                     /translation="MLAHRGERPVRRLSSRPCAADDILRLGTLLLLPEDRDVLAEVRR
                     LLDEGMSLEEVLTGLLAPTARHIGRLWEEDVCDFVQVTTAMARLRRLVHDLETHCLDP
                     RPVDPASRRVLLAPAPGETHTFGLTLTAHFLGETGWDVATSFEPCLTDAIERLRAEWF
                     DVLGLSLSCDVHVERLALAVPVLRRASRNRDLRVVVGGPAFAGRPDRIRLVGADAAVE
                     DARQAPGILQSLLDLRIRAC"
     CDS             334279..334770
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012333496.1"
                     /locus_tag="Maq22A_c01675"
                     /note="451c0016"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="2-vinyl bacteriochlorophyllide hydratase"
                     /protein_id="BAQ43831.1"
                     /transl_table=11
                     /translation="MATSTDRPFLYSEAERRRRDASPWTLVQGVLAPLQFAVFLVSLA
                     LVSRTLATGEGVALANASVVAKTLALYAIMVTGSLWEKAVFGRYLFAPAFYWEDVVSM
                     LVLALHTAYLVALATGALATTGLMLLALSAYATYLVNAGQFLLKLRAARLQAPAYAMG
                     AAR"
     CDS             334767..336041
                     /codon_start=1
                     /gene="nifD"
                     /inference="similar to AA sequence:RefSeq:WP_018260064.1"
                     /locus_tag="Maq22A_c01680"
                     /note="451c0015"
                     /note="light-independent reduction of protochlorophyllide
                     to form chlorophyllide a; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /product="light-independent protochlorophyllide
                     reductasesubunit N"
                     /protein_id="BAQ43832.1"
                     /transl_table=11
                     /translation="MTALASAHPSAVPCGPKIRHERGQRAVFCGLTGIVWLHRKIQDA
                     FFLVVGSRTCAHLIQSAAGVMIFAEPRFATAIIEERDLAGLADAHEELDRVVRRLLER
                     RPDIRLLFLVGSCPSEVIKLDLGRAATRLSGTFAPDVRVLSYSGSGIETTFTQGEDAC
                     LAALVPDLPRSQDASLLVVGALADVVEDQFARLFGDLGIGNVRFLPGRRAADRAPVGP
                     NTRYLLAQPFLTDTARALEDRGAARIPAPFPLGAEGTTLWLSAAARAFGIPSARLAAV
                     TEAGRARAARALAAHRDRLAGKRVFFFPDSQLEVPLARFLSREMGAALIEVGTPYLHR
                     GHLAEDLALLPDGTRVTEGQSLDDQLDRCRAARPDLTICGLGLANPLEAEDLATKWSI
                     ELLFTPIQGYEQAGDLAGLFTRPLARRARLEG"
     CDS             336046..337581
                     /codon_start=1
                     /gene="nifD"
                     /inference="similar to AA sequence:SwissProt:B0UDK6.1"
                     /locus_tag="Maq22A_c01685"
                     /note="451c0014"
                     /note="light-independent reduction of protochlorophyllide
                     to form chlorophyllide a; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /product="light-independent protochlorophyllide
                     reductasesubunit B"
                     /protein_id="BAQ43833.1"
                     /transl_table=11
                     /translation="MQLTLWTYEGPPHIGAMRVATAMRGLHYVLHAPQGDTYADLLFT
                     MIERHGARPPVTYTTFQARDLGSDTAEIFKQAVAAAYGRFRPQAMIVGASCTAELLQD
                     DPGGLSKALGLPIPVIPLELPAYQKKENWGASETFYRLVRTLAPAAPAPARPKASCNI
                     LGPTSLGFRHRDDLREVRGLLAELGIAVNVVAPLGATPADLGRLGQAAFNVVLYPEVA
                     RAAAQWLERSHGQPFVETAPIGVKGTTAFVEAVAALAGIDPAPVLDGEGSRLTWYARS
                     VDSTYLTGKRVFVFGDATHAIAAARVAAREIGFSVVGLGTYSREFAREVRAEAAEHGI
                     EALVTDDYLAVEAAIAAAQPELVLGTQMERHVAKRLGIPCAVISAPMHVQDVPARHAP
                     QMGFEGANVLFDTFVHPLMMGLEEHLLAMFRDDPEFHDGVAPSHLGGAPREEAETAVV
                     AAPVTAATPVVWSIEAERELKKVPFFVRGKARHNTERYARERALPLITVETLYDAKAH
                     FSR"
     CDS             337556..341263
                     /codon_start=1
                     /gene="cobN"
                     /inference="similar to AA sequence:RefSeq:WP_012333499.1"
                     /locus_tag="Maq22A_c01690"
                     /note="451c0013"
                     /note="involved in chelation of magnesium into
                     protoporphyrin IX; involved in bacteriochlorophyll
                     biosynthesis; the enzyme from Rhodobacter capsulatus
                     contains an Fe-S cluster; part of a complex with BchI,
                     BchD, and BchH; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /product="magnesium chelatase"
                     /protein_id="BAQ43834.1"
                     /transl_table=11
                     /translation="MPKRISAGDGPGALPELRVVIVTLDNHLAGAVERARRVLAVSAP
                     GLVLGFHAAAEWETDPSAVEACRADIARADIVLSAMLFMDEHVRAVLPALLARRTECD
                     AMVGCLSAAEVVRTTRMNRFAMDGSQRGALDFLKRLRGKSGPGGTQGNGARQMALIRQ
                     IPRILRFIPGSAQDVRAYFLTLQYWLAGSDENVVNLVRFLAGRYAAGPRTAWRRHLTA
                     AEPLSYPETGLYHPRLAERVTERLDRLPASGKAGRVGLLLMRSYVLAGNTAHYDGVIA
                     ALEARGLSVVPAFASGLDNRPAVEKFFLRDGRPAIDALVSLTGFSLVGGPAYNDAAAA
                     SAMLARLDVPYLAAQAVEFQTLEQWEASARGLSPVEATMMVAIPELDGATAPMVFGGR
                     AAGGTESRDMAVHPERTARLAERVARLVSLRARERAERKVAIVLFNFPPNAGATGTAA
                     FLSVWDSLHRVLQGLNADGYSVEVPESVDALRARVLEGNAARFGTQANVAHRITADDH
                     VRREAHLAEIEAQWGPAPGRHQSDGSTILVLGAHFGNVFVGVQPAFGYEGDPMRLLFE
                     HGFTPTHAFSAFYRYLREDFCADAVLHFGTHGALEFMPGKQTGLSAACWPERLIGALP
                     NVYLYAANNPSEGTLAKRRAAATLVSYLTPSLAQAGLYRGLIDLKASLERRRALPPEE
                     AAERGKLAALIHGQALALDLAAGDGWGEDAEARIADLAVRLIELEHTLIPHGLHVVGQ
                     GTPPEERIDLLLALAESVHGLAPDRAGIARLVAGATPEEAAGPGAAEATLAAFRALAE
                     TDRLLAEDHEIPALLRALDGRFVAPVAGGDVLRSPAILPTGRNLHGFDPYRIPSAFAL
                     ADGRAQVEKLLARHAADGGAYPESIALVLWGSDNLKSEGAPVAQALALMGAQPRFDGY
                     GRLCGAVLIPLEDLGRPRIDVVATLSGIFRDLLPLQTKLLAEAAWLAASADEPQDMNF
                     VRKHALAHQAAQGIDLETAALRVFSNAEGAYGANLNHLVDSGRWEDETELCETFSRRK
                     SFAYGRTGKPEPRRALMQAVLAGVDLAYQNLDSVEVGVTSVDHYFDGLGGMARAVAKA
                     RGTSVPVYISDQTRGEGRVRSLSEQVALETRTRMLNPKWVEGMLGHGYEGVRQIDQHL
                     TNTVGWSATTDQVAPWIYQRITETYVLDEAMRERMAALNPAASAKVAHRLIEAHRRGF
                     WTPDPETRAALDRAEEALEDRLEGITAEAAA"
     CDS             341260..342153
                     /codon_start=1
                     /gene="nifH"
                     /gene_synonym="bchL"
                     /inference="similar to AA sequence:SwissProt:A9W9E2.1"
                     /locus_tag="Maq22A_c01695"
                     /note="451c0012"
                     /note="light-independent; with chlN(bchN) and chlB(bchB)
                     reduces ring D of protochlorophyllide to form
                     chlorophyllide a in chlorophyll/bacteriochlorophyll
                     production; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /product="protochlorophyllide oxidoreductase"
                     /protein_id="BAQ43835.1"
                     /transl_table=11
                     /translation="MNIAIRNPVPARREEGSLQVALDPDIRIETAKVFAVYGKGGIGK
                     STTSSNLSVAFSKLGKRVLQIGCDPKHDSTFTLTKRLAPTVIDALEAVQFHSEELRVE
                     DFVVEGYNGVRCVEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVC
                     GGFASPLQHADRALIVTANDFDSIFAMNRIVAAIHAKSKNYGVRLGGVIANRSAKTDE
                     IDRFNDAVGLKRLAHFRDLDVVRRSRLKKATLFEMDPSPELLAVQAEYLQLAEQLWAG
                     VDPLPAVPMKDRDLFEFLGFD"
     CDS             342153..342854
                     /codon_start=1
                     /gene="ubiG"
                     /inference="similar to AA sequence:RefSeq:WP_012333501.1"
                     /locus_tag="Maq22A_c01700"
                     /note="451c0011"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="SAM-dependent methlyltransferase"
                     /protein_id="BAQ43836.1"
                     /transl_table=11
                     /translation="MTTSTYAARRAQLETYFDRTAVEAWARLTSDAPVSRVRATVRAG
                     RDAMRAELLSWLPADLSGRRLLDAGCGTGALAVEAARRGAEVVAVDVSPNLVELARER
                     HAGLRLSGRLHFQVGDMLDDTLGRFDHVVAMDSLIHYRTPDIVRALARLARRTDASVL
                     FTVAPRTPLLTVMHAAGRLFPRGDRAPAIEPVGEGALRRRVAAEPGLQGFALARSRRI
                     NSGFYLSNALELVRR"
     CDS             342851..344257
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012333502.1"
                     /locus_tag="Maq22A_c01705"
                     /note="451c0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="protein pucC"
                     /protein_id="BAQ43837.1"
                     /transl_table=11
                     /translation="MSAARRLARVLADLGPRYLPFADAATKELPLGRLLRLSLFQVTV
                     GMAAVLLIGTLNRVMIVELDVPAWIVAVMLALPLLAAPFRALVGFRSDTHRSVLGWRR
                     VPYLWFGTLLQFGGFAIMPFALLILSGDTTGPIVIGQVAVALAFVLVGAGLHTTQTVG
                     LALATDLAPAYARPKVVALLCAMLLAGMMASAVVFGLALHDFSAIRLIQVIQGAALAT
                     LILNGIALWKQEPRDTSRKSVPARRFGEAWEAYAAQPQARRRLIATGLGTAGFSMQDI
                     LLEPYGGQILHLPVAATTALTALLAVGGGIGLLTAARWLNRGGDPFRVAAAGAVVGIA
                     AFSAVVFAAPLGSGGLFACGVALIGLGGGLFAHGTLTASMAGAAPEQSGLALGAWGAV
                     QATAAGAAIAASGILRDAGSALAVSGRLGEAMSEASTGYLVVYHIEIGLLFATLVAIG
                     PLVRRPALPPLSARPALS"
     CDS             344270..345061
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012333503.1"
                     /locus_tag="Maq22A_c01710"
                     /note="451c0009"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="H subunit of photosynthetic reaction
                     centercomplex"
                     /protein_id="BAQ43838.1"
                     /transl_table=11
                     /translation="MPKGALTSYLDVAQVVLYAFWIFFAGLVFYLRREDRREGYPLES
                     EVHGGLKGWDWLFVPSPKTFLLADGSAVLAPRPHEGPVGELKAVKLEPWPGAPIVPTS
                     TDDSRLADGVGPGAYALRAERPDLTWEGKTRIVPMRVADEFTVSADDPDPRGLPVYGA
                     DRVLAGTVTEIWVDRGESLPRYYEMELEGARDRTVLIPVTFADVQRFSRHKKIIVEAL
                     LARQFAGVPPHRDPDSITLREEERVIAYYGAGTLYATDDRQEPLL"
     CDS             345076..345699
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012333504.1"
                     /locus_tag="Maq22A_c01715"
                     /note="451c0008"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="phosphopantetheine adenylyltransferase"
                     /protein_id="BAQ43839.1"
                     /transl_table=11
                     /translation="MTDLLPHGLPGPLPKGERLLWQGRPALVSLARRAFHVDLVALYF
                     GGLAGFQAYSSGRVSAAWPVLLAGALALVILFALAWGTCRTTVYTLTDRRLMLRIGIA
                     LQMDVNLPLKEIEGAAFHRFGDASGDLPLRLKPGVRLAYLHLWPHARPWRLTRPEPML
                     RCVPEAEAVAKRIATALAEASGQPVQALPPAPAASPVLPGRLAAAGH"
     CDS             345710..346159
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012333505.1"
                     /locus_tag="Maq22A_c01720"
                     /note="451c0007"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="photosynthetic complex assembly protein"
                     /protein_id="BAQ43840.1"
                     /transl_table=11
                     /translation="MAHDIPIPRPLLRNAGLLVAFSLAAVAVGRFGGVGITQMPPALA
                     VQVLDLAVEDRPDGRVSLRNAGSGRLVAEVQPGEDGFLRATLRVMAQARLREGLPRDP
                     PFRLTRWDNGTLTLDDVASGRRINLEAFGLDNAVAFARLLEQGRGAS"
     CDS             346159..346458
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012333506.1"
                     /locus_tag="Maq22A_c01725"
                     /note="451c0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43841.1"
                     /transl_table=11
                     /translation="MQWLSGKRRIEVPCTVEIEQTAESLHAHVTLDGGLLIAPGDEVT
                     VHDAPTSVPYGDRIVVRRTATVVRAGAIERLWTRIAGHFELTELYEVSFSERTRL"
     CDS             346455..347516
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012333507.1"
                     /locus_tag="Maq22A_c01730"
                     /note="451c0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="magnesium-protoporphyrin IX monomethyl
                     estercyclase"
                     /protein_id="BAQ43842.1"
                     /transl_table=11
                     /translation="MSATTLKTPNESTKSAQETTFLSPRFYTTNFEELDRTNVEPVRA
                     EWDVLLAEMRSDPNKRHFVRNSDFDLDLSGLDPELRKEFLDFLVSSITAEFSGCVLYA
                     EMRKRAKNKDIRELFAFMSRDEARHAGFINDTLKDFGVGIDLGFLTKAKKYTHFRPKF
                     IFYATYLSEKIGYARYITIFRHLERNPDNRFHPIFKWFEKWCNDEFRHGEAFALLMRA
                     NPKLLTGINYYWIKFFLLAVFCTMYVRDQCRPAFHKALGIDPKEYDFQVFAITSEISR
                     QVFPLTLDLDNPGFRAGLERLLSCARGIEEAKAQGGLIGRIKHAGHAARAALAFGRLM
                     VMPAKANPMPAQIRLSPAW"
     CDS             347524..348306
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012333508.1"
                     /locus_tag="Maq22A_c01735"
                     /note="451c0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="photosynthetic complex assembly protein 2"
                     /protein_id="BAQ43843.1"
                     /transl_table=11
                     /translation="MSDYAAPILYAVVIWWFLTGAILWLNHRPRRTHAWSFGATTVAL
                     FGALWVIGWSTNQESEAGAYAAFTAALIVWGWQEMAFYMGYVAGPRRTPGVPTDQGLA
                     RFGAAAATNLWHEAAIILGFAAIAWLTAGGPNRMALWTYLVLWGMNLSARLNLFLGVR
                     NLHAEFLPEHLRYLGSFFRRAPMNALFPVAMILATGFLLVLLHPAVTESASAFKRSGH
                     TMMATLMALAILEHGFLMLPLPSAALWGWGLPARRPGADAAP"
     CDS             348354..349565
                     /codon_start=1
                     /EC_number="2.3.1.37"
                     /gene="bioF"
                     /inference="similar to AA sequence:RefSeq:WP_012333509.1"
                     /locus_tag="Maq22A_c01740"
                     /note="451c0003"
                     /note="catalyzes the formation of 5-aminolevulinate from
                     succinyl-CoA and glycine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /product="5-aminolevulinate synthase"
                     /protein_id="BAQ43844.1"
                     /transl_table=11
                     /translation="MDYEAHFSAALQGLHREGRYRVFTDLERQAGRFPYATQHGAHGT
                     REVTVWCSNDYLGMGQHPAVTGAMHEAIDRCGAGAGGTRNISGTNHYHVLLEQELADL
                     HGKEASLLFTSGYVSNWAGLGTLASKLPGCVVFSDEGNHASMIEGIRSSRAERHIFRH
                     NDPDDLDRKLRLVDPKLPKLVAFESVYSMDGDIAPIAELCDVAEAHGAMTYLDEVHAV
                     GLYGPRGGGIAERDGLMHRLTVIEGTLGKAFAVSGGYIAASTALCDFVRSFASGFIFT
                     TSLPPSIAAGAAASIRHLKASGAERARHQDRVAAVRRRLSAIGIPLLDNPSHIVPVMV
                     GDPVLCKQISDTLLDEFGIYVQPINYPTVARGTERLRITPSPLHSDADIDHLALALGT
                     IWGRIGLARAA"
     CDS             349737..350852
                     /codon_start=1
                     /gene="chlI"
                     /inference="similar to AA sequence:RefSeq:WP_018260058.1"
                     /locus_tag="Maq22A_c01745"
                     /note="451c0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="magnesium chelatase"
                     /protein_id="BAQ43845.1"
                     /transl_table=11
                     /translation="MAPTQSALSRRASKPGFPKPTVVDSAALAEAGPRPAYPFAAIVG
                     QEAMRRALLVAAVDPAVGGVLVFGDRGTGKSTAVRALAALLPPMRAVAGCPYACDPVE
                     AAAMCQACAARRGQGLAVRTVPVPVVDLPLGATEDRVVGALDIGRALGAGEKAFEPGL
                     LARANRGFLYIDEVNLLEDHLVDLLLDVAASGVNTVEREGLSLRHPARFVLVGSGNPE
                     EGELRPQLLDRFGLAVTVTTPTDLPTRIAIVRRRDAYERDPAAFAAEWAGEEARLSGQ
                     ILAARAHLPEVAVPDAILEAAARLCLALGTDGLRGELTLMRTARALASLDGAATVTLD
                     HLREVAPSALGHRLRRNPLDEAGSEARIARALAEVVG"
     CDS             350849..352573
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018260057.1"
                     /locus_tag="Maq22A_c01750"
                     /note="451c0001"
                     /note="involved in chelation of magnesium into
                     protoporphyrin IX; involved in bacteriochlorophyll
                     biosynthesis; part of a complex with BchI, BchD, and
                     BchH; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="magnesium chelatase"
                     /protein_id="BAQ43846.1"
                     /transl_table=11
                     /translation="MSASPDATWLQACRAAALLALDPAGTGVVLRARPGPVREAWLDR
                     LRALLPASAPVTRLPAGIADDALLGGLDLPATLRTGRPVAQAGLLARSDGGVVLVPMA
                     ERLAPGTAARIAQGLDAGAVEVARDGVATRCPARFGLVLLDEGEGDDEAVPAGLADRI
                     ALHLDLDAVPVGALTAALPLRDLAAARAADPDTPPDASETLCALATRLGIASLRAPLL
                     ALRVARLHAALEGRAAVGEADLAAAAALVLAPRARAWPQEEEQDERTGEDAPPADEAE
                     GDDNRHEGRQEGEDRLLAAVEASLPPGLLARLLAGDGPRIRSAGAGRAGAVAAAPRGR
                     PVGARPGDPRRGRLALIETLRAAAPWQRLRRGDGEARLRITADDLRIRRLVQRRETTT
                     IFAVDASGSAALERLAEAKGAVEQLLAECYVRRDRVALVAFRGRGADLLLVPTRSLVR
                     AKRALAALPGGGGTPLACGIEAAARLAATERRGGRSPVVLLLTDGRANIDRAGRPGRA
                     QAGADALAAARALAAEGTRALVIDTAARPQDSARALAAAMRARYLALPQADAARLARA
                     VREAAPAA"
     CDS             352579..353463
                     /codon_start=1
                     /gene="mhpC"
                     /inference="similar to AA sequence:RefSeq:WP_012333512.1"
                     /locus_tag="Maq22A_c01755"
                     /note="1d0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="alpha/beta hydrolase"
                     /protein_id="BAQ43847.1"
                     /transl_table=11
                     /translation="MTSARASDDRPDFARQGRDWPNRETSRFVAAGGLTWHVQEAGAG
                     PVLLLVHGTGAATHSWRGLLPLLARDFRVIAPDLPGHGFTDPLPTPSLPRMARALAAL
                     LRTLDAAPQIVVGHSAGAAILARLCLDGVLAPRLLVGLNAALKPFPGMAGFLFPAMAR
                     ALFLNPVTPRVFAWSADRAAVERLIHGTGSTLDRTGLDLYRRLFQTPGHVAGALGMMA
                     NWDLVPLDRDLPRLAVPLLLIVGSQDRTIAPDVSIALADRLGGRARVEWLRGLGHLAH
                     EEKPEVVAELIRADAARA"
     CDS             353540..355066
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012333513.1"
                     /locus_tag="Maq22A_c01760"
                     /note="1d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+. Start codon location
                     was manually corrected by using GenomeMatcher"
                     /product="phytoene dehydrogenase"
                     /protein_id="BAQ43848.1"
                     /transl_table=11
                     /translation="MLTLDDAPPRVTSARRRPRAVVIGSGFGGLAAAVRLGARGYRVS
                     VLERLDQPGGRARVHRQDGFTFDAGPTIVTAPFLFEDLWALCGRRLSDDVTLVPMRPF
                     YRIRFDDGATFAMSGDPAAMRDEVERLSPGEAPAYDRFMALSDELCRVGFEQLGAVPF
                     GRVTDMLRIAPDLLRLGGHRSVYSLVSSVFRDERLRTAFSFHPLLIGGSPFRASALYC
                     LIASLERRWGVHSALGGTGALVRGLVRLIEGQGGEVRCGSEVARILVEDGTARGVALA
                     DGTAIRADIVVSNADSVATALHLLPPEVRGRGSRRLARAHSSMGLFVWYFGTRRTYPE
                     LPHHTIVLGPRYRGLLDDIFSRKVLAEDMSLYLHRPTATDPSVAPPGHDAFYVLAPVP
                     NLAGGQDWAALAEPYRQRIAARLEATVLPGLSDALATSRVTTPQDFSDDFLAFRGSGF
                     GLEPILTQSAYFRPHNRCGAVRHLYLVGAGTHPGAGLPGVLSSSKILDRVVPDAAVFA
                     "
     CDS             355047..356159
                     /codon_start=1
                     /gene="erg9"
                     /inference="similar to AA sequence:RefSeq:WP_012333514.1"
                     /locus_tag="Maq22A_c01765"
                     /note="1d0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="phytoene synthase"
                     /protein_id="BAQ43849.1"
                     /transl_table=11
                     /translation="MLPSSPDAPLGGCTARPADHAACRAAIRAGSRSFYAASWLLPRA
                     VRRDAYGLYAFCRLSDDAVDGAGAQADAVPRLRARLAAVYAGRPADAPADRALAEIVA
                     RHAIPQALPAALLEGLAWDAAGRRHPDLSSLVAYAARVAGSVGAMMTLVMGERSGEAL
                     ARACDLGIAMQLTNVARDVGEDARAGRLYLPESWLRDAGIDPDAFLARPEQSPALAAV
                     VARLLAAADLLYARADSGIAQLPAACRPAVRAAGLIYAEIGRDLARGGLDPVSRRARV
                     PGARKAQLLARAALTGSLRRADRPVLPEAAFLVEAVTAMPRPASVPPVAVSPVVLPPL
                     AGARPAWWNLAARVVRVLDLIEVLRERERFGGAAPS"
     CDS             355082..356305
                     /codon_start=1
                     /locus_tag="Maq22A_c27760"
                     /note="1d0004"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47058.1"
                     /transl_table=11
                     /translation="MYRPPRRPRRLPGGDPGGVAKLLRRLVAAAPGGAPRRLRALRLL
                     PPLGRCRRRGGRPGRRGAPPAGAPGCGLCRPARRRARRPGARRDRRPPCDPPGPARRA
                     PRGPGLGRRRAPSPGSLLPRRLRGPGRRLGRRDDDAGDGRALGRGAGPGLRPRHRHAA
                     HQRRPRRRRGCPRRAPLPAGILAARRRNRPRRVPGPAGAEPRARRRGRAPARRGRPAV
                     RAGRFRHRAASRRLPAGGAGRRPDLRRDRSRPRPRRPRSGQPSRPGSGSPQGATPCPR
                     GADGLAAPCRPAGPAGGRLPGRGGDGDAQARLRPPGRRLPGRPASARRSASGLVEPRR
                     AGRARPRPHRGAARAGALRRRGAVVNETLFALLDFGLVFGAVLGFGFWQLWVLRRDRR
                     RSEAARRGDEPGREG"
     CDS             356402..357436
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012332500.1"
                     /locus_tag="Maq22A_c01775"
                     /note="1d0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="endonuclease/exonuclease/phosphatase"
                     /protein_id="BAQ43850.1"
                     /transl_table=11
                     /translation="MTGLRTTRRDTLVAGLALCLAASAARAEVKAGPVLMHWGTCQAS
                     GAVPYPAGSFGDRVLVVSDADNSLRLYRANESGPPLALKGGDLDAALATDAREEPGQA
                     DIEALTWLGSDLVAIGSHGRDAEGRTREATRQVLALSVGGDAAAPTVAPKGKAFRGLA
                     KAIADLDPALADRIAVDLAAKPNLSPQRRGLAIEGLSPAPDGRGLFVGLGNPLNADND
                     ALVVPVENPAAVLGEGAAPKLGKPIALDLKGRGIRDIAYAGGIKAYFIVAGGRGGAFD
                     LYRWSGRAGEAPARVPGVAEALAAIPDFQPEGLVVAADGTKVQLLADDTDICPARRPQ
                     GFRSVVLELQ"
     CDS             complement(357468..357818)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c01780"
                     /note="1c0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43851.1"
                     /transl_table=11
                     /translation="MQETVVPEGPGVSEKKRRATAAEIRERAFLDVIDWLDYRVAVCR
                     DGLERYSASHGADSRAAAAERAAAFEAELILREIRKLAEVPPRSRTFREAAEARRRYV
                     AAQASRPGEPEREA"
     CDS             complement(357989..358504)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015933717.1"
                     /locus_tag="Maq22A_c01785"
                     /note="1c0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="GcrA cell cycle regulator"
                     /protein_id="BAQ43852.1"
                     /transl_table=11
                     /translation="MMDAGPGWTNERVELLKRLWSDGHSASQIAAEIGGVSRNAVIGK
                     VHRLGLAGRVTKPNGAQAASGRRPRAEAESPGASVAPTVLAPAPPALALIQPTSVPSA
                     VALPESSRVTIMELRDFMCRWPMGDPSTPDFRFCGDRAITGLPYCTHHSRIAYQPAAE
                     RKRDRKVVGFR"
     CDS             359047..359916
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015933716.1"
                     /locus_tag="Maq22A_c01790"
                     /note="1d0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="domain of unknown function DUF1849"
                     /protein_id="BAQ43853.1"
                     /transl_table=11
                     /translation="MRTLLACVVLALSSPVLAAESVHLAPHRAVYDLSLSGSSGTRAV
                     ESARGRIVFDFTGDACKGFALQYRQVTVLESSESGSRTSDLRNTTFESGDGRSFRFRT
                     QSDLNGKTTAPVDGNAERGDKGLSVSLKQPKRGEMSVPGEVLFPAAHMRRLIEAARAG
                     QSTVAIKVFDGSDDGRKVYDTLAVIGAQRGSDKTKTEVKPETRPDAPAPKPVPVEAAL
                     RDGAMATMPHWPVTLSYFSPGEGERTPVYVLAFDLYENGVSAALRLDYGEFSLKGELS
                     RIDLLPESKDCKP"
     CDS             complement(359945..361261)
                     /codon_start=1
                     /EC_number="2.7.7.7"
                     /gene="dinP"
                     /inference="similar to AA sequence:RefSeq:WP_015933715.1"
                     /locus_tag="Maq22A_c01795"
                     /note="1c0003"
                     /note="involved in translesion DNA polymerization with
                     beta clamp of polymerase III; belongs to Y family of
                     polymerases; does not contain proofreading function;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /product="DNA polymerase IV"
                     /protein_id="BAQ43854.1"
                     /transl_table=11
                     /translation="MSGAPLCRDCGETVPPGTPRCRACGSPRLLTHPERDALSIAHVD
                     CDAFYAAVEKRDDPALRDRPLIIGGGRRGVVATACYIARIRGVHSAMPMYRALEACPD
                     AVVLRPDMEKYARVGREVRAMMQDLTPLVEPVSIDEAFLDLSGTDRLHGAPPAVTLAR
                     FARRVEDEVGITVSVGLAPNKFLAKIASDFEKPRGFSIIGRAEAAAFLAGKPVRILPG
                     IGQAAAERLAALGIRQVGDIARVAPERLHAGLGRDASRLLALARGEDPRRVQPVRETK
                     SISGETTFAEDLRGFSELRPILWQLCEKVAWRLKRAEFAAGSVTLKLKDRDFRLRTRT
                     RSGLAPTQVAERLFRPAEALLREACDGTAYRLIGIGAGDLCGAAHADRGDLADVSALR
                     DASRAAAIDALRDRFGAAAVQRGLGFTPQEAERPARAKPDRTGREP"
     CDS             complement(361258..361542)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018263172.1"
                     /locus_tag="Maq22A_c01800"
                     /note="1c0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43855.1"
                     /transl_table=11
                     /translation="MLSESAAEALGARVFDYVTGDPGRLLRFMESSGLSPDALRQAAG
                     TPELAAGLLDHVVADEELLLACAGALEVAPEQITQAWRRLGPPDAGEFGA"
     CDS             361678..362058
                     /codon_start=1
                     /gene="cheY"
                     /inference="similar to AA sequence:RefSeq:WP_015933713.1"
                     /locus_tag="Maq22A_c01805"
                     /note="1d0007"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="chemotaxis protein CheY"
                     /protein_id="BAQ43856.1"
                     /transl_table=11
                     /translation="MTKTVLIVEDNELNMKLFNDLLEAHGYATLKTANGIEAIELARR
                     HRPDLILMDIQLPEVSGLEVTKWLKEDDDLKGIPVIAITAFAMKGDEERIREGGCEAY
                     LSKPISVAKFLATVRTYVGDERQS"
     CDS             362087..363451
                     /codon_start=1
                     /gene="pleD"
                     /inference="similar to AA sequence:RefSeq:WP_012336306.1"
                     /locus_tag="Maq22A_c01810"
                     /note="1d0008"
                     /note="involved in swarmer-to-stalked cell
                     differentiation in Caulobacter crescentus; catalyzes the
                     condensation of two GTP molecules to form the secondary
                     messenger cyclic di-GMP (c-di-GMP); upon phosphorylation
                     of domain D1 the protein dimerizes; presumably this
                     allows the two GTP-bound GGDEF (diguanylate cyclase)
                     domains to catalyze the condensation reaction;
                     allosterically inhibited by c-di-GMP; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /product="response regulator PleD"
                     /protein_id="BAQ43857.1"
                     /transl_table=11
                     /translation="MSARVLIVDDLFPNIKLLETKLTLEYFDVVSAMNGPDALAICEK
                     GLCDIVLLDVMMPGMDGFEVCRRIKATPTTAHLPVVMVTALDQPSDRLRGLDAGADDF
                     LTKPIDDTALMARVRSLVRLKAVTDELRSRAMASRVGDPLAAAAAETGHNANVLIVED
                     RRSAADRLSAALGQYHCVETVATPQEALERVKAGEYDVVLVSLDLQDHDGLRLCSQLR
                     SLDRTRTVPVVMLADAGDRARIMRGLDLGVHDYLVRPIDRNELVARVRTQVKRKRFSH
                     SLRESVQASMDLAVTDGLTGLHNRRYLDSYLAGLFSEPSLRDRPVSLLILDIDRFKSI
                     NDRFGHDAGDEVLKEFATRIRSQTRGIDVVARFGGEEIVVVVPDTALEAARQVAERIR
                     ERIEAAPFVVQRGTCSIDVTVSIGVAARQAGDGEPGALLKRADLALYEAKQTGRNRVV
                     AAAA"
     CDS             complement(363542..365056)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015933703.1"
                     /locus_tag="Maq22A_c01815"
                     /note="1c0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="carbohydrate kinase, YjeF related protein"
                     /protein_id="BAQ43858.1"
                     /transl_table=11
                     /translation="MAGTELLTTDEMRRADAAAIAAGTPGLTLMNRAGAAVAERAEAM
                     AGASAGDGRVLVLCGPGNNGGDGFVAARLLAAAGIAVEVALLGDRGALKGDAAAAAAE
                     WTGPVSDAAGAEPAGFALVVDALFGAGLSRPLDGAAAALVGRINASGVPVLAVDVPSG
                     LDGDTGAPLGPVVTATETVTFARPKPGHRLLPGRRLCGPVTVAEIGIPDAVVTGIGAQ
                     AHDNGPDLWGAAFPRLSAESHKYTRGHAVVLSGPAHRTGAARLAARGALRIGAGLVTL
                     LSPTPALAENAAQITAIMLRPCDGADDLDDTLTDERLNAIVAGPGLGSGAPTRDLVRV
                     ACEAGRGLVLDADALTSFSGRADELVEMIAAGGSQAVATPHDGEFARLFKGVAAVPAE
                     GSRLARARAAAAFLDAVVVLKGADTVIAAPDGRAAINANGTPWLGTAGSGDVLCGFVG
                     GLLAQGMPAFEAAAAAVWLHAEAGRRYGPGLISEDLPEQMPAVLRAVLERLGAA"
     CDS             365259..365597
                     /codon_start=1
                     /gene="glnK"
                     /inference="similar to AA sequence:RefSeq:WP_008547261.1"
                     /locus_tag="Maq22A_c01820"
                     /note="1d0009"
                     /note="indirectly regulates nitrogen metabolism; at high
                     nitrogen levels P-II prevents the phosphorylation of
                     NR-I, the transcriptional activator of the glutamine
                     synthetase gene (glnA); at low nitrogen levels P-II is
                     uridylylated to form PII-UMP and interacts with an
                     adenylyltransferase (GlnE) that activates GlnA; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /product="nitrogen regulatory protein P-II 1"
                     /protein_id="BAQ43859.1"
                     /transl_table=11
                     /translation="MKKIEAIIKPFKLDEVKEALQEVGLQGITVIEAKGFGRQKGHTE
                     LYRGAEYVVDFLPKVKLEIVLPDTLVDGAVEAIRKSAQTGRIGDGKIFVSSIEEAIRI
                     RTGETGQDAI"
     CDS             365715..367127
                     /codon_start=1
                     /EC_number="6.3.1.2"
                     /gene="glnA"
                     /inference="similar to AA sequence:RefSeq:WP_019904733.1"
                     /locus_tag="Maq22A_c01825"
                     /note="1d0010"
                     /note="forms a homododecamer; forms glutamine from
                     ammonia and glutamate with the conversion of ATP to ADP
                     and phosphate; also functions in the assimilation of
                     ammonia; highly regulated protein controlled by the
                     addition/removal of adenylyl groups by
                     adenylyltransferase from specific tyrosine residues;
                     addition of adenylyl groups results in inactivation of
                     the enzyme; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /product="glutamine synthetase"
                     /protein_id="BAQ43860.1"
                     /transl_table=11
                     /translation="MSKTATDVLKEIKENDVKYVDFRFTDPRGKWQHVTFDVSLVDED
                     IFAEGTMFDGSSIAGWKAINESDMLLMPDPATACMDPFFSASTMSIVCDVLEPMTGEP
                     YGRDPRGIAKKAEAFVKASGIGDTIFVGPEAEFFVFDDVRFSADPYNTGFKLDSVELP
                     INGQTEYEGGNLGHRVQIKGGYFPVPPQDSAQDMRGEMLAAMQSMGVKVEKHHHEVAS
                     AQHELGMKFDTLTLMGDQMQIYKYCIHNVAQSYGKTATFMPKPVYGDNGSGMHVHQSI
                     WKDGKPVFAGNKYADLSQECLWYIGGIIKHAKALNAFTNPSTNSYKRLVPGYEAPVLL
                     AYSARNRSASCRIPWTTSPKAKRVEVRFPDPMANPYLAFAAMLMAGIDGINNKIDPGP
                     AMDKDLYDLPPAELKEIPTVCGSLREALTSLDADREFLKAGGVFSDDFIDSFIELKMT
                     EVMRYEMTPHPIEFVNYYSL"
     CDS             complement(367206..368789)
                     /codon_start=1
                     /gene="glcD"
                     /inference="similar to AA sequence:RefSeq:WP_006462103.1"
                     /locus_tag="Maq22A_c01830"
                     /note="1c0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="FAD linked oxidase domain protein"
                     /protein_id="BAQ43861.1"
                     /transl_table=11
                     /translation="MMLPESGIDHIKTSDPETAMTNRFAGRAAASTALSRRRLFQSGA
                     LAAGAALGSRIPGAAALEGPPPRGLDALARDLKGRLIRPNEPGFRVAAWPNNGRWADV
                     LPLAVAMCVDDRDVRACLAWARQERQTFAVRCGGHNYAGFSTTSGLLIDVKPMSAITF
                     DPKTGLVTVGAGASNQDMADAFRATGLAIPSGRCPTVGISGLTLGGGWGFSATRNGLT
                     CDALRATDAVTADGVLRRASARDDAALFWAARGGGGGNFAVHTAFTFEPHPVYDVTVF
                     NIVWPARHQVELMLDLQDIQLRNPGLISTRSKLAPAAAGPVSRGGLRVQTLGQFFGSP
                     DQLRAVLDRPLSRSRPIVAEINAMNYWSARDYLVTDDPGGLYDMRSSYVAGGLGGEAI
                     EAMIGWMEKWPGGSVRQDNMGILFAAGGQVKAVKPTDTAYVHRDSDFIVEMETSWSPL
                     DTPDTVARQQAWLTEYFAAMQRFVKPQSYVNFPSRDLPNWLNAYYGENVGKLCEVKRR
                     YDPDNVFRFPQSIPLTAPA"
     CDS             368936..371953
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012320510.1"
                     /locus_tag="Maq22A_c01835"
                     /note="404d0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43862.1"
                     /transl_table=11
                     /translation="MTTDLRRSCSGITPRPREPTVAPWPHSAHISQERPRLARRALSA
                     SRRLDRVVGQETSPRGPSPGGPFPEEQARARAAAHPRGGARLHRGFAPEGRQARDRAR
                     LRDQGLRQDRAEAPAQGDAGGGRDREGPRRPAQGRPPAPGRGRRHRQPARPRRRIGGA
                     ARAVGSGGRTRPRHHRADAARAPGRRAGAGHRRPGARQGRARRRHARALPRPGHQGDR
                     PQQGRDARRVPGAPHGRRAHRARGQEGARARDRGAAGRGGRRAGRRPRHRGARPRGPL
                     RADAGARQGAPRQPRLREGGQPDRHSRPRHPARLPARGAGGGGRHPRGRPGGPRGLAR
                     TAAGHHRPAGCQGPRRRRDGPARSRSDQSGRVRDHRRHRGRRGLCPARLRPRPRGADP
                     RQLGLLPRPGGADAARADLERPLFPAARPGPAGARRADDHHGGGAKTSPQRPPGHDAL
                     ARQARLRAGAGRDRRPARRGDGPDPRRGAAPALGRLRRSGRRPRRPRPPGARPARAQG
                     DPQRRGRGRPGDRAGAPLRPPADRGVHDPGQRRGGRGPGSRAPGPDLPRPRGALARED
                     AGARRGDGLDRPEAAQGSEPPPGPVQPHPRHGRGQRAPALPQRGGAALAGPGGLRRRE
                     CRPFRPGAPPLRPLHLADPALRRSRRPPRPDPGPAARRRRPAVGHGGRCARRDRPADF
                     RRRAPRHGGGARDDRPPDRPPPRRPGRRDLRGPGLGRHPLGAVHQARRDRGGRLRADL
                     DARRRVFPPRGGPPRPRRRAHSPDLPSWRQGRGAADGGRAGGRGPALRDRRRRPYRSP
                     RAGPRRAAQGPAGARAPREPDQAPRETRMIEIHAGPAAEPVGGARPPAVAQAPEQPSW
                     ALAMWRGFRNRCPHCGEGRLFHRFLKVREACESCGMELHHHRADDLPPYLVIFVVGHL
                     VGWAVLETEMRYDVPLWLQMTVWPTVALVASLLLLQPTKGAVVGLQYALGMHGFSAIR
                     RAGARPVDGPARNETETRHGGGTDARPIGSGRA"
     CDS             369183..371417
                     /codon_start=1
                     /gene="vacB"
                     /inference="similar to AA sequence:RefSeq:WP_015933706.1"
                     /locus_tag="Maq22A_c01840"
                     /note="1d0011"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="ribonuclease R"
                     /protein_id="BAQ43863.1"
                     /transl_table=11
                     /translation="MLAFIEDSPQKVGKREIAHAFGIKGSDKIELKRLLKEMQEEGAI
                     EKDRAGLRKAGRLPPVVVADIDSRRDRDGELVARPAQWDPEAGPAPVITVLTPRGRRA
                     DGPAPGTGDRVLVKVEPDGDTPGRYLGRVIKVIGRNKAETLGVFRALPTGGGRIVPVD
                     KKAQGREIAVPPGGEGDALDGDLVTVALGREDRFGLTQGRVKERLGSLGSEKAVSLIA
                     IHAHGIPHVFPREVLAEADATREVGLEGREDWRELPLVTIDPPDAKDHDDAVMALPDP
                     DPTNPGGFVITVAIADVAAYVRPGSALDREALIRGNSVYFPDRVVPMLPERISNDLCS
                     LRPGQDRPALAVRMIITAEGRKLRHSVHRVMMRSRAKLAYAQAQAAIDGRPDEVTGPI
                     LDGVLRPLWAAYDALAVARDARGPLALDLPERKVILNAEGGVDRVIVPERLSAHRLIE
                     EFMIQANVAAAEVLEAARQALIYRVHEEPSLEKMRALGEVMASIGLKLPKEANLRPAL
                     FNRILGMVGGSEHQLFLNEVVLRSQAQAVYAAENAGHFGLALRRYAHFTSPIRRYADL
                     VVHRALIRALRLGDDGLPSGMEGGALAEIGQQISAAERRAMAAERETIDRLIAHHLAD
                     RVGATFAGQVSGVTRSGLFIKLDETGADGFVPISTLGAEYFRHEEGRHALVGERTRQT
                     FRLGDKVEVQLMEAAPVAGALRFAIAGGDRTAAPAPARGGPRKGRPAPERRESLTKRR
                     GRRA"
     CDS             371907..372647
                     /codon_start=1
                     /gene="mutT"
                     /inference="similar to AA sequence:RefSeq:WP_012336301.1"
                     /locus_tag="Maq22A_c01845"
                     /note="404d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="NUDIX hydrolase"
                     /protein_id="BAQ43864.1"
                     /transl_table=11
                     /translation="MAAGPTHDPSAPAAPERKARPLRIRNAATLIILDRSGERPKVLM
                     GKRHAGHKFMPGLFVFPGGRIELGDRSMPVAGTLNDRAEAALAEQVHPPLFHLGRVLA
                     LAAIRETYEETGLMIGSLDYGPPEMAPPGAWSAFREAGVMPDLELLQFVARAITPPSR
                     PKRFDTRFFAVDREAVVAETPGIVGPDSELTELAWVDLTEARRLDLPRITGIVLDELE
                     ARLEAGFSPMLPVPFFRDVDGEHTRVEL"
     CDS             372663..373889
                     /codon_start=1
                     /gene="proP"
                     /inference="similar to AA sequence:RefSeq:WP_015933709.1"
                     /locus_tag="Maq22A_c01850"
                     /note="404d0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="multidrug ABC transporter ATPase"
                     /protein_id="BAQ43865.1"
                     /transl_table=11
                     /translation="MVFQGRLVHTDPPCRRPRVMTSLPSDSEFGRARLAAIAAAIACV
                     AVVGIGLSLSIPLLSLEMERMGLSNTWIGVNTAVAGVASIVVLPFVPRVAARLGVMPL
                     LLGAIAVAAVALLGFRAVRDFAWWFPLRFVFSAALGVLFVLSEFWINQAAPPTRRGLV
                     MGVYATVLALGFAIGPALLRFLGTAGWAPYLAGAALFCAGTLPLFLARDLSPEIPRKG
                     GRGFLGYLRVAPSATLAALIYGAVETGGFAILPIYGLRLGLTAEQAAGLVSVAALGNV
                     LFQIPVGLLADKVDKRRLLLAAAFFGALGAAALPLGADDVRLLAVILFAWGGIAGTLY
                     TVGLAHLGARFDGAALAGANAAFLVLYNIGLVLGPPLVGGGMDLASPHGFAWALALLF
                     VAYLAVVGGRMIRAAP"
     CDS             374073..374240
                     /codon_start=1
                     /gene="rpmG"
                     /inference="similar to AA sequence:SwissProt:B0UFA1.1"
                     /locus_tag="Maq22A_c01855"
                     /note="404d0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="50S ribosomal protein L33"
                     /protein_id="BAQ43866.1"
                     /transl_table=11
                     /translation="MAKAVTIKIKLLSTADTGFFYVTKKNSRTKTDKLSFKKYDPIAR
                     KHVEFKETKIK"
     CDS             complement(374327..374872)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012336305.1"
                     /locus_tag="Maq22A_c01860"
                     /note="404c0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43867.1"
                     /transl_table=11
                     /translation="MLGACSVAAVRTGLQRIDEVPSMEHQPLRHIRDIADIGTVPPLL
                     DDPVLEGRRARLERFATILERDPDRSFLTLEEIEFVPRGMRAGIRADNSPLALAAADP
                     VLRANGLADDTFGEARRFFGLSTGEAHRLLCSCVNGRSVKAGPTAKRLRRLAARRPGL
                     WLAYAGAAGLVALPGTLLLFG"
     CDS             complement(375025..376605)
                     /codon_start=1
                     /gene="sufI"
                     /inference="similar to AA sequence:RefSeq:WP_012336213.1"
                     /locus_tag="Maq22A_c01865"
                     /note="404c0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="multicopper oxidase"
                     /protein_id="BAQ43868.1"
                     /transl_table=11
                     /translation="MVDRSRSKNFGPGLAPRPHPGYKAARRHRAHPARGPPFSRTERG
                     AMPSSLPPSRRALLAGAALSLAPALVRAQGGAPQAGTAAPGAAVAPGPGAEARPLTAQ
                     AARARLKPEPAPETPVWAFDGRSAPPVIRVKLGEAVRLRLENKTEKPLSLHWHGVRNR
                     NAMDGVGGVTQAPVAPGGSFVYEFTPPDAGTFLIRPLVVGGASEPSGRGLAGMLAVEE
                     KTPPVVDRDVPLLLQDWRLEADGTLAPFGQAAFAASSGRLGNALTINGRPAPETIEAA
                     PGTRLRLRLANACNARATRIRFDGLKAWVAAVDGQPTDTFEPLRATLPFPPGTRYDIL
                     LDVPGAAEPAGAVVALIGAGMPLARIIAKGEPVAARPAVAPIGENKLLPPEIKLQNAF
                     RRDIAIAGGATFDKAKPDAAPAFTGDPTRIWTLNGAAGRAENPPLFTVKRNTAVVLAL
                     TNTTAFPQSLHLHGHAFRLLHPLDDGWEPYWLDTFQLLEGRTARIAFLADNPGKWLVS
                     ATALERFDTGLWGWFEVS"
     tRNA            376652..376736
                     /anticodon=(pos:376686..376688,aa:Leu,seq:tag)
                     /inference="profile:tRNAscan-SE:1.23"
                     /locus_tag="Maq22A_c01870"
                     /product="tRNA-Leu"
     CDS             376878..378299
                     /codon_start=1
                     /gene="tig"
                     /inference="similar to AA sequence:SwissProt:B8IN25.1"
                     /locus_tag="Maq22A_c01875"
                     /note="46d0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="trigger factor"
                     /protein_id="BAQ43869.1"
                     /transl_table=11
                     /translation="MQVTETKSEGLKREFQVVVPAAELETRLATELDGIKGKVQIKGF
                     RPGKVPVAHLRKVYGRSVMADVVQNAVNEANQKIVEDNKLKLALEPQIQMPEDKDQIE
                     KALDAKADLAFTIALEVMPSFDLVDLSDVSLTKQVVTPSDEEVAETIERMASANRPFE
                     DRPEGQYAESGDRLTINFTGRIDGTPFEGGTGEDINLDLGSNTFIPGFEDQLLGAKVG
                     DERLVKVTFPESYGAEHLAGKEAEFDVVVKAVQAPGELKIDDELAKNFGMDSLDALKD
                     AVRTTMGREYEAASRQKLKKGLLDALDTRYSFELPPSLVHQEFAAVWAQVEQDLKNRG
                     KTFEDEDTTEEKAREEYRRIAERRVRLGLVLAQAGESADIKVSDDEVNQALIARVRQF
                     PGQEQQVWDFYRKTPQALAELRAPLFEEKVVDHVLGQVKLVEEPVSKEALFADEDDAE
                     EAKADKAKGDSAEAAPAGESNPA"
     CDS             378412..379041
                     /codon_start=1
                     /EC_number="3.4.21.92"
                     /gene="clpP"
                     /inference="similar to AA sequence:RefSeq:WP_012336215.1"
                     /locus_tag="Maq22A_c01880"
                     /note="46d0002"
                     /note="hydrolyzes proteins to small peptides; with the
                     ATPase subunits ClpA or ClpX, ClpP degrades specific
                     substrates; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /product="Clp protease"
                     /protein_id="BAQ43870.1"
                     /transl_table=11
                     /translation="MRDPVDYYNSALVPMVVEQSSRGERAFDIYSRLLRERIIFLTGP
                     VEDYSASLIVAQLLFLEAENPKKEISFYINSPGGVVTSGLSIYDTMQFIRCPVATLCV
                     GQAASMGSLLLAAGEAGHRFALPNARIMVHQPSGGFQGQATDILIHAREIEALKRRLN
                     EIYVKHTGREYEAIEQGLERDNFMTADAAKEWGLIDEVLQKRAEAPAQA"
     CDS             379337..380608
                     /codon_start=1
                     /gene="clpX"
                     /inference="similar to AA sequence:RefSeq:WP_019904739.1"
                     /locus_tag="Maq22A_c01885"
                     /note="46d0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="Clp protease ATP-binding protein"
                     /protein_id="BAQ43871.1"
                     /transl_table=11
                     /translation="MSKAGGNDSKSTLYCSFCGKSQHEVRKLIAGPTVFICDECVELC
                     MDIIREESKSSLVKSRDGVPTPKEIRRVLDDYVIGQDFAKKVLSVAVHNHYKRLAHAT
                     KHNDVELAKSNILLIGPTGSGKTLLAQTLARILDVPFTMADATTLTEAGYVGEDVENI
                     ILKLLQASDYNVERAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKIMEGTV
                     ASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLERIISARGKGTSIGFGATVQAPD
                     DRRTGEIFRNVEPEDLLKFGLIPEFVGRLPVLATLEDLDETALKRILQEPKNALVKQY
                     QRLFEMENVDLTFQEEALSLVARKAIERKTGARGLRSILESILLETMYDLPGLDSVEQ
                     VVIGPEVVDGKSRPLYIHGDRGKETPASASA"
     CDS             380878..383301
                     /codon_start=1
                     /gene="lon"
                     /inference="similar to AA sequence:RefSeq:WP_015933702.1"
                     /locus_tag="Maq22A_c01890"
                     /note="46d0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="DNA-binding protein"
                     /protein_id="BAQ43872.1"
                     /transl_table=11
                     /translation="MTQPKSRQPVVPGTSGTYAVLPLRDIVVFPHMIVPLFVGREKSI
                     RALEEAVRTDRHILLATQVNATDDDPATDAIYTIGTLASVLQLLKLPDGTVKVLVEGG
                     GRAKIQDFVRSDEYYAAEAEVLPNDLGDKIEAEALARSVISEFENYVKLNKKISPEVV
                     SAVIQIDEPSKLADTVASHLAVKISDKQAILEIPTVAQRLERVLSLMESEISVLQVEK
                     RIRTRVKRQMEKTQREYYLNEQMKAIQKELGDEDGRDELAELEDKIEKTKLSKEARDK
                     ALAELKKLRQMSPMSAEATVVRNYLDWMLGIPWGKRSKIKKDLPGAQAMLDSDHFGLD
                     KVKERIVEYLAVQQRANRLAGPILCLVGPPGVGKTSLGKSIAKATGREFVRMSLGGVR
                     DEAEIRGHRRTYIGSMPGKIVQSMRKAKTSNPLILLDEIDKMGMDFRGDPSAALLEVL
                     DPEQNGTFNDHYLEVDYDLSGVMFVTTANTLNIPPALLDRMEVIRIAGYTEEEKVEIA
                     RKHLMPGALKKHGLEPKEWSISDDGLMLLIRRYTREAGVRNLEREISNLIRKAVKEIL
                     MSGVKSVTVTADNLDTFLGPAKFRYGEIETDDQVGVVTGLAWTEVGGELLTIEGVMMP
                     GKGKMTVTGNLRDVMKESISAAASYVRSRAVDFGVEPPLFDRRDIHVHVPEGATPKDG
                     PSAGIAMATAIVSVITGIPVRRDIAMTGEVTLRGRVLPIGGLKEKLLAALRGGIKIVL
                     IPEENAKDLVEIPDSVKNGLEIVPVARMDQVLQRALIRIPEAIEWDEPLPKAAPARTE
                     DDASGVLAH"
     CDS             complement(383396..383800)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015933697.1"
                     /locus_tag="Maq22A_c01895"
                     /note="46c0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="MucR family transcriptional regulator"
                     /protein_id="BAQ43873.1"
                     /transl_table=11
                     /translation="MLDQDQETKLVERAADIVSAYVSNNSLPIAELPALISAVHQSLS
                     RLGNVEAVEPEKPTPLMPIKKTVTPDYLISLEDGKQYKSLKRHLSTRGLSPEEYRRKW
                     GLPHDYPMVAANYAAQRSELAKNSGLGRRRSA"
     rRNA            384433..385930
                     /locus_tag="Maq22A_c01900"
                     /product="16S ribosomal RNA"
     CDS             385560..385883
                     /codon_start=1
                     /locus_tag="Maq22A_c01905"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43874.1"
                     /transl_table=11
                     /translation="MDDVKSSWPLRDGLHTCYNGGDNGQRRGDLERIPKSRLSSDCTL
                     QLGCMKAESLVIVDQHATVNTFPGLVHTARHTMGVGLTRRRCANRKEAGDHGRVSDWG
                     EVVTR"
     tRNA            386070..386146
                     /anticodon=(pos:386104..386106,aa:Ile,seq:gat)
                     /inference="profile:tRNAscan-SE:1.23"
                     /locus_tag="Maq22A_c01910"
                     /product="tRNA-Ile"
     tRNA            386267..386342
                     /anticodon=(pos:386300..386302,aa:Ala,seq:tgc)
                     /inference="profile:tRNAscan-SE:1.23"
                     /locus_tag="Maq22A_c01915"
                     /product="tRNA-Ala"
     rRNA            386613..389423
                     /locus_tag="Maq22A_c01920"
                     /product="23S ribosomal RNA"
     rRNA            389524..389639
                     /locus_tag="Maq22A_c01925"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /product="5S ribosomal RNA"
     tRNA            389684..389760
                     /anticodon=(pos:389718..389720,aa:Met,seq:cat)
                     /inference="profile:tRNAscan-SE:1.23"
                     /locus_tag="Maq22A_c01930"
                     /product="tRNA-Met"
     CDS             complement(389822..391066)
                     /codon_start=1
                     /locus_tag="Maq22A_c01935"
                     /note="29c0001"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="protein of unknown function UPF0057"
                     /protein_id="BAQ43875.1"
                     /transl_table=11
                     /translation="MQGARRPGRPGDRGGAGSGARAGRGPGACERRGAQLLRHADHRR
                     PLPSEAGLAVLARRRGLRGDRGGRTGRRGVPRRRARHRPSRLRRLPRAGGGADLRPDP
                     GAGGRERRAGGRPLGHLRHLAARAAGPGEPAARRDPGGARRHRRRRAGGGGTRPRDGR
                     ACDRLRLVGREARTRESPRRRPHPRLRPRIPARGPEAARRRGRHRRRVRSRRRRVFRA
                     GAPLAQLEGPLPRRRLRRRRDPENSAEPRPPEGHRHPGRVLGRLPQARAGRPRRQPGS
                     PVVAGARGPPLRQGARRLPAGEGRLCPRHPGPPRGDGEGAAAPVSPLPSRPRREVSGA
                     GAGTVRAPRRSQRGFSFSKRQDGDTVGDIIRIILLVVIPPIGVLFTVGFGLQFILNVL
                     LTLFGYIPGLIHAIWVVTRRNY"
     CDS             complement(390106..391080)
                     /codon_start=1
                     /gene="qor"
                     /inference="similar to AA sequence:RefSeq:WP_012334054.1"
                     /locus_tag="Maq22A_c01940"
                     /note="29c0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="NADPH:quinone oxidoreductase"
                     /protein_id="BAQ43876.1"
                     /transl_table=11
                     /translation="MKALLCKALGGPDDLVIEEVPDPVPGPGEALVRVSVAALNFFDT
                     LIIAGRYQVKPDLPFSPGAEACGVIEAVGPGAEAYRVGERVIVHLGYGACRERVVAPI
                     SGLTRVPEGVSDEQAAGLSVTYGTSLHALQDRANLQPGETLVVLGATGGVGLAAVELG
                     HAMGARVIACASSAEKLELAKAHGADLTLDYGRESLREGLKRLGGEAGIDVVYDPVGG
                     EYSEPALRSLNWKGRFLVVGFAAGEIPKIPLNLALLKGIDIQGVFWGAFLKREPEGHA
                     ANQARLLSLVREGRLSAKVHGVYPLEKAASALGILARREAMGKVLLRP"
     CDS             complement(391171..391743)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012317158.1"
                     /locus_tag="Maq22A_c01945"
                     /note="29c0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="phosphatidylethanolamine-binding protein"
                     /protein_id="BAQ43877.1"
                     /transl_table=11
                     /translation="MLEKIPHALGEALSGLRAGIETTAYHAEFEGAPEAIRVASPAFG
                     EGAAVPARFTQDGEKLSPPLAWSGIPAGTAALVLLVEDADSPTPKPIVHAIAWDLEPT
                     SEGLAEGALASPGSTGTIEEVGKNTFLKAGYLPPDPPTGHGPHRYLFQVYALNRRLGL
                     EGTPGRGALLEAMHGHVLAKGALTGTYERP"
     CDS             complement(391807..392556)
                     /codon_start=1
                     /gene="ubiG"
                     /inference="similar to AA sequence:SwissProt:B8IUB0.1"
                     /locus_tag="Maq22A_c01950"
                     /note="29c0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="3-demethylubiquinone-9 3-methyltransferase"
                     /protein_id="BAQ43878.1"
                     /transl_table=11
                     /translation="MSEPTGPSIDRDEVARFDRLAATWWDETGPMRVLHRFNPVRLTY
                     IRDTVCRHFGRDPLAPSPLAGLSLVDVGCGGGVLSEPLARLGAEVTGLDPAVTNVKIA
                     QAHADEAGVPVRYRAETIEDVVSAGERFDVVCAMEVVEHVTDMPAFVRTACTAVKPGG
                     LLFAATINRTMRSFALAIVGAEYVLGWLPKGTHDWNKFVTPDELQDAVEGGSLTVTDT
                     TGVVFNPLTNRWSAARDTAVNYMIAAERLRA"
     CDS             392814..394049
                     /codon_start=1
                     /gene="lysC"
                     /inference="similar to AA sequence:RefSeq:WP_012634396.1"
                     /locus_tag="Maq22A_c01955"
                     /note="29d0001"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="aspartate kinase"
                     /protein_id="BAQ43879.1"
                     /transl_table=11
                     /translation="MPRLVMKFGGTSVATVDRIRNVARHVAREVRAGYEVAVVVSAMS
                     GKTNELVAWCKDASALYAQSEYDAVVASGEQVTSGLLAIVLNEMGLKARSWQGWQIPI
                     ETSDQHGSARIQNIDGARLDAGFQRGEVAVIAGFQGIHAETGRLTTLGRGGSDTSAVA
                     IAAAIGAERCDIYTDVDGVYTTDPRVVPKARRLERVAFEEMLEMASLGAKVLQVRSVE
                     LAMVHRVPTTVRSSFDDPDDARPGTLICDEDDIVEQQIITGIAFSKDEAQITLRRVKD
                     KPGIAAAIFGPLADANINVDMIIQVVSGDGAATDMTFTVPAADYERARAILEAQSGTV
                     ECERIEGATDVVKVSAIGIGMRSHAGVAAKAFRALAEKGINIRAITTSEIKFSVLIDA
                     AYTELAVRTLHALYGLDKA"
     CDS             394329..396590
                     /codon_start=1
                     /gene="ptsP"
                     /inference="similar to AA sequence:RefSeq:WP_012634397.1"
                     /locus_tag="Maq22A_c01960"
                     /note="29d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="peptidase"
                     /protein_id="BAQ43880.1"
                     /transl_table=11
                     /translation="MPAAPGGPRLLLRRLREAMAEPVGPQARLDRIVVLIASNMVAEV
                     CSVYVLRDDGNLELFATEGLNREAVHLTTMRAGEGLVGLIAATAEPLSLSDAQSHPAF
                     SYRPETGEEVYHAFLGVPLLRAGNTLGVLVVQNRTYRVYSEEEIEALQTTAMVLAEMI
                     ASGELQALSPGTVSASRRALSQCGVALADGVGLGHVVLHEPRIVVRTLIAENVEREAS
                     RLDTAIAEVRAAIDDLVERGDVAGAGEHREVLETVRMFAHDQGWLRRMREAVLSGLTA
                     EAAVERVQSDNRARMLRQSDPYLRERLHDLDDLANRLLRQLVGRETIGPDAMPENAIL
                     VARSMGPAALLDYDRARLRGVVLEEGGPTSHIAIVARALGIPAVGEVANATALVETGD
                     AIIVDGGTGEIQIRPGPEVEAAYAEKARLRARRQEQYRSLRDVPAVTRDGVSVGLQLN
                     AGLIVDLSHLHETGAEGVGLFRTELQFMVAERMPSAAEQQILYETVFDAVGELPVTIR
                     TLDIGGDKVLPYMKSLEEENPALGWRAIRIGLDRPGLLRMQLRALLKAARGRPLKIMF
                     PMVATVDEFVQARGIVEREKAHLTRHGYPLPSECRLGVMVEVPSLLFQMDEIAAEADF
                     LSVGSNDLMQFLFAVDRENRQVANRFDPLSAAALRAFRLIAERANAAGTPATVCGEIG
                     GRPLEAMALIGLGFRALSMSPASIGPVKAMVLGIDAGAVAAFLEQELARTKDGASLRP
                     ALAAFAEEHGVPI"
     CDS             complement(396961..397383)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_008972801.1"
                     /locus_tag="Maq22A_c01965"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43881.1"
                     /transl_table=11
                     /translation="MTNATVLEDLFDRWERVWHEGAFDLVESCVAPSYVRHDEMGDRT
                     VAREDYAAELSRLRQARPDIRIIVYDHSFEGDRAWFRFTMKWTDLESSEVRTRAGLQS
                     YRTEAGRLAETWVIMQPVGSAWSDTVAQASWTGRAPGR"
     CDS             397607..398686
                     /codon_start=1
                     /gene="prfA"
                     /inference="similar to AA sequence:SwissProt:B0UAV4.1"
                     /locus_tag="Maq22A_c01970"
                     /note="29d0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="peptide chain release factor 1"
                     /protein_id="BAQ43882.1"
                     /transl_table=11
                     /translation="MIAIPSDRLDAILARHDIVTAILSAGEADAESFVQLSRELSDLD
                     SVVEAIRAFRAAETALHGVEEMIAEGDPEMRALAAEEKPEAEAARDGAARALQLLLLP
                     KDAADEKSAILEVRAGTGGDEAALFAGDLFRMYSRYADLKGWKVEVISESAGTMGGYR
                     EVVAEVKGRGVFARLKFESGAHRVQRVPDTETQGRIHTSAATVAVLPEAEEVDIQVNE
                     SDLKIDTMRAQGAGGQHVNKTESAIRITHVPSGIVIFVQEERSQHKNRARAMALLRAK
                     LYDQERSQKDAARAADRKSQVGSGDRSERIRTYNFPQARVTDHRINLTLYKLEEVMAG
                     TALDEVVDALITEHQAALLAAEGMA"
     CDS             398683..399555
                     /codon_start=1
                     /gene="hemK"
                     /inference="similar to AA sequence:RefSeq:WP_012334466.1"
                     /locus_tag="Maq22A_c01975"
                     /note="29d0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="SAM-dependent methyltransferase"
                     /protein_id="BAQ43883.1"
                     /transl_table=11
                     /translation="MIALAPETSRIAARARAVDVLAAGGIETAALDARILVEEALGVT
                     ATDLALRGEAPIGPEGAARLAAFLARRAAGEPVARIIGAWEFWGLPFALSPETLVPRP
                     DTETLVETALGLGLRRDGAHRLADLGTGSGCILVALLSEWPRAEGLGLDRSPGALRTA
                     RANAARNGVGDRAAFAAGDWAAALAGPFDLVVANPPYIASTIVDGLSGEVRDHDPRLA
                     LDGGSDGLDAYRAILAQVPPLLAPGGHLVVEIGYDQEAALRGLAAAHGLMPEVRRDLA
                     GHPRVVVMAPRIAT"
     CDS             399991..401073
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012334467.1"
                     /locus_tag="Maq22A_c01980"
                     /note="29d0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="predicted membrane protein"
                     /protein_id="BAQ43884.1"
                     /transl_table=11
                     /translation="MRGRNRTNNKGPNPLTRAYESNGPDVKIRGTAQHIAEKYAQLAR
                     DAQASGDPVMAENYFQHGEHYFRIITAANEQYRQQYGGTYGRQGYDDEDDGDDEGTPT
                     NGYAVQERGQDRGQERGNGYAQSGYGAADDYGDPSQQPQPYDGRGEDRPSRYERQDRG
                     ETQRQDRPDRQERRERFQQNRQDRQDRPERQQRDRQDRPERSERQDRQPRSERQDLSR
                     VEQPRQDDARQDAPRQESLRQDSPRQDFPRQDAPRQEGYREGGRSEFRRERRREEPRS
                     EPVLAADEPTGLPAFLTTPVRPAVSNPAPVEEAPPAPPATAVEASDEAPAPRPRRRRR
                     TRFEGAEGEGQPSGELFPKPSEPSGE"
     CDS             401302..402219
                     /codon_start=1
                     /locus_tag="Maq22A_c01990"
                     /note="29d0007"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="BAQ43885.1"
                     /transl_table=11
                     /translation="MTHHPALAQGRVAVVTGAASGIGLAAARAFAEAGMRVVLADLPG
                     EALTAAGRAVAAAARGGEAEVRAVPTDVADPEALAALSHEAASLGEVSILMANAGIEA
                     GGRFFSDAATWHRILDTNLWGVINALQAFVPGMIERGRPGAVIVTGSKQGITTPPGNT
                     PYNVSKAGVKVTAEALAHELREAGSPVTAHLLIPGFVYTGLTRARGVTEKPAGAWTPE
                     ETVALLLDRMAAGDFYVLCPDNETTREMDEKRMRWSSDDVIRNRPALSRWHPDHKAAF
                     AAHMEAPLAGGSTGADEGIREAAATPASF"
     CDS             402408..403883
                     /codon_start=1
                     /EC_number="1.1.1.49"
                     /gene="zwf"
                     /inference="similar to AA sequence:RefSeq:WP_012334539.1"
                     /locus_tag="Maq22A_c01995"
                     /note="29d0008"
                     /note="catalyzes the formation of D-glucono-1,5-lactone
                     6-phosphate from D-glucose 6-phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /product="glucose-6-phosphate dehydrogenase"
                     /protein_id="BAQ43886.1"
                     /transl_table=11
                     /translation="MHKIIPVAAFDAVVFGATGDLTMRKLLPALYQRFRDRQIPEESR
                     IVAAARTHLGTDEYRNLAATALERHVPTADRDPDTVGRFLAHLHYVAVDGAGDEGWDD
                     LASLLAERPDHVRPYYLATSPSLYGSICRNLSAHGLIGERSRVVLEKPIGHDLASARS
                     INDQVGKVFPESQIFRIDHYLGKETVQNLLALRFANTIFERLWNADVIDHVQITVAET
                     VGVEGRGGYYDTSGALRDMLQNHMLQLLCLLGMESPLSLDADAVRDEKLKVLRALKPI
                     PAHEVAMRTVRGQYVAGAVNGQPVASYAADLGGEAHSLTETFVALKLELMTPRWAGVP
                     FYLRTGKRLPQKVSEIVVQFRSSPFSIFSDEFAREPNRLVIRLQPQEGIKLEVMTKEP
                     GPGGMRLRATGLDISFEETFNQRYPDAYERLLMDVVRGNATLFMRRDEVEAAWAWADT
                     LLDAWADRPEPPRPYQSGTWGPTAAIALIERDGRTWHEDLG"
     CDS             404106..404771
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015928384.1"
                     /locus_tag="Maq22A_c02000"
                     /note="29d0009"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="invasion protein"
                     /protein_id="BAQ43887.1"
                     /transl_table=11
                     /translation="MPPCRLPAASLLVLAAFLAGPVRAQEEPAVEAPPAAEAPHKAAP
                     KPVRRPAPKPAPAPKAEAAPPVVAAPVGAWPNGASAVSEVYGDWTISCTRENEKRQCQ
                     LSQAQGVAQTGQRRFSIELNPPQDGRSNGLLLMPLGLSIEPGVTFKLDDATLGKGAPY
                     TSCVQAGCIVPISFPTVATDAMKTAVNLRVTGTKPNGEADTITVPLAGFAAALTRMAQ
                     LLS"
     CDS             404815..405012
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_020092413.1"
                     /locus_tag="Maq22A_c02005"
                     /note="29d0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43888.1"
                     /transl_table=11
                     /translation="MSIDSASLAAFAVATQGANYSQQVATLVTRQALDAERSVAAYVA
                     ETANIPAPPPPGQGQIVDVSV"
     CDS             complement(405047..406018)
                     /codon_start=1
                     /locus_tag="Maq22A_c27765"
                     /note="29c0005"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47059.1"
                     /transl_table=11
                     /translation="MLLEALVLAVRRLLGEDDHDGERDQHERAGEAVDRLPAIGLGER
                     RREQHGEHGARVAGPGDAHRQALVLRREPARAEGQGDAEGRARDAEQHAHGEHVGERV
                     HQEEAVGHRQDDQRHLGDRGVLAPDILGEHAEGKAHDRAGQDRQRDHEPGLGRRELVV
                     LGDERTHGAVEHPDRETEIEVQECGEQGRGMARLHHGLETGHLTSLTHGPRGGSSTRF
                     RARIVQDRRGPFTLLRLSDIPVQGSGVVAPRAVRPACGGRLQLSCQCSKAGSSGIAPD
                     RGPACLPVGQAGTGVRGSSRRPEPPIRNPVDRSAMRISASLKRRAGW"
     CDS             405413..406675
                     /codon_start=1
                     /gene="narK"
                     /inference="similar to AA sequence:RefSeq:WP_015928383.1"
                     /locus_tag="Maq22A_c02010"
                     /note="29d0011"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="MFS transporter"
                     /protein_id="BAQ43889.1"
                     /transl_table=11
                     /translation="MASFKTVMKSGHPPTLFAAFLYFDFCFAIWVLNGAMGPFITEHY
                     KLTPAQTGFMISLPILAGAIMRFPLGVLAQYIGRKNAAITEMSLIVLAMAYGFFLVHS
                     FTDVLAMGVLLGIAGASFGVALSLGSGWFPPEHKGLAMGIAGAGNSGTVLAVLFAPPL
                     AQAYGWQAVYGFAGAFMLIPLAVMVVFAQEPPDREHQSFKQHVSCLFEKDGWAFNLVY
                     VITFGGFIGLSNFLPTFFYEQFAVTKIEAGRLTMLAALMGSGIRILGGYFADRIGGIL
                     VLTVVLLAAVGSFLMLTAAPTLLVTTILFMVCFAALGAGNGALFQLVPLRWPTNTAVA
                     GSMIGEVGALGGAILPNAMGLSKQYTGGFAAGFLFYAAFTAVVLGCLALWSRKWVGVW
                     VGPRGKVLSTSGEPEAGQANPIGGVQRA"
     CDS             complement(406677..407438)
                     /codon_start=1
                     /gene="comFC"
                     /inference="similar to AA sequence:RefSeq:WP_015928391.1"
                     /locus_tag="Maq22A_c02015"
                     /note="29c0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="competence protein ComF"
                     /protein_id="BAQ43890.1"
                     /transl_table=11
                     /translation="MSRFTRLPGLAVRALVGLVYPPSCIACGGATAVPHALCAACWRE
                     MRFIERPYCERLGTPFSVDLGSPGLLSPAALADPPVYQRARAVARYDATARRLVQRLK
                     YEDRLDLAGALGGMMARAGAELMAEADLVVPVPLWRWRLWRRRFNQAHLLARVVARGS
                     GVTVAPDLLARVRRTRQQVGLTRAARAENLQGAFRVPEAARARLQGKRVLLVDDVLTT
                     GATANAAARALLRGGAAAVDVLVFARVVSDGRDVV"
     CDS             407627..407839
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02020"
                     /note="29d0012"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43891.1"
                     /transl_table=11
                     /translation="MNAVRISSSAETGLGATLRTAGQRSSESGVDAGAFMTASFVPGA
                     PSTIEELRERAQREFKRIWELGVLTH"
     CDS             complement(407950..408696)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015930682.1"
                     /locus_tag="Maq22A_c02025"
                     /note="29c0007"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="restriction endonuclease"
                     /protein_id="BAQ43892.1"
                     /transl_table=11
                     /translation="MRRTSSLADRLFWPILVGGAASLWFGPKALGVAGLVALVLVLHR
                     LGRGGRFRRRVRAIARHHRETLALRRRQESYVDPYGNEILDGWLRERSYFADRTVLPR
                     LEAEGYGDLIAARYDEILDIVEAASLSVVLPDEDDAAPTDGIAYERFCATLLERAGWD
                     ARTTRAAGDQGADVVAERDGVRLVVQCKRYAKPVGNGAVQEVVAARSYWNADHAAVVS
                     NAGFTRAARKLAAATDVLLLHHDALPDIET"
     CDS             408963..409757
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015930683.1"
                     /locus_tag="Maq22A_c02030"
                     /note="29d0013"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43893.1"
                     /transl_table=11
                     /translation="MRSRVAALLACLLAATAAGPPVRAADAPVEVDVALVLAVDVSLS
                     MTGDEQAVQREGYVEAFRNPAVHQAIRQGMVGRIAVTYVEWAGVGNQRVVVPWTLIAG
                     AEEAAGFAERLSQSPPRRSTWTSIASAIDFSAGLLAGSGFEAMRRVIDVSGDGPNNQG
                     RSVTRARDDAVGQGIVINGLPLMIREPSGPWDIKDLDRYYRDCVIGGSGSFMVPVRER
                     DQFAAAIRTKIIREVASGDPGPLLQRAQGEPRANCLIGERPNPDWD"
     CDS             complement(409815..410246)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012334153.1"
                     /locus_tag="Maq22A_c02035"
                     /note="29c0008"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="MucR family transcriptional regulator"
                     /protein_id="BAQ43894.1"
                     /transl_table=11
                     /translation="MSDTEASTDHIQLAADIVAAFVSNNSLPVAELPALIASVHSALG
                     GLGNTETADPAEPLTPAVPIKKSIMPDYLVCLEDGKKFKSLKRHLRSRYGLTPEEYRA
                     RWNLSPDYPMVAPNYAAARSELAKTMGLGQQRRKALRGNEG"
     CDS             complement(410956..412083)
                     /codon_start=1
                     /gene="cyaA"
                     /inference="similar to AA sequence:RefSeq:WP_015930686.1"
                     /locus_tag="Maq22A_c02040"
                     /note="29c0009"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="adenylate cyclase"
                     /protein_id="BAQ43895.1"
                     /transl_table=11
                     /translation="MPAAGPADHRSSGEPDSVGLAARAAEFLRTLRLPIPQHAWFWIG
                     ILALSAGAGLLYDALFKNGIPLVAAIHGVFIGACALLMERGTLLPRLQARLRRLPTFL
                     YVPIAELAYVGMITLGHATGGVIVWSTGLSPEPFAEAVVPSLRVLVYALAVSALLVFV
                     VRMRDLIGAEVFVNLLVGRYHRPVEEERIFLFVDVVGSTAYAETHGALRTQAFLSAVF
                     ATLAEPVRRCQGSTDDFVGDMAMITWPMARGLQGARCVACVLAIQDSLTRDAAAWQER
                     FGTVPRIRAALHGGPVVTAEIGVDRHKIAYFGDAVNVTARLEALCRTLDAPVLISGDL
                     LAKLPRLPEGVRARPLGEHAVRGRDQVLAVAALEPATQTAA"
     CDS             412318..412551
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015930687.1"
                     /locus_tag="Maq22A_c02045"
                     /note="29d0014"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43896.1"
                     /transl_table=11
                     /translation="MSLRLATLATLAALVTVPALAEDVTVIRRDSAPVERSTVIEKRS
                     VESTGSVGGCETKTVKKTNEYGDSKTVRSERCD"
     CDS             complement(412661..413065)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018259829.1"
                     /locus_tag="Maq22A_c02050"
                     /note="29c0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="histidine kinase"
                     /protein_id="BAQ43897.1"
                     /transl_table=11
                     /translation="MLNRTLLLAALLAAPLALPASAEAKPAADRTIAAVDTDSDGTLD
                     LAEVKAAAAAVFDKLEKDADGTLDAKELKGRLSRQQLMKADPDNDGTLTKDEYVALAE
                     SLFKAADPDNDGTLDAKEMKSPAGKTLARLIK"
     CDS             complement(413184..414506)
                     /codon_start=1
                     /gene="tlyC"
                     /inference="similar to AA sequence:RefSeq:WP_015930689.1"
                     /locus_tag="Maq22A_c02055"
                     /note="29c0011"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hemolysin"
                     /protein_id="BAQ43898.1"
                     /transl_table=11
                     /translation="MIFSDSPWGTGLGLFAIVFLVFANGFFVAAEFALVAVRRSRVQE
                     LVAEKRINAGALQRAVDSLDSHLAATQLGITISSLALGWVGEPALAHLIEPLLAFLPQ
                     GVSTAGAHAIAVVFSFVVITSLHIVLGELAPKSLALQRSERTALAIVRPLRLFLLVFR
                     PAISFLNGLGNGVLRLCGLQPGSGEGSLHSTAELSLLVAASQEAGLIQESQQAAVQRI
                     FGIGERRVRDIMTPRHEVDWIDVEDPREAVLETIRACRHEQLVASRGEIHEIVGVLRK
                     QDVLNQLLDGAPISLDAIIREPIVVHEGMPILRVLETFKAKPVRMAIVVDEYGDLEGI
                     VTQTDLLEAIAGDIPETDDDEPMVVERQDGSLLIDGMMPAVEAFERLGLTERPDTDDF
                     STLAGFVIFQLGRIPTAGDGFERGGWRFEVVDMDGRRVDKILAERLGA"
     CDS             414795..416396
                     /codon_start=1
                     /EC_number="2.1.2.3"
                     /gene="purH"
                     /inference="similar to AA sequence:RefSeq:WP_012332777.1"
                     /locus_tag="Maq22A_c02060"
                     /note="29d0015"
                     /note="involved in de novo purine biosynthesis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /product="phosphoribosylaminoimidazolecarboxamideformyltra
                     nsferase"
                     /protein_id="BAQ43899.1"
                     /transl_table=11
                     /translation="MASDLSRISRALLSVSDKTGLVEFARALAARGVTLVSTGGTHRA
                     LTEAGLTVTEVSDLTGFPEMMDGRVKTLHPGVHGGLLAIRDNPEHQAAMLAHGIAAID
                     LLVVNLYPFEATLAAGKPAAECIENIDIGGPAMIRAAAKNHKDVAVVVDVADYAAVLA
                     DLDAHDGAVAFATRRRLAQKAYARTASYDAAISTWLAGEIEAAPETQTFRALGGTLAQ
                     GLRYGENPHMKAAFYRTAGAPRPGVATARQLQGKELSYNNINDTDAAYEAVSEFDPAR
                     TAAVVIVKHANPCGVAEGASLIEAYERALRCDPVSAFGGIVALNRTLDAEAAKKIVEI
                     FTEVIIAPDATEEAAAIVAAKKNLRLLTTGGVADPRAPGQAWRTVAGGFLVQDRDNAV
                     VDDMPLKVVTRRAPTEAELSDLRFAFRVAKHVKSNAIVYAKDGATVGIGAGQMSRVDS
                     SRIAAWKAAEAAKAAGLPESLARGAVVASDAFFPFADGLLAAAEAGATAVIQPGGSMR
                     DDAVIQAADEAGLAMVLTGHRHFRH"
     CDS             416506..417789
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015931684.1"
                     /locus_tag="Maq22A_c02065"
                     /note="29d0016"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="egg lysin"
                     /protein_id="BAQ43900.1"
                     /transl_table=11
                     /translation="MRLDEHPLRARVLAEVHARPFTPVKTPRRFLHYAFLTDGDAAAA
                     DRDALEAYCTGLGHPGPALGAKQHRVIFSGAILRWESHSEFTTYTWEYGDAQGHAFQP
                     QPDAIEGAMGEVAQPGPLLVAVDLHLLPAVDGGLPADVVSGFNAASLAMAEAEGGAAV
                     IATDFQPDPHGYVRIVVADRRLSRLGAGTLVQRLLEIETYRTLALLGLPEAQALGPTI
                     RRIETALPPLMEAMRSSEGFEKNHALLDELIGLAAELEAGASRAMYRFGATRAYDELV
                     RLRLSSSGEHALPGQTSWSVFLARRYNPAIRTCTTIAERQDLLSRKLARAAQMLRTRV
                     EIELERQNQAQLQSMIDRVRLQLRMQQTVEGLSVAAITYYVASLVHHVLEGVHHAGVP
                     VDATVGTAIAVPVVLAGVWWTVRRIRRMHAEPGGH"
     CDS             complement(417811..418605)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018860355.1"
                     /locus_tag="Maq22A_c02070"
                     /note="29c0012"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43901.1"
                     /transl_table=11
                     /translation="MPDDFGDFRRRLLENVPAVRVLILSRSTQTNEPARCALLLPVLA
                     RLPQPLALIEVGASAGLCLLPDFYGYDFGSGVLRPEVGDGTFPIFTCAASPSTPIPSR
                     MPRIVWRAGLDLNPLDAGNPEQSSWLETLVWPERTERLAGLRDALRIAAIQTPRIVEG
                     NLIGGALASLCRQAPADATLVVFHTAVLAYVPDHATRQAFANEVTALSPYWICNESPR
                     VMPDLSAGIGDPGGGRFLMTVNRKPIAWTDPHGAAITWIAAENTVP"
     CDS             complement(418846..419085)
                     /codon_start=1
                     /locus_tag="Maq22A_c02075"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43902.1"
                     /transl_table=11
                     /translation="MSRERDMSSREAGKLDIEPRSVGCAAGGAPAIEQFIHVFPEVYA
                     DIVAMVSTPATVVLEISEIAAHCAPRKTGDGEGLQ"
     CDS             complement(419198..420886)
                     /codon_start=1
                     /gene="dhlC"
                     /inference="similar to AA sequence:RefSeq:WP_015931282.1"
                     /locus_tag="Maq22A_c02080"
                     /note="29c0013"
                     /note="member of the sodium:solute symporter family;
                     cotranscribed with the acs gene which encodes acetyl
                     coenzyme A synthase; mutations affect acetate uptake;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /product="acetate permease"
                     /protein_id="BAQ43903.1"
                     /transl_table=11
                     /translation="MTARRIAVVALLTIVGAGAALAAGPDLGAVQKQATNWTAVVMFL
                     LFVLATLGITYKAAAGSKSAADFYAAGGGISAGQNALAIAGDYMSAASFLGISGLVFS
                     SGFDGLIYSIGFLVGWPIVLFLIAERLRNLGKFTFADVASFRLDQTRIRILSATGTLV
                     VVAFYLIAQMVGAGKLIQLLFGLDYLTAIVAVGILMIVYVAFGGMKATTWVQIIKACL
                     LLAGASFMALAVLWRYGFNPEALFAAAVAEHPKHEAIMAPGGLVADPISSLSLGIGLM
                     FGTAGLPHILMRFFTVSDAQAARKSVFYATGLIAYFYILTFIIGFGAITFLMGDPSYF
                     KAGANGAYDRITGLLGGSNMAAVHLANATGGSLFLGFISAVAFATILAVVAGLTLAGA
                     SAVSHDLYAQVFARGRTTEAGEVRLSKISAVVIGIVAIYLGYVFENQNVAFMVGLAFA
                     VAASCNFPVLAMSILWKGTTTLGALVGGLIGLVSAVVMVVLSKAVWVTTFGHPAALFP
                     YDNPALFSMPLAFLGIWAVSKIDNSARAKRERAAFEAQYVRSETGIGASGAHAH"
     CDS             complement(420883..421191)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012332765.1"
                     /locus_tag="Maq22A_c02085"
                     /note="29c0014"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="membrane protein"
                     /protein_id="BAQ43904.1"
                     /transl_table=11
                     /translation="MAEIDHSRVLASPKFRQLVTERTRFGWILSGVMLGIYLVFILLV
                     AFAHGLMATKVGSGVTSLGIVLGLVVIVAAFVLTGIYVARANGRFDDLTRDLNRELGR
                     "
     CDS             complement(421586..423535)
                     /codon_start=1
                     /EC_number="6.2.1.1"
                     /gene="acs"
                     /inference="similar to AA sequence:RefSeq:WP_012332764.1"
                     /locus_tag="Maq22A_c02090"
                     /note="29c0015"
                     /note="Acs; catalyzes the conversion of acetate and CoA
                     to acetyl-CoA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /product="acetyl-CoA synthetase"
                     /protein_id="BAQ43905.1"
                     /transl_table=11
                     /translation="MSQRVVEVSQDARARAHIDEAKYQSWYRASIDDPEAFWREHGKR
                     IDWFTPYTKVKETTFGPGDVSIRWFSDGVTNAAHNCIDRHLETRGDQVAIIWEGDDPS
                     ESRHITYRELHAEVCRMANVLRNRGVSKGDRVTIYLPMIPEAAFAMLACARLGAIHSV
                     VFGGFSPDSLAGRIQGCDSKLVITADEGLRGGRKVPLKANVDAAIQRLPADSVDHVIV
                     VRRTGGAVEMDPVRDVYYDAAAAQVTDECPVTHVEAEHPLFLLYTSGSTGQPKGVVHT
                     TGGYLVYAAMTHQYVFDYHEGDIYWCTADVGWVTGHSYILYGPLANGATTLMFEGIPT
                     YPSISRFWEVVDKHKVNIFYTAPTAIRSLMGAGEAPVKKTSRASLRTLGSVGEPINPE
                     AWEWYYRVVGDERCPIVDTWWQTETGGILITPLPGATPLKPGSATRPFFGVKPVVVDA
                     DNKVLDGACEGNLCIDDSWPGQMRTVWGDHERFVQTYFSTFPGRYFSGDGCRRDADGY
                     YWITGRVDDVINVSGHRMGTAEVESSLVAHPKVSEAAVVGYPHDIKGQGIYAYVTLMQ
                     GEEPSDALRKELVAWVRKDIGPIASPDLIQFAPGLPKTRSGKIMRRILRKIAEDEFSS
                     LGDTSTLAEPAVVDDLIENRQNRTH"
     CDS             complement(423690..423986)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015931671.1"
                     /locus_tag="Maq22A_c02095"
                     /note="29c0016"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43906.1"
                     /transl_table=11
                     /translation="MRSTLRLAALGLAGLLATALAPAPLFAQVAPGTRDIAVHDTAVT
                     GSLGPGSRTTTGVGQTKPPGAALGPDSGLTPELQARDREIGRKIETEICTGCTE"
     CDS             complement(424103..424582)
                     /codon_start=1
                     /gene="cumB"
                     /inference="similar to AA sequence:RefSeq:WP_015934251.1"
                     /locus_tag="Maq22A_c02100"
                     /note="29c0017"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="dCMP deaminase"
                     /protein_id="BAQ43907.1"
                     /transl_table=11
                     /translation="MTDDETFMARAIALSEHTSLVESAGGAFGAVIVRDGQIVGEGAN
                     RVVAENDPTWHAEMAAIRDACRKEGNFKLHGATLYTSAEPCPMCMAAAYWAGISRIFY
                     ASTNEDALKHGNFDDSMIYEEIRKPAGERKIPIRQIMRAEAIEVWERYEAKADRVPY"
     CDS             complement(424682..425572)
                     /codon_start=1
                     /gene="lysR"
                     /inference="similar to AA sequence:RefSeq:WP_012333569.1"
                     /locus_tag="Maq22A_c02105"
                     /note="29c0018"
                     /note="charges one glutamine molecule and pairs it to its
                     corresponding RNA trinucleotide during protein
                     translation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology. Start
                     codon location was manually corrected by using
                     GenomeMatcher"
                     /product="LysR family transcriptional regulator"
                     /protein_id="BAQ43908.1"
                     /transl_table=11
                     /translation="MDWDKIRIFLNVAEAGSFTKAGDDIGLSQSAVSRQISALERELK
                     APLFHRHARGLILTEQGDLLFRAARDMKMRLETTRARLVETSERPSGDLKVTTTVGLG
                     TAWLSQRVAEFLDLHPDVRVELILTNEELDLAMREADVAIRLRRPAQPDLIQRRLFTV
                     HYHVFASLEYIKRFGEPKTIDDLDKHRLVSFGGDQPSYLMATHWLATVGREGREHRTI
                     HFTVNNISALQLAVETGAGIGILPDYVADGNEQLVQVLRDYEMPNLESYLVYAEEMRT
                     VARVQAFRDFLVAKAQRWTY"
     CDS             complement(425684..426676)
                     /codon_start=1
                     /gene="trxB"
                     /inference="similar to AA sequence:RefSeq:WP_012333570.1"
                     /locus_tag="Maq22A_c02110"
                     /note="29c0019"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="thioredoxin reductase"
                     /protein_id="BAQ43909.1"
                     /transl_table=11
                     /translation="MSTTPQAPQHEKLVIIGSGPAGYTAAIYAARAMVEPLLISGFQP
                     GGQLMITTDVENYPGFAEAIQGPWLMEQMRAQAEHVGTRIVSEYIAKVDLAQRPFRLD
                     ADSGAVFTCDALIIATGAQAKWLGLPSEAKFQGFGVSACATCDGFFFRNKDVVVVGGG
                     NTAVEEALYLANLASKVTVVHRRDGFRAERILQERLFKHPNVEVVWNHAVEEICGRDK
                     PAPSVTHLRLRDTVTGAITERKADGVFIAIGHQPATAVFEGQLPFRAGGYLEVTPGTA
                     MTAIPGVFAAGDVTDDVYRQAITAAGMGCMAALEAEKYLANLAIGEEPRKAAAE"
     CDS             complement(426708..427706)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012333571.1"
                     /locus_tag="Maq22A_c02115"
                     /note="29c0020"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="nucleoside-diphosphate sugar epimerase"
                     /protein_id="BAQ43910.1"
                     /transl_table=11
                     /translation="MVDAPPPPASLLPPDTTVWLVTDGKAGDLAPCRGLAEALGSMPV
                     ERRIAPRPPFSWLAPRGPADPRERALAPPWPNLAIATGRRAVPALRAIKRRSGNDTFT
                     VFLRDPRIGTRAADLIWVPAHDRLRGANVIVTEAGPHPVSPARLAAARAHPDPRLAAL
                     PSPRIAVLVGGDSRHGRFSEADAARLLAGLERLSEGASLMVTASRRTPAALRAALSDL
                     VRRRGGFVWDGSGENPYLAMLALADTIVATGDSANMVVEACAAGVPVRLFEPANVYAR
                     HRTLFEALKRHGTVHAFDGRVEALRPKPLDMTLAIAQAVANAYMGHRDALARRTAR"
     CDS             427794..429158
                     /codon_start=1
                     /EC_number="6.1.1.17"
                     /gene="glnS"
                     /inference="similar to AA sequence:RefSeq:WP_015931106.1"
                     /locus_tag="Maq22A_c02120"
                     /note="29d0017"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="glutamyl-tRNA ligase"
                     /protein_id="BAQ43911.1"
                     /transl_table=11
                     /translation="MLYEGRMAPVVRFAPSPTGFLHIGNARPALFNALFARRAGGRFW
                     LRLDDTDTARSTAEFAAAIEEDLGWLGIVPDGMFRQSERLAIYDAAAERLKAVGRLYP
                     AYETAEELDRRRKRQLGRGLPPVYDRAALKLSPEERAAFEAEGRRPHWRFRLDPGTVT
                     WDDLVRGPCHVEADSLSDPVLIREDGSYLYTLPSVVDDAETGVTHVIRGEDHVTNTAV
                     QIQIFSALGAPVPVFAHHNLLTTASGEGLSKRLGHLSLRGLRAAGYEPMAVAALAVLT
                     GSAEAVRPVSDLDELASLVDLAHVSRAPAKFDEHELDGLNARVVHGLGYAVVAERLAA
                     LGVASERAEAFWEVVKANLTRVSDAADWWRVVEGPVTPVIGETPDLFAVAREALPEEP
                     WDATTWKRVTEAVRNATGLKGKALFLPLRLALTGLDHGPDLAGLLPLIGRARALARLK
                     GETA"
     CDS             complement(429165..430571)
                     /codon_start=1
                     /gene="gatA"
                     /inference="similar to AA sequence:RefSeq:WP_015928327.1"
                     /locus_tag="Maq22A_c02125"
                     /note="29c0021"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="amidase"
                     /protein_id="BAQ43912.1"
                     /transl_table=11
                     /translation="MDQPASDNLADLAATELLALYARRAVSPVAVARAVIARAEAREP
                     HLHALYAFAPEAALAAAHASEARWMRGEALPLDGVPVTIKENIATKGVPMPLGTAARD
                     DAAPSPADAPATARLREDGAVIFSATTMPDYGMLSSGLSSFHPLTRNPWDLARGPGGS
                     SAGSGAAAAAGYGPIHLGTDIGGSIRLPASWCGVVGHKPSHGRVPLDNAFYGRCAGPL
                     TRTVADAALAMRAISRPDDRDPTGLPPADLPWLDLDGIDLKGLRLGLVMEAGAGLPLD
                     PGNRAVIEAAAALLAQAGASVTPVPAFLTQEMLDGLDRFWRQRASLDIDALDEARRAR
                     VLPFIRDWAAGGRDLSGAAVFHGMAQMAAMRDAALAAIRPFDFLIGPVSPNPPFPAEH
                     ASPTNDPARAMHHIAYTVPFNMSEQPAVSVPAGFTPDGLPVGLQIVGRRFDDVGVLRL
                     ARAFERIRPALRPWPGVA"
     CDS             complement(430576..430923)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012330434.1"
                     /locus_tag="Maq22A_c02130"
                     /note="29c0022"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43913.1"
                     /transl_table=11
                     /translation="MPHFDEFYANKLRGSLGVTDAESVLDLRGAPRAQAEASLADMLE
                     RSRFAKGKTVAVRFDGPVPGGGETLFQPVGRQLLDAKRRGWVERLQTLPSQDGLGFYV
                     ALAGRPEKTPEAR"
     CDS             complement(430938..431504)
                     /codon_start=1
                     /gene="uma2"
                     /inference="similar to AA sequence:RefSeq:WP_015928329.1"
                     /locus_tag="Maq22A_c02135"
                     /note="29c0023"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="uncharacterized protein conserved in
                     cyanobacteria"
                     /protein_id="BAQ43914.1"
                     /transl_table=11
                     /translation="MSLALRRAPRMRVADFIAMIRERPDEERWELLDGDAVLMAPPSE
                     RHQQIVSNLLAALRPLVAKFGCRALPGLGLRNDFVDDYAPIPDVVVRCGPLLTDGYAR
                     DPLIVAEVLSPSTLNNDRGRKAAFYQGLQTLRAYLIVYADEARVELWSRGNGPDATLR
                     VLGHDDTIPLPDLGGEIPVAALYDGIPL"
     CDS             complement(431615..433048)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012330432.1"
                     /locus_tag="Maq22A_c02140"
                     /note="29c0024"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="homospermidine synthase"
                     /protein_id="BAQ43915.1"
                     /transl_table=11
                     /translation="MTDWPVHGRISGPIVMIGFGSIGRGTLPLIERHFTYDKARFTVV
                     EPSDAHKALADEHGLRFEQVALTKDNYREILTPLLTEGGGQGFCVNLSVDTSSRDIME
                     LCREIGALYIDTVAEPWPGFYFDKNAGPADRTNYALREQVLDARRRNPGGPTAVSCCG
                     ANPGMVSWFVKQALLNLSAELGLKTPEPKSREEWAALMREVGVKGIHIAERDTQRAKS
                     EKPQGIFVNTWSVEGFVSEGNQPAELGWGTHETWMPENGRTLPNDAPAIYLLQPGADT
                     RVRSWTPTGQAQFGFLVTHNEAISIADYYTVRQDGKAVYRPTCHYAYHPCNEAVLSLH
                     EMWGQAGKVQEKHHILDENEIVDGIDELGVLLYGHGKNAYWYGSQLSIEETRRIAPYQ
                     NATGLQVTSAVLAGMVWALENPEAGIVEADEVDFRRCLEVQTPYLGPVVGVYTDWTPL
                     SGRPGLFPEDIDETDPWQFRNVLVHGA"
     CDS             433379..433594
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015928331.1"
                     /locus_tag="Maq22A_c02145"
                     /note="29d0018"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43916.1"
                     /transl_table=11
                     /translation="MLAVITHSLIAPAIDERSDMEPGILTLVSRMVHAIHAANQRRLE
                     RQIGEYVEVNGGRITDDLERRIGQHFC"
     CDS             complement(433847..434485)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02150"
                     /note="29c0025"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43917.1"
                     /transl_table=11
                     /translation="MGAFFIRYRWLTVALLVVVAFAVVFGIWSRWITADPLDASLSMS
                     PPGRVETDVVVRLSCPHRLRLHLSSKTRAREDMRRLVGRYGTAEGIDIPLQWSFRDMA
                     GQPVAWGKAENIGSDGFDAEGFYRTVSTSLPLPAGKYRLSAALTEEMAGFQDVSAQMS
                     FRCHPKASAGWQTDLLFFGSFAWLLAWPIMAILALWLAALALRDRGRARAVR"
     CDS             complement(434652..435815)
                     /codon_start=1
                     /gene="proB"
                     /inference="similar to AA sequence:RefSeq:WP_015931226.1"
                     /locus_tag="Maq22A_c02155"
                     /note="29c0026"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="glutamate 5-kinase"
                     /protein_id="BAQ43918.1"
                     /transl_table=11
                     /translation="MLTTSAPGSQDTPPFTPSLDQFRRVVLKVGSALLVDRARGRLRH
                     AWLAALAEDIADLHGRGVDVLVVSSGSIALGRTVLGFGPGPLRLEESQAAAAVGQIAL
                     ARHWSEALAHHGIVAGQILVTPQDTEERRRYLNARATTLKLLEERAVPVVNENDTVAT
                     SEIRYGDNDRLAARVATMIGADLLVLFSDIDGLYTAPPASDPAARHLPVIARITPEID
                     AMAGGPASELSRGGMRTKVEAAKIAIQGGTQMMIADGRGKNPLKAVANGARCSWFLAG
                     STPGAARKTWIGGSLEPRGTLTIDAGAARALQGGASLLPVGVTRVEGSFGRGDAVTIR
                     SGDGLVLARGLVAYDSDDAARILGRSSREIEAVLGYPGRAAMVHRDDLALVGD"
     CDS             complement(435827..436225)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_007568216.1"
                     /locus_tag="Maq22A_c02160"
                     /note="29c0027"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="twitching motility protein PilT"
                     /protein_id="BAQ43919.1"
                     /transl_table=11
                     /translation="MIVLDTSALVAIALNEPESEAFSRIIAVNGMARVGTPTLVETAM
                     VLEARLPAGAEHFLDGLMALPSLRSVDFDHRMVRAARDAFLRFGRGRGHPARLNMGDC
                     MAYAVAKVWRLPLPFKGDDFVDTDLTPAAP"
     CDS             complement(436222..436494)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02165"
                     /note="29c0028"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43920.1"
                     /transl_table=11
                     /translation="MTERLIFKGDEIVGIAERVAQRLGTTPSEAVIGLLREAEVRPAA
                     PAAPLTPAQTSDYDALRRLTKATAPHRRPGATSNHSDLYAEDGLAA"
     CDS             complement(436519..437841)
                     /codon_start=1
                     /locus_tag="Maq22A_c27770"
                     /note="29c0029"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47060.1"
                     /transl_table=11
                     /translation="MGRAEPPRPVQLEVPAPARADHGRGPAGPALRRHHGPRRAADRA
                     ARDPRRRVPGGRGPHLRGRARRRALAADQRTPHQGRRLRLGRHRHHGAQAAPGAAGGI
                     RAPAHRHHLRPQALAPHPRDPDPAARRPRRALPRPEGPGRERQPLEIRVPGQHEPRVA
                     HPAERHPGLRRGDGERGVRVARLGEVPRILPRHPIERALPALGHRRHPRHVAHRRPPG
                     EARQAAGRRERGAGARPQAHRRAGPRQGPHRQRRDERRHPGHGRRARPAPDPGQPAPE
                     RREVHPRGRPGRGAHPPRPRRRPHLRRGQRHRHPEGGAAEARLPVRAGRDQLRPQLQG
                     LRPRPRHRPLARRAPRRRPAHPLRGGHRHDRAGPPAPPRPQRGRRRAGRGPGQRLPGH
                     RAGNRRPRGVRDAAPIPDSCETGAQKNEPANELACRRLRALAAPARLP"
     CDS             complement(436635..439031)
                     /codon_start=1
                     /gene="baeS"
                     /inference="similar to AA sequence:RefSeq:WP_015931927.1"
                     /locus_tag="Maq22A_c02170"
                     /note="29c0030"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="histidine kinase"
                     /protein_id="BAQ43921.1"
                     /transl_table=11
                     /translation="MLEADPAPFSERAATILGISRSSKTAHQRLAHAESWLRFAVPAM
                     LAAFLICLATVTALQLTGHREEVVGDARREIDLVARLLAGTLPTALARPASLPGLGLP
                     ETATPATLRERLVRLLPVGSLPAGRTVLLVGADDAILAALPERPGLPRSFAELVGEVQ
                     VLGIMGERAGVLPVVLGNGERALATVRTVTGGAGVAQVAVVQTLDSVTAIWGTRARTA
                     AVLVGAVALVVVCTGLAYALQADRARAVDRVCEQVRQRLDTALGRGRCGLWDWDIPRG
                     RIYWSDSMYQLLGYVREQEFLSFGDVNALVHPDDTDLYGLARQLAARDTTVDHEFRIR
                     GAGGEWVWLKARAEIVQDLEDNGRHLVGIVIDISEQRRLAESTATADMRLRDAVEAVS
                     EAFVLWDAQNRLVLCNSKFRRLHALTTDEAQPGRRYDAIMGRAALPTVRREIPAGEFP
                     EAGARTFEAELADGRWLQISERRTKDGGYVSVGTDITALKRHQERLVESERQLIATIS
                     DLKRSRRTLEIQTQQLADLAERYLDQKAQAESANRSKSEFLANMSHELRTPLNAILGF
                     AEVMESEVFGSLGSEKYREYCRDIRSSGHYLLSVIDDILDMSRIDARRVKLAKQPVAV
                     SEALERALKLIAEPARAKGLTVSVEMSADTLVMADERALHQILVNLLQNAVKFTPEAG
                     RVAVRTRRALDAVHIFVEDSGIGIPKAALPKLGYPFEQVETNFARSYKGSGLGLAIAR
                     SLAELHGGGLRIRSEEGIGTIVLVRLPRPGLNEAAAAQDAAQDSAYPDIVRETAALEA
                     "
     CDS             complement(439231..441888)
                     /codon_start=1
                     /gene="pepN"
                     /inference="similar to AA sequence:RefSeq:WP_015931926.1"
                     /locus_tag="Maq22A_c02175"
                     /note="29c0031"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="aminopeptidase N"
                     /protein_id="BAQ43922.1"
                     /transl_table=11
                     /translation="MQTIVRLADYRPSDYLIDRVDLDVRLHPTETRITATLGLRPNPA
                     GEPGAPLVLDGDELTLVAIALDGQPTGPGAIEVTPRSLTLHQPPQRPFVLEIETQVNP
                     STNTKLMGLYRSNGVYCTQCEADGFRRITYFLDRPDVMAVFTTRIEGSRAAAPVLLGN
                     GNPVAQGEAGPGRHYAIWHDPHPKPAYLFALVGGRLGRVGSRFTTMEGRDVEIAVYVE
                     PGKEGRADFALDAVARSMAWDERTFGRAYDLDVFNVVAVSDFNMGAMENKGLNIFNDK
                     YVLASPETATDADYANIEAIIAHEYFHNWSGNRVTCRDWFQLCLKEGLTVFRDQEFSS
                     DERSRPVHRIAEVRTLRARQFPEDAGPLAHPVRPQAYREINNFYTATVYEKGAEIVRM
                     LRTLLGPETFRAGMDRYFTTCDGTAATVEDFLAAFAAESGRDLAAFSRWYAQAGTPTV
                     AVSGTYDAAARTYTLTFRQSLPVVATEAAAGAAPQPLAIPIALGLVAPGGGPVAAASE
                     RVRDGVFVLDRAEDALVFTGLDAAPVPSLFRGFSAPVKVEHALTRDERLTLLAHDRDA
                     FNRWQAAQSLAMEVLVVRARANAPLAEEAGTEGAGLAAALATFLDGEALADPAFAALV
                     LTLPGEQEIAQAIGAEIDPDAIWRARQTLRVQLGRDLGPRLLALREALVEPEGAPFSP
                     DAASAGRRALRNAALDLVTAADPQAGTALALGQVENAATMTDRLAALATLSLVPGAAR
                     EAALARFGETYRGEALVLDKWFALQAMIPEAGTLERVRGLMHHAAFSLGNPNRVRSLI
                     ASFSLNNPTQFHRPDGAGYDLTAEVVLALDGKNPQVAARLLTAFNTWRMVEGGRRLHA
                     EAALRRVAQAPGLSPDVSDIVGRSLAPAR"
     CDS             442121..442561
                     /codon_start=1
                     /gene="gloA"
                     /inference="similar to AA sequence:RefSeq:WP_012330255.1"
                     /locus_tag="Maq22A_c02180"
                     /note="29d0019"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="glyoxalase"
                     /protein_id="BAQ43923.1"
                     /transl_table=11
                     /translation="MEYLHTMVRVADLERALDFYCNKFGLQEVRRTESEKGRFTLVFL
                     AAPGDAARAKDTKSPLLELTYNWDPEEYAGGRNFGHLAYQVDDIYETCQKLQDAGVTI
                     NRPPRDGHMAFVRSPDGISIEILQKGGAKPPQEPWASMQNTGSW"
     CDS             complement(442609..442779)
                     /codon_start=1
                     /locus_tag="Maq22A_c02185"
                     /note="29c0032"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43924.1"
                     /transl_table=11
                     /translation="MSENIEAGWTLDTVQQLRAMAREGVPASVMSLKLKRPVTAIHAK
                     LAELGVTPAAGA"
     ncRNA           442986..443414
                     /locus_tag="Maq22A_c02190"
                     /ncRNA_class="RNase_P_RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /product="bacterial RNase P"
     CDS             443868..444884
                     /codon_start=1
                     /inference="similar to AA sequence:SwissProt:B8IMX2.1"
                     /locus_tag="Maq22A_c02195"
                     /note="29d0020"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="16S rRNA methyltransferase"
                     /protein_id="BAQ43925.1"
                     /transl_table=11
                     /translation="MTDAPHIPVLLDEVLGALRLGDAPARIIDGTFGAGGYTRAILAA
                     HPGNQVLAIDRDPTAIAAGQALVEREAGRLVLVQGRFGDLDALARDHGFADADGVVLD
                     IGVSSMQLDQPERGFSFRFEGPLDMRMERAGESAADLVNEASEAALADVIYHYGEERR
                     ARAVARALIEARRRGRIETTAALAEIVAGVVRAEPGSGIHPATRTFQALRIAVNDELG
                     ELQRALHAAERTLRPGGRLAVVTFHSLEDRIAKQFFSARSGRAVAASRHLPMAAQPAP
                     RSFTLATKGPVAAGEAECRANPRARSAKLRAGERTDAAPPPPLTALEALASLPEPQTR
                     GGRR"
     CDS             444881..445327
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015931921.1"
                     /locus_tag="Maq22A_c02200"
                     /note="29d0021"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="predicted secreted (periplasmic) protein"
                     /protein_id="BAQ43926.1"
                     /transl_table=11
                     /translation="MIRLLHLAAIAGLIASAIYAYSIKYDTLYQAEQVAKLKTRLRKE
                     RDAIAVLRAEWQLLTRPDRLQGAVDKYLTLEPIGTSHLARLADLPAKVDRGDEIARKL
                     EALGLGATATPAAKDRAPSTTGATAARPEEPRTTGSTSTRTPTAKR"
     CDS             445333..447183
                     /codon_start=1
                     /gene="ftsI"
                     /inference="similar to AA sequence:RefSeq:WP_015931920.1"
                     /locus_tag="Maq22A_c02205"
                     /note="29d0022"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="penicillin-binding protein"
                     /protein_id="BAQ43927.1"
                     /transl_table=11
                     /translation="MTQDSDFQAHAPLDPDAVPETGAQPVDDAPPSVPGRSLAALLRG
                     GVLAMFRLSVERSAARVGLVSLVFGAVFLTLMGRLASFALFPDDPVTASARRAEAGGT
                     TQIRPDIIDRNGEILATDIRTVSVFAEPKNIYDKDEAVELLTAVLPEINARDLREKLS
                     SKKGFVWVKREITPRQQVEVHRLGIPGVGFLPDHKRVYPNGTAAAHILGVTNLDNVGI
                     AGIEKYIDRQGLRDLTSLGFVEKSADMAPVQLSIDLRAQHAVRDELAWGMEHYRAKAA
                     AGLILDVTTGEVIALASLPDFDPNEPKDALDPDRINRMNVGVYEMGSTFKAMTLAMAL
                     DSGKFNVNSTFDTRGGVLHWGRQKIHEYHGTNRVITMPEVFTHSSNIGSAKMALGIGV
                     PGHKAFLKKMGLLDRLRTELPESAEPIIPPRWTEINTITIAFGHGLAVAPLQASAAVA
                     AIANGGFLMTPTFLKRTEAEAREKATQVLSAQTSEAMRYIMRLNATEGSAKKAAIPYY
                     YVGGKTGTAEKVIRGRYVKNRLFTTFMAAAPMDKPKYLFVTIMDEPQAVAAESGSYAT
                     AAWNSGVVTGRVIARVAPILGLPPQFEPPAKPFPLMVKLGAYHVNQVDGR"
     CDS             447180..448637
                     /codon_start=1
                     /gene="murE"
                     /inference="similar to AA sequence:RefSeq:WP_012330249.1"
                     /locus_tag="Maq22A_c02210"
                     /note="29d0023"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-
                     diaminopimelate ligase"
                     /protein_id="BAQ43928.1"
                     /transl_table=11
                     /translation="MSLTLGDLFPQAGQAAGLPVAGLTADSRKVEPGFVFLAVPGTAA
                     DGRLFAAKAAAAGAVAMVAEGARPADLPDPVAYLTVPDARVALAAAAARLHPGQPGTV
                     VAVTGTSGKTSIADFVRQILGRLGRQAASLGTLGVITTSGAAYGSLTTPDPITLHETL
                     DRLARDGVTELAMEASSHGIEQSRLDGVRLTAAGFTNLGHDHLDYHGTPEAYLQAKLR
                     LFTTLLPEDGTAVINADGPQSQAVIAAVRERGIRLVTTGRAGEGVRLVSARPEGFAQR
                     LEIAVAGTTHAVDLPLVGTFQVENALLAAGLVLATPAGAGREAEVIAALGHLAGVPGR
                     LERVGTVRDALCIVDYAHKPDALANVLDALRTFTTGRLVCVVGCGGDRDRAKRPLMGR
                     IATEKADRVIVTDDNPRSEDPATIRAAILAAAPGAEEIGDRAEAIRAAVRDLRAGDVL
                     VVAGKGHETGQIIGDRTLPFSDRDAVLSAIEESRA"
     CDS             448634..450091
                     /codon_start=1
                     /gene="murF"
                     /inference="similar to AA sequence:RefSeq:WP_018262897.1"
                     /locus_tag="Maq22A_c02215"
                     /note="29d0024"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-
                     diaminopimelate--D-alanyl-D-alanine ligase"
                     /protein_id="BAQ43929.1"
                     /transl_table=11
                     /translation="MTEPLWTLDTAAAAMGGRAVADAAASRDLSGISIDTRTLKVGDL
                     FFAIRGEARDGHDFVRDALARGAGAAVVAEERAADLAEAGPVIAVPARDEDGVLAAMR
                     GLAAAARARTGARVLAVTGSVGKTGTKEALRHVLAAQGVTHASVASYNNHWGVPLTLS
                     RMPAASEFGVFEVGMNHAGEIAPLTRLVRPEIAIVTTVEPVHIEHFRSLSGIADAKGE
                     IFYGLEPGGVAIVNRDNPNFERLEAHALASRAGRIVSFGEHREADVRAERIVMRPDLS
                     IVDVRAMGQAVTYQLGTPGRHTALNSLAVIAAVQALGADLALAALSLAQLRPPVGRGA
                     RTMLRIGDGEALLVDESYNANPASIRAALSTLAGAETAGRRIAILGDMMELGADAPAL
                     HRELAGAVEEHGIDLVLTAGPLMQELFEALPASRRAAARPTSADLVDPVLDLVRPGDA
                     VMVKGSNSTRMGRIVEALKARYGAQDQDLAVGRSG"
     CDS             450171..451256
                     /codon_start=1
                     /EC_number="2.7.8.13"
                     /gene="rfe"
                     /inference="similar to AA sequence:SwissProt:B8IMW7.1"
                     /locus_tag="Maq22A_c02220"
                     /note="29d0025"
                     /note="First step of the lipid cycle reactions in the
                     biosynthesis of the cell wall peptidoglycan; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /product="phospho-N-acetylmuramoyl-pentapeptide-
                     transferase"
                     /protein_id="BAQ43930.1"
                     /transl_table=11
                     /translation="MLYLLSDLSGVFSPLNVFRYITFRTGGALFTAGFFVFWFGPWII
                     SLLRLRQGKGQPIREDGPQSHLLTKRGTPTMGGLMILAGTLVAVVLWANPRNHYVWIV
                     MMVTLGFGAIGFYDDYLKVTKQSHKGFSGKFRLGLEALIAIAACTAIAEYSAPGLAYR
                     LAFPVFKDAIINLGLFYVAFAGFVIVGAGNAVNITDGLDGLAIVPVMIAAATFGIIAY
                     LVGNVIYASYLQVNYVPGTGELAVICGALIGAGLGFLWFNAPPAQIFMGDTGSLALGG
                     LLGTVAVATKHEIVLGIVGGLFVLEILSVIIQVASFKLTGKRVFRMAPIHHHFEQKGW
                     KEPQVVIRFWIIAVVLALLGLATLKLR"
     CDS             450935..453751
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018262038.1"
                     /locus_tag="Maq22A_c02225"
                     /note="29d0027"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="endonuclease"
                     /protein_id="BAQ43931.1"
                     /transl_table=11
                     /translation="MVQCAAGPDLHGRYRLAGARRPARHRGGGDQARDRARHRRRPVR
                     AGDPVGHHPGRVVQAHRQARLPHGADPPPLRAEGLEGAAGRDPVLDHRRGAGAARPGD
                     AQAAVGAARSDLAISAAAWKEGAFPLPHREGGGALRSSGGTPHDTLHHLRRPDGRPVR
                     PRRLGPRHGAQPQGGRGPGDRLRRQPGPHGGGARAGHRDRRPARGGVEHLRRPRPRAR
                     RAPDPPGPALDRGPRDGRRRPGDRRHRAVLPRAGGDEPGRALRRHHRHQRQVDHHGAD
                     RPRPGGGRTRRADGRQHRHGHPVARPAVAGARPRHRAVVVPDRPDAVARTHHRRPPQP
                     HARPPRPPRRHGALRRHQGAAGDRRRACDRRRRRRVLPRDRGASHGAAHPGPCRRGGG
                     GAGHPRPRRHRHRRAPGAGGAGGGPRRHRVPARRPQLAERRHRLRGGERARRDAGRLR
                     SGARDLPGPAAPDGGGRASRPGPVHQRFEGHQRRLDREGAVGLPAGPLDPRRQAEGGR
                     DREPRAVLPARRPRLPDRCGERRLRRHPRRACAVQPLRHARRRGRAGRRDGRGGCGGR
                     AGGAALAGLRLLRPVPQLRGSRRPVPRPRPGPAGPAPSRGLSADLGPPASAAPFPGRA
                     NRRKGLAAGRASRGPGARPGGAVPHPPSCRPLHALPAGAMLPPQHLLPAESQAPATTP
                     AHVPHRPGPRKIISWNLLRRTGATVDALEALIAQEKPDLLLMQEATVDITELQARVGG
                     HYAWAPLPKRIHGLAMWSPTPWPSPPRVITLPSGALIDRVCQILDLGSFGVANVHLSH
                     GQVLNRRQLRRIAQNLPVRAAVLGDYNIVGPALLPGFHDVGPRHPTHAMVDIVPLRLD
                     RCLVRGLTCRGQAVLPRGASDHRPIVVHLEPGNPQGRREPLRDRIAAFRDRAEDLRKR
                     VPLKDMAAAIGRRRRAAARPSRES"
     CDS             451368..452756
                     /codon_start=1
                     /EC_number="6.3.2.9"
                     /gene="murD"
                     /inference="similar to AA sequence:RefSeq:WP_015927245.1"
                     /locus_tag="Maq22A_c02230"
                     /note="29d0026"
                     /note="UDP-N-acetylmuramoylalanine--D-glutamate ligase;
                     involved in peptidoglycan biosynthesis; cytoplasmic;
                     catalyzes the addition of glutamate to the nucleotide
                     precursor UDP-N-acetylmuramoyl-L-alanine during cell wall
                     formation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /product="UDP-N-acetylmuramoyl-L-alanyl-D-
                     glutamatesynthetase"
                     /protein_id="BAQ43932.1"
                     /transl_table=11
                     /translation="MTPSTTFAGRTVALFGLGGSGLATALSLKAGGARVIACDDNPAR
                     MAAAREQGIETGDLRGAEWSTFAALVLAPGVPLTHPVPHWTVDLATAAGVPVIGDIEL
                     FCRERAATSPDAPFVAITGTNGKSTTTALIAHVLAAAGRDVQMGGNIGTAILSLAPPS
                     PERVHVIELSSFQIDLTPSLAPTIGVLLNLTPDHLDRHGDMARYAAIKERLVTGAAHA
                     IVGVDDAYCRAIAARRTGPLTRVHVGEAGEGPGILARGGIVIDGRREPAEPVADLAGI
                     GSLRGAHNWQNAAIAYAVASALGVTPDAFAAALATFPGLPHRMEEVGRRGPVLFINDS
                     KATNADSTEKALSAFPRVHWILGGKPKEGGIASLAPYFPRVAHAYLIGAASDDFAATL
                     DGHVPFSRCGTLAAAVAQAAGMAEADAAGEPVVLLSPACASYDQFRSFEDRGDQFRDL
                     VRALPGLRPPGA"
     CDS             complement(453684..455120)
                     /codon_start=1
                     /gene="cls"
                     /inference="similar to AA sequence:RefSeq:WP_015927247.1"
                     /locus_tag="Maq22A_c02235"
                     /note="29c0033"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="phospholipase D"
                     /protein_id="BAQ43933.1"
                     /transl_table=11
                     /translation="MEHEIYRWLGIPAAIQSEVLAPIGLALAVIVTVHVLMNKREVGA
                     AIGWIGLGWLSPMLGSLLYVMFGINRVSRRARRLPVLPGPRPGAPPAPVAEVPEAFAP
                     LRRAVERISGLPLVAGNSVRRYRHGDEAYPAMLLAIAEAQTSVALSSYIMRDDDSGRA
                     FAAALDAAQARGVAVCVLIDGIGSGYFFPAMYRRLRGLGIPAGLFMHSALPWRMPFLN
                     LRTHKKLLLIDGRIGFVGGVNIADENVMAKDPPEPVRDSHFRIDGPVVGQLAQAFWRD
                     WAFVKGEDLEGPAWFPQIPPAGASLARVVTSGPDADIEKIEFVVLEALATARHSVRFA
                     TPYFLPSEMLLTALGLAAMRGVTVDVIIPQASNHRVVDWATRAHVGPLLEAGVRIWLD
                     RPPFDHSKLMVVDDAWCFVGSANWDSRSFRLNFELNVEVYDPDFAADLNRLMQAKMEA
                     RLTADDLNSRGMAVRLRDAAVRLLLPYL"
     CDS             complement(455303..457129)
                     /codon_start=1
                     /gene="typA"
                     /inference="similar to AA sequence:RefSeq:WP_015927097.1"
                     /locus_tag="Maq22A_c02240"
                     /note="29c0034"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="GTP-binding protein TypA"
                     /protein_id="BAQ43934.1"
                     /transl_table=11
                     /translation="MKLRNIAIIAHVDHGKTTLVDKLLQQSGSFRENQRVEERAMDSN
                     DLEKERGITILAKATSVVWKDTRINIVDTPGHADFGGEVERILSMVDGVIVLVDAAEG
                     PMPQTKFVVSKALKIGLRPIVAVNKVDRPDARITEVVNEVFDLFAALDATDDQLDFPI
                     LYGSGRNGWMATSPEGSQEDGLAPLFDLVLEHVPQAKTEDGPFRMLGTLLEANPFLGR
                     IITGRIASGTVKPNQAIKVLDREGKVVETGRVSKILAFRGLERQPIEMGEAGDIVSIA
                     GLVKGTVADTFCDPQVETPIQAQPIDPPTVTMSFIVNDSPLAGTEGDKVTSRMIRDRL
                     FKEAEGNVTLKIEEAADKDSFYVSGRGELQLAILIETMRREGFEIAVSRPRVVFEKDE
                     AGEIMEPIEEVVIDVDEEYSGVVVQKMSERKADMIEMRPSGGNRLRLVFHAPTRGLIG
                     YQGELMTDTRGTAIMNRLFKAYEPYKGEIAGRRNGVLMSNDQGEAVAYALWNLEDRGP
                     MMIEPGWKVYQGMIIGEHNRENDLEVNVLKGKKLTNIRTTSKDEAVRLTPPIRMTLER
                     SLAWIQDDELVEVTPKSIRLRKAVLDPNDRKRAERAKEALSA"
     CDS             complement(457310..458632)
                     /codon_start=1
                     /locus_tag="Maq22A_c02245"
                     /note="29c0035"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="TRAP transporter solute receptor, TAXI family"
                     /protein_id="BAQ43935.1"
                     /transl_table=11
                     /translation="MRRHLPLVLAAILALVATALLAYQWLGQPTTLRVAVGPAGSEDA
                     RLMAAVAQSLARTHEEVRLRLVPTSGVAESARMAEIGRADLAVVRSDVGIPASTQTVA
                     ILHRDAALLLATDPSLSAVPDLRGKRIGIMRNPAANLRLLASLLAHYDVPADAVTTVP
                     LGDGQEAGEALREGKVDAVLTVSPLIGRTAGDVVASIGRTGGTPAFVPIGEAAVLARR
                     WPALESVEIARGTFGGTPPRPAETVTTVGVSHRLVAQARLADSVVSELTRLLFVIRPA
                     LAVEVPLANQIEAPETSKSASLPVHPGAQAYYEGEVESFFERYGDWFYLLVMCVSILG
                     SAAATLVSRAANRSRARDMALLRQLLAIVRASRDVEDELELSDLERQADEILAAALAR
                     AGTGAIDNAGVAAFTLGLDQARRAIAERRAVLVERHAAGPDPLSAAAE"
     CDS             complement(458737..460224)
                     /codon_start=1
                     /locus_tag="Maq22A_c27775"
                     /note="29c0036"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47061.1"
                     /transl_table=11
                     /translation="MIRDTDRPDQAHGYSYNRGGISNQKIALLGLFLKAMTGENRCVV
                     LPDIVIFDQITFIHKRVPIATAFDVARLRDFAESIGVTILDRDPAGDEGGWEYFHHGE
                     RHIAGTAAAGELDRDGVAARFLRALVPSARTAPDVARLRDIVLDERGITHVVQMRIER
                     DWEFHVRTRVDPEVGFNEDNLHTAESIARKFRATHPDGAAKIYVVCDEAALVDGKDRI
                     RQSLREHFDIEAFWKSDLLPRFQSDDANLLELSLADFEIALAAGAFVGTSRSTFSGMA
                     ALERFAQTGSVENHSLYNALGPRLAVRHDRGAFRSARLATAESVADPSCGYELGLILE
                     TAGRLRPAHDRYLARGAFGGPDREEVYLALYRAACLKAALGDEPQSVLDAFAQAASIG
                     ASRAEALHAAARHARTQGRHEEAYGFVARGLGIGPPAEGRAVEAWIHDWALLDEYAVA
                     ASWTGRPADTLRACLQLLTEGKLPAEHRERIVANAKFAIDRIAGL"
     CDS             complement(460392..460586)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015927095.1"
                     /locus_tag="Maq22A_c02260"
                     /note="29c0037"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43936.1"
                     /transl_table=11
                     /translation="MRQGRTPGAAAREHAPLLRQEKNAHQRYLAAPGYHPGALLIATV
                     GPALGAAIVAVIALGLRVSL"
     CDS             complement(460724..461542)
                     /codon_start=1
                     /gene="modA"
                     /inference="similar to AA sequence:RefSeq:WP_014006630.1"
                     /locus_tag="Maq22A_c02265"
                     /note="29c0038"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="ABC-type molybdate transport system,
                     periplasmic component"
                     /protein_id="BAQ43937.1"
                     /transl_table=11
                     /translation="MSETTPHHRAGRTRRSALPRLAALLAAGLALAGPAKAAEVRVMI
                     SGGFTAAYQALVPGFETKTGDTVATAYGPSMGTAPEAIPVRLARGEPADVVIMVGYAL
                     DALDKEGRIEPGSKVALADSRIALAVKAGAKVPDIATLDAFKRALLGAASIAYSDSAS
                     GVYIEKEMYRKLGLEKELAPKSRMIVAERVGNVVARGDAEFGFQQVAELKPVPGITIV
                     GPVPPEVQKVTVFSAGIPKGAQHPEAARALIAWLSAPEHAGTVAGTGLDPISAR"
     CDS             461701..463020
                     /codon_start=1
                     /gene="proP"
                     /inference="similar to AA sequence:RefSeq:WP_015929390.1"
                     /locus_tag="Maq22A_c02270"
                     /note="29d0028"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="major facilitator transporter"
                     /protein_id="BAQ43938.1"
                     /transl_table=11
                     /translation="MAGPVHGPQGSKVATVLRVTSGNFLEMFDFFLFGIYASHISKAF
                     FPAENEFASLMFTFMAFGAGFLMRPLGAIFLGAYVDRIGRRQGLIVTLGIMAAGTVLI
                     AFVPSYQTIGLAAPFLVLVGRLLQGFSAGVELGGVSVYLAEMATPGRKGFYVSWQSGS
                     QQVAVMVAALIGFTLSRTLMPAQMSDWGWRIPFFIGCMIVPFLFYIRRSLEETQEFLH
                     RKHRPSLPEVFKSLGENWKIVLLGMLLVVMTTVSFYTITVYTPTFGKSVLKLSETDSL
                     IVTFLTALSNLFWLPVMGALSDKIGRKPILLVFSGLTLLTAYPALAWLTSNISFTNML
                     ITLLWLSFLYGSYNGAMVVALTEIVPANVRTTGFSLAYSLATAIFGGFTPVVSTWLIQ
                     ALDNKAAPGLWMAFAGACGLIATLLIYRRREGATAALPGTVRPMAGE"
     CDS             complement(463045..463722)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015928140.1"
                     /locus_tag="Maq22A_c02275"
                     /note="29c0039"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="haloacid dehalogenase"
                     /protein_id="BAQ43939.1"
                     /transl_table=11
                     /translation="MPLPAPLDRAEAVVFDAYGTLLDVHSAVQRHAAAIGPQSQALSE
                     TWRQKQLEYSWVLALCGRYAPFWTLTERALDFALARHPDVDAGVRDALLEAYRSLDAY
                     GEVPDTLDALRRAGLKTAILSNGDPAMLDAAVTAAGLSGRLDAVLSVDPAGTFKTAPR
                     AYDLAPRALAVERERIAFLSSNRWDIAGAAAYGFAPVWVNRTGQPDEYPDLAPVRVIR
                     SLDGLLT"
     CDS             463910..464560
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_010684264.1"
                     /locus_tag="Maq22A_c02280"
                     /note="29d0029"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="epimerase"
                     /protein_id="BAQ43940.1"
                     /transl_table=11
                     /translation="MPHLLVIGASQGIGLETVKAALAAGHRVRAFARSAAKIDLSDPN
                     LERFPGDALSSADVTGALQGVDAVVQALGVPARDLLGPVRLFSDATNVLVPAMEKAGV
                     RRLVAVTGFGAGDSRAAIGPLQRLPFRLVFGRAYDDKDAQEIRIRQSGLDWTLVRPGV
                     LTGGAATGRYRVLDRPSSWKNGLIARADVARFIVAEIADNAHVGRPVVLISHALPL"
     CDS             464565..465179
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012321187.1"
                     /locus_tag="Maq22A_c02285"
                     /note="29d0030"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="heme-binding protein"
                     /protein_id="BAQ43941.1"
                     /transl_table=11
                     /translation="MDRLAYYAVTLFESVLGVVGIRTFYDQPRYAVVERLDRGVEIRA
                     YEARVAVETDARGQGGGQGDGEAFGRLFRYITGANRAGDRIAMTAPVETGGRRIAMTV
                     PVEQGAGGTMRFFLPHAVADAGAPEPTEAGVRLVRVPPERIAALRFSGRITPEARAEQ
                     ERILTGVLASAGKATAAAPFFMGYDPPFAIPFLRRNEVAVRLGE"
     CDS             complement(465552..466574)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012331984.1"
                     /locus_tag="Maq22A_c02290"
                     /note="29c0040"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43942.1"
                     /transl_table=11
                     /translation="MTTNAAPTRRGLARLGLSALASLSLGGCFGDGLLGESPGPEKQS
                     ALDVSPVLLVATTRRPADPAGRPPYFTDQRGRGLSFATVRLAVPDRSLIGKVSAVVTG
                     DWRIAAAPRVVTGPEAATAFAEAALGRDVLLYVHGYRESFETAAVSAAQLSDGIRFRG
                     VSGLFSWPSAGKTFDYGYDRESALWSRDAFEDLLRALAVSQGGRIHIVAHSMGTLLTL
                     ETLRMLRADAGEAALDRIGAIVLAAPDIDIDLFTNGIERLGTAAQKITVISSTNDRAL
                     ELSSTIAGGVTRAGAADRSRLEALGVRVADASDYGSGLINHDLFLSNVEVQQVIKRAV
                     ARADGR"
     CDS             466781..467758
                     /codon_start=1
                     /gene="meaB"
                     /inference="similar to AA sequence:RefSeq:WP_012331985.1"
                     /locus_tag="Maq22A_c02295"
                     /note="29d0031"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="arginine transporter"
                     /protein_id="BAQ43943.1"
                     /transl_table=11
                     /translation="MTVPAPDLAQLLSGNRAALARAITLVESKRADHRAAARGLLDAA
                     LPHAGKAVRVGITGVPGVGKSTTIDALGAALTARGHKVAVLAVDPSSSRTGGSILGDK
                     TRMARLAVDPNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVVLVETVGVGQSETA
                     VADLTDFFLVLMLPGAGDELQGIKKGILELADMIAVNKADGEEGMRRAMAAAAEYRAA
                     LHILTPAIATWSPPVATISGLSGQGLDALWDAVLDHRRKLTATGEIAAKRRDQDVKWM
                     WALVHERLHQRLTGSAEVRKTTAEAERMVAAGERSPAAGADLIAELIGL"
     CDS             complement(468061..468234)
                     /codon_start=1
                     /locus_tag="Maq22A_c02300"
                     /note="29c0041"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43944.1"
                     /transl_table=11
                     /translation="MAIFQVRQAATGAILWTGGAADEQQALDAMAREAGYTDFAAIPE
                     SLRSTKVDRLNLG"
     CDS             468374..469015
                     /codon_start=1
                     /gene="acrR"
                     /inference="similar to AA sequence:RefSeq:WP_012330413.1"
                     /locus_tag="Maq22A_c02305"
                     /note="29d0032"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="TetR family transcriptional regulator"
                     /protein_id="BAQ43945.1"
                     /transl_table=11
                     /translation="MPPSQSPARLDSAEERRTRILDAAEACFVRHGFHRATMHDVAAE
                     AGMSPGNLYRYFPSKDAIVAGLAERDRAAVAEDFSGIEAAPDLMQAFTGLARRHLAEA
                     PAEKAVLCLEMWAEATRNPAMAAICRDFEREIAGRLTSLYRLAQDRADPPKAGADPEA
                     LARLAMVMADGIMVRRALSPDFATGPVIDAMLTLVGAALDGRFDPTTTPESDR"
     CDS             469012..470241
                     /codon_start=1
                     /gene="acrA"
                     /inference="similar to AA sequence:RefSeq:WP_015930565.1"
                     /locus_tag="Maq22A_c02310"
                     /note="29d0033"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="RND transporter MFP subunit"
                     /protein_id="BAQ43946.1"
                     /transl_table=11
                     /translation="MTRPRRRAGIPALTLAAALAATSAAVPALAETAPSAPVVAAAPA
                     PAVTVAVAAEREIVERAVVTGSLVPRDEILVSPEIEGCRITELLVEEGDRVAKGAVLA
                     RLSREMIDTQLAQNAAAIARAEGAVAQARSTIVQAEAAQTEAALSLERAQSLMKTGNG
                     TAAVLEQRESAAKGADGRLSAARNGLAIAQADLAQARAQRTELDLKLARTEIRAPEGG
                     IVSRRTARVGATASASGEPLFRLIARGEIELEGEVPETGLARLRAGAPASLDLDTPDG
                     PVSVSGRVRVVYPEIDRATRLGKVRIKLEADPRLRIGAFARGAVEAARRTGVAVPLAS
                     VVYGPSGPTVLVVSGERVELRSIRTGLSAGGFIEARDGVKAGDAVVARAGSFLRDGDR
                     VRPIYPAMPATAEAGRP"
     CDS             470347..473448
                     /codon_start=1
                     /gene="acrB"
                     /inference="similar to AA sequence:RefSeq:WP_015930566.1"
                     /locus_tag="Maq22A_c02315"
                     /note="29d0034"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="ABC transporter permease"
                     /protein_id="BAQ43947.1"
                     /transl_table=11
                     /translation="MRLNVSAWAIRKPIPSIVLFLVLGLLGLVSFRSLPITRFPNIDI
                     PIVSVTVTQAGAAPSELQTQVTKWVEDAVAGVKGVKHIISSITEGTSTTTIEFRLEVN
                     TDRAVNDVKDAIAKVRMNLPRTIDEPIIARVEIAGLPIMVYGASAPAMTPEDLSWFVD
                     DVVARQIQGLRGVGGVERLGGVAREVRVTLKPDRLLALGITAADVNRQLRLTSADMAG
                     GRAEVGGQEQSIRTLAASASLDTLAATSIVLPGGRKVRLDDLATLSDGAEEPRTFARL
                     NGQPVVAFAISRASGASDASVGEVVSKKIEELGQTYPGVRFDRIDSSVTNTIGNYESA
                     MHSLMEGAALAVLVVFLFLRDWRATLIAAVALPLSVFPTFWAMSAMGFSLNAVSLLAI
                     TLVTGILVDDAIVEIENIVRHMRMGKSPYRAAIEGADEIGLAVIAITATLIAIFAPVS
                     FMGGIAGQYFKQFGLTIAAAVFMSLLVARLITPMMAAYFLRDHGHHEEREGPVMRVYN
                     RLVLWSVRHKYVTLVVGLALFAASILSTSLLPAGFLPKEDAARTLMVVELPPGARLED
                     TIAVTDRIAQRIRTLPEVRSVFVDGGRQLPGKKEVRLATFTINLTPKNARARKQADVE
                     AAIMDLMRDEADVRYWSLREGGQRDFTLIVAGGDTAQVTEVAEKMQREVATLPNLVNV
                     MSTAPLDRTEVRIRPKPGVAADLGVSTDTIAETVRVGTIGDIGQNLAKFNATDRQIPI
                     RVQLPMALRGDLSALESLKVPAKNGASVPLAAVADISLGRGPTAIDRYDRAVRVALEA
                     NMQGSDALGEQIKLAMNTPTARNLPPGISLRQTGDAEVMGEVFEGFALAMGAGLMMVL
                     GVLILLFASFFQPLTILFSLPLSIGGAILGLLVFNRPISMPVVIGILMLMGVVTKNAI
                     MLVDFAVEEMSRGVDRVTAITQAGAKRARPIVMTTIAMAAGMVPSAMAFGIGGEFRSP
                     MAIAVISGLIVSTLLSLLFVPAIFLLMDDLSRLMGRLFGRFVGAVDEPPGHEGAQRPA
                     AAE"
     CDS             complement(473907..474893)
                     /codon_start=1
                     /locus_tag="Maq22A_c02320"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43948.1"
                     /transl_table=11
                     /translation="MPEKKYQVFISSTYRDLIEERRDIARSVLDLGHIPAAMEYFPAM
                     DQEQLEYIKLIIDQCDYYILVIAGKYGSVDEEGTSYTEREYDYAMSKGKIVLGFPIAN
                     IDKLPRDQTETTQDAIDKLDKFKSKLMTGRLVRQWQDRQGLELAVVKGLNAAFSRFPQ
                     EGWVRTPENSNERLLNEINDLRKENKRLSQQINDLQSSPITKISNLAGFDDIHELIIR
                     MRDRFGGDSRDISLEMSWRQIFRVFGMCIQTYPVRNYTKEALPKMLISSHSYNGSEPT
                     LPKIYTMSQEKFEIIVGHLIAMGHITEDESGKFLLTPAGRLAYLDSLAVRKE"
     CDS             complement(475093..476607)
                     /codon_start=1
                     /EC_number="4.1.3.27"
                     /gene="trpE"
                     /inference="similar to AA sequence:RefSeq:WP_012335099.1"
                     /locus_tag="Maq22A_c02325"
                     /note="29c0042"
                     /note="with component II, the glutamine amidotransferase,
                     catalyzes the formation of anthranilate from chorismate
                     and glutamine; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /product="anthranilate synthase component I"
                     /protein_id="BAQ43949.1"
                     /transl_table=11
                     /translation="MLVAPSPEAAAAAYAEGRPVLLRITLVADLETPVAAFLKLKAGR
                     DGAAFLLESVEGGAVRGRYSMIGVDPDLAWRCADGRAERAVAPDLAAFAPEEAAPLDS
                     LRALIAESAIPAEPGLPPMAAGLFGYLGYDMVREMERLGPAHPDPIGVPDAILVRPTV
                     MVIFDAVRDEIALVAPIRPVAGISARAAYERALARLEAAADALEGPLPVEARQNPAEI
                     PTPIQVSNVAPDEFHAMVARAKEYIAAGDIFQVVLSQRFESPFGLPALALYRALRRVN
                     PAPFLCYLDFGGFQIVCSSPEILVRVRDGAVTIRPIAGTRPRGATPEQDRALADELLA
                     DPKERSEHLMLLDLGRNDVGRVAEIGSVRVTDSFFLEFYSQVMHIVSNVEGRLDPRHD
                     ALSALAAGFPAGTVSGAPKVRAMQIIDELEREKRGPYGGCIGYFGADGQMDTCIVLRT
                     AIVKDGRMHVQAGAGIVHDSNPASEQQECINKAKAQFRAAEEAVRFAAQARRGQ"
     CDS             complement(476612..478516)
                     /codon_start=1
                     /gene="surA"
                     /inference="similar to AA sequence:RefSeq:WP_018261254.1"
                     /locus_tag="Maq22A_c02330"
                     /note="29c0043"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="peptidylprolyl isomerase"
                     /protein_id="BAQ43950.1"
                     /transl_table=11
                     /translation="MLQGFRAASQSWLGKIVVTVVFGLLIAGLAIFGIGDIFRGGGSN
                     AVATVGSTQIPAEALRTAYQNQLQRLSRQSRRPITPDQAKALGLDRQVLAQLITEASL
                     DQKTKDLGLRIPDSTVVRLIQEEPAFKGTNGAFDVNTFRDTLRQAGLTEQGFVQEQRA
                     VAARLQLADAITADLPVSLAAREAIHRYTSERRAAATFTLPDSAAGEIPAPTDEQVTT
                     FYTERKGAFRAPEYRSVNLLVLDPATLAKPDAVTDADARARYESEKTRFGTPEKRSIQ
                     QIVFPNDADAQAALARIRGGQATFDQVATERGLDAKALDLGTFAKSELFDPAVADAAF
                     AAEANAVSEPVKGRFGTVLLRVTAVQPAARKPFEEVAGEIRAEVALDKARDGLEKVHD
                     AIEDQRAGAKPLADIARDQGLTLVSVPAVDAQGRDPQGKAVEAIPDKDATLAAIFRSD
                     MGADNEALRTRAGGYVWYDVTKVDPAHDKPLAEVRDAVTAQWKADEVARRLAAKAREA
                     TERLDKGEAIEEVAKSLGQEAKTVTDLARGRGRDGLSAESVARIFATPVGKAGTAAGD
                     DTARAVFRVTNAAVPAFVPSAAGAVAVEQQYRTALADDILAQYIADVQKQAGVSVNDA
                     AFRRAIGGEY"
     CDS             478679..479440
                     /codon_start=1
                     /gene="tpiA"
                     /inference="similar to AA sequence:RefSeq:WP_012335101.1"
                     /locus_tag="Maq22A_c02335"
                     /note="29d0035"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="triosephosphate isomerase"
                     /protein_id="BAQ43951.1"
                     /transl_table=11
                     /translation="MTTERPRPLVAGNWKMNGLQASLAVAEAVRDGLDAGLAARIDVL
                     VCPPATLVGATAAALKGSAVQVGGQDVHAEANGAYTGNVSAEMLADLGARYTIVGHSE
                     RRAYHHESDADIRAKALAARRAGLVAIICVGETREEREAGRTLEVVGGQLAGSLPDGA
                     TAADTVIAYEPVWAIGTGLTPTVDDVAQVHALIRKELEGRLGAEGAKLRILYGGSVKP
                     SNAAELMGVANVDGALVGGASLKAEDFLGIAAAYR"
     CDS             480332..481351
                     /codon_start=1
                     /gene="araC"
                     /inference="similar to AA sequence:RefSeq:WP_017487324.1"
                     /locus_tag="Maq22A_c02340"
                     /note="29d0036"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+. Start codon location
                     was manually corrected by using GenomeMatcher"
                     /product="AraC-type DNA-binding domain-containing
                     proteins"
                     /protein_id="BAQ43952.1"
                     /transl_table=11
                     /translation="MPDIEASGRQTVSLRFSTDLAAPSGQCGFEAYHDLYATAADAVR
                     LDETFAVAVTAERLGGMILFDRQLRGVAHARPRRRALRNGFDHFTAQIVLDGALTVGT
                     PNGSRIVGPGECALIDMSQPMETRASQARVITLSIPRDVIEVAAPEPGRLHGAVLPQD
                     RARLLTGFLHAVLDELPRHGASDRQRLERVTAELLALTLAGHVPPASDAVRTASAAAC
                     RRRARRYIDAHLGTTPDDVARAVGVSRSVLYRAFEASGGVARVIRSHRLARLRALLAS
                     PDECGRISDLSRACGFSSESDCSRAFKAAYGVSPSDYSHLRRAESSPGAASPQGLAEW
                     WDDLR"
     CDS             481736..482113
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018264138.1"
                     /locus_tag="Maq22A_c02345"
                     /note="293c0013"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43953.1"
                     /transl_table=11
                     /translation="MPVLDIPSIPDTVLSWSRGFASLSPGVVPCRGLRPDEWRETHRL
                     CGEFVERWGMQAHAAGWDTLRLFGVHPELGTIRGDYSGILVTLSVEIHEVTPEWIKLG
                     RWTAYRHEPVKMPGMVPIWGTKR"
     CDS             482110..482352
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015930472.1"
                     /locus_tag="Maq22A_c02350"
                     /note="293c0012"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43954.1"
                     /transl_table=11
                     /translation="MTGGEAYKQKLLTDDALDAAIGAYLADPSKPVAVEVGKGSIDVA
                     AAVMAHAYTVEVLAREGVTGPQQRNAVKTAILLATV"
     CDS             482894..483103
                     /codon_start=1
                     /locus_tag="Maq22A_c02355"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43955.1"
                     /transl_table=11
                     /translation="MKNKENDIAEIGPGETKLIPCNITNLGSEIKATMEISGTYKTLG
                     ITRALRKKHFNWQKDAVPPRWIEGD"
     CDS             483119..483232
                     /codon_start=1
                     /locus_tag="Maq22A_c27780"
                     /note="293c0011"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47062.1"
                     /transl_table=11
                     /translation="MPAFYPALTVALVLACAWAAVAGLRRAARRLDERSGR"
     CDS             483322..483522
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02360"
                     /note="293c0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43956.1"
                     /transl_table=11
                     /translation="MAAHPPTDPQPLEVIARELHEHARQRVTWWPAWEDLDMTDPFEA
                     GLIRSAYDRARAFVEMNGGDVG"
     CDS             483519..483878
                     /codon_start=1
                     /locus_tag="Maq22A_c02370"
                     /note="293c0009"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43957.1"
                     /transl_table=11
                     /translation="MRRGRNPRRAYDEAGREIVPPTVGDMRAQGDITAAVTCHGCQRR
                     VVIPTDCFPTDLPFPDIALRLVCSTCGSRDVGVMMDMQAHYARLTAETGWVMEVKPWP
                     KVGPNTEKRPEPEPGAC"
     CDS             complement(483901..484251)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02375"
                     /note="293d0043"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43958.1"
                     /transl_table=11
                     /translation="MTSRAAAEPLEGAILLPKRLPLLAVVGGLAFLGAQFVGAGVYMA
                     KIDSRFEVLADSDSRITKRSDERYSAIVERIASLERDRNDTSGRLIRLEEQLRMSVDL
                     LREIRESMRAPPRR"
     CDS             complement(484256..484672)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_017483392.1"
                     /locus_tag="Maq22A_c02380"
                     /note="293d0042"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43959.1"
                     /transl_table=11
                     /translation="MGLLNWISNPIGAALGTIGGGLIKVFGSSVLGPILATLQNGQNA
                     QRDVAVQVVQAELAANQAKAAIAPAFKGLIYGIGIPPTVHFGAICLSATFDLGWPVKD
                     LPAAYVPIEATILTAFFVSSPLTTLARAGAARLLKA"
     CDS             complement(484672..484926)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_020094959.1"
                     /locus_tag="Maq22A_c02385"
                     /note="293d0041"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43960.1"
                     /transl_table=11
                     /translation="MLRRSVFRARLRLHRWFAAAKGYRIYLLALLLALPDMLDALAGV
                     DLTPFVPPGYSAKVASGLAVARILVGIYIRRLPPPPPGAR"
     CDS             complement(484930..485658)
                     /codon_start=1
                     /locus_tag="Maq22A_c02390"
                     /note="293d0040"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="putative transmembrane protein"
                     /protein_id="BAQ43961.1"
                     /transl_table=11
                     /translation="MDKTVPAGAALLLDFIASKEAPEGYGTVYGNNQAKLAKPLTSMT
                     LAEVIAAGPGWTRLFGSSACGRYQFMKATLEGLRDELGLTGREVFGPDLQDRLGYHLL
                     KRRGYEAFMSGSLSTAGFGLKIAQEWASFPVLAATKGQKRSVSRGQSYYAGDGLNKSL
                     VSADAVEIALSKARQAGNAVPVGVPPTLATVPPPTVPRIAIALEPAPTGGLVRSGVQA
                     TGGAVRSGLAGLYDAIHRALARKV"
     CDS             complement(485816..487666)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02400"
                     /note="293d0039"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43962.1"
                     /transl_table=11
                     /translation="MRQGVADLMTRAQVDAYVGPSGEILSDGETLRLHDGAAPGGNPL
                     ATQAQVPGLSADRSGIADAGGDLSSGLAKLAAAGGGRPRLPRAGYRLVSPLVMREATC
                     VEGQGSSPSSYAGQGTVFTVTPAASNGLVGPTSGAVHTTGLRDFTIDARALRSGGAAV
                     RAGFLESRFSNVKIQGAGSYDQGGYTANTIGFHHVATAPSWINWSKDMLIGGFAVGKR
                     MEGSDSLDTGHYISGNQIGYQVAKSTASLRTGHMMIDLSSGAGMDIQAPDQTDASGNA
                     LPAASAGTHTGHIFHFNNLHLAINNLTWSTPADFLHAFSGCVFHYGKVAGSPAVLTSS
                     NARGLTFAGCIFYQNRGADFQFGPNNSGHTLHFSSDQAPNDRIIGMPLDSHVLSGGIG
                     GQYNYLNSLILNSPGNPGGKIQETRLAVYGNDGVLSASGVSARFGLGRDAAGFDAALL
                     AGNDNGNAPYLDGCDGERTTAAQFVIKFRHTARLTMDAVGTLVGGLLSALTSNTVLGA
                     TNVVARFGLGKNIAGVDAAMLLGSENGNTPFIDIANGEQTNAAGFNVKWRHSARFGLD
                     GTGNFKVVPQVTATPEQNGDLVLEKTSDTVIKIKVRGSDGVVRSTTLTLS"
     CDS             complement(487690..488532)
                     /codon_start=1
                     /locus_tag="Maq22A_c27785"
                     /note="293d0038"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47063.1"
                     /transl_table=11
                     /translation="MIPTSASPAASVDVRGGTGVRVDRVGTSTVVSMSDTVLTTGGSG
                     PDFTVTSADGKIRLFDGLSLLLRMDRAGPNAPTLVVDGSPRAPWRDANGSPLADGALQ
                     RDSLQRVVYDATRGMFLGTQLGGPGTTGVTPDFTGTLAQRGAYDSQPAGKTFLAVSDL
                     PTGPEWTFYIKQSDTLGDWSAGLAIKASPAQTTVEAQAAADAAAAQKALAAQQAAAAA
                     TSQAVAAERAGVSAAQAQIAFTQANAATQSAGEARDIASLVGIQIYDFSFDSAASSSD
                     DWSV"
     CDS             complement(488551..488922)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02415"
                     /note="293d0037"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43963.1"
                     /transl_table=11
                     /translation="MAFLNAMGAVSRHGQWRLQRVLRSILPDGRVDASDAGLIDFSAA
                     SEILLQVVPRQPRGNHDPHPVLAASAVAGTLVVSNPGVVEALFPLGWSAHVPAGVYDV
                     RIWMTVGPETALIFDNPVELR"
     CDS             complement(488926..490098)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02420"
                     /note="293d0036"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43964.1"
                     /transl_table=11
                     /translation="MTISWPFSRQQVLDANGRPYLDLRANFFASGTTNPLTVYSDPGR
                     TTARTQPVLADGNGRFPRVYLPDGQYREQVLGPGGAELWFDDGLGEPVVTDPTDPTDP
                     TTPPDANSYARTGDVKWRMDASIQPGWVRLNRGTIGNASSGASERSNADAAALFIYLW
                     TTFPDSLAPVVGGRGLSAASDFAAGKSIALPSMQGRLAAGLDDMGASPAQRLQTIANL
                     DIAEGSTRAQASNTANLALGMSIIAPGLSAGTRIADLDGATVTLSQPAGAGSTGTVQA
                     RFSVLDDAQSPGQDGGSALVTLQAKQVPKVTPSGSISPIPAHRHPLVYQRLSVYGGGG
                     ASGAVNSIGNEAAQHDDAVTSEAGGATPTFTGTPFGGDQAHSNLPPMRLGTFFMRL"
     CDS             490282..490731
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02425"
                     /note="293c0008"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43965.1"
                     /transl_table=11
                     /translation="MLVTVVVVAGLVAGCQSSKEKQIEAATSSLQAAKVKCDATPFRT
                     SVERARCANTAEETFLVPVFPDSDLVRLKMAARMSLAEKVDARQISQADADLEMARVT
                     SQGVAETERRFNQRRSIAAQENLAASVRRATTSPSLCAGGPNVVGCI"
     CDS             complement(490693..491007)
                     /codon_start=1
                     /locus_tag="Maq22A_c02430"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43966.1"
                     /transl_table=11
                     /translation="MVRRRATARPARKGSPWSFACEPRNSRASQSQALTITAVKKAVK
                     ITAITNATAHIAGVPAGGLGFGSSIPAVTQVRPAMQASCPIFQIAPEALDAPDDIRPP
                     GT"
     CDS             complement(490931..494233)
                     /codon_start=1
                     /locus_tag="Maq22A_c02435"
                     /note="293d0035"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43967.1"
                     /transl_table=11
                     /translation="MPGLFDDVPDAPQASALAPSPRRGGGLFDDVPDAKAAEPSALSR
                     AGAAASDVVQSAGAGIIRGAAGLVDLPQTLAGLADAGAGILARGAIRMAGGTPASDQG
                     VDVSSRSVIPPVANLPRAGDAAVHGLEEATGKLYEPQTTAGEYARTAAEFIPGAGRSI
                     AGIVKNALIPAVASETAGQATKGTAAEPWARGAAGLAAGVGAAAAGRRSAAERMFDRS
                     FGTVTPEEYGQIQKLVDDAAGLRAPDGTLTPIDLSWPEAAQQILGPRRAGDLMRIVEG
                     QGGLSEFFARRPEQIRAAGHAGLDTIAPAGAAPTQVGEAARSAAQSGMAATPEGQAVI
                     RATQAVGPRVTPAQAGAVIQREMRGVADAREAKRAEQAARDYPAARDAPERAGVERTV
                     TVERPGEPLLQTIDPGPAPPPRFDAPIDGGPATIGSLAPQRQPAPPRDPGARSLSRYI
                     AENGGIGLERGDVKAAGLDRWKQPGVGSLVRTEGGKSIDSFWREKLIEDGYLPPDVDG
                     GAARNIHDELLGLLQQEQRGQKVYPYDWSGSDERSGFSRLRDQHQDAAGRAMSDIRAS
                     LTESGVDPKTMHKDVLDRAAAALMRGDALDPLDAVEAAVRAAREPAARPTSRMVPTTV
                     TEEVSAPRFGQVDPQPAIDALDWQIRTAKGDVRSALEGIRRDLYEYGTDPVSGIRETD
                     MTVEGLLHARERIDQHIAAAQEAGDRTKIRDLEIVRSSLDDQLKGVPEVAKADAGFAA
                     NSRPLEPFAGNTPLGRVTARDDLTKRMQTPAEQVPGMVQGATAARELLANATPEARRA
                     FSGREVTRILDEARGGEGGLSAVSIRSGMQRNEDVLAQLPEAQQSLARLARAYEGRAL
                     VEKSPLGRIARAPHVEAAIDALFPTKTTSGAAQEVTEAVRRMATSNPAAARDLVRMHL
                     ETEFGAAKQQRATGPDQKRGAYYAARLRGNEFQQQNIEAALKALPNGEAINVGFSRLL
                     DILEATGQRQGVGSKTAFNTEALQDLRQGGAAVEAGKMAATGGLKLPTRIKDALDRWQ
                     LGENTDELARLMTSPEGGRRLAQLASAKPGAATIALLNRLTALAARGAQTGDRPARPE
                     GEPLELRVRAAQ"
     CDS             complement(494246..495514)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02445"
                     /note="293d0034"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43968.1"
                     /transl_table=11
                     /translation="MSGGLWDLIGSPRRQPTGGRPLGDMAAAYLGEEVPAGLAPGQPP
                     VDPRRDGSVQPTAAGRKLSGAIGAAAGGMAQGLLDAAKLPGDVYAGRVDPMSDEGIQR
                     AGDLAGFAMTGGIAAPAKASGEAVLGSGPIRAYHGSPHDFDRFSLAHIGTGEGNQGFG
                     RGLYFAGDERIAKSYRDDLSKVPVLKFDGDASGLNIATPQNARDLAAFGFDTGGGNLD
                     AGLGNIRMIAEFDPRLAPFADEAALHLRDGRVALGPKSPGHMYEVGIDADPARLLNWD
                     TPLSGQSPAVRSFAADRLADPQVRAAIETTARQRLGGPSEATGRDLYRGMAGFDGATA
                     AAVSADMRAAGIPGVQYMDTGSRGFGGGTQTRQYVTFGDDLVSILRKYGVAGAAGAGG
                     AASALAPGDAQAAPSPQTLDTIADAYLGRR"
     CDS             complement(495511..497802)
                     /codon_start=1
                     /locus_tag="Maq22A_c27790"
                     /note="293d0033"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47064.1"
                     /transl_table=11
                     /translation="MSAGASVYQMVTGLGDAFSKSYGEARRQAQEDEAPGLIANLIGT
                     YQGGAAAGPGALPAAAPASGQPAGKLPAFAGGDASMRIPATGGPLETRFVDALKAGGL
                     TNPAGLAAMTAYANRESGFKPSAITGSWSDPSESGQPGTSGGILSWRGDRFANMRRFT
                     AGAEDPVTAQAKFALTENPNLTQALQNAKSAEEANSLMANAWRFAGYDRPGGGEHAAR
                     LGTTRTYLARLGGAPAGAEQVAQQAPTRQLPAPATAAVAPASLAFARPIGPAMTMPDA
                     PAQQAATPESSAADRPAPGARPAGFMVPGQDAPTPSAAPIAAPQTAAQGFAGFGAPAS
                     RVSPQMQAALTAAWRNPQTRPMATAIYGQMLKGQDSAWKLSSMGDQPVLFNERTAQIV
                     PVGQAKRQTATVGNTVIDTATGQPIYRGEQDPRTATVGNTIVDLRTGQPVYQGEKDEK
                     FTYQAMPGVGMVALHPTDPSQSRVIIAGQQPRPFTDAEMQAWRVPQGVGGGMGADGKP
                     FTLGAAPKTEINIDNKGAGKFAEKANELQAKRYSEMVEAADNAVPLRADIDTMASLGE
                     QISTGKLAEARLGLAQYAKAAGLDSVANGLTAGKMGEMEAYTALADKITPRMRVPGSG
                     STSDAEGRAFKNSLPSLLKSAEGNRIIVDTFRGLADYQAQAGDIAGRALRGEISQAEA
                     DQGIRALPNPYSRFREHQGKQPGAQGSGGLPKEGDRTRIPGGMSPAAALAEAKKAMAS
                     GKDPAAVRARLRSWGIDDARLDQ"
     CDS             complement(497807..498526)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_013946884.1"
                     /locus_tag="Maq22A_c02460"
                     /note="293d0032"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43969.1"
                     /transl_table=11
                     /translation="MASIFSGKAGRQAAMFQAGQIQKGIDQGNEALDQGYDRAVDGYG
                     RAATTFGNLADSYGSGSKLYQDALGVNGQGAADAARGKYQTSAGYGFNMDQGLQALQR
                     TRAVNGTLASGNADTDAMKFASGLASQDYGNWLANLSNLDTKRFGATGAQAGSYGQIG
                     AAGLTTGGAKANLDYQGAVGIGNAGAQGLMAGQQAAQNRFGLMMGGLNLFSQAAGSLA
                     GNGNALGNIGKNLGSAFSIFG"
     CDS             complement(498676..500103)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:YP_007518349.1"
                     /locus_tag="Maq22A_c02465"
                     /note="293d0031"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+. Start codon location
                     was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43970.1"
                     /transl_table=11
                     /translation="MLMADISFPTSSRPGLSASEGAGRLINASVEKLGDGARGPVSIR
                     RSAGLARFADTDRYGPRGFLTVGGVLLAAYRDRLVRVTADGTATDLGSLPGSRRVTFA
                     RNNRTPVPNLVAVTEYGPFVLSIDTAPAPLVIPTGLPTPNSCTFLFGFLFFTAGNGAC
                     FASGLNTTTFNTLDTTVEQGRSGGLLRAVAFRDELFLFGPSLIGVYGGQAQANGFPLG
                     RITGIPRGLIGPWAVAGHDEGWSNELIWVGDDAVVYQLKGYSPDRISTHDVERDLAAA
                     AAVDPAAIEASVHLVAGHAYWVVSMPARTWVYDLTTQQWHERASHEAARWRGSCSVKA
                     FGRWLVGDSLGTGLLEVREDAFTENGAPLRMRVESLPGEAFPSRLAIPRADFDYVVGQ
                     GRLSADPTVRDPQALVSWSDDGGANWSSPLARPLGRQGESRARVSVLRTGMTGVQGRT
                     WRLDVSDPVYCALLGGAMAVEERTE"
     CDS             complement(500097..503447)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02470"
                     /note="293d0030"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43971.1"
                     /transl_table=11
                     /translation="MATRQDLIALVLENLGVLAAGQSASAEDREAVNRRIDPKLRELE
                     RREVFAGLNADVLDDAVFLYVGDIIAAACRTPFGITGAKSDQLAKAAGEAEAMLKSMA
                     RQFNAGASTAAYDIVQDVLEQLGVVTPGQAPTSQDRGVVSARIAPMLADLRQREIIAF
                     TDLASADAAHRRHLTTILVASCAPAFGATGAALAPLVDAARAAEVALRAVVRQFDTGT
                     GTSGTFSVAQTVLELLGVVEGGQTATAKDVAVVSARYAPLLADLRARHIIDLPSIDGA
                     DPSTKHFLATILASRCALLFGAEEPVLAGLRAEEARAESALRAISRQLDTGIGTGSAL
                     DAPQSVLEILGVVSAGQSASPKDRAVVATRLPAIFADLRDRQIITVTDFAAASPSVQP
                     HLITIIAAAVAPLFSVEPALLQTLGAEAVRAEAALRIISRQVDSGVATAGAFDLIQVT
                     LENLGAVAVGRTATDKDRSIVSGRVTAVLDDLRQREVISIPSLAGAAPSTLLQLSVIL
                     TSACAMAFGIPAEVRGQLRADAERAEIALRAQARQLDSGSATSGTFDLPQVVLEALGV
                     IDAGQTASAKDRAVVSARIAPVLADLQAREIISIPSLDAAPDAVKVALSVVVTAACAP
                     AFQVEPAARAVFEAAAAKAEVDLRAMARQFDTSTGTAGTYDLVQSVLEMLGVVSGGQT
                     ASAKDRAVVAARAPVLLADLRDRDIIALASTDAAAPSTKLHLAVLLAARCATLFGADA
                     AMTQSLKAEAALAETALRRIARQIDTGTATSGNFDPIQSVLETLGVVSAGQTATMRDR
                     AVVSARVAPMLADLAQREIIAVPSLAAADAATQIHLSAILALTCAVPFGVPAEPFQAP
                     AAAAEVSLRLIGRQFDGGVATSGTFDVIQAVLENLGVVSAGYTGSAKDRAVVSARVGP
                     TLADLRLREIASIASLDAADPGVLIHLSAILTSVCAQAFGKDATLRALLAGEATKAET
                     ALRALARQLDTGSATSGTYDVVQATLEMLGVIEPGQTGSDRDRAVVFARVQPKLMELY
                     GRDICGVTDLSQLTPELQGAFARCLAADCLLSFPAVPASRAAMLLGMVPAAEQVLRWQ
                     SFVYDARPPLRVEPFWGRRHCRPDPGAC"
     CDS             complement(503454..503978)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02475"
                     /note="293d0029"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="chromosome segregation ATPases"
                     /protein_id="BAQ43972.1"
                     /transl_table=11
                     /translation="MDQTNRTWGYRPTGEAKIFDLALGAPLPEGWEASPACITDPALA
                     TAEALTAAAEGRPYAAPLEAAPIATSHPLAELEASVAEIERLKAIIAAGTEENARLVA
                     EIEQAEADLDLTAKDIIALRASLEQAQRDGGFAAEERDAAKADLDALGQELARVRADL
                     DTATAPKPAAKAGK"
     CDS             complement(504071..505330)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015951870.1"
                     /locus_tag="Maq22A_c02480"
                     /note="293d0028"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43973.1"
                     /transl_table=11
                     /translation="MPNTFLTNSVIAKMAVKILDNELVAASKVHRGYEDEFASQVNGY
                     KVGASVTIKRPPQFQVRDGAVASPQTITEGTTSVTVDKMKGVDLQITSTDRTLSIGEL
                     SERVLKPAMVSLANQVDQDVMGLYSSVANWVGTPGTTLSSYPAFLRGTTRLNNGSVPK
                     DSRFCMLSPDDESGLAGAQSTFYSDKLVNEAYREGGVGRIAQVDTYMSQNVPVHVTGT
                     RTNGTVNGANQNVTYTQVLANGVAVKDFGGQILNVSGLGAGATVAKGDVFTIAGVFAV
                     NHVTKQQLNYLRQFTVMSAAVADGSGNVALNIHPAIIAPAPLPNGAFTTVSAAPAAGA
                     AVTWMGTANTPYVQNIMAHKSAFALTCVQLVKPDGAVDCVRESYKGLSVRMIPYYDGA
                     NDISNMRLDILYGVKAVDPRLGLRLNG"
     CDS             complement(505355..506218)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_020850871.1"
                     /locus_tag="Maq22A_c02485"
                     /note="293d0027"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43974.1"
                     /transl_table=11
                     /translation="MDEDLIVLGAPAETQAAGSETSENAASQVDSHPAGGEGEAAAPG
                     TGSAEVVAPEAPEGGKPEGSPEEPKPRPKRTGIERMRDRIARLEAENANLRSAPSGAG
                     EDRKAALEKEIGAAPKEADFADFMEFEDAKADYRVRKALAEQRLADREVQTSRTQYAA
                     RQEAVEAFQERMDEARDRIPDFDRVLNEAKGREVAPHLTDLIVESEKGALLAYYLAKN
                     PAELQRLNGMGERQAAKAVGALEHRLTLAKPKTATKAPAPARPVSGGAAPSSPDAEGD
                     AWLAKTYGRRG"
     CDS             complement(506571..507974)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02490"
                     /note="293d0026"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+. Start codon location
                     was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43975.1"
                     /transl_table=11
                     /translation="MPGLKPGDPAGNLTTLGAGPVARTLEARARDAVYLADYIPLVEQ
                     PAIAAGTSTYDVTQWIAKVMADGYSEAILTPGLYNVCGHPAPRSNFHLRGVDRSTVTL
                     KQCAGSGGAAMIEGPGGVVANGAIVSGWLDNFTISDVAVDVGWVDTGLRFRDARNLRV
                     SRVDFKRCQYWCLVVGSNPALDTTTAITSERIRIEDVTADGAALTYGQFLVYNARDVA
                     VTRSSFKNGRTGAIGIEIWQNVHGFSCDHCSFGNLTIGAYYSETSRDIRFLNSTFVGN
                     GGGLQGSQSSDHGNFGSLNALNLIVDSSLFEGNDVAQSIGATIGAKISNTTYRANKNA
                     LKFYGGSVVGGKQPATNVTLSAVDFVNNNIENNLFALHAPIVFTEIGGALNLTLRDVN
                     FYDTRTGSETQQCAMSFFGGFNYANIQIFGGNLNTYNNCPTFNLQEGSTISNVHIWGG
                     MNRRTADTPAPPNVTVH"
     CDS             complement(508089..508334)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02495"
                     /note="293d0025"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43976.1"
                     /transl_table=11
                     /translation="MPGPSQPPCVAARPITPGTIVRAGRGVVIACSAAGNVRLVMADG
                     SFLDVYAGVGTAEFFGYAVVGVDGPGTTATAKVTVVE"
     CDS             complement(508361..508882)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02500"
                     /note="293d0024"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43977.1"
                     /transl_table=11
                     /translation="MKVRGALYLFAALIGGAIAASAQSSGFNPAPVPSPSAIMPPATG
                     LDGMLGTSTQYARADHTHAVRVQRVARTTAADGTLTWVFARSIVVPSGETPPLAYMVE
                     DTGSPVVVQVTGRTFTTAGGQDTHTAVTVRAQRARTLPATLTVLTALVGYDVFAGGAS
                     GVRVNLWAADPTQ"
     CDS             complement(508879..509766)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_003307903.1"
                     /locus_tag="Maq22A_c02505"
                     /note="293d0023"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43978.1"
                     /transl_table=11
                     /translation="MIPMKLTTLLRAALVVCLFAPAAVMAQTPIGALAVDGIVPAYQL
                     NGFGPVTVDRATGGLRVLCVGGCAGGSGSTGSVTAPGTSGSQAQAVQGINGGVPLPIS
                     AASLPLPAGAATAANQTASTAAPGSVPSLLVGIQGGGGNAIPILTSAGQYLASLLTRS
                     DGQALALVTDLRGQAKISETGSSDPLVGIVPAVTQAGTSVVGKANQGNLYSAYAVNST
                     TTAGYLACINATAAPAAGAAITPVDVATLAGTIGATATLNYGAGPPNGYSTGIVCLVT
                     TSLTTYTAGGNAFMQARVR"
     CDS             complement(509763..512108)
                     /codon_start=1
                     /locus_tag="Maq22A_c02510"
                     /note="293d0022"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43979.1"
                     /transl_table=11
                     /translation="MAKKQPRAVERPASLPAEVEERPERPADPRAADHAKVVDLAMKR
                     WRRADPADRENRDNAYADLEFLEVPGAQWGEDAKRARADRPCLEFNRLPTTIAQITGD
                     IRQMRPAIKVVPVDSRGDPDTADVIAGMVRYIENRSDAASAYFSAADQQVACGIGHWK
                     VTTEYGSDSTFEQEIRITHVPDGIGVRWDPDAVLPTREDARFCFVPVDMSREVFEETY
                     PDKPAAEIGDGVLHQQGLSEWSTADTVRVCEYWTKTPVKKTLALMPDGEILDLTDKTD
                     LQAYDERFERAQVAGARIEVREGHKVERYIISATDVLEGPTPWPGRFIPVVPVIGIEM
                     QVGKRRYRRGVVRLAKDPQRAYNYARSTQIEVVALQPKAPFTGTATMFKGYEAVWETA
                     NTVNHPFLPYNPDPMAAGAAPQRVPPPVPSAGLAELTRDASEDMKAVTGVYDASLGAR
                     SNETSGKAIKARQQEGDVGSFVYIVNFSRAIRHTGSIVVDLIPHIYDTARTLRIVGED
                     GKVDLVSINQPEGLADDDVAERIQNDVTVGAYDVAMEMGPSYTTRREAALDGMIQLVQ
                     AAPQLAPMILDLLAKAQDWPMADKIAKRIRTMLPPQIQAEEAQESGEPPPAPPPPSPQ
                     EQAAMAQQQRQQQLEEGRQQLDLAKLGLEKDKLQADVMKIQAELQKAHIDAEARAIEA
                     SRPPEPQAAAAPAASTAAPATDPRLDAITEAVQQLGAVVSMILEEMAPPEAPPPGPDG
                     LPGADPQIPGDMPTIPTEAPQGAFSFDPSAMGLPAAPEMMG"
     CDS             complement(512113..513690)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_018184701.1"
                     /locus_tag="Maq22A_c02520"
                     /note="293d0021"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43980.1"
                     /transl_table=11
                     /translation="MSDRERAVRQKLKDDFEHYAPRCLRIRTKSGKIVAFTLNKAQRY
                     IHARLQDQLLATGSVRALILKGRQQGASTYIGGRFFWRTSHSRGVRTFILTHQEDSTA
                     ALFEMVSRYHEHCPSLVRPSTGAANAKELLFDRLDSGYKVGTAGSKAVGRGNTLQFFH
                     GSEVGFWPHAHSHASGILQAIADEPGTEVILESTANGVGNYFHQQWRKAERGESEFQA
                     IFVPWFWDDGYRKEPPPDFTLSTDPDEQNESEVDYAEAHGLDAAQMFWRRRKIADLGE
                     SLFRQEYPATAAEAFQMANTNGLISAKLVMAARKRTVEPSGPLVFGYDPAHQGGDRHA
                     LAKRRGRKVLSAGGPVGMSIPESAAYLRAEIDRDRPLKCFIDVTGGYGAGVYDILVEW
                     GYGTPGKGIVVPVNFGGAPIAPDRFSPTTGEKLPGPLNRRAEIWLNSLDWLEDPAGVD
                     LPDEDEIQADACSTGYTHNSRGQIQLWSKEKMRSMGIPSPDCWDAVALTFAEPVIEAE
                     PLKINIAARRGGGWQGA"
     CDS             complement(513683..514120)
                     /codon_start=1
                     /locus_tag="Maq22A_c02525"
                     /note="293d0020"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="uncharacterized conserved protein"
                     /protein_id="BAQ43981.1"
                     /transl_table=11
                     /translation="MAGNTLSDEVKTFIVQQLACFDPPSVVVKAVKAEFGEVVTPQQV
                     EAYDPTKRAGRALSEYLRALFEATRTAFLDDTAGIGISHRVTRLRTLQRLADRAEAQG
                     NIALAANLVVQAAKEVGDVYTNRQRIDASHTVRSHEDALGDLE"
     CDS             complement(514145..514777)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012322580.1"
                     /locus_tag="Maq22A_c02535"
                     /note="293d0019"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43982.1"
                     /transl_table=11
                     /translation="MILVRPRPPAELLGMLGAVTDEPFRPAPELLEWLRAAFIDEGAP
                     LFNEDHAHLQNASLGVLWCSLPRASGGNAVVGQAERLQFQGNKWSQARQAQQMIGWFG
                     CLPAFVLTFHADYADVVDDATFCALVEHELYHCGQERDAFGAPKFRKDGSPALAIRGH
                     DVEEFVGVVARYGAGNAAGQTQALVDAASKSPSIAAADVAGCCGTCGRGV"
     CDS             complement(514777..515112)
                     /codon_start=1
                     /locus_tag="Maq22A_c02540"
                     /note="293d0018"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="protein of unknown function UPF0150"
                     /protein_id="BAQ43983.1"
                     /transl_table=11
                     /translation="MAAPYFTPAERAECFGPWAERDSAAAVGTGFHVEVQHLPLADGG
                     GFVATVPELPECMSDGETIGEARANVADAIGCWLAAAWRSKIPPDMRARWATLQRQHF
                     DGLAHRLGR"
     CDS             complement(515112..515222)
                     /codon_start=1
                     /locus_tag="Maq22A_c27795"
                     /note="293d0017"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47065.1"
                     /transl_table=11
                     /translation="MPRLAAALILAGVALAALRPRPAATAWGLPISRTVY"
     CDS             complement(515222..515437)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02550"
                     /note="293d0016"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43984.1"
                     /transl_table=11
                     /translation="MREYRPVSKPPRPRGTIVVDQFDEMSIVRDLTVYEPDGDWHDTG
                     LVDSAGTRLMRRDQTGPIGFLTARLDD"
     CDS             complement(515437..515685)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02555"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43985.1"
                     /transl_table=11
                     /translation="MLTADQHARLPALLRDIVDHDRKSAQLADELFASPVSRIHVAHL
                     IRVRRETRAEMTAGARHLYGRAPLRGDTGPGRPTAVRA"
     CDS             complement(515685..516677)
                     /codon_start=1
                     /gene="xerC"
                     /locus_tag="Maq22A_c27800"
                     /note="293d0015"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="integrase"
                     /protein_id="BAR47066.1"
                     /transl_table=11
                     /translation="MPETLPVPVAPAALQDNDRVTAGRALADALDAAKAFALAEKSDA
                     TRLAYRRDFDHFAGWCCGVERSPLPAEPATVAAYLADLARSGLKASTIRRRLAAIRHA
                     HKLSGIEPPTGAEPVRAVHRGIRRQLGTRVEQKAPATAAAIAAMLKRIDATTLTGKRD
                     RALLLLGFAGALRRSELVGLNVEDLVPAREGLLIQIRRSKTDQEGAGHEVPIPHGTKL
                     KPVEAVRQWLAAAGITTGPVFVRVRRGDRPTAERLTPQSVALIVKARAKAARLDPDQF
                     AGHSLRAGFVTSALESGADVFAAADQGRWKKLETVREYDRRAKAFKNHAGKGFL"
     CDS             complement(516875..517147)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02565"
                     /note="293d0014"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43986.1"
                     /transl_table=11
                     /translation="MTLRRRFDYATELRRFAGEVDALALASRVDPEKPIVDKIALADR
                     MRARANEVMRHEDPTERGVFRAGSVFASRGGRPVRAEKRAPRQIRA"
     CDS             complement(517144..517392)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:YP_002242070.1"
                     /locus_tag="Maq22A_c02570"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43987.1"
                     /transl_table=11
                     /translation="MGSGGGEPAPHRARALTRRAFYGKTPWSAAIRPGLRAAGRFCFY
                     PSPGRSPCDPGPNPEPLRQPDRSPWETRPSLYDMIGPR"
     CDS             complement(517344..518207)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02575"
                     /note="293d0013"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43988.1"
                     /transl_table=11
                     /translation="MTAAATTSPTRKAPPLVPLRRGTSSRRERDPRGDRYDRSGAYQH
                     GAGVGRPARPEAVPTAVVAIDDPHEPGKRLFAAVNRRVDILEDERSHGRITVSQYETA
                     RQVQAVFERASGARLGSGGWGIGGSRDQTIAHELQVIYAIEDARVIKALLGRVEKAVG
                     TVGARFLKSVLADRQTFAQAAEARGKAGERGTSQVAAHFRILLEGLDEAFASRGVASD
                     IERFFRTEDTGEETDARGTVVPAGHGHAWGVDQARFADHMNEDAASLAEPTRPRWDRV
                     AANRRRIAHER"
     CDS             complement(518288..518626)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012322594.1"
                     /locus_tag="Maq22A_c02580"
                     /note="293d0012"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43989.1"
                     /transl_table=11
                     /translation="MERWLKVAFRQMPFTPIYAPRGNTLTSASTKVPSATFDMIAFTG
                     TVLGDRSEERRALLIWARAIVTEGDIGGSIAAFCREMGWKRRTFDRRRHRACLKVAAA
                     KNEMDRRARQ"
     CDS             complement(518668..519339)
                     /codon_start=1
                     /locus_tag="Maq22A_c02585"
                     /note="293d0011"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="metal dependent phosphohydrolase"
                     /protein_id="BAQ43990.1"
                     /transl_table=11
                     /translation="MPALGSIHAIARAVCTFQDRACPAGACPPCLERALRAVRAMREA
                     GMFQAASDFDAWELAESSHRGQQDKAGRPYMAHVGRVNEGVSDLLAGLLGRATHDQFQ
                     SIMQAATLHDVVEDSAVTLDDLLLRGFSDDVLDMVRLLTKPPGDTRTYAQRIEDLIAS
                     GNLGAILVKLADVEDNGDPARLALLPEDQRGIGERYRRARARLHEAATALGWRDPREQ
                     AESAA"
     CDS             complement(519396..519827)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012335942.1"
                     /locus_tag="Maq22A_c02595"
                     /note="293d0010"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="MucR family transcriptional regulator"
                     /protein_id="BAQ43991.1"
                     /transl_table=11
                     /translation="MSNENTLHTTADRDFFTAHTADVVSAYVSNNPVPAADLPALISS
                     VYAALSKLGAQAESEPVRPEPPVPVRKTVTPDHIVSLEDGRPYKTLKRHLAGRGLTPD
                     EYRKKWGLPPDYPMVAANYAAQRSELAKASGLGSTRNRKAA"
     CDS             complement(519865..520608)
                     /codon_start=1
                     /locus_tag="Maq22A_c02600"
                     /note="293d0009"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43992.1"
                     /transl_table=11
                     /translation="MSLPALSRASAVLTAPEALTAAVSRCSGRLATMPGRALRSCLSQ
                     TDAPTPAERRAMAVWRDRILVALEPCTDADMVEAVVGKLLLGFENGQQNAQATQARNG
                     EYLTALEGLPLWAVMEASDRFRTGEVLVAGWNKAFRPTPPQFADEVREGLADLRRQQI
                     QIRDILNAEILPDPDPEAVERARQAARDAIAGKLMREQQDRRRAVEAEEAERDVVLAG
                     PPIKAGALGLAALGKFLRAPFTRATTAAR"
     CDS             complement(520448..521386)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_008037270.1"
                     /locus_tag="Maq22A_c02610"
                     /note="293d0008"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="pyocin large subunit"
                     /protein_id="BAQ43993.1"
                     /transl_table=11
                     /translation="MSFQALAWARSVKTGSSTLKAVLVALASYSDADGRAFPSQDRLA
                     EDTEFTSRAVRGAIATLVERGFISREQRWRKDGSRATDLLTLNVGFVPSLNRNEVPGG
                     EGIPERRSAPPERPSTQEEPRSKPPEGRSALTTFEQPENYQKELPPESGARAGAWPAD
                     FWEQFQAAYPHLVKLRGTLRLLREIQAEGGTRFEDILDGIARYVASRPADRNWLGSDK
                     FLEDRRFEDRPAPLPATGRQPPLSGQAARLAQLAQTFQGGSDVAASTQPSQRRAYGTR
                     GSYGGGQPVQWTSGDDARPSAEVLLIADRRAYAGRA"
     CDS             complement(521383..522372)
                     /codon_start=1
                     /locus_tag="Maq22A_c27805"
                     /note="293d0007"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47067.1"
                     /transl_table=11
                     /translation="MMPRSTCWSAGVWCGRGLGGRHDVALRRAAPPPLQRRHHRPALA
                     LEGRHEEPPPALPPDDARRDQGAAGPRPAPPRGRPGLHVDHRAAPAPHRRDRQCLAAA
                     LLVGDSVDQDLGLRGRPVRLPLFDRPRHRPRGDGERRVRGDPQGGPAAQHQGPPLLRR
                     VDPAPPGAQPQAAQPRRGDRGSNPRPLCRGVRAAGSTGLGRLRERGGEVRSAASGAGR
                     PDADGGGVAPMSPFRSMPIFRAAPLAGTFTAGGDALRLTEAMRMVWKASPDAFAALEP
                     AAQALGDPFNRERRERALAILEALPARLRAKILAAYGKKGADAESSSQPARAA"
     CDS             complement(521694..522308)
                     /codon_start=1
                     /gene="ime4"
                     /locus_tag="Maq22A_c02625"
                     /note="293d0006"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="MT-A70 family protein"
                     /protein_id="BAQ43994.1"
                     /transl_table=11
                     /translation="MTWPFGALRPHHYSAVIIDPPWRWKAGTKSRPQHYPRMTLAEIK
                     ALPVRDLLHPEGGRVFMWITAPLLHRIGEIGSAWRLRYSSAIPWIKTWASEDALFVYP
                     SSIARGTGLEVMGNAEYVVILKAGRPHSIKGRPFSGVWIQPRREHSRKPPNLAEEIEA
                     RIPGPYAEVFARQGRPGWDAFGNEAAKFDRLPAAQGAQMLMAAE"
     CDS             complement(522305..522664)
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02635"
                     /note="293d0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ43995.1"
                     /transl_table=11
                     /translation="MPRRLPFQPAETAIQAAVVDHWLALGRPNTLVAAIPNARAAGQP
                     GLTKGLPDLLVLGGLVGVGLLELKTLTGEPSDEQIAVRAICERARVACEIVAGRDAPI
                     DVLERWGVVRPRAGRAA"
     CDS             complement(522668..522979)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_010684423.1"
                     /locus_tag="Maq22A_c02640"
                     /note="293d0004"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+. Start codon location
                     was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ43996.1"
                     /transl_table=11
                     /translation="MKVPIMPTDRAFSQASPSMPDADVASSGVAAEELKQFIERIERL
                     EEEKAGLQGDIKDVFLELKGRGFDVKAVRAILKIRKKDHSERQEEEAILELYMQALGI
                     A"
     CDS             complement(523045..524859)
                     /codon_start=1
                     /locus_tag="Maq22A_c02645"
                     /note="293d0003"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43997.1"
                     /transl_table=11
                     /translation="MRSVATAFVLIFGLRPSPRRARRDCRGHPPPFPHRSGRGGRRRP
                     PGCEGGRRAPPRLGPATAAFPSACSPLRSRAYPCSSAALRLPLRNRCCSAGCPGARKD
                     EAALVYAHSRSDLRRQARKDRRPRCEAHRRAWLEDGCLPRPRLDARHVVGMGPPHRRP
                     PRRRADRPPRRAADPRPPRPPLRPGRSRGRRRRGAQRPHPGADRCGCSGFFGGWCPPG
                     WCCRGGCRASSPSGACSPTRTGLRVTSHAWPGPGLPGTERSAPVAAPRRAALMAEQQR
                     REHVERNPQGPAVRGLPGADLRQGRPGEREQAARGALHPRRRDDPRHAGHGRPHGVAR
                     DHRHPGGLHVAEPGGVPARPGEPARGQSGECGVMGGRPTLDQMTPAGRQIVLDFEPTH
                     VGVKQVRALEIVALDDLSLGYLDVRMPDGAVRQVDVPRDLARRGTPVPGDRLIIYRDG
                     YVSWCPRAVFEGGEYRPIADLATAIARVCHEVNSAICAEFGHDVPPPWDEAAEWQRKS
                     AIDGVMFALANPDATPEQQHEAWREAKWADGWTIGPVKDPIAKEHPCLVEYELLPADQ
                     RVKDRTFRAIVAEMARQGLPRVPRFTGADAVEAVPPTT"
     CDS             complement(524049..524537)
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_012322607.1"
                     /locus_tag="Maq22A_c02665"
                     /note="293d0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ43998.1"
                     /transl_table=11
                     /translation="MLTAAQTFDDKRGKIVDLVAKLTDERGSKMDAYRALGSMLGTSS
                     AWVRRIVGRRDDVRIDHHVALRIRDLHDRLCVRVARAADAAEARNALIQEQIDAAVQA
                     SSAAGVRLDGAAEADVAPPRRPAPAPQPALAFASPRTRGPAQASLELNDLPLWQHPAA
                     PR"
     CDS             complement(524789..525019)
                     /codon_start=1
                     /locus_tag="Maq22A_c02670"
                     /note="293d0001"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ43999.1"
                     /transl_table=11
                     /translation="MSAGPLIQAAITLLGSEAKLGAACGVSQAAIWKAKRAKRVSAEL
                     AVQIERATKGAISRHRLRPDLWSAPLPEESAA"
     CDS             525000..525809
                     /codon_start=1
                     /locus_tag="Maq22A_c02675"
                     /note="293c0007"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="putative phage repressor"
                     /protein_id="BAQ44000.1"
                     /transl_table=11
                     /translation="MRGPALMEQEEITLVVESQRLSDWRHATTRVVASNAMTLAEKIR
                     TRRESLGMSQATLASELGVSQAAVNKVEQGKTLRPRFLPKIAKVLKFRLTELDPDMED
                     IAEGDPLVRSVPDAESSPASSLKDIINDPRVLAAATGVGGEVPVYAAAEGGPGEIVID
                     KDPLEWVPRPGPLAGVKGGYLIYISGTSMSPEYKPGERAIVDPRLPPLADEVHVFYTD
                     DPSDDRATIKLLVRSTKKAWIVQQHNPPEQFELDRELWPRCDRVVGKYARG"
     CDS             complement(525806..526084)
                     /codon_start=1
                     /locus_tag="Maq22A_c02685"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ44001.1"
                     /transl_table=11
                     /translation="MVRRAKVEGERRTYYVVQSFSGMPQRPTADEPREAISREAAASL
                     AARLAPSKLAVVAFSRTGNFQTGEFDDAVVIANYGRIPEDDDIKEEFT"
     CDS             526279..526689
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02690"
                     /note="293c0006"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology. Start codon
                     location was manually corrected by using GenomeMatcher"
                     /product="hypothetical protein"
                     /protein_id="BAQ44002.1"
                     /transl_table=11
                     /translation="MQTTSNVAAFPDSQHAVRRLAAVNLRTARQALDTAERHLDDVVL
                     GLIAGASELSIVDRRSQAAIREARENVFAARRSLDQIRLGLLAPDADTLTPNDEEDMA
                     TALQACLVGNEAARINDAAFDRLTPACVGVRTGW"
     CDS             526697..527044
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02695"
                     /note="293c0005"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ44003.1"
                     /transl_table=11
                     /translation="MAAHDTPTNPSGRLAALVGISPTDLAEIRADVARRAENEALRLK
                     LETATADLARAHCAMMAVVRSRVLADAHRVADDAVVELAVAHAAALHGLETIGQPTQK
                     GPATIVPFPGRRA"
     CDS             526864..527145
                     /codon_start=1
                     /locus_tag="Maq22A_c27810"
                     /note="293c0004"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47068.1"
                     /transl_table=11
                     /translation="MRHDGGRPVPGSRRRAPGRRRRGGRARGRPRRGAAWPGDDRPAH
                     PEGPGHHRPVPGEARVIASHLAQVGHLLWIAGLAGAVFLMGLAVMRGWS"
     CDS             527136..527369
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02700"
                     /note="293c0003"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /product="hypothetical protein"
                     /protein_id="BAQ44004.1"
                     /transl_table=11
                     /translation="MVVNAPHLIAARPIGPERAAQLLHDRGLSPALVETDTAMAEALF
                     AALVEASIPRRYAPIDFPAVRAALVALTLPQDA"
     CDS             527371..528309
                     /codon_start=1
                     /inference="similar to AA sequence:RefSeq:WP_015007362.1"
                     /locus_tag="Maq22A_c02705"
                     /note="293c0002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /product="hypothetical protein"
                     /protein_id="BAQ44005.1"
                     /transl_table=11
                     /translation="MAATIEVATDPYAWHAAALAGTSPELERGQAPCGWFRLQQRDGS
                     FLPVALWPAAGDVLWAQVGTKEPVCLRGPGVDAGAEEAFCERVIAFCWRSPITEDLYW
                     QVREGAPWPDLPPERAATYSNLPADPFEALRAEVEGEREEIERWLAADPIKDQTACDR
                     AANWSSRLADLEKRAGGLRVEEKRPHDEAAKAVQAKWKPIEDLAAGLKRRLKDATLPF
                     QQEQRRREAEARAAAAQAGEALRPAKPAGAGTVGRKVSLRTSYRAEVTDYDAALAALK
                     DSPEVREVIQKLADRVARNTGTAPAGCRLVPIQTAA"
     CDS             528320..529549
                     /codon_start=1
                     /locus_tag="Maq22A_c27815"
                     /note="293c0001"
                     /note="Derived by automated computational analysis using
                     Genaris Flexible Annotator"
                     /product="hypothetical protein"
                     /protein_id="BAR47069.1"
                     /transl_table=11
                     /translation="MNAVVPMDATRRERTVVVDAVPVLDTSRFEQMQRIASVMARSPL
                     VPDCLRYGTNDYGDVVKSELLPVETAMANCFLVTNQAVRWGLDPFAVAQCCSIVRGRL
                     MFEGKLVAAVLAAKLGVQLSYAWNDKTGDAFGVLVRGPDDDLGNARTISGTVGEWKTE
                     RKGSPWGSVSGHRRMLAYRGTREWVRLYEPAILLGVYTPDEMDDMQETARATRAAPAR
                     VAAPEGPPRRLAAPAPALVEAAPAPAASLTPTASITEPDEDEVEAALVQFEADAAAAT
                     ILGQVDKSRELLDDLQLSRPQQRRVEDASEAAKARIWKEAQKVQAASQPDGPPRKAAA
                     ASQAPQPDPAPMEEQAADDSEDDAPAIDTENPDYQRGMRDHRDGVKRCVISAIRNDPA
                     RHEAWQAGWMAGANGDA"
     CDS             529549..530034
                     /codon_start=1
                     /locus_tag="Maq22A_c02725"
                     /note="107c0013"
                     /note="CDS was addded manually by using GenomeMatcher."
                     /product="hypothetical protein"
                     /protein_id="BAQ44006.1"
                     /transl_table=11
                     /translation="MSSAPICCGQPARLTTGAEVYPHRPDLHDKPIWRCDVCPDAYVG
                     CHPGTTDPLGTPAGPDLRRARRMLHERMIDPLWQTADRSGAYGTLDEEGRRVVRQAAR
                     GRVYGFLADRMGLTRDETHTGLFDLEQCRAAWRALSGVAYPEIREWAQRRRAAPKRRA
                     A"
     CDS             529989..530552
                     /codon_start=1
                     /inference="ab initio prediction:GeneMarkS+"
                     /locus_tag="Maq22A_c02730"
                     /note="107c0012"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /