LOCUS       AP009044             3314179 bp    DNA     circular BCT 07-OCT-2016
DEFINITION  Corynebacterium glutamicum R DNA, complete genome.
ACCESSION   AP009044
VERSION     AP009044.1
DBLINK      BioProject:PRJDA19193
            BioSample:SAMD00060924
KEYWORDS    .
SOURCE      Corynebacterium glutamicum R
  ORGANISM  Corynebacterium glutamicum R
            Bacteria; Actinobacteria; Corynebacteriales; Corynebacteriaceae;
            Corynebacterium.
REFERENCE   1  (bases 1 to 3314179)
  AUTHORS   Nonaka,H., Kos,P.B., Okai,N., Inui,M. and Yukawa,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2005) to the DDBJ/EMBL/GenBank databases.
            Contact:Masayuki Inui
            Research Institute of Innovative Technology for the Earth (RITE),
            Microbiology research group; 9-2 Kizugawadai Kizu-cho, Soraku-gun,
            Kyoto 619-0292, Japan
REFERENCE   2
  AUTHORS   Yukawa,H., Omumasaba,C.A., Nonaka,H., Kos,P., Okai,N., Suzuki,N.,
            Suda,M., Tsuge,Y., Watanabe,J., Ikeda,Y., Vertes,A.A. and Inui,M.
  TITLE     Comparative analysis of the Corynebacterium glutamicum group and
            complete genome sequence of strain R
  JOURNAL   Microbiology 153, 1042-1058 (2007)
REFERENCE   3
  AUTHORS   Inui,M., Suda,M., Okino,S., Nonaka,H., Puskas,L.G., Vertes,A.A.
            and Yukawa,H.
  TITLE     Transcriptional profiling of Corynebacterium glutamicum metabolism
            during organic acid productions under oxygen deprivation conditions
  JOURNAL   Unpublished (2005)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..3314179
                     /db_xref="taxon:340322"
                     /mol_type="genomic DNA"
                     /organism="Corynebacterium glutamicum R"
                     /strain="R"
     CDS             1..1575
                     /codon_start=1
                     /locus_tag="cgR_0001"
                     /product="hypothetical protein"
                     /protein_id="BAF52962.1"
                     /transl_table=11
                     /translation="MSQNSSSLLETWRQVVADLTTLSQQADSGFDPLTPTQRAYLNLT
                     KPIAIVDGYAVLSTPNAMAKNVIENDLGDALTRVLSLRMGRSFSLAVSVEPEQEIPET
                     PAQQEFKYQPDAPVISSNKAPKQYEVGGRGGASTSDGWERTHSAPAPEPHPAPIADPE
                     PELATPQRIPRETPAHNPNREVSLNPKYTFESFVIGPFNRFANAAAVAVAESPAKAFN
                     PLFISGGSGLGKTHLLHAVGNYAQELQPGLRIKYVSSEEFTNDYINSVRDDRQETFKR
                     RYRNLDILMVDDIQFLAGKEGTQEEFFHTFNALHQADKQIILSSDRPPKQLTTLEDRL
                     RTRFEGGLITDIQPPDLETRIAILMKKAQTDGTHVDREVLELIASRFESSIRELEGAL
                     IRVSAYSSLINQPIDKEMAIVALRDILPEPEDMEITAPVIMEVTAEYFEISVDTLRGA
                     GKTRAVAHARQLAMYLCRELTDMSLPKIGDVFGGKDHTTVMYADRKIRQEMTEKRDTY
                     DEIQQLTQLIKSRGRN"
     CDS             complement(1594..1920)
                     /codon_start=1
                     /locus_tag="cgR_0002"
                     /product="hypothetical protein"
                     /protein_id="BAF52963.1"
                     /transl_table=11
                     /translation="MIVDNFVYLWIDFEVRILSPVCADVSPAYPQFLESCAQSGKFRG
                     ITFSVTKLTELQVCNYTAVNKVVDNFVSWGFIGSCPQNPCTTPKLQKDPSEDGSSRAA
                     ELNFVI"
     CDS             2292..3476
                     /codon_start=1
                     /locus_tag="cgR_0003"
                     /product="hypothetical protein"
                     /protein_id="BAF52964.1"
                     /transl_table=11
                     /translation="MESQNVSFRVAREDLVTAVAWVARNLPTKPTQPVLRAMLITADD
                     EGLELAGYDYDVSTRVRLSAEVSQPGRIAVAGKLLSEITGSLPNKPVDFRIDGSKAFV
                     TCGSSRFELPLIPLDDYPMLPKLPAGTGSINAKLFTEAVSQVASAAGKDDSLPMLTGV
                     SMEIVGNQINLAATDRFRLALRTFEWEANDPELNVKLLIPARTLLDNARSLDSGLNDS
                     IDIAVGTGDQVGREGLFGVHTDNRETTTRLLDADFPNIAPLLPKEHTAIASVEIAPLV
                     DAIRRVSLVAERNAQIVLHFSEGQVILTAGATEAGHAEETLPCAFTGKELTIAFNPGY
                     LKDGLSVVPTSRAVFGFTEPSRPAIMIPEPEEMPSANENGIFQTPDTYFTYLLMPVRL
                     PG"
     CDS             3585..4769
                     /codon_start=1
                     /locus_tag="cgR_0004"
                     /product="hypothetical protein"
                     /protein_id="BAF52965.1"
                     /transl_table=11
                     /translation="MHIRSLELRDYRSWPELKVDLEPGITVFIGRNGFGKTNIVEAIG
                     YLAHLSSHRVSSDAPLVRAHAENARVSAVAVNQGRELAAHLLIKPHAANQASLNRTKV
                     RTPRELLGVVKTVLFAPEDLALVKGEPAERRRYLDDIIATRQPRMAGVKADYDKVLKQ
                     RNALLKTATIALRRGYGTEEGAAALSTLDTWDGQLARLGAEVMAARFALLNELGPKIY
                     EAYTTIAPESRPAAVNYKTTIDQGLSQFSEFDAGIIEATLLTELAAKRQREIERGSSL
                     VGPHRDDVDLMLGDQPAKGFASHGETWSFALSLRIAEFNLLKSDDTDPILILDDVFSE
                     LDAGRRQKLVGIAQEVEQVLITAAVHDDLPENLKKVLTAQHTVTVQDTDTGRISLLDV
                     QP"
     CDS             4766..5302
                     /codon_start=1
                     /locus_tag="cgR_0005"
                     /product="hypothetical protein"
                     /protein_id="BAF52966.1"
                     /transl_table=11
                     /translation="MTDPIEQAFERIRAEAMRRNGSVPDLNKNDAFRRPPAPKGGVEK
                     RKKGRASGLDGRQKRYVRGAESLGSVLNKEIQRRGWGKDIAGGWVTSNWEELVGAKIA
                     QHTRVEMIKDKKLFITCDSTAWATNLRMMQRQILQVIAEKVGPNIITELRIFGPQAPS
                     WRKGPLHVKGRGPRDTYG"
     CDS             5435..7489
                     /codon_start=1
                     /locus_tag="cgR_0006"
                     /product="hypothetical protein"
                     /protein_id="BAF52967.1"
                     /transl_table=11
                     /translation="MANTEHNYDASSITILEGLEAVRKRPGMYIGSTGPRGLHHLIWE
                     VVDNSVDEAMAGHATKVEVTLLEDGGVQVVDDGRGIPVDMHPSGAPTVQVVMTQLHAG
                     GKFDSDSYAVSGGLHGVGISVVNALSTRVEADIKLHGKHWYQNFEKSVPDELIEGGNA
                     RGTGTTIRFWPDAEIFETTEFDFETISRRLQEMAFLNKGLTITLTDNRATDEELELEA
                     LAEQGETATELSLDEIDNETELVEETTDAPKKPKKREKKKIFHYPNGLEDYVQYLNRS
                     KTNIHPSIVSFEAKGDDHEVEVAMQWNSSYKESVHTFANTINTREGGTHEEGFRSALT
                     SLMNRYAREHKLLKEKEANLTGDDCREGLSAVISVRVGDPQFEGQTKTKLGNTEIKSF
                     VQRMANEHIGHWLEANPAEAKVIINKAVGSAQARLAARKARDLVRRKSATDLGGLPGK
                     LADCRSKDPEKSELYIVEGDSAGGSAKSGRDSMFQAILPLRGKILNVEKARLDKVLKN
                     AEVQAIITALGTGIHDEFDINKLRYHKIVLMADADVDGQHIATLLLTLLFRFMPDLVA
                     EGHVYLAQPPLYKLKWQRGEPGFAYSDEERDEQLNEGLAAGRKINKDDGIQRYKGLGE
                     MNASELWETTMDPTVRILRRVDITDAQRADELFSILMGDDVVARRSFITRNAKDVRFL
                     DI"
     CDS             7830..8798
                     /codon_start=1
                     /locus_tag="cgR_0007"
                     /product="hypothetical protein"
                     /protein_id="BAF52968.1"
                     /transl_table=11
                     /translation="MIQTYILKIQSLKRAQREMLKTTLITDTLGHVTSTEPTTTAHVP
                     LPDGSSTPVQIWASDNKDSQLVMLWPGFGMGGYYYRPIAAALNKAGFHVAIGELRGQG
                     QSSAKSSRKNQWGYHDLASVDFPLQIAAAKKALDLEEGHPMRFLSHSMGGQISCLFAA
                     RPEAEKYNLRAIFGVGAGSPFRPTFSPKMGKRLGLGAVLLGGIGGHVVGFWPGKVLGK
                     DLVGYGRQSGTHMREWRRFHKHNSLDDLTAQDINYVEAMKKVSIPITFSRCPDDEDCP
                     QASIDGLASFVPAAQIKMIEIPEALGHNRWAREPESTVKLFLEQAL"
     CDS             complement(8795..9466)
                     /codon_start=1
                     /locus_tag="cgR_0008"
                     /product="hypothetical protein"
                     /protein_id="BAF52969.1"
                     /transl_table=11
                     /translation="MSNPNKKPLDPAQRFSLPTRWAMFFVGIFIMSFAIGITVHAGLG
                     TTTISSLPVVWTAASGLSLGWTTIYFNGFMILCQIIVLRSQFKPQMLVQILWAVLFGF
                     LCDLSLQLTTWAQTDNYFVAWIWVIVSTILMSIGVFIQVLPNITFIAGEGIVSALVKK
                     FPNVEFGTMKQIVDWTFVSVAAILSWITMGGLIGVREGTVFAAFFIGFFVRQWRKLYL
                     RSIGH"
     CDS             complement(9471..9914)
                     /codon_start=1
                     /locus_tag="cgR_0009"
                     /product="hypothetical protein"
                     /protein_id="BAF52970.1"
                     /transl_table=11
                     /translation="MTSLKDLLVSTNADAAIADMSAFIEETVGKQSGTSGIALKGAMG
                     AATKIDSDIVAKGSRRLLPELADSLDGLWQEYQNGGTAANFGEHLEANSSTALDAILS
                     VADKNAESINVPGLGKVYKGVRGKAAKVIEQELPAIGQLIEKNAQ"
     CDS             complement(10105..11178)
                     /codon_start=1
                     /locus_tag="cgR_0010"
                     /product="hypothetical protein"
                     /protein_id="BAF52971.1"
                     /transl_table=11
                     /translation="MFMLAQRTLPIHITAPHLPVARVFHQIRATDADRTSLQRDLELS
                     QAGITRHVSALIDAGLVEETRVDSGARSGRPRTKLGIDGRHLTAWGVHIGLRSTDFAV
                     CDLAGRVIRYERVDHEVSHSTPSETLNFVAHRLQTLSAGLPEPRNVGVALSAHLSANG
                     TVTSEDYGWSEVEIGAHLPFPATIGSGVAAMAGSEIINAPLTQSTQSTLYFYAREMVS
                     HAWIFNGAVHRPNSGRTPTAFGNTNTLKDAFRRGLTPTTFSDLVQLSHTNPLARQILN
                     ERAHKLADAVTTAVDVVDPEAVVFAGEAFTLDPETLRIVVTQLRANTGSQLRIQRADA
                     HILRTAAIQVALHPIRQDPLAFV"
     CDS             complement(11261..11524)
                     /codon_start=1
                     /locus_tag="cgR_0011"
                     /product="hypothetical protein"
                     /protein_id="BAF52972.1"
                     /transl_table=11
                     /translation="MKGLSAENVLAIADEVCAEHGVVVRDFAALAAAAAVSTANFHGV
                     RVFGSAEAMAGKVSEMIRALKPLSGRNETFAAVTQRVLLEINK"
     CDS             complement(11521..11730)
                     /codon_start=1
                     /locus_tag="cgR_0012"
                     /product="hypothetical protein"
                     /protein_id="BAF52973.1"
                     /transl_table=11
                     /translation="MAMTLRLNDAQDRALTLLARTQGCSKQEAATRAIIAAASRAVDD
                     AEIAGLARTMLHEYAGVEKRIRQAR"
     CDS             11832..14402
                     /codon_start=1
                     /locus_tag="cgR_0013"
                     /product="hypothetical protein"
                     /protein_id="BAF52974.1"
                     /transl_table=11
                     /translation="MSDDNTGQFDRVNPIDINEEMQSSYIDYAMSVIVGRALPEVRDG
                     LKPVHRRVLYAMFDNGYRPDRSYVKSAKPVADTMGNFHPHGDTAIYDTLVRMAQPWSM
                     RYPLVDGQGNFGSRGNDGPAAMRYTECRMTPLAMEMVRDIRENTVNFSPNYDGKTLEP
                     DVLPSRVPNLLMNGSGGIAVGMATNIPPHNLNELADAIFWLLENPDAEESEALEACMK
                     FVKGPDFPTAGLIIGDKGIHDAYTTGRGSIRMRGVTSIEEEGNRTVIVITELPYQVNP
                     DNLISNIAEQVRDGKLVGISKIEDESSDRVGMRIVVTLKRDAVARVVLNNLFKHSQLQ
                     ANFGANMLSIVDGVPRTLRLDQMLRYYVAHQIEVIVRRTQYRLDKAEERAHLLRGLVK
                     ALDMLDEVIALIRRSPTPDEARTGLMSLLDVDEAQADAILAMQLRRLAALERQKIIDE
                     LAEIELEIADLKDILASPERQRTIVRDELTEIVEKYGDERRSQIIAATGDVSEEDLIA
                     RENVVITITSTGYAKRTKVDAYKSQKRGGKGVRGAELKQDDIVRHFFVSSTHDWILFF
                     TNYGRVYRLKAFELPEASRTARGQHVANLLEFQPGEQIAQVIQLESYNDFPYLVLATA
                     HGRVKKSRLLDYESARSGGLIAINLNEDDRLIGAALCGEEDDLLLVSEFGQSIRFTAD
                     DEQLRPMGRATAGVKGMRFRDNDQLLSMSVVRDGEFLLVATSGGYGKRTPLEDYSTQG
                     RGGLGVVTFKYTPKRGRLVSAIAVEEDDEIFAITSAGGVVRTEVKQIRPSSRATMGVR
                     LVNLEEGVELLAIDKNVEDQGEASAEAVAKGAVEGPASKTAAEETDSVDNGSDENGEE
                     "
     CDS             14406..14750
                     /codon_start=1
                     /locus_tag="cgR_0014"
                     /product="hypothetical protein"
                     /protein_id="BAF52975.1"
                     /transl_table=11
                     /translation="MASREVSITRISPLSTFRVALAMSIIGLVAWIICVTVLYFGLNV
                     AGVWQNFNDVIGGVGAEQTITFGLVLSISALLGAIGAITVAVLAPLCAIIYNSIVDLF
                     GGLKIQLQEEVD"
     CDS             15244..16440
                     /codon_start=1
                     /locus_tag="cgR_0015"
                     /product="hypothetical protein"
                     /protein_id="BAF52976.1"
                     /transl_table=11
                     /translation="MYGLFGFSLSAAIAAWTGVAIPWWIVGLVGWVFVALMGVSNVEL
                     SAKVLGVLVALEFLVAIVVMIVALIHSPEGISTATLHAEDFFVPGIGVLLAFSIAAFM
                     GFESGAIYSEETKDPSKTVSRATYIAVGIIAIFYAASTWALAMGVGPSAIIDESRIYG
                     PDLVFVWLASFSPALSNVAHLLFVTSILAALLAFHNAAARYFFALGRSKVIPSVFGKL
                     GKNGAPIGGSIAQSVVGLVVVIVFAIGGANSTLGELFPVTTLFTWFSTAAAFGLVFLM
                     AITSVAVLFWFRRNHHGYGVFTRVIAPGAAALFLVVIAVLILMNFDIMIGEESPRAMI
                     FIMPGIIIGTGVLGALWSLRFDREIDVNAIPIAETAVVDESGTGSNAGSNAEDTQASS
                     PAHTTI"
     CDS             16467..17780
                     /codon_start=1
                     /locus_tag="cgR_0016"
                     /product="hypothetical protein"
                     /protein_id="BAF52977.1"
                     /transl_table=11
                     /translation="MTKKVVVVGAGFAGLVAARELQMFGIDVEVVEARDRVGGRAWTE
                     NRLGADLELGATWVHWHQPHTWSEITRYQREIYQSPECEEAYWLTGGQVKTGTEAEMD
                     GLQLRGMEKIFEGSRTFFPDPYNQLAALDDPSMRDAFIAADHRSPIDELLSDPSFTQE
                     EIDLCEAFWSGGYIGDPRQGSALMAKHWASLSSHSMEEMVEQQLKYKLKGGMKGLYEN
                     IAADLTCPVHLSTPVTAIKHTPNESVVTLQNGEKIECDAVIVTVPVGALDTISFDPPL
                     PPAMRKVVDDKWNSTGAKIWIKVEGHHSMAAMAPQPAVANVLKSEVFTDDGSTIIVAF
                     GAFHDKFNLEDPECGQHIMNQWRDDLKVTACTGHDWVADPWSGQAWASLKKGQFTDSW
                     HHFHETGTRLHFAGSDWARGWRGVVIDGALEMGIRTARDVAKEIL"
     CDS             complement(17786..18712)
                     /codon_start=1
                     /locus_tag="cgR_0017"
                     /product="hypothetical protein"
                     /protein_id="BAF52978.1"
                     /transl_table=11
                     /translation="MESIQAYNFTQWRQIVASSFHNVRAAAPAPNFRATAHHKHVGDI
                     ELFDMITDPHTVIHTEGDGSFPLSTMCKFSLQLEGVATLVQDGRSCTMSPGDLALYTG
                     KRPYHLVFDEPQRSLVVYFPRSLLQLRDDQIDMITATPISRDEGLGKIIIPLFEQFAR
                     NLDDLQGLHAQSLIRASLDLLVTVFAEHTERMNGELEDSSQLFRRATSYIDENLHDLD
                     LAPGTIADALYVSVRNLHAHFSSQGLTVSAYIRARRLNAIHADLGNPQMRDFTIQSIS
                     ARHGLVDASYVSKAFRAEYGESPRTYRTRTLT"
     CDS             18907..20316
                     /codon_start=1
                     /locus_tag="cgR_0018"
                     /product="hypothetical protein"
                     /protein_id="BAF52979.1"
                     /transl_table=11
                     /translation="MSDQLLSIVGVGKEEGRPIENPATGDVIGYAPDHTADDLDAAVG
                     GAVEKQPEWARLGHSARSNYLNKMADAIDAHAEELAQLLTLESGKPLNGPNSRMEVSM
                     CGDWLRANAEFETPSEVLVDDGEARAVLEYEPIGVVGAISPWNWPMMITIWQIAPALR
                     MGNTVVVKPSENTPLSVLALVHVLNTVLPEGVLHAISGGREVGARMSEHAEIGKIMFT
                     GSIATGRAIAAASADTLKRLTLELGGNDAAIILDDCDPAAIAEDLFWGAFINTGQTCA
                     AVKRVYVADNIYDELCQALASIAQAAPMGPGTDENNVLGPLQNKGQRDIVAKLVDAAR
                     DSGAQILTGGQPSDGPGNFYPATIVTDIAPDNPLVVEEQFGPALPIVRYSNIDEAIGW
                     ANGLEVGLGASVWSADRNRAMDVARQIQAGTVWINNHARPDPRIPFGGIKQSGYGLEF
                     GADGLKAVAVXKGLQRLIV"
     CDS             complement(20826..21863)
                     /codon_start=1
                     /locus_tag="cgR_0019"
                     /product="hypothetical protein"
                     /protein_id="BAF52980.1"
                     /transl_table=11
                     /translation="MSTNLLESTPPFTQLRTGVLQKYTPGLLLCSIAVLIAMIVNHFF
                     SGVSPLIVAIILGIILTNLIQLPASISPGITLASKKLLRLGIVFLGLQLVFSDILSLG
                     FPMLGVIVCIVAGGIFGTILMGHLLRMKPTQVLLIACGFSICGAAAVAGVEGVNDSEE
                     EEVVTAVALVVIFGTLMIPFIPFATKVLGLSPEIGGMWAGGSIHEIAQVVAAGGIIGG
                     GALGVAVVVKLARVLLLAPIAAILSFRQRRQGYTSPDGKRPPVVPLFILGFLAMVVLR
                     STVALPDEVIAAGGFLQTALLSAAMFGLGCGVKIQNLIHVGVKPFILAFGSTTLVTSI
                     ALAGTLLTHLG"
     CDS             21934..22830
                     /codon_start=1
                     /locus_tag="cgR_0020"
                     /product="hypothetical protein"
                     /protein_id="BAF52981.1"
                     /transl_table=11
                     /translation="MDNGWPNLQTLALFVAIVEEGSLGAGARKVGMAQPNASRAIAEL
                     EADMKAELLVRHPRGSHPTAAGLALIEHSRNLLQSVQEFTEWVTEGRTEQPLKLHVGA
                     SMTIAEALLPAWVADMRARFPASRVDVSVMNSSQVIEAVQKGHLQLGFIETPHVPVRL
                     HARVVQEDKLIVVISPNHEWANRTGKISLRELSETPLIVREIGSGTREALQELLADYD
                     MAEPIQVLNSNAAVRVVVEAGAGPAVLGELALRDHLALGRLLSVPFEGSGVTRPLTAV
                     WSGPRRLPILAGELVSIASNHI"
     CDS             22871..23293
                     /codon_start=1
                     /locus_tag="cgR_0021"
                     /product="hypothetical protein"
                     /protein_id="BAF52982.1"
                     /transl_table=11
                     /translation="MTIMNEIPEWLTLVSVEAGKRLGLPGPLVFPPELITLAVEGIEL
                     IELEPSWTSDLPLPEFAFLAADMVDFYDDYEFSEWIPGAWPLALDGGGGFFCLDLRAA
                     NADGEIPVVWVHASNLGWGDDEAVRVAASLADLLSPSK"
     CDS             complement(23476..24348)
                     /codon_start=1
                     /locus_tag="cgR_0022"
                     /product="hypothetical protein"
                     /protein_id="BAF52983.1"
                     /transl_table=11
                     /translation="MDVGLVTAFLGGTLALLSPCAALLLPAFFASSVGAGPRMILHGV
                     VFYAGLLVLLVPLGLGAGILGELFITQRQTIIVVSSIVLIVLGIVQIFGGGFDFGKAL
                     PGLGRLQSKATVSSGLGKSFLLGMTSSIAGFCSGPILGAVLTLAATSGNFITSALILS
                     AYGAGMVLPLMAIAALWAKLGQRGQQVLRGREFTFLGRKWHIVSVISGALIIGVGILF
                     WTTNGLVSMPELVPMDTQIWLQEATFSLGSPLFDIAVIIVAAGLFLYFWNKRQKRKEE
                     AQRPKESGWVINPR"
     CDS             complement(24352..25098)
                     /codon_start=1
                     /locus_tag="cgR_0023"
                     /product="hypothetical protein"
                     /protein_id="BAF52984.1"
                     /transl_table=11
                     /translation="MNQQSKKWLVPTLVVIIAVLLIAVVLLMYRGNASETAEGAAATA
                     PAGSDSGSASGTDSGSGAADSDLTSVEARDPSDPVAVGDVNAPVGLVVFSDYQCPFCA
                     KWSDETLPQMMKHVEDGNLRIEWREVNIFGEPSERGARAAYAAGLQDSYLEYHNALFA
                     NGEKPSEELLSKDGLIELAGELGLDVSKFTEDFQSPETAAAIAQHQQLGIDLGAYSTP
                     AFLLGGQPIMGAQPASVFEAAFEQALAAKE"
     CDS             25336..25707
                     /codon_start=1
                     /locus_tag="cgR_0024"
                     /product="hypothetical protein"
                     /protein_id="BAF52985.1"
                     /transl_table=11
                     /translation="MNIEQGIPTLGPLEEQVMHILWDRGQLTVREVIEFLPGDPAYTT
                     IATVLRHLGRKGMVTIVKDGRTARHSALMNREEYTASVMDQLLSTSRDRSASILHFVD
                     SITDTDRELLLEYLQQQEGRK"
     CDS             25704..26702
                     /codon_start=1
                     /locus_tag="cgR_0025"
                     /product="hypothetical protein"
                     /protein_id="BAF52986.1"
                     /transl_table=11
                     /translation="MTAASALTAVLIIGISLAVIGFFGPALLRHAAPALAKTPRLAVA
                     LLVGGILIWPTTLLALSLALAWVLAGPALLPEKAALVCEQCLTAANPFSVESIQTALP
                     TVLLLVIPTVIAAMCTVGIAAQFLARVRCSRSTAARVQHEAYRRPLLGYDVSVVQDHR
                     PWALTFSPRLGGIALSSGAIDQLADDELAAVLAHEQAHMDQRHHIVTALADSIAAQLR
                     WVPFIREAAEILPDYLEIAADQQACRKVNITALVRALLVLGEKKIPTGTIGSAAGTLF
                     AAGPGRISHLVGSSTGRKGYVPALAAGSQILLLGTVSVIVLLSYAIALLTGCSLPS"
     CDS             27029..28984
                     /codon_start=1
                     /locus_tag="cgR_0026"
                     /product="hypothetical protein"
                     /protein_id="BAF52987.1"
                     /transl_table=11
                     /translation="MFLSAYRAPIAAGTAEAAALAGVSVAQAQENISQFNIANITDFH
                     GYISATAAHPGAAMLKCAVDEAAGGRAQAFVSSGDNIGGSPFQSFILGDEPTLEALNQ
                     MGLDYSAVGNHEFDKGYADLSGRVADIADFDYLGANVDGENPDLAPYGISELDGVKVA
                     FVGTVSQETPMLVNSEGIEGITFTDPLEATNRLADQLVESGEADVVVALYHEGITGTE
                     AWSENIDAVFAGHTHQVRDLGTDNGPLIMQCGNYGHALADVDFSFNHDTGELTVDDAR
                     MLGVADINACGNPDGTLAGIVAQAELDAGEAGKEVVATIDGDFLRATDEGAESGSNYG
                     AESQLVNMIASAVRWSMSTNTATTADIGLMNAGGLRADLFGGEVTYAEAFEIQPFSGE
                     DSFVTLKGSDFKDALEQQWKEDSARPVAALGVSDNVSYTYDIKRPIGDRVTSVTIDDA
                     PLGPECDYVVAASLYLLSGNEGMTALTRGTAPAQTGIVDVQSTIGYLANNVVTPRTGQ
                     AQISITPSGDFNAGETVTLDLAGLRYTQGDTAKEVTVSLGDAIDSAPIDPQLGAAGFG
                     EAGIATVSLEIPAALSGTQNLVVTTDAGTRISMPVEVVGAEQPAPQPAGSSVLGTGIL
                     SGILGMVGLGNWIDPSFIQHIQQQLFA"
     CDS             29651..30901
                     /codon_start=1
                     /locus_tag="cgR_0027"
                     /product="hypothetical protein"
                     /protein_id="BAF52988.1"
                     /transl_table=11
                     /translation="MENTNVSSTEYEESEHEETEHEEPGKSPTHAKHARAIDLKPQKR
                     IEGLDIARGFALLGMITVHLIPWDIEIGVSVFHDLFSGRAAALFALLAGISLALITGG
                     STPHTGKKLRRDRIAVVTRGLILLIFGLALNSLTPGDISILPYYGVFFLVGSLLIGLH
                     TRTLAVLTGILIVAGPAVVHMALWVEGFDSVRSSTLPEFFTSPLNTVFSLLFIGFYPA
                     ATWITFVACGIALGRIDVQDLSVQIKLMFFGGLTAVCSALASEVIVYHFGVLDRIIEA
                     TPWEYSDIMFALDYGGETVPGYSWWWLMVDNPHNNTPFSLLDAGGSAVFMVGLSLLAS
                     RVLAKELSPIAAAGSMTFTLYTAHLLALKIDHSELQIMWVCINITVAIVFAYFWKKHI
                     GQGPLERLISSASKSTARAVVPRV"
     CDS             31102..33330
                     /codon_start=1
                     /locus_tag="cgR_0028"
                     /product="hypothetical protein"
                     /protein_id="BAF52989.1"
                     /transl_table=11
                     /translation="MNSRDVKKPNYLFVNENIGGHRTVHRSLRKILADREDVTVEFID
                     GEDPGFVGKVLRAPIPGLSKLDMDFQPLRGQLVHSFNLRRRVRKRLKQGGVDAMHVYT
                     QNGMLGGAELLRETPSVITTDSTGRLNVFSVPYRTPTRFTSPLSKVNPIFERPVLKAA
                     SRVFACSNAVETSLTSSDYSMTLQQVERLEMGVHSPYFTDPLPPRDPAKRPVIVFVGT
                     SLERKGGSLLLDVWREQLRDRADLVLITLETPPAEEGLTVINDLQPGEDRLWDLLAQA
                     DIFCLPSLIDQAPNAILEAMAASLPVVAHPNGAIPEMVIDGETGFLVDASKPEPVAEA
                     LNKLIDDPELRATMGAAGYRHAKDHYDMSSSVETILAALHHATDIGARPNDNDMVFEL
                     HEEVDDDLLKQWMELATVHSTRFASRPSYVLNWFEFLGKGQMAIATVHREGQLVALLP
                     LHSRTRLGVSVYRLAGHGLGTIGEALSADPQALKALVEGLYERKLLLALTHLPENSAL
                     VQALIDHGGWTLNHNVDDVCPVTDLPEGTTAVDLRSARSLRRLRNARNKSAKDAGEVT
                     FEVVDSPERFIEVWPEIVSVAAVAEADEQVARLNLTAGVHGNFTRAFLFEEAQQGRLR
                     VLLLRVGGEAKAFEIMFLSGTYAESWLTRFDPEQRGLSVGHQLIESTANDSETAGITV
                     LDHMIGESDYKQAWETRTYQVGTVIAAPAKTAWFWLPLERLIRGTSELVYHKVQEWRE
                     RK"
     CDS             33327..34814
                     /codon_start=1
                     /locus_tag="cgR_0029"
                     /product="hypothetical protein"
                     /protein_id="BAF52990.1"
                     /transl_table=11
                     /translation="MTTAPAQSESRQLFSSSVAMIGGRLVSAGFGWAGSVIIARSLTG
                     DDWGRYSFVFALLGMLEIVTDLGVGRVVLARLTSNDRAETSKIAGSFFVLRAVLGVIG
                     FAIAVGYAWTIGLDPVVMAATMLAGTTVLIATPANALFVLYQSRLKLTYVALFDIAGQ
                     AAQFLLIVVVSLFSPTLIMFILPAVVREVIVFACRAFGIPKLLDPEFRPSFREPTAYW
                     GEMLREAIPLSVGFALLHLLERIDMLMLQQMDTFDAVGKYAVGYKFSDLLGLAVSALA
                     IPFTTVLITAWPGKPEVFRARFRQAVLIAALLAGVAVVVFIPSAQAVITLLYGVEFES
                     ASLAAILLVVGAGFSGVTYAVVSSLIAAKKLRVFPIIAAAGLILNVVLNLILIPLQSI
                     VGAALATVITESAMLVAMLLVLQWSLKVAQLIPWTIFIRMIIIVGVAVFLFTQLIDIN
                     WVLEVVGSLVVFVAVWGVAERKTSAVVVDLIRNRFGTETEPADDH"
     CDS             34804..35556
                     /codon_start=1
                     /locus_tag="cgR_0030"
                     /product="hypothetical protein"
                     /protein_id="BAF52991.1"
                     /transl_table=11
                     /translation="MTISEFLQRRLTESGVVLAYHDIIDDSASIYPYAVRESTFRAQI
                     NLARRLGFEFIPLSSLVEALLSRASVSGKAALLFDDALRGVHLRAMPYLSEESIPWSL
                     LPVVDRLGVFPDWWEPADRTMTLDEVLEAVDSGAQLCGHTATHPSLPKLDDVSMLMEL
                     QHSREKLSDWGNREVLDMCYPFGHQDARVRKLAREAGYRSGWSFTNGRCHPADDPFSL
                     ARMAMREDMSGARFAKFLLRPRWTWPAVEELS"
     CDS             35553..36893
                     /codon_start=1
                     /locus_tag="cgR_0031"
                     /product="hypothetical protein"
                     /protein_id="BAF52992.1"
                     /transl_table=11
                     /translation="MIGFLTALLLAGLIFLVSLQRPQWGLLIVATLVPFHGLLLIAPV
                     TASWWKEAAVLAVVAGALFAPRERDRVAVLPWLRPALVLVAVGSASAFLVLGEQAAFP
                     IKIAFFYIIPAVVIYCHPFTRADKDLLVTLLLSTGAITAAYGLWQQIIGGWALADLGY
                     EWNEAIRHAGPLLRSFGTFNQPFPFAFFLMLVLVVGFAAAIAQPRRFRSKLYWWLSPF
                     LLAAMLSSVVRAAMVGLVVALIVLGIVLYRRLLALLAVLAAVVAMLLPLALLLDPGGA
                     VSTLFSATSLEDRGGHWSDRLPEMLVQPFGTGLGTTGSAAERLHNWGSPVAAAYQPDN
                     QYLKIGLELGIPGVVLYAVVVIIAAVVLIRLISVHTDALEQAITAAALAMTLAACVAG
                     FFSTYLEIFPLDFYFWFLLAVGASVPASTKAQVVFWQKSPEFSTANESEKVDDH"
     CDS             36883..38031
                     /codon_start=1
                     /locus_tag="cgR_0032"
                     /product="hypothetical protein"
                     /protein_id="BAF52993.1"
                     /transl_table=11
                     /translation="MTIREVETPARPVPRPLDLGLLWGAFIRSLPIALLIGVLAGGAT
                     YFIQDGEPPVYEVTSTVSLGVLSDADIPDWIVARAEPVYLSMAQDRETVEQVSAVTGV
                     PDPVISAESGAVQGVILISAEASDVAQARSLVDETVITLIRRSARMHETAMFAASTQS
                     EQLTAPLRAQIAARQLEDPLADISDLEWEIQLIAREIETSIPEVVPPVQVSQTDNDGK
                     PIRPQPLNTALVGGMAAGLIALLPLIWWNFSNPRRVGRMWLRSLRNRYGVDTEAASFA
                     RSISPLAEARAVQTLSTSGTVLLLGQMGSLSELEGSGRIYQADWFDPWWREVPPNEVG
                     LAIVTVEKRSKKLRDIEKLVAHLTGMGIPTMVAFNNKEENNGSHSDRS"
     CDS             38006..39124
                     /codon_start=1
                     /locus_tag="cgR_0033"
                     /product="hypothetical protein"
                     /protein_id="BAF52994.1"
                     /transl_table=11
                     /translation="MARIAIAHERWTDIAGSEQVTQQLTKTWSETSVHVPFAKKSLIP
                     EDLRDSFHISPLQVAYQLIRQRTYAPLLPLVPPAMQWGSLRQAHDVDAVVVSHHAFAL
                     AAVGAAQAINKPSVAYVHSPARWAWDARFRQEEEHSRAGKAALSVLSARARANETRWA
                     PHVTSIMGNSSAVVKRIEQHWNREAQVVHPPVDTEFFHPDEAIEKGDYFISVGRLVPY
                     KQVPLGVAAAVAAGVRLVVVGDGRDMDRARAFAGPNVEFKGRLPGDEMRDLIRGARAL
                     LMPGEEDFGIVPVEAMACGTPVIALGKGGALDTVKPGISGELFSGDGEKEVIANLAEV
                     LKNFDDSRFNISTLRNWAEGFSEAAFREKMAEVVDAVV"
     CDS             complement(39121..40152)
                     /codon_start=1
                     /locus_tag="cgR_0034"
                     /product="hypothetical protein"
                     /protein_id="BAF52995.1"
                     /transl_table=11
                     /translation="MTSIVFGALALRPHGSGVQTYQRELIHALTKVEGLPSFSAVVQK
                     DSVGALPPEVKPVTRPVGSGTRRAVEGLRPVPATLFHSLDVDLPLAQKGLTVSTVHDM
                     SAFDTPWAMSKFRARGEQLLLRRSLRRADAIIAVSQFTAERIKALTGRDSTVTPLAPA
                     TWTHIPDEASVNRVREKYNLPKRFVFQLGTLEPRKRPDVVNDALRGLGVPLVLAGGHT
                     DGLKRPAGAIGLGYVDREDIPALYRAASVVAYASSYEGFGLPPVEAMACGAVVVASAV
                     GGIPEAVGSGACVVKRLRTSEWRASLSAALNDAAFRSSLLDDATLQVASLNWQATARS
                     TAQVYAEML"
     CDS             complement(40149..41435)
                     /codon_start=1
                     /locus_tag="cgR_0035"
                     /product="hypothetical protein"
                     /protein_id="BAF52996.1"
                     /transl_table=11
                     /translation="MDTVAIFLSAWIVDIPSPWITALVMVIILQVLPDFYRHRLNLSL
                     LNALPTVVPRALIVGFFAYIVVNPHVDARDSFDFIVVSTIGLIISWALSFAAIRSWRR
                     HAPISLHRTLVLGSADDSIEIVTALKENPQFGLSPVAVIDLESQAASDEFPEVETEYF
                     SDNLTELLQRHEADVVIVAPNQHSEEFLLSAFRASLRDPTTFYVVPALPLQGQRHDTE
                     ELGLISLRPVKRSAYRSFWWLLKRPIDVTLSLIAMLLLSPLMAVLAILVKLDSPRNPL
                     LFRQTRIGLDGKPFELLKFRTLTPATVNESDVTWNVSHDDRLTPLNRIMRKFSLDELP
                     QILNVLRGDMTLVGPRPERPHFVEKFGADYPIYHDRHRVPVGLTGWAAINGLRGDTSI
                     KTRAEYDNWYIEHWSIWLDVKILLLTVRAVLKGTGG"
     CDS             42155..43027
                     /codon_start=1
                     /locus_tag="cgR_0036"
                     /product="hypothetical protein"
                     /protein_id="BAF52997.1"
                     /transl_table=11
                     /translation="MGLPFLWFFSAKEIRKISADADTIIVNSTFALPAVGLAFPMHGR
                     KRGGPVISWLVHDTITSLKQRVVAKLGAHSITRAVAVSEVTAASVRPFVGTVLVQPNG
                     VEVPSEVVAVKHSQVPTIGILAVITGWKGHDVLLEAVALLPDVHLDIAGEVFAGSEDF
                     EAALRERASQPDLQGRVHFLGHVNKQDVFPQWKALISASTSPEAGPLGVLEAMAYGVP
                     VVATNHGGAAEYLRDGAGILVTPSDPQDLANGIRRILENPEQTAQIIAVARERIIEKH
                     NLVHTRERMLEVLS"
     CDS             43027..44136
                     /codon_start=1
                     /locus_tag="cgR_0037"
                     /product="hypothetical protein"
                     /protein_id="BAF52998.1"
                     /transl_table=11
                     /translation="MGFLHPRYLAWRATLLTLLVIALVGGVVGRVVVVSLESNEAMVK
                     DKALDRCDSLGIAGPMSWENMTSEEFHVMVNEMADIGASWIRIGVIWRDVEPSSGNFK
                     WDDLDERLQLAVDAGLRPLLLIHTTPSWIDDVGEVGNGTAQEYARFSGEVAKRYHDQA
                     EGYEIWNEPNLDRFWPKPSPESYAELLTATAPLLRQIDPDAEIVAAGLAPAASIEEYS
                     VTIEDFLRGLYDLDALQDVTAIGIHPYSYPEMPSGTSSWNTFAQLPRIQAIMHSYGDR
                     EREIWLTEYGAPSEGNGGVGLELQSDMIVEALQMTEDGDNFGPIFIYTMYDIDFDPED
                     RESHFGLLYGPGDPKPAFLALSDATKRCSLLSDLE"
     CDS             44709..45146
                     /codon_start=1
                     /locus_tag="cgR_0038"
                     /product="hypothetical protein"
                     /protein_id="BAF52999.1"
                     /transl_table=11
                     /translation="MAIESIAYTTEALSTGSGRLGQVRTTDGALEFDMTPPKALGGSG
                     EGTNPEQLFAAGYAACFHSAMHSVARSRKITLEDTAVGARVSIGPNGAGGFEIAVELE
                     VSIPHLPLAEAQELADAAHQVCPYSNATRGNISVTVSVIDEEA"
     CDS             complement(45296..46819)
                     /codon_start=1
                     /locus_tag="cgR_0039"
                     /product="hypothetical protein"
                     /protein_id="BAF53000.1"
                     /transl_table=11
                     /translation="MGLSEPDFTPVEGFDSQASIQFIRAGLNPQDRDALKVEPVPHHE
                     IHEMTVDGAEVVLVSVSPLAVNGPCYYLPGGIINGSFKRVGDEDRKLSHLEIYELQNR
                     FVQTKTDRNPVPDSSINDLNNQLVASFKQRLVETGSRSLGTDDNWLLRKNITTPIGEL
                     TIAGLLALGSYPQQFFPRVIIDVAVHPGLHKSPIGTSIRFEDRKICEGNLLEMVQEAM
                     TAIKRNLRVRRVVEGLSGKDVLEIPEEVLREALANAVLHRDYSELAQNEAIHVDIYKD
                     RVEITSPGGLPNGKRPESILDGYSEPRNRVLSRILMDIPWTHEVQGVLAESNGTGVPR
                     MFNLMREAGLPVPNFKIDISSVTVELSRHGLLDTQTNEWLVEKLGSDFSNTQGIALVL
                     AKELGAVTPRDLRNQTGHDSEDMRSLLDALVDRGVLNQNSQNQYQLATSSVNVTQSEQ
                     EVLDAINKTTPVTIREIATKTGKTASSLRPLLRGLVEAGLVVATAPPSSRNRAYLQA"
     CDS             complement(47232..48512)
                     /codon_start=1
                     /locus_tag="cgR_0040"
                     /product="hypothetical protein"
                     /protein_id="BAF53001.1"
                     /transl_table=11
                     /translation="MKNSKLLLIAAVSTASILLASCGTDSSADTATASSSATASSEAH
                     DHDGHEAEGSSTAVEVSSPQARIVTTYDSGIITLDANTLEVLDDTELAGFNRLNSAGD
                     GRHVFVSTGGGFQLFDTGAWTEPHGDHTHSYTATPELTDITYSTNKPGHVVNHAGKTV
                     LFGDGDGKIQIFDTASLLKGDEVEPEIKNALEAHHGVAVVLENGDLLHTLGDEDSRNG
                     AIVFNAAGEEIARNEQCPGVHGESAALGDAIAVGCEDGVLIYKDGEFTKVQAPDSYGR
                     IGNQSGSDVSPVVLGDYKVDKDADLERPERVSLTNTETGELTLVDLGTSYSFRSLGRG
                     PAGEAVVLGTDGALHIIDANTGAITNTYPVIDAWTEPEVWQEARPTLFINKDRAYVSD
                     PSNNELHVVDLANGNILASATLPGTPNELTGVSG"
     CDS             complement(48594..49550)
                     /codon_start=1
                     /locus_tag="cgR_0041"
                     /product="hypothetical protein"
                     /protein_id="BAF53002.1"
                     /transl_table=11
                     /translation="MILKDIFNNGELFGASSAKNFRKLLAVPAVAASLAFGITACSAV
                     DDTPDIVVTTNILGDVVSHIVGDSADVQVLMKPNADPHSFGVSAQDAAAMEHADLIVA
                     NGLGLEEGLQSNVDNAKNQGVPVLEVGEHIDVIDYSPGVPDPHFWTDPARMIVATEVI
                     EAELIKELDPSLTESITQSAQHYREELVALDEEVTELLSSVAPENRKLVTNHNVFGYL
                     ANRFNYIVIGTIVPGGSTLAAPSASDLNDISTAIEDNNVPAIFTDTSSPQRLAEVLAS
                     NAGIDVQVVSIFTESLTDADGEAPTYISMQKINAERIASTLS"
     CDS             complement(49547..50398)
                     /codon_start=1
                     /locus_tag="cgR_0042"
                     /product="hypothetical protein"
                     /protein_id="BAF53003.1"
                     /transl_table=11
                     /translation="MKFFIDALIVPFDVSFISRALVAGCLAAILCSLIGTWVTLRRLT
                     FFGDAMSHGMLPGVATASLLGGNLMFGAAISALIMSAGVVWTSRKSSLSQDVSIGLQF
                     ITMLSLGVVIVSHSDSHAVDLTSFLFGDILGVRPSDIFIIAIATVLGGLTIFLFHRQF
                     TALAFDERKAHTLGLNPRFTHLLMLALIALATVVSFQVVGTLLVFGLLISPPATAALL
                     VQDKASISLIMIVASLLGCAEIYLGLLISWHASTAAGATITLLSAAIFFATLLTKSAI
                     SGLNFTA"
     CDS             50428..51087
                     /codon_start=1
                     /locus_tag="cgR_0043"
                     /product="hypothetical protein"
                     /protein_id="BAF53004.1"
                     /transl_table=11
                     /translation="MAELSVRNLTCTYGNHIALNNITARFPTGKITALIGSNGSGKST
                     LLETLAGTLQPRSGSINNLAPDIAFVPQRSHVSHNLPITIRQTVSMGRWSAKKNWQRL
                     TAADRNIVDSCLDRLEISGLADRPLGEVSGGQRQRALIAQGLAQQAPLLLLDEPLAAV
                     DSHAASLIEDVINQQRNQGTTIILATHDLDQAHQADQIIALEKGIIKPQRKATESIKK
                     R"
     CDS             51130..52113
                     /codon_start=1
                     /locus_tag="cgR_0044"
                     /product="hypothetical protein"
                     /protein_id="BAF53005.1"
                     /transl_table=11
                     /translation="MKLPRLAAALIGAALLITGCSATGGAPRATDGASGGGTVDTPRL
                     VVAMVSHGAPGDTFWDLVRKGAEDAAQKDNVELRYSSNPEIPEQSNLVQNAIDSRVDG
                     IAMTMPNAQSLGPVAQKAVDAGIPVVGLNAGMNEYQDYGMTGFFGQDESVAGASAGAR
                     LAEENAQKVLCVIHEQGNSSQEARCGGVSEGLGKQVETLYVNGMDLTSVNSTLQAKLA
                     QDRSIDWVVGLQAGVSMAISDAADAANSEVKIATFDTNAQLMTAIRDGKIQFAIDQQP
                     YLQGYMAVDSLWLAHRNGTTVGGGRPVYTGPAIVDATNVDVIAEAVGEGLR"
     CDS             52110..53135
                     /codon_start=1
                     /locus_tag="cgR_0045"
                     /product="hypothetical protein"
                     /protein_id="BAF53006.1"
                     /transl_table=11
                     /translation="MTKIKSGEASTSIVERALKRPELTSLLGAVLVFTLFMVVAPAFR
                     SWDSMATVLYASSTIGIMAVAVGLLMIADEFDLSTGVAVTTAALAASMFSYNLWLNTW
                     VGALIALVISLAIGFFNGFLVVKTKIASFLITLATFLMLQGINLAVTKLISGTVATPT
                     IADMEGFPSARAVFASSIPIFGVNIRITVFWWLLFVIVGTFVLFKTRIGNWIFAVGGD
                     EEAARAVGVPVRGVKIGLFMFVGFAAWFVGMHNLFLFDSIQAGQGVGNEFLYIIAAVI
                     GGISMTGGRGTVVGTMIGALIFGMTNQGIVYAGWNPDWFMFFLGGTLLLAVLLNHRFE
                     RFNKERS"
     CDS             53132..53893
                     /codon_start=1
                     /locus_tag="cgR_0046"
                     /product="hypothetical protein"
                     /protein_id="BAF53007.1"
                     /transl_table=11
                     /translation="MTDLIQLREVSKKYGAFQALNDINLSVRAGEVTCVLGDNGAGKS
                     TLIKILSGLHPATSGEVIVAGDVVNFGSPRDALDAGIATVYQDLAVVGQMSVWRNFFL
                     GQELTGRFGVLKQEEMRRITDEQLREMGIELRDVDVPVASLSGGQRQVVAIARAIYFG
                     ARVLILDEPTAALGVKQSGMVLRFIAAARDRGIGVIFITHNPHHAYLVGDHFILLNLG
                     KQVMDKSRAEVELEELTLAMSGGGELDSLSHELKR"
     CDS             complement(53895..54725)
                     /codon_start=1
                     /locus_tag="cgR_0047"
                     /product="hypothetical protein"
                     /protein_id="BAF53008.1"
                     /transl_table=11
                     /translation="MNMSTIGNLKLVVDGARKAYGTYADYRDRKVSETYEALSHAAGE
                     YAPKAEQAVETARESAKEFYAESRDKAGNVTKAARARLEKALAEAEKQGTSALKDTRE
                     SGKKLNRKARRKADKAAKAARKATEKKESHWVRNLSLAALATSGIVAVAYAFLNKTKK
                     ETPGTQPPRVEVQLKKAVEQDEPEVVAEAAVEEPELVYSTESPETTEAPAEATETPAE
                     TTEEEAKTEAELEAEFEAELEAEADAEQEAAEEAEAEAIQAEFDKKNAPQRTQSEKKK
                     "
     CDS             54774..55346
                     /codon_start=1
                     /locus_tag="cgR_0048"
                     /product="hypothetical protein"
                     /protein_id="BAF53009.1"
                     /transl_table=11
                     /translation="MGHVVGISLDVVMMGVMTSKTATAILHTNRGDITIDLFGNHAPE
                     TVANFVGLAQGTKEYQAQNAQGDSEGPFYNGSVFHRVIDGFMIQGGDPTGTGRGGPGY
                     TFADEFHPELRFDRAYLLAMANAGPGTNGSQFFITVTPTPHLNNAHTIFGEVTDAESQ
                     KVVDAIATTATDRYDRPADAVVIESVEITA"
     CDS             55426..56115
                     /codon_start=1
                     /locus_tag="cgR_0049"
                     /product="hypothetical protein"
                     /protein_id="BAF53010.1"
                     /transl_table=11
                     /translation="MKDELKIVGFMNVERIYRQAPASTLISLAIIAVYAVTAIQSRSV
                     TDNLGSTSIGDAWILYAPLMDDGGFGPLRAIGGIFLHIGPGHMLLNLVLLWLLGREIE
                     RDFGSALFTAMYFVGGIGASAAVIWMDPYSPTAGASGAIYAMMAILVGLFVLRSADIR
                     APLILIAINIAYTLMSTNVSLWGHLGGLITGALITWPMVKAKNKRTRWIIVLIGLAVV
                     VVAVILGIDRV"
     CDS             complement(56688..58112)
                     /codon_start=1
                     /locus_tag="cgR_0050"
                     /product="hypothetical protein"
                     /protein_id="BAF53011.1"
                     /transl_table=11
                     /translation="MFLNRHVVTITPNAVLIWVYSGQVRITNGSTFELSAAHGILIPA
                     GSDITIEYSEDSLVIPIQLPNQCRPNLGVLRIPDDAHNRLMYAFAQGLGYLKENPESD
                     AFLVDLVEAVPQQYSITPSKPHSPEALKASQIIIDDPATTVPIAEIVHRVGLSERTLQ
                     RRFFDETGLNISTWRTRTRLSLAVAYLSDGHSAEWAAHHVGFSGASSLSKAFRTHMVI
                     SPSQILTLPQPEHLDPPLPLLGSLEIPANETWSRINGSHIMVWAFQGTSTVRVADREL
                     TVHQGEGLILPAGMRLDLHTPAGGLMLPLGYQVPDSHSISAQHVDIIQFDCSIQQLLQ
                     CTISAYTPFHPHKAAPDQCFSLPFQKSSTKNTENAPTESHNDELVSLAVDLAVSRETN
                     VSAIRGGIAEEFAHITGIAVQRWGLLRRMSLARIQLSKGLSPGVVARNLGYSHLPAFN
                     RAFTATHGCTPMQYQADCARIPTP"
     CDS             58176..58607
                     /codon_start=1
                     /locus_tag="cgR_0051"
                     /product="hypothetical protein"
                     /protein_id="BAF53012.1"
                     /transl_table=11
                     /translation="MSRTLKLLAIGMVALFATGCSQSASEEADAPTTQSGEWPRTITH
                     EAGETVIPEQPLRIVSTSPSITGTLLAVDAPVVGTAAALVTSLSDDKGFFTQWADVAD
                     DRHVEVVYPNLEIDLDAIDAFEPDLIIGSISGGDSVAAEYE"
     CDS             58758..59039
                     /codon_start=1
                     /locus_tag="cgR_6001"
                     /product="hypothetical protein"
                     /protein_id="BAQ21063.1"
                     /transl_table=11
                     /translation="MISLPEQPVTVLSYMGADGGWVLDAESQQALLLDSIGFDYVRCG
                     PQQVFARDALWYYCQRHMVRQQRRRPRRYRLTRIALLAGRGSESFSWTW"
     CDS             complement(58879..59034)
                     /codon_start=1
                     /locus_tag="cgR_0052"
                     /product="hypothetical protein"
                     /protein_id="BAF53013.1"
                     /transl_table=11
                     /translation="MSMKSFQTLAQQAKQSWSDDTVAVDDAAASPYAADSNTRVHLGR
                     TLAEAHT"
     CDS             complement(59134..59274)
                     /codon_start=1
                     /locus_tag="cgR_6002"
                     /product="hypothetical protein"
                     /protein_id="BAQ21064.1"
                     /transl_table=11
                     /translation="MFCTFHGSKTVLLLGGYDKGKDPSPKRQQKEIQRAQKQLTQWRK
                     SL"
     CDS             complement(59595..59867)
                     /codon_start=1
                     /locus_tag="cgR_0053"
                     /product="hypothetical protein"
                     /protein_id="BAF53014.1"
                     /transl_table=11
                     /translation="MPKARVTKNETAPVSSNPSANRTPVKINSAGTPMWYKVIMFAFM
                     IVGLAWLIVNYLVGPQIPFMADLGAWNYGIGFGLMIIGLLMTMGWR"
     CDS             complement(59980..61932)
                     /codon_start=1
                     /locus_tag="cgR_0054"
                     /product="hypothetical protein"
                     /protein_id="BAF53015.1"
                     /transl_table=11
                     /translation="MTFVIADRYELGAVIGSGGMSEVFAATDTLIGREVAVKMLRIDL
                     AKDPNFRERFRREAQNSGRLSHSSIVAVFDTGEVDKDGTSVPYIVMERVQGRNLREVV
                     TEDGVFTPVEAANILIPVCEALQASHDAGIIHRDVKPANIMITNTGGVKVMDFGIARA
                     VNDSTSAMTQTSAVIGTAQYLSPEQARGKPADARSDIYATGCVMYELVTGKPPFEGES
                     PFAVAYQHVQEDPTPPSDFIADLTPTAAINVDAVILTAMAKHPADRYQTASEMAADLG
                     RLSRNAVSHAARAHVETEETPEEPETRFSTRTSTQVAPAAGVAAAGAGSGSGSGSDSR
                     KRGSRGLTALAIVLSLGVVGVAGAFTYDYFANSSSTATSAIPNVEGLPQQEALTELQA
                     AGFVVNIVEEASADVAEGLVIRANPSVGSEIRQGATVTITVSTGREMINIPDVSGMTL
                     EDAARALEDVGLILNQNVREENSDDVAAGLVIDQNPEAGQEVVVGSSVSLTMSSGTES
                     IRVPNLTGMTWSQAEQNLISMGFNPTASYLDSSEPEGEVLSVSSQGTELPKGSSITVE
                     VSNGMLIEAPDLARMSTEQAISALRAAGWTAPDQSLIVGDPIHTAALVDQNKIGFQSP
                     TPATLFRKDAQVQVRLFEFDLAALVQ"
     CDS             complement(61929..63338)
                     /codon_start=1
                     /locus_tag="cgR_0055"
                     /product="hypothetical protein"
                     /protein_id="BAF53016.1"
                     /transl_table=11
                     /translation="MSQEDITGKDRLQELIGADYRLQWIIGHGGMSTVWLADDVVNDR
                     EVAIKVLRPEFSDNQEFLSRFRNEAQAAENIDSEHVVATYDYREVPDPAGHTFCFIVM
                     EFVRGESLADLLEREGSLPEDLALDVMEQAAHGLSVIHRMNMVHRDIKPGNMLITANG
                     IVKITDFGIAKAAAAVPLTRTGMVVGTAQYVSPEQAQGKEVTAASDIYSLGVVGYEMM
                     AGRRPFTGDSSVSVAIAHINQAPPQMPTSISAQTRELIGIALRKDPGRRFPDGNEMAL
                     AVSAVRLGKRPPQPRTSAMMAQAEAPSPSESTAMLGRVARPATITQEAAPKRGSGIGI
                     GLFIAALLAVIIGAVIYAGTTGILFNDTPEETTTPETITETYTPTVEETTSQWVPPTP
                     PTRSTFTEPETTSHRPTTSEESTSAEPTTEAPTSSRTVPQIPTSTPRTSASVPVETNA
                     PADDLIDAVNGLLDVGGAQ"
     CDS             complement(63342..64766)
                     /codon_start=1
                     /locus_tag="cgR_0056"
                     /product="hypothetical protein"
                     /protein_id="BAF53017.1"
                     /transl_table=11
                     /translation="MNRSIRITSLFSLLLILVLVANLTWIQAFRDDDLAQNPLNARGF
                     FAAKSTPRGQISTGGQVLAESSQDNQGYYQRSYITNPTTYAPVVGYFSDVYGAAGLEL
                     GYNSILNGSDSSLFTTQWLDVISGRPTHGANIELTLDPNAQQTAYEQLSQSGYEGAVV
                     ALRPSTGEVLAMASSPSFDPNQIVNPATAEDAWAEYTSAEGAPLLNHATQESLPPGSI
                     FKIITTAAALENGYSADSTVTAEAAVTLPGTNTTLTNYGGQTCAGGGTTTLLTAFQLS
                     CNTAFVETGIDVGADALRASAEDFGVGQTYSLGLDNVPGGLGEIPDDAALGQSSIGQR
                     DVQMNVLQAAVMAGTVSNGGVRMEPYLVSRVTGQDLSELSTHKPKSVGGVEPEIAEQL
                     KTLMEASERNTSGYAGIQIASKTGTAEHGDENTPPHTWYVAFNNDIAVAVLVKDGGGF
                     GTSATGGQVAAPIGRAVLQAAGGF"
     CDS             complement(64763..66088)
                     /codon_start=1
                     /locus_tag="cgR_0057"
                     /product="hypothetical protein"
                     /protein_id="BAF53018.1"
                     /transl_table=11
                     /translation="MNTLERLKLRRTEMWLLILATLVVSIMFISLELAMGNELGTHIL
                     MLMGGYIGIFIVAHLAMAWVAPFADQIMLPVVAVLNGIGLVMIYRLDEATGYSTVNSQ
                     LMWTVVGVTLMVAVLLLLRDYKSLSRYSYLLGVVGIVLLALPLVWPQPGGVEARIWIW
                     LGPFSIQPGEFSKILLLLFFAQLLATKRALFTVAGYRFLGMDFPRLRDLAPILVVWAL
                     AILIMAGANDFGPALLLFTTVLAMVYLATGRGSWLLIGAVLVAVGAFAVYQVSGKIQE
                     RVQNFVDPVAHYDTTGYQLSQSLFGMSWGGITGTGIGQGYPNMIPVVHSDFILAAIGE
                     ELGLIGLAAIIVLFGVFVTRGMRTATLARDSYGKLVASGLSMTIMIQIFVVVAGISSL
                     MPMTGLTTPFMSQGGSSLMANYILLAIILRISDSARRPVMSKQASEVAA"
     CDS             complement(66085..67440)
                     /codon_start=1
                     /locus_tag="cgR_0058"
                     /product="hypothetical protein"
                     /protein_id="BAF53019.1"
                     /transl_table=11
                     /translation="MLKLKYAVASDRGLVRGNNEDSAYAGPHLLALADGMGGHAAGEI
                     ASQTMINHLRALDVDPGDNDMLALVGMVANEANTAIAEGIAEDPARDGMGTTLTAFMF
                     NGRDLAMCHVGDSRGYVLRDDKLVQVTVDDTFVQSLVAEGKLDPEDVSTHPQRSLILK
                     AYTGHPVQPTLEQFPALRGDRLLLCSDGLSDPVTHSTIEETVRVGTPQDAATKLVELA
                     LRSGGPDNVTVIVADVVEVTKAEAAAEASVPVTAGALNGEQPEDPRPDTAAGRAAAIT
                     RRAQVIDPAPKISDAGTEDIPTIEEPPEKSSSKLAVLIVALVILIGVVAAGWWGYSRI
                     DSTFYVAVNDEEAITVEHGVDYRIFGKDLHSQFQVACLNEAGTLSLKESCENGTSFKL
                     DDLPASVRGSVAGLPSGSYDEVQAQMQRLAAQALPVCVNLEVTTGGDRNEPGVNCREV
                     S"
     CDS             complement(67440..67904)
                     /codon_start=1
                     /locus_tag="cgR_0059"
                     /product="hypothetical protein"
                     /protein_id="BAF53020.1"
                     /transl_table=11
                     /translation="MDSLVLLGLRIALLVVLWFFVLMALRAMRADLKVTGQASTSSTS
                     VAAPQGLARAFNRSSPPRLLTVVEGPLAGSSIEVSEDMTMGRSPECTFVVGDDYASGM
                     HARVFKRGSEWFVEDLDSRNGTFVGGTRIDQPEQIAVGTDIRIGRTTVRLVP"
     CDS             complement(67921..68817)
                     /codon_start=1
                     /locus_tag="cgR_0060"
                     /product="hypothetical protein"
                     /protein_id="BAF53021.1"
                     /transl_table=11
                     /translation="MATSNRIANAMNSLAKLDSSMQRGLDNALAFVFRGRVVPAELEE
                     LLKQEAEDNVVHTEFGYVEAPNVFKVSVSPNDFSNLVDRFPDQPARFGDQMMRFCRNS
                     GWTLVGPVIVLIEEDSSLHTGQLKSVSEKDPDPELSSGYLPLEGDGILPVAESESKNV
                     SDSSPYTGTEFLPAQSADRPLVQGVPQSQVDASRQSALKPAGPTVTLLLQDGSSRTYL
                     VREGSNIIGRSNDADLRLPDTGVSRQHVEITWDGRDAILVDLKSTNGTTVNDTPVDNW
                     LLADGDVITVGHSNIEVRIVSP"
     CDS             69130..70284
                     /codon_start=1
                     /locus_tag="cgR_6003"
                     /product="hypothetical protein"
                     /protein_id="BAQ21065.1"
                     /transl_table=11
                     /translation="MAELADALASGASVRKDVGVQVPPRAPFKTTLLRKGGFCPFGLS
                     SVRTFGTKILAKWGSKSGNLGVEFTSAGKLGTFRPFQQSNLSMARRIWTYQQLIDSGK
                     TKRQIESLVHEQQLTRIFRGVYISGEVTGDSVWWALKSRRKNIALDGYSAIQSHLNQH
                     LTLPILIRVPTSSKSNITDAYVRQVRSTRMPNGQRVSFIDAIATCLDHNYFRDSYLHQ
                     IVEEYYSGDYGAQNLKKHLAEIGGRDCTKLADFLAVATPGSDSELELILVRLLQRFGF
                     KTEQNTKIGGYKWDVCIRDLWVLIDIDSWKYHGGDNRTQFVLDRWKSNHAAAMGWTAL
                     RLTDSCVGYDQVEIVDFLNRIREFREKAPNGRLKGVTSRPVWEWHSDLNI"
     CDS             complement(70422..72176)
                     /codon_start=1
                     /locus_tag="cgR_0061"
                     /product="hypothetical protein"
                     /protein_id="BAF53022.1"
                     /transl_table=11
                     /translation="MSKSSTSIKTITTDRTCDVLVIGSGASGLATALAAAHQGLDVIV
                     AEKEKYFGGTTAISAGWAWVPGNPKGAEATGDSREEVETYLKALAPEHYNEAGVSAFL
                     DTVPEAISFFENNTEVNFVYPEKAPDYQMDLPGARLSGRAILPDDADARMLGDRRREL
                     QPYLSSYTVFGYMPQVGADLNQVLHANRSIKSFLYVATKLTRTWFDTAIHGQPLKRTN
                     GSALITRMVKSALDAGVQIWTSTPVESLIQESDGSVSGAILGGVHSGKVKARMGVVLA
                     GGGFTGNTSLRSQYFPHDSHGTNHITPTVGHDGSSAEMAIQAGGRINDDLFAPGSWAP
                     ITAFKQLRDGRQRLFPHLRQIGLPGMITVDRTGKRFGNEALSYHDFGRQLLEHDKNHD
                     DTYAWIIADEACMHTYGIGYAKPWPIPRKYFHDIGFLHKANTLRDLAIKIGADPATLE
                     ATVNRFNGFAEKGVDDDFGRGSTAYNHFRGDPEHKPNPNLATLEKAPYYAVKIQMGDL
                     GSFAGIDVDDHSTVIDTAGEPIRGLYSVGASAVSVFGGGYPGYGSHIGPALVFGYRMG
                     RDIAKLSQETSTVKAESA"
     CDS             complement(72209..73549)
                     /codon_start=1
                     /locus_tag="cgR_0062"
                     /product="hypothetical protein"
                     /protein_id="BAF53023.1"
                     /transl_table=11
                     /translation="MASFLGSTLEYYDFFIYGTAAALVFPKLFFPDGNPAIATIAAFA
                     TFGVAYIARPLGGLVMGHFGDRLGRKNVLLVTLLIMGIASLSIGLLPTYSQIGIWATI
                     LLVVARLAQGFSAGAEAAGASSLTLEHSPEGRRGFFNSFVMTGYASGMVLSTLVFIPV
                     AALPEAQMLSWGWRIPFLLSVVVLIIAFWVRTRLDETPVFEDEVAEAGEEKKLPAGRV
                     LKYQGGDVLRVLLMSIFSVMQTIFTVFGLSYATSHGGFERSSILAVNAIAIGLSMIMM
                     PLAGRLSDRIGRKPLMLTAMIGCGFTIFVYFLALGTGNILLVFGASFLFMTILYSGFN
                     GVWTSFFAELFAAPVRYTGMAMGNQLGLVVAGFGPMIGGMLLNDGTYGWIPVAVFGAG
                     CSLLAIGAVLSTRETAFTDIKLLGEPYLKATGAWPTQQAAQPAMSQTKEPAPSL"
     CDS             complement(73641..73934)
                     /codon_start=1
                     /locus_tag="cgR_0063"
                     /product="hypothetical protein"
                     /protein_id="BAF53024.1"
                     /transl_table=11
                     /translation="MIRHVLMIRWKDSFTDDIRSKWVDGLEKLEANIPGLLKLIHGHD
                     ILKTEKSWDHVIIADFTSTEAIAVYNTHPLHEAIKPYSLPNAEEIAYVDFELP"
     CDS             complement(73931..75580)
                     /codon_start=1
                     /locus_tag="cgR_0064"
                     /product="hypothetical protein"
                     /protein_id="BAF53025.1"
                     /transl_table=11
                     /translation="MKVLNAENLANHYDLIVVGSGAGGLTAAATAAHAGLSVLVLEKA
                     ELLGGTSAVSGGMLWVVDNHYAREAGFADSKQAGREYVEAVARGRGRAELLDAALLHG
                     SDMLEFIEDELDVKFLFLDNFPDYRQDLPGAVHGGRTIEPQLFNYREALGKLADYVRT
                     DGRHPYTMQEYETWGAFTKFPWDELNKRVEDGFAAKGHALVAMLIAACIRLNVTFAVD
                     ARVTKLLGDAQQVTGIELEEGHTISAGSVMIASGGFEWDRQLADSLLATRLYTMCSPP
                     TNTGDGLKMAQRIGAATRGTREAWWAPMSITGGMRDGEPIGSLLRFERQGPGSIMVNR
                     HGQRFANEAQNYNDLARCLQSWDSPNNQTLNTPAHVVFDQSYLDRYGILDHRSGQPTP
                     DYLIEAATLEELAAKLNVPASNLTATVERFNQMALKGVDEDFGRGDSEYDRYWGDADS
                     PWPNPSLGPLQQGPFYAMEVVNGAFGTCGGIATDGNAQVIDVDGNPISGLFAAGNATE
                     SPYASGYPGAGATLGPLMTMAYQAGRTIAATVRIPAESHAS"
     CDS             75667..76506
                     /codon_start=1
                     /locus_tag="cgR_0065"
                     /product="hypothetical protein"
                     /protein_id="BAF53026.1"
                     /transl_table=11
                     /translation="MEQSVPLNGFLFGGWRFSYGLMGILRLMTHTTKRVEGKVAFITG
                     AASGMGASHARVLAAHGAKVVITDLNDELGQELVKEIGEEKAHYVHLNVTSFEEWEVA
                     VQKALERFGKIDTLINNAGIFSSGSVEDATAADWDKTIAIDLNGTFYGMKAALPALKE
                     NPTASIINISSIAGVTGFKNRAAYSAAKWGVQGLTKTSAMDLGKYNIRVNSVHPGSVE
                     TPLTANLKRGLGQIPLGRAAQVEEISNLILYLSSDESSFVTGSSFVIDGGETAGNNLR
                     DDQ"
     CDS             complement(76511..77314)
                     /codon_start=1
                     /locus_tag="cgR_0066"
                     /product="hypothetical protein"
                     /protein_id="BAF53027.1"
                     /transl_table=11
                     /translation="MANSPSGESMIARVVRLLSVFPKYNRPLSVREIAEYASLPVTTT
                     HRLLKELEAEDLVTRMTDGGWQHGTRLWEIASRNSPVQSLRDAALPPMEDLVAGLRVH
                     VSLAILDRHEVLYLERITPDDYTVNITSVAGRLPAHATSAGLVLHAFGSQEGQRLFLS
                     RGHARFTETTPTEIEQLKEKLSRARIDGFVASLGTIIPESTGISVPIFGPKKLAIAAL
                     TVIVPIGDEDLDLIVPQMKITARAIQRRTGVVPEINSRVTRETRQSPLG"
     CDS             77357..79504
                     /codon_start=1
                     /locus_tag="cgR_0067"
                     /product="hypothetical protein"
                     /protein_id="BAF53028.1"
                     /transl_table=11
                     /translation="MELPQDLNPGSTLAIFLTAEPDVDNISITRGRVRHAKDPLAVAA
                     AWRARAEKDNLSIRELVIEAAARTSFVGTYKSVAEQINEFIQQRAADGFILVFVGGGP
                     RTTGILLRLAANIPAEGAPITDIHVVDLYPAGSGRIWRTKQSGLLWMNSMAQDVTIFA
                     DDSVEMAGPVIPGPSLAEWVLGIGREQVKAAGLGEELEHFSGRSFASRRLQSLYLDWA
                     FQEAVARLGKVTVHEALAIGLDDSQTVHLDNGLKIHADTVVLTQGHLDMVKSPESAAL
                     ASIAATEGLAYVPPGFTADQDLSVLPSGKPVLVRGFGLAFIDAMVLLMEGRGGTFVTV
                     DDQLEYIASGEEPELWVGSRRGVPYLPKIGYSVPLYTEAPLYFDDDSLSAFGFVLDYR
                     EHIFPLLTWNLQYAHYGQLLATDPSRATVPWGELSAALHRTLPPELGGSDHDISAFLE
                     SAIPDPADRFDFLKLDKPLTELHFTTQEELSDHIANYISDRIKRASDPRYSMDQAVFF
                     TLLKIYFRVHELAETGHFTLNDLRENIDRSPHNLFSYIASGPPPIRLEQLLALNRAGL
                     VHFLGPDIRIGIDDTHFTASSTATQGEIKAKALIDAYLASDSASAVDDTLLQNLLQAG
                     EVTVESIDGSIWGKFLVDGIGRPIRHDGTTHPSRFLLGPLVSGGGSEAPFSRPGTNAR
                     GFQRADRLARKLLDLDEELDTDIQLATASRHPD"
     CDS             complement(80263..81735)
                     /codon_start=1
                     /locus_tag="cgR_0068"
                     /product="hypothetical protein"
                     /protein_id="BAF53029.1"
                     /transl_table=11
                     /translation="MTINVSELLAKVPTGLLIGDSWVEASDGGTFDVENPATGETIAT
                     LASATSEDALAALDAACAVQAEWARTPARERSNILRRGFELVAERAEEFATLMTLEMG
                     KPLAEARGEVTYGNEFLRWFSEEAVRLYGRYGATPEGNLRMMTTRKPVGPCLLITPWN
                     FPLAMATRKVAPAIAAGCVMVLKPARLTPLTSQYFAQTMLDAGLPAGVLNVVSGASAS
                     AISNPIMEDDRLRKVSFTGSTPVGQQLLKKAADKVLRTSMELGGNAPFIVFEDADLDL
                     AIEGAMGAKMRNIGEACTAANRFLVHESVADEFGRRFAARLEEQVLGNGLDEGVTVGP
                     LVEAKARDSVASLVDAAISEGATVLTGGKAGTGAGYFYEPTVLTGVSTDAAILNEEIF
                     GPVAPIVTFQTEEEALRLANSTEYGLASYVFTQDTSRIFRVSDGLEFGLVGVNSGVIS
                     NAAAPFGGVKQSGMGREGGLEGIEEYTSVQYIGIRDPYAG"
     CDS             complement(81844..82167)
                     /codon_start=1
                     /locus_tag="cgR_0069"
                     /product="hypothetical protein"
                     /protein_id="BAF53030.1"
                     /transl_table=11
                     /translation="MLRARSDQIVLVFGEESGGEFLRSNVVPLHRLWIFQLRCHEGGP
                     SLIESTEVCRSWVVLVVVGAQQRFRRTTRKHVAELPAGRCGRSINPSKLSAMLVNLWV
                     SMPLI"
     CDS             82192..82629
                     /codon_start=1
                     /locus_tag="cgR_0070"
                     /product="hypothetical protein"
                     /protein_id="BAF53031.1"
                     /transl_table=11
                     /translation="MGRRFKSDIALRRCDAVTTHIGHEHSADGGWKKAKTHHSTASLQ
                     KTATATQSSISRPSTSSITTPSTCSMRQRSSSHELDHTSCKTSKTSGPHWIPRTSSSP
                     VASAAMAQLLSFAQTSTSQQSSRLRTLPDWPSSSMAICLSHKP"
     CDS             82281..82622
                     /codon_start=1
                     /locus_tag="cgR_6004"
                     /product="hypothetical protein"
                     /protein_id="BAQ21066.1"
                     /transl_table=11
                     /translation="MEESEDSPLNRFTPEDGDRNAIFDIKAIYQQHYHSFDLFDAPEV
                     FFPRVGPYKLQNLENVWTALDSQDIFESRGISRDGAIVVVRPDQYVAAVLPLEDTAGL
                     AEFFNGNLLEP"
     CDS             82789..84159
                     /codon_start=1
                     /locus_tag="cgR_0071"
                     /product="hypothetical protein"
                     /protein_id="BAF53032.1"
                     /transl_table=11
                     /translation="MLIERIYDEDLAQASYFIGCQAHNTAVVVDPRRDIAIYLDMAKK
                     NGMEIVGVTETHIHADYLSGTRELAAATNATMYVSGEGGADWQYEFDAERLYDGGEIR
                     LGNLVLTAVHTPGHTPEHLSFLLKDGAFADEPGFMLTGDFVFAGDLGRPDLLDQAAGG
                     VDTRFEGARQMFKSLKEKFLTLPDHIQIFPGHGSGSACGKALGSVPSTTLGYERQFAW
                     WGKYLEADDEQGFIDELLEGQPDAPAYFGRMKRQNRQGPAIMGAREPLPQLEASDLHD
                     VIVVDTRSADEVHQGTVAGAVNIPAGNSMAKFGSWTVDPEKDSRALVLLAASQIGAME
                     MWDHLVRVGIDNVAGFVTNFDGVDLVAPQTVSPDELDKFEYDLLLDVRNRSEVEEGYI
                     PGALHINGASVLWNLEKLPRDGKIVSYCKSGTRSSIAASTLRNAGFDVVELEGSYDNW
                     VRHNAQ"
     CDS             complement(84235..84981)
                     /codon_start=1
                     /locus_tag="cgR_0072"
                     /product="hypothetical protein"
                     /protein_id="BAF53033.1"
                     /transl_table=11
                     /translation="MTATLIITLFLSLFIGISLGLLGGGGSILTVPILTYVAGLEPRE
                     AIAASLFVVGTTSLVSAISHARNGRVRWKTGLLFGAAGMVGAFGGGLLGGYIPGTILM
                     IAFALMMIATSTAMLRGRKEKKGASKSSLWRVLVDGLVVGAVTGLVGAGGGFLVVPAL
                     ALLGGLSMPVAVGTSLVVITMKSFAGLAGYLTSVQLDWGLVLMVTAAAIVGSLAGSRL
                     AGRVPETLLRKGFGVFVLVMGVFVLGLELL"
     CDS             complement(84991..85284)
                     /codon_start=1
                     /locus_tag="cgR_0073"
                     /product="hypothetical protein"
                     /protein_id="BAF53034.1"
                     /transl_table=11
                     /translation="MPITITETNKRRNLDQILDVRENFEITEGMIPEAIHIPMGDLSF
                     RFKELDQNRPVIVVCRSGNRSTQVANALKQAGYTAYSMTGGMSAWYQNNLPIK"
     CDS             complement(85285..85878)
                     /codon_start=1
                     /locus_tag="cgR_0074"
                     /product="hypothetical protein"
                     /protein_id="BAF53035.1"
                     /transl_table=11
                     /translation="MTSTQPITSVDAQTLKSWIDKREGLTIIDVRTSHEFSNLHIRGS
                     YNVPLTTLAEHSEEIASRVGEHVVLVCQSGIRAGQAQQKLAPLGISTVAVLEGGINSF
                     AKTDGDVVRGTQVWDIERQVRFAAGSLVLAGLAGGKFLSPKVRALSGIIGAGLTFSGV
                     SNTCAMGKALSALPWNKTKPVPTKAETLSKLPSPKEN"
     CDS             86004..86261
                     /codon_start=1
                     /locus_tag="cgR_0075"
                     /product="hypothetical protein"
                     /protein_id="BAF53036.1"
                     /transl_table=11
                     /translation="MQLNPDEITPVLNRLKRAQGQLTGVIRMLDEGEDCKAVVTQLSA
                     VAKALDRAGFAIIATGLEQCLTNPDGDMDKKELEKLFLSLA"
     CDS             86722..87579
                     /codon_start=1
                     /locus_tag="cgR_0076"
                     /product="hypothetical protein"
                     /protein_id="BAF53037.1"
                     /transl_table=11
                     /translation="MRTVFQLVQDFHKKARGEGLPIKWGPSRGEFGVLEFPADVIPEN
                     IKHIAQTKFQTEATSVEDIRRAINLLSDQAERAGASFNPGFILAQVGSTIVEVYGGAP
                     VAWLDAVELLISPDVEWVGVHGSRKLDINVSGELSGVISAGDKLGELLGDDWTINIVH
                     GEYKIQIEDAQLCTAFFADAAELINKANAEIVPFHVRMLSNSKIVMSGFSDYSLAGDS
                     ITLAGKLAELARPFAHWKENIIPKIEIAMDYEPLPVADLWQEDSSEAPEPFDDFERLL
                     REEILITEF"
     CDS             87726..88568
                     /codon_start=1
                     /locus_tag="cgR_0077"
                     /product="hypothetical protein"
                     /protein_id="BAF53038.1"
                     /transl_table=11
                     /translation="MMIGMSNQTVKQTVPSGVKVSPHRFNRFEIKYLIPEQDVPALRE
                     QLATRMSTDPLSPPGGYRVESLYFDSADLRCYTEKIEGLKFRRKLRIRTYGDGVLTPE
                     STVSVEIKQRVNKVTQKRRLDLPFIYALALGDSTGAAVGEQVDVEKLLEISPENQHAL
                     IHEMASFAKNYRLRPIATTKYHREAFVGADAEASSRVTIDHGVSGRDRDFLLGQDLED
                     RPTVAQGLAVVEIKCDERVPFWLTDMTAQLEMSVIRMSKYCETIEAFHNRPASAFGAV
                     DPIF"
     CDS             88587..89300
                     /codon_start=1
                     /locus_tag="cgR_0078"
                     /product="hypothetical protein"
                     /protein_id="BAF53039.1"
                     /transl_table=11
                     /translation="MLSDLSSIFDFQDLSGTFSVVDVLITLVLSFVLTSIVGVVYQKT
                     HRHISYSQSFVQTLVLVGMVIAIIMLVVGSNIARAFALVGALSVIRFRNAVKETRDVG
                     FLFLAMAIGMTCGTRFYVLAIAATIVVCGVLFIMYRFDWFKADIQRQVIKVQVPADGQ
                     ADSGRSYAEEVELILAQYCTSFEMMSAESVRGGALTEFSYTAQMRKNVKPHELVAKMR
                     DVNYGQKATVLTGHDQTDV"
     CDS             89304..90980
                     /codon_start=1
                     /locus_tag="cgR_0079"
                     /product="hypothetical protein"
                     /protein_id="BAF53040.1"
                     /transl_table=11
                     /translation="MPSFKSARWRMNRRLFLGTSAAIIAVGGVLGGVQVVPYISSGEI
                     QTSASSTATIDVGAGNVDIFDTSVSHEISLQVSQESLDEMLADYQEDGSKTWVKATIT
                     IDGVTIENVGIRLKGNSTLSGLGRTSEEGGPQAPEGVEEFTDLSEEEIAQFEEQFAAQ
                     QGTTDASETGETAETEETRGPGGGMGGGGMGGMTSVDADDVSTWPLLISFDKYEDGRV
                     YQGMTQLALRPGTTVVNEAMALALTAETDQVSQQSSFTTFSLNDEPSTTRLLLEHPDE
                     NYADALGNGVLFKADSNSSFTYQGEDQTEYDGQFKQINGDGNGDIQPIINLLKWLDTA
                     SDEEFAEHLSDYVDVESFARYVATQNLLVNSDDMAGPGSNYYLWYDYDTGLISVISWD
                     LNLAMSGSTDAGPDDEISMGGGGGMRPGGTTDTEIEGTTTEDMPAMGEMADTENMPDM
                     ANMQQGERPEGMPDMGEMPDREGGGSMGGNQLKERFLASDAFTEIYEQVYWELYEEMY
                     GSGTAIELLDEIAASIPETDAVTADEIATEVASMREWITARTEALAALQE"
     CDS             complement(91043..92164)
                     /codon_start=1
                     /locus_tag="cgR_0080"
                     /product="hypothetical protein"
                     /protein_id="BAF53041.1"
                     /transl_table=11
                     /translation="MPKNYDINGAIRRRDMLRRRYLPDSANSTPVPEEVSPLTRYVTD
                     GIPKRPPLGATVADGLKFAEGASNRMVMSLYPAPSKPAIEELAEAWDLHPTIVEDLLL
                     GQQRPKLDRYEDIIFIAIRSARYIDSREEVDFSEFHILMKPQAIAILCQDNQWIDGTS
                     AASFSDPEQIDKRIKTLLADAELLSSGPRAVAYRLVDAIVDGFSPVLRGIAIDQEQIE
                     RQVFSGDAAVAERIYNLSQEIIDMQHTTSSVTEVVQRLNKDFIRSGMSEELRAYLDDV
                     ADHLTRDNTRVSEYRESLSQILNVNATLVAQRQNEDMKKISGWAAIIFAPTLVSSIYG
                     MNFDIMPELHWAFGYPLALLAMLGFTLLLYWIFKRSKWM"
     CDS             complement(92247..92696)
                     /codon_start=1
                     /locus_tag="cgR_0081"
                     /product="hypothetical protein"
                     /protein_id="BAF53042.1"
                     /transl_table=11
                     /translation="MPTYTCWSQRIRISREAKQRIAEAITDAHHELAHAPKYLVQVIF
                     NEVEPDSYFIAAQSASENHIWVQATIRSGRTEKQKEELLLRLTQEIALILGIPNEEVW
                     VYITEIPGSNMTEYGRLLMEPGEEEKWFNSLPEGLRERLTELEGSSE"
     CDS             92847..94118
                     /codon_start=1
                     /locus_tag="cgR_0082"
                     /product="hypothetical protein"
                     /protein_id="BAF53043.1"
                     /transl_table=11
                     /translation="MSTIPLNRLAVIAAIIGVGTGLFVAALNWSAIGVERLVYGADHL
                     HNHNPVANVSPLRLSITVIVLSVVASWAWFFVHRTGSKEVSIVGAIRGEKMPILETIA
                     SAFLQVTTVAAGAPVGAENAPRIAGALVGERFSRWLQLDIDAKRILVASAAGAGLGAS
                     FHLPLAGVLFALEVLLVEASTRTVVIAIITTTAAVATTGFFVQTPDVFSTVPLTESPW
                     MLLAAMVTGVVAGMCGHWFSAAAHKMAQASPKGVRILWQMPLGFVVIAAVIYFFPETL
                     ANPRWLADSMLGDGLILSTILLVLVLRTAMFLLAFRVGMVGGNLIPAFALGSMVGGVV
                     GAVLEPITNVPIAAFALLGAAAFLSTTMAAPLFGLIAAVEFTDMEAQGYLPIFLAVAS
                     AVLAVRVWSVIAKRELRAIPITYASWTGELK"
     CDS             complement(94162..94854)
                     /codon_start=1
                     /locus_tag="cgR_0083"
                     /product="hypothetical protein"
                     /protein_id="BAF53044.1"
                     /transl_table=11
                     /translation="MNPITELLDATLWIGGVPILWREIIGNVFGLFSAWAGMRRIVWA
                     WPIGIIGNALLFTVFMGGLFHTPQNLDLYGQAGRQIMFIIVSGYGWYQWSAAKRRALT
                     PENAVAVVPRWASTKERAGIVIAAVVGTLSFAWIFQALGSWGPWADAWIFVGSILATY
                     GMARGWTEFWLIWIAVDLVGVPLLLTAGYYPSAVLYLVYGAFVSWGFVVWLRVQKTDK
                     ARALEAQESVTV"
     CDS             95384..96643
                     /codon_start=1
                     /locus_tag="cgR_0084"
                     /product="hypothetical protein"
                     /protein_id="BAF53045.1"
                     /transl_table=11
                     /translation="MLLSDPLSLTRFAEHDVVLPIVVITELEAKRHHPDLGFFARQAL
                     RMLDELREIHGDLSKPLPIGDEGGHIHVELNHQNAESLPVGFRLGNNDTRILAVAKNL
                     QEEGHNVVLVSKDLPMRIKASASGIAAQEYRAALARDRGYTGMTHANITDDQLSELYD
                     TGEVRIEELEKLPVNHGFTLKSNSGSALGRMNSDKIIELVPGDQQVFGISGRSAEQRV
                     AIDLLNDDAVGIVSIGGPAGTGKSALALCAGLEAVMERRIQRKIIVFRPLFAVGGQEL
                     GYLPGDQEEKMGPWAQAVFDTLSSMVSQNIIDEALSRGLIEVLPLTHIRGRSLHDAFV
                     IVDEAQSLERNVLLTMLSRIGQNSRVVLTHDVAQRDNLRVGRYDGIVSVVEALKDHEL
                     FGHITLQRSERSRIAELVTQVLDAPSL"
     CDS             96737..96844
                     /codon_start=1
                     /locus_tag="cgR_0085"
                     /product="hypothetical protein"
                     /protein_id="BAF53046.1"
                     /transl_table=11
                     /translation="MAIGTAVNPGSLQGKDPPRLSGNLGSVVDSCKIGL"
     CDS             complement(96904..97290)
                     /codon_start=1
                     /locus_tag="cgR_0086"
                     /product="hypothetical protein"
                     /protein_id="BAF53047.1"
                     /transl_table=11
                     /translation="MSNREYGLGFRSFIVGIIFAALWLVFTGANEFSQMQVIGACTNF
                     VLICAALTFWGYRQRLTAKRVITRVSAGLTLAIGAAFAAISAPFDETGLWGVGLVFIA
                     VGSYAGAALVSSIVLALLSLSHLRQQ"
     CDS             complement(97373..98953)
                     /codon_start=1
                     /locus_tag="cgR_0087"
                     /product="hypothetical protein"
                     /protein_id="BAF53048.1"
                     /transl_table=11
                     /translation="MSSSTLLLASGQVTALAADYSLSHTPSDGILVVLGFAMILTFMT
                     LIMLGRMTPMVAMLLVPTIFGLIAGAGLGLGDMALDAIKDMAPTAALLMFAIMFFGIM
                     IDVGLFDPLIRGITRVLHDDPAKVVLGTAILAGVVSLDGDGSTTFIITTSAMLPIYLR
                     LGMSPVVLTCTAGLINGTMNILPWGGPTVRAAAALGLEPADVFVPMVPSLIAGVVICL
                     LFAWFLGLSERKRLGKIDSSRFGGPGLDAPETGTGSGSSPNKKGFPGLGGLGKAKNAP
                     KPGPTGGVLVEDREVETEQHINLDDSTLTENMTDTLLDPHRATLRPKLFWFNAALTLV
                     VMVLLVADIFPLAFVFMAGAGLALAVNFPKVKDQATEMLAHSSSIVGVVSMVLAAGVL
                     VGVLSGTGMVDAMATWITTVIPNAMGPHLAVITGLLSIPMTFFMSNDAFYFGILPVLA
                     ESASHFGIEPVEMARASITGQPVHMQSPLVPAILLLVSLANVNLGDHHKKVLWRACIV
                     SIAMLAVALFIGVVPLSA"
     CDS             99122..100816
                     /codon_start=1
                     /locus_tag="cgR_0088"
                     /product="hypothetical protein"
                     /protein_id="BAF53049.1"
                     /transl_table=11
                     /translation="MLHALLIITPGGRYVCWSIRTKNFKEVDIIRFATRILVIQVATV
                     ALVVAICTGIFAVLMMDQMKTEAEHTALSIGRSVASNPQIREEVALDTQTGANPSAEE
                     LADGDIQAVAQAANERTGALFVVITDGLGIRLSHPDEERLGEQVSTSFEAAMRGEETM
                     AWETGTLGASARAKVPIFAPDSNVPVGEVSVGFERDSVYSRLPMFLAALALISVLGIL
                     IGVGVAMGMRRRWERVTLGLQPEELVTLVQNQTAVIDGIDEGVLALSPNGTIGVHNEQ
                     AQSMIGAGPMSGRTLKELGLDLGLDGVVLHGQHPETVAHNGRILYLDFHPVRRGDQDL
                     GYVVTIRDRTDIIELSERLDSVRTMTHALRAQRHEFANRIHTATGLIDAGRVHDAAEF
                     LGDISRNGGQSHPLIGSAHLNEAFLSSFLSTASISASEKGVSLRINSDTLILGTVKDP
                     EDVATILGNLINNAIDAAVSGEAPRWIELTLMDDADTLVISVADSGPGIPEGVDVFAT
                     ATQIGDSEDNERTHGHGIGLKLCRALARSHGGDVWVIDRGTEDGAVFGVKLPGVME"
     CDS             100816..101472
                     /codon_start=1
                     /locus_tag="cgR_0089"
                     /product="hypothetical protein"
                     /protein_id="BAF53050.1"
                     /transl_table=11
                     /translation="MDQTLKVLVIDDDFRVAGIHASIVDASPGFSVVGTARTLAEAKT
                     LIATFSPDLLLVDVYLPDGDGIDLVGTSNIDAFVLSAADDIKTVRRAMRAGALGYLLK
                     PFPQKRLVERLDRYVRYRHVLSGTQGLSQDKIDQATAILNGTQAPVTVSRSATEQLLL
                     DALEGQELSATEASEAAGVSRATAQRRLAAMASQGVIQVRLRYGQSGRPEHLYSKPLL
                     "
     CDS             complement(101469..102383)
                     /codon_start=1
                     /locus_tag="cgR_0090"
                     /product="hypothetical protein"
                     /protein_id="BAF53051.1"
                     /transl_table=11
                     /translation="MKIFVGFGDYPLTTKALKEAGAEIVDSLEKAEGFVFTQTPGTEF
                     PLLPDGVRWVQFPNAGLNAYFTAGQIDDKRRWSNASGVYGQQVAEAAMGLLLGLIHMH
                     PTMVRADSWAPRTHVDQQTRWLDGAIVAIVGAGGIGKHLAAMLKPFGAKSLSVSRTGT
                     PTQDFDATEPISNLHQVLADADHVVLCVPLTADTYHLIGKAELKAMQSTAILINVARG
                     EVVDTEALVDALDAQEISGAGLDVTDPEPLPDDHPLWGRSNVIITPHVANTLTSMDRM
                     LAPVVAENYRRLLAGEKMLTEVDIHKGY"
     CDS             102499..102930
                     /codon_start=1
                     /locus_tag="cgR_0091"
                     /product="hypothetical protein"
                     /protein_id="BAF53052.1"
                     /transl_table=11
                     /translation="MSISNAILRGVSGAYILQSGYGKLGLPNEAAAGIQGLAATGIPA
                     VADMDSDTFGKFVAYSELGIGGALLAPFIPSRLAGLGLGAFSAGLLAIYFRNPAMTQD
                     DGIRPSQDGTGLSKDLFLAAIAGALVFAPAKKRKKAKNKSK"
     CDS             103145..104149
                     /codon_start=1
                     /locus_tag="cgR_0092"
                     /product="hypothetical protein"
                     /protein_id="BAF53053.1"
                     /transl_table=11
                     /translation="MTIPATILDTARTQVLEQGIGLNQQQLMEVLTLPEEQIPDLMEL
                     AHQVRLKWCGEEIEVEGIISLKTGGCPEDCHFCSQSGLFESPVRSVWLDIPNLVEAAK
                     QTAKTGATEFCIVAAVKGPDERLMTQLEEAVLAIHSEVEIEVAASIGTLNKEQVDRLA
                     AAGVHRYNHNLETARSYFPEVVTTHTWEERRETLRLVAEAGMEVCSGGILGMGETLEQ
                     RAEFAVQLAELDPHEVPMNFLDPRPGTPFADRELMDSRDALRSIGAFRLAMPHTMLRF
                     AGGRELTLGDKGSEQALLGGINAMIVGNYLTTLGRPMEDDLDMMDRLQLPIKVLNKVI
                     "
     CDS             104161..104400
                     /codon_start=1
                     /locus_tag="cgR_0093"
                     /product="hypothetical protein"
                     /protein_id="BAF53054.1"
                     /transl_table=11
                     /translation="MNDDLQMAMILADTPIFHPNTGKPFDGEHKLSPSARAGLEAPRY
                     CQLCGRRMKVQVRPDGWDALCSRHGFVDSSYLGRR"
     CDS             104352..104693
                     /codon_start=1
                     /locus_tag="cgR_0094"
                     /product="hypothetical protein"
                     /protein_id="BAF53055.1"
                     /transl_table=11
                     /translation="MLPPRFRRLLLSRASIMRGHLIDGDGRCIHYHGPFDVVGNKCAT
                     CNEWWACHRCHEEIANHPFGKMLIDAPSSLQCGHCGELMAYGVQKCPRCGHNFNPGCS
                     LHTPLYYEMPS"
     CDS             complement(110791..112242)
                     /codon_start=1
                     /locus_tag="cgR_0095"
                     /product="hypothetical protein"
                     /protein_id="BAF53056.1"
                     /transl_table=11
                     /translation="MSNASFKGDDKGLIGIVLSVLTFWLFAQSTLNIGPDMATDLGMS
                     DGTMNIAVVAAALFCGTFIVAAGGIADVFGRVRIMMIGNILNILGSLLIATATTSLAT
                     QMVITGRVLQGLAAAAIMSASLALVKTYWLGTDRQRAVSIWSIGSWGGTGFCALFAGL
                     VVASPFGWRGIFALCAIVSIVAVALTRHIPESRPAQSIGMHLDWSGIIVLALSVLSLE
                     LFITQGESLGWTHWITWTLLAVSLTFLAVFVFIERVASWPVLDFNLFKDHAFSGATIT
                     NFIMSATGGVVAVVMWVQQMGWGISPTISGLTSIGFAAFVILFIRVGEKAMQKVGARA
                     VIITAGILVATATALLMITAVSESTYIVISLAGFSLYGLGLGLFATPVTDTALGTLPK
                     DRTGAGAGVFKMSSSLGAALGIAISTSVFLALRDGTSINSDVALAGTVALGINVVFAA
                     TATITAAVLIPKAAGKVSQTSITLPEPAIAVKI"
     CDS             complement(112362..113609)
                     /codon_start=1
                     /locus_tag="cgR_0096"
                     /product="hypothetical protein"
                     /protein_id="BAF53057.1"
                     /transl_table=11
                     /translation="MRITNAQVKNYTELVDITIEGEKISSITPSSIRSEEDHRTDDYD
                     AAGRLVTPQFAEAHIHLDYANTAGIPRENSSGTLFEAIEIWADRKTQGFHIKEDIKAK
                     ALQAARRAAEHGVGFIRTHVDVTDPTFAGFEAIAELRDEVREWCDIQIVAFPQNGIYA
                     YEGGQKLISDAMSAGADVVGGIPHLEPTRDDGVESVKWLFDLAEKHSASIDIHTDEID
                     DPHSRFVEVLAAEAAKRDMGAQTVVSHSVAMAYYSPGYMARLLPKLAASKVRFAVCPN
                     ENLHLQGLGFQGPVPRGVAPVKQLTEWGIPVSFCQDSLNDPFYPMGDGDLLRILDSGL
                     HVSHMLTASHLKNALSFITTNPAGNLGLDNYDIAENSPANLLVLDASSEKEAVQRKAS
                     VLLSIHRGKKVLSREPEQVDWNI"
     CDS             complement(113853..114374)
                     /codon_start=1
                     /locus_tag="cgR_0097"
                     /product="hypothetical protein"
                     /protein_id="BAF53058.1"
                     /transl_table=11
                     /translation="MTMSFLNSAKTKTVAFTATFVGAATLATPAIASADIIDNALAAL
                     PSGEISCSQAEKYWTTEADYNSKVAQANALAMFDSRGPQIKAALARVDEAANRCGLKG
                     GTVAAQAEATEAAPAAPAPATTPEVAAAVAPAINLAPAGSPAFTIEVPGVGTVQLPDL
                     NKSVQQFLAQFTA"
     CDS             114466..115392
                     /codon_start=1
                     /locus_tag="cgR_0098"
                     /product="hypothetical protein"
                     /protein_id="BAF53059.1"
                     /transl_table=11
                     /translation="MFDELTARAHNSALRSIARVVAETVEPMGEDVARVGVVKQLKAG
                     NVLAVTGAGVSTDSGIPDYRGPKGSLSRHRPMTYQEFRHDPAASHRYWARSFVGWRVM
                     DQARPNRTHYAMVELEQHGFLSGVVTQNVDGLHAEAGTKNLVALHGDLAHVMCLNCGF
                     GEDRHLFDERLEAANPGYVASIRLEPGAVNPDGDVFLDEEQVRRFTMIGCLRCGSLML
                     KPDVVYFGEPVPAARKKDLKKLLDASSSLLIAGSSLAVMSGYRIVIEAQRQGKQVSVI
                     NGGPGRADSRVDILWRTRVAPAFDDILDALDL"
     CDS             complement(115734..116708)
                     /codon_start=1
                     /locus_tag="cgR_0099"
                     /product="hypothetical protein"
                     /protein_id="BAF53060.1"
                     /transl_table=11
                     /translation="MVDALNDLRRELTNALRSVWKNLPTENAPQADALPDDVVEEIAT
                     NFYRNPKNRGKLNEDKTDSLPMLARIRSRGLFEDDWRARPTEDRPWPVVLVHGTGSTK
                     GDWQDLGADLRRDGWAVFAPEFGQRATGSVAESSAQIGAYIDTVLLATGASKVIVVGH
                     SQGGVLLRYWMRVLGGASKVKHMVSLAVPNHGTTMGGIVSPLIRNNRGESVVNSVVQS
                     WFGEAGFEMIRGHDTINAINEGGDLDPDVTYLCIATHFDTVIQPPETCFLEARNPEEL
                     KRVQNIWVENLDPNSVVLHEAMPYDPRVRALVRADLSKLVEISETAEN"
     CDS             complement(116718..117620)
                     /codon_start=1
                     /locus_tag="cgR_0100"
                     /product="hypothetical protein"
                     /protein_id="BAF53061.1"
                     /transl_table=11
                     /translation="MSQENSGLFKRAISRGVAKVRRNPREDFAEEFTQELYDHATNIT
                     LPLTARLKPKGFFQDDWRARPSGARPWPIVLIHGSGASKGSWEEMGAELRSKGWAVFA
                     PDFGTRATEPIAASAAQIGAYIDAVLLVTGAAQIVLVGHSQGGVVARYWMRTYGGYMK
                     VRHMISISTPNHGTLMGGILNPMTKVKSGEGTIEKLMHRLFGPTGFEQLRGHDIIEFL
                     ADGGDLDPGVTYTCVGTHFDPFIQPPEVAFLEVSEDDDPNRVHNIWVEDEHPRAMIAH
                     NDMVRDPRVIEIVRAELDRVARLG"
     CDS             117791..118624
                     /codon_start=1
                     /locus_tag="cgR_0101"
                     /product="hypothetical protein"
                     /protein_id="BAF53062.1"
                     /transl_table=11
                     /translation="MNNVQQFHRFFDDSAVYYPCFVPLDRAIGEHFDRQNKPMSRFIG
                     TLILPLAKLEEAAQYTGDEVLRVSAVISTDELADLRRDFYELPNIDIASVEIKLVGAA
                     LTNTAWLGDVEKLIQQHRNTFVWVEIPTALVTADIVRKLRHMGAGLKYRTGGDREELF
                     PTPQDLITVLRTAIDAALPFKLTAGLHRALRYRDEKTGRLHFGFLNIAATVATLRAGK
                     GEAEALSVLEGDDAAPLIHALQIGGNWRDSFRSFSTCNVVEPLNTLIDLDVLAEGDVH
                     P"
     CDS             complement(118634..118942)
                     /codon_start=1
                     /locus_tag="cgR_0102"
                     /product="hypothetical protein"
                     /protein_id="BAF53063.1"
                     /transl_table=11
                     /translation="MSPLQVADKTGMKKSAISNLLKPLLAESLIVQVTAENDRRSKVL
                     SLSEKGTTYIQKTATRQNALESEWFGTLTDIEQDLLESLLRKLLDSNRASKVRKNRSN
                     "
     CDS             119349..119651
                     /codon_start=1
                     /locus_tag="cgR_0103"
                     /product="hypothetical protein"
                     /protein_id="BAF53064.1"
                     /transl_table=11
                     /translation="MHITPREQEKLMIVVAADLARRRKDRGLKLNHPEAVALITYELI
                     EGARDGRTVADLMSWGSTILTRDDVLEGIPEMIPDIQVEATFDDGTKLVTVHNPIR"
     CDS             119678..120154
                     /codon_start=1
                     /locus_tag="cgR_0104"
                     /product="hypothetical protein"
                     /protein_id="BAF53065.1"
                     /transl_table=11
                     /translation="MIPGEYILSSESLTGNVGREAKTIEIINTGDRPVQIGSHFHFAE
                     VNPSISFDRSEGYGFRLDIPSGTAVRLEPGDARTVNLVAIGGDRIVAGFRDLVDGPLE
                     DLKVNVWEGREDDWRRSSAAGDAPQELPQVEAAERGRKLDEATDVGTEDTPEEGQN"
     CDS             120155..121867
                     /codon_start=1
                     /locus_tag="cgR_0105"
                     /product="hypothetical protein"
                     /protein_id="BAF53066.1"
                     /transl_table=11
                     /translation="MSFEISRKQYTDLYGPTVGDSVRLADTELFLCVEKDYAAIGEEV
                     AFGGGKVIRDGMGQNGTLVRDVDIPDTVITNVIVLDYTGVYKADVALRDGKIFRIGKA
                     GNPNVMENVDIVIGVATDIIAGEGKILTAGGIDTHVHFLGTDQVNTALASGITTMIGG
                     GTGPSQASMATTVTPGQWNTYNMLSAFEGMPMNFGILGKGHGSSKSPLAEQVRAGAIG
                     LKIHEDWGATPSSINTALEVADDMDIQVALHSDTLNEAGFVEDTIEAIAGRVIHTFHT
                     EGAGGGHAPDLIRVAALPNVLPASTNPTLPYTRNTVEEHLDMVMVAHHLNPDIPEDVA
                     FADSRIRAETIAAEDVLHDMGIFSITSSDSQAMGRVGETITRTWQVADHMKRTRGSLT
                     GDAPYNDNNRLRRFIAKYTINPAIAHGVDYVVGSVEEGKFADLVLWDPKFFGVKPDLV
                     IKGGLMVNSLMGDSNGSIPTPQPRTLRNTWGAFGQAVSRSSITFLSQDAIDANVPDLL
                     NLRKQIRGVRGVRNLTKRDMKLNAEMPDIRVDPETYQVFVNGELITSKPAETVPMARR
                     YFLF"
     CDS             121892..122365
                     /codon_start=1
                     /locus_tag="cgR_0106"
                     /product="hypothetical protein"
                     /protein_id="BAF53067.1"
                     /transl_table=11
                     /translation="MIITAIDTNIYDQPEFVEGRDVIGVRFEDLVLDKRIQRVALSGG
                     EELGLRLNHGHPILREGDVLKADDKTVFVVEIIPTDVLVITPSDIHQMGFVAHSLGNR
                     HLPAQFSKPGELTEKAAMIVQYDHTVVSFLDDHDIEYQRTELVPPIPFRHSGHTH"
     CDS             122365..123045
                     /codon_start=1
                     /locus_tag="cgR_0107"
                     /product="hypothetical protein"
                     /protein_id="BAF53068.1"
                     /transl_table=11
                     /translation="MDLDADFLLLHLSDSALPTGAFAHSFGFETYMDAERITNAEEFQ
                     DWLKVLLKVQLTSSDALAMRMFYATPTASELKRLDERLFAGTPAREVREANARMGTRM
                     AEIVAETYSVPLIIEYLELIKNRELSGHPALALALATHSMGIDVDRAIHAHLTATVSS
                     LIQNAVRGIPLGQMAGQRVMFAMREHIGAAVKRSAMLDAIDFCSGDPGLDISQMVHET
                     QRARLFMS"
     CDS             123062..123679
                     /codon_start=1
                     /locus_tag="cgR_0108"
                     /product="hypothetical protein"
                     /protein_id="BAF53069.1"
                     /transl_table=11
                     /translation="MGPIRIGVGGPVGAGKTQLVERITRALIDEVSMAAITNDIYTIE
                     DAKILAANGVLPEERIVGIETGGCPHTAIREDTSMNDAAIKDLVERFPDLELIFVESG
                     GDNLSATFSPELVDFSIYIIDVAQGEKIPRKAGQGMIKSDLFIINKTDLAPYVGANLD
                     VMVEDAKTFRKNKPFCLTNLRTDDGLDKVLEWIRHEVMMQDLQEA"
     CDS             123680..124531
                     /codon_start=1
                     /locus_tag="cgR_0109"
                     /product="hypothetical protein"
                     /protein_id="BAF53070.1"
                     /transl_table=11
                     /translation="MTQTQPVGTLRLTIDDQGPQGQSRAVEQFHQGALRVIRPHYLDD
                     SGQVSYTIIAIGGGYLGGDVYEQQFTVKDNAKALITTQSATKIYRTPQGPVTQYTEIN
                     VGENAVLEYLADQTIAYRESTYHQFTKVTLHPTSTFVMSEQITPGWHPDGKHFAYDEM
                     RLHTEITDSTTGRLVLLDNLLLRPDSREGSFGWTEQYTHSGQMIVMGEGVDKQLVAEL
                     NEQLAAHPDVYGAVNFLSAPGTLLRGFIARTLSNRTEELINLHEHIASLLRGRWRGQE
                     PVNLRKY"
     CDS             complement(124535..125689)
                     /codon_start=1
                     /locus_tag="cgR_0110"
                     /product="hypothetical protein"
                     /protein_id="BAF53071.1"
                     /transl_table=11
                     /translation="MRSGNANRVFIGVTLLLFTAGWAANHFASVLVLIREQLDVSSVL
                     VNGAFGIYALGLLPSLLAGGVLADRFGARMVVLTGGVLSALGNLSLLAFHDGPSLLVG
                     RFIVGLGVGLVVSAGTAWAGRLRGASGVTLAGIILTAGFMMGPIVTSGLGMASTSIIT
                     PFAISVALSLIAVVVGFALGDARSTPSALGASSGIKHERSMKKALAVSLPMAIWVFSC
                     ITTSLIVMSARIDATFGNAILLPGIGAAIAFSAGLIAQFLGRKFAWGRGSGIVGALCA
                     LAGFALAAFGGDSIPVWLFVIASILLGTAYGLCLREGLLGIETYTPLNRRGTGIGIYY
                     VFTYLGFGLPVLLDVLLPHLGASIPLYALAALALGSAVIRGVQIKRGYVV"
     CDS             complement(126024..128801)
                     /codon_start=1
                     /locus_tag="cgR_0111"
                     /product="hypothetical protein"
                     /protein_id="BAF53072.1"
                     /transl_table=11
                     /translation="MDYAFEQSATALLDRAIDMPMNDEQMEAFQLALSVAQETEDQDT
                     EFKARLFLATLGNINEDHTSMLTHFSAAVGMHDRDPARFPGQGDGSYPDLFWLYKNAL
                     NLVISSVLFTREQMDNMLDQMDEHFTRAGIPRIAIDIERRDDALMNGSLERALELQEL
                     IDASQHDDPFDDCPTCQIAGKAALAMAADDYDETQNLVSQIISYGSIGCVMEPETTLA
                     AFMLRVLKSGDADYARYLQDVSAKANPEFQSLDSVGRHLEFLGITGNHSRGLGFLTRY
                     QHRLITDPLATLGHFQFYLGAYTLLSSTERAGFGDLVVSGTGEVFGHDEDLNVEKLKE
                     RCLELARNLAREYDARNGNDNFMKRFEASIANSTLDIPVGLGGSNLLLKAQTATPSEP
                     ANAQDKLYRFCIANGKRAFSDAQRFLLNADELAELSDYERLAYAITLLDQHGKEAEGR
                     ELFLSELRRQGYRAVDFLESQTVDQLNNPDVQTYLTEAELIRDDLRSWAVLNQMALDN
                     IDLVPYSEENEEPLAIARKIIEETASHPELRFENLEAQFSEFTILLAQSPENLDVARY
                     QEIRTQGNFVQELALDSIFGQHAVVQDTGNGEAILDETIGYMIGAGMRETTARTASQF
                     AQLYSFVGRQERSIEMARLAFEELQAAGLPHREEELRLGMQLAQVEPIEAREILEKLL
                     LPKFEQNLTLDELETEALLPLGATVAIHDPQAAAAILRHARENAAGFGNFELAVQAMT
                     MITDVLYTQDMHEQLLEELNHSLPYAQMLDDQHQAELKLLDSIAIVQADLGSTEALET
                     LGTAMGLAETTAQKLYVQESLNRAYFTFARPEDCISGAAKASALAMQNDDPSNAAAQL
                     EQCAQYLFQLGHETDGASLLESAFRVEGIPTEQALYYANALSSIYEDFGDSAKSQYWE
                     QQAQEKQQLLE"
     CDS             complement(128828..130654)
                     /codon_start=1
                     /locus_tag="cgR_0112"
                     /product="hypothetical protein"
                     /protein_id="BAF53073.1"
                     /transl_table=11
                     /translation="MQESSRDNFQVDLGGVVDLLSRHIYSGPRVYVRELLQNAVDACT
                     ARSEQGEEGYEPSIRIRPVTKDRATFSLVDNGTGLTAQEARELLATVGRTSKRDEFGL
                     QREGRLGQFGIGLLSCFMVADEITMVSHAEGASAIRWTGHADGTFNLEILGDDATDVI
                     PVGTTVHLTPRPDERTLLTENSVVTIASNYGRYLPIPIVVQGEKNTTITTSPVFAKDT
                     DQQHRLYAGRERLGKTPFDVIDLTGPGIEGVAYVLPEAQAPHMSRRHSIYVNRMLVSD
                     GPSTVLPNWAFFVECEINSTDLEPTASREALMDDTAFAATREHIGECIKSWLINLAMT
                     KPHRVREFTAIHDLALRELCLSDADLAETMLGLLTLETSRGRISIGEITTLSITEDVS
                     LQLATTLDDFRQLNTIARPDTLIINGGYIHDSDLARLIPVHYPPLTVSTADLRESMDL
                     MELPPLQDVEKAKALDAQVTDSLKDFQIKGATRVFDPADVPAVVIIDSKAQASRDRNE
                     TQSATTDRWADILATVDNTLSRQTANIPQDQGLSALCLNWNNSLVRKLASTDDTAVVS
                     RTVRLLYVQALLSSKRPLRVKERTLLNDSLADLVSLSLSSDI"
     CDS             130722..132131
                     /codon_start=1
                     /locus_tag="cgR_0113"
                     /product="hypothetical protein"
                     /protein_id="BAF53074.1"
                     /transl_table=11
                     /translation="MEATTIDDAIAKLIDIYDTSTKLAKETLDNEDYAAYADVVYPKL
                     TVDVLEWKPIDRTEPFGYVDRAGRYSAILSKPRVIERYLREQLERLTSNYPCKIYVSE
                     SDIRIPPEYIRGAPSATEARRAGDVADIIPRPTLDEVHDAIIDGDWHAFNGPELPLFH
                     FGPQRFDIACARIEHYTGINVEHVQKYILFTNYAMHTTEFVHFAMSELTSEDSRYVGL
                     SLPNGQVIDRETATSLGTETLDLTSRFQMPRYDLITEAGDGITIINIGVGPSNAKTIT
                     DCLAVLRPEAWVMIGHCAGMDARMRIGDLILGNAYQREDHILDKRISLGNPIPAIPEI
                     QKALEASVDEIYGSDNSLMRTGTVLSTDDRNWEWHTPEDLWNWLKGSTAAAVDMESST
                     LATNGYRYRIPYGTLLSVSDLPLHAVPKLPAQAQAFYSNSKEAHVMCAVRAMEYLAVD
                     PERLRTRKLRRTLGEVPFR"
     CDS             complement(132809..133987)
                     /codon_start=1
                     /locus_tag="cgR_0114"
                     /product="hypothetical protein"
                     /protein_id="BAF53075.1"
                     /transl_table=11
                     /translation="MKALTWQASNTVNVEEVPDPQIQEPTDAVIRVTSTAICGSDLHL
                     YEVLTPFMDKGDIIGHEPMGIVEEIGSAVTHIKPGDRVVIPFNISCGHCFMCRQGLQS
                     QCETTQVREYGTGAQFLGYSRLYGSVPGGQAEYLRVPHADYGAIKVPNVGEDERYLFL
                     SDVVPTAWQAVDYAAVPDGGTLAVLGLGPIGQMSARIGKHLGYRVIATDAVPERRAMA
                     ERYGIETLDSSEDGVAEQLKDLTDGRGPNSVVDAVGMEAHGSPVASAVQAAVGKLPSP
                     LDRKAMERAGVDRMSALYTAIDSVRRGGTISISGVYGGMKDPMPMLTMFDKQIQLRMG
                     QCNVRSWTETLLPLVDDPSDPLGVLDLKTHTAPLEEAPAMYEKFQKKQDGCIKVVLKP
                     "
     CDS             complement(134356..135357)
                     /codon_start=1
                     /locus_tag="cgR_0115"
                     /product="hypothetical protein"
                     /protein_id="BAF53076.1"
                     /transl_table=11
                     /translation="MPTSRDVARAAGVSQATVSRALNRPETVSQKTRERVQAAVQTLG
                     YHPHSGAIAMKTQRTKTIGVVVSELSNPFFQEIFETLSQEFAKAGSRVIVWDSALHER
                     DAIRALQERSVDGVIMSAWDEDAQEMRDILETGLPVVLLNRTAPKGSFDSVTSDNHNG
                     GQLVADYLHQHGKHHLVFIQGNPHTSTSMERLNGFRAGLHALNQPSPTVLNGEFSFEK
                     SFAVTRDFLDQHGAPDAFFCANDYMAFGVLNAVKAAGMSVPEDVWVIGYDNVSQSDWP
                     ILDLTTVRQGSRQMAQLGAQKLLNRIENPTTPAVKTILPVQLEIRGSSENAPFNHEN"
     CDS             135615..136841
                     /codon_start=1
                     /locus_tag="cgR_0116"
                     /product="hypothetical protein"
                     /protein_id="BAF53077.1"
                     /transl_table=11
                     /translation="MIADIRARGDEAVREYSLKFDNYGPDSFLVQGEQLQEILDRVPE
                     QVIEDIKFVQDQVRKVAQAQLQSMGEFEIETLPGVHIGQKNVPIDSAGAYVPGGKYPL
                     LASAHMTILTAKVAGVKRVVACTPLIQGEVPDATVAAMHLAGADEIYLLGGIQAIAAM
                     AIGTETIKPVSIIAGPGNAFVAEAKRQLFGEVGIDLLAGPTETLIVADETTDPFIAAV
                     DLLSQAEHGPDSPAVLISTDRAVAEQVIDHINELLPEMPTKDYAEVAWRDWGEVHVVE
                     SIEDAFSLADKFASEHVQILTASPRRALDEMKHYGALFLGEGTCVSYGDKVIGTNHVL
                     PTRGAARYTGGLWVGKYVRTITYQEVTNEDSSAFFGELCGRAARVERFEGHARSGDVR
                     AAKYAGAALTWTDHSF"
     CDS             136868..138187
                     /codon_start=1
                     /locus_tag="cgR_0117"
                     /product="hypothetical protein"
                     /protein_id="BAF53078.1"
                     /transl_table=11
                     /translation="MIGFLGLLASLILLIVLTMRGMNLLIAAPLSALVLAVISGLPLF
                     PQLVGSDEDSFVSTYMAGFSGFVASWFLMFLLGAIFGKVMEDSKSAASVSAWLTKKFG
                     AKYALAAVIVACAVLTYGGVSLFIVGFTVFPIALSLFKLANYPRRFIPAALAFGSVTF
                     TMTSAGSPEIQNWIPMEYLGTTPYAGWEVSLIVASVMAVGGYFLLHYLVKRAISRGEE
                     FESRPGDPKEYDGPLPNPALSLLPLLTVLILSFIFHDSLGTSALIVALTGGVVLTWLL
                     NHKYMSSFWRAASEGTTGALLAIANTAAVVGFGAIARTTPAFQDAVDVMTSVPGDPLI
                     GGAIAIIVIVALTGSASGGLTIALPILGPQYMDAGVNPEALHRVATLSSGALDSLPHG
                     GYTVTTIRVICGETHKTAYSPVFWVTVVVPTVGVILAVALFSLGVGI"
     CDS             complement(138656..139357)
                     /codon_start=1
                     /locus_tag="cgR_0118"
                     /product="hypothetical protein"
                     /protein_id="BAF53079.1"
                     /transl_table=11
                     /translation="MTSEGRAGRSHHDSHRWVQKYAPELDKHTRWYRQAPDWQASSWR
                     VDETYIRVGGRWCYLYRAITAGGQTLDFYLSPKRNVAAAKRFLAKTLRSNASAGFPRV
                     INTDKAPSLAKAISELKEEGICPPTVEHRQVKYLNNVLEGDHGRLKRILGPKGAFKNL
                     DICISDAEGDGSDALLAERSGDDVCLRATEPGRGDRQPGLRDGLRTLSRRDHGEMKLG
                     RSWPLHPTLQQHPSS"
     CDS             139439..139597
                     /codon_start=1
                     /locus_tag="cgR_0119"
                     /product="hypothetical protein"
                     /protein_id="BAF53080.1"
                     /transl_table=11
                     /translation="MTTGEDTYGCDYFTSLFLLPQLCNSTEQATRVTAVSTAATAMAA
                     LRGVLGMD"
     CDS             complement(139741..141222)
                     /codon_start=1
                     /locus_tag="cgR_0120"
                     /product="hypothetical protein"
                     /protein_id="BAF53081.1"
                     /transl_table=11
                     /translation="MTSSFSRRQFLLGGLVLAGTGAVAACTSDPGPAASAPGPSLRPT
                     PTPTALGEPTVRRTLTARPLSLDIGGIEAKTWGYVSDTGDAAIEATAGDVLQVDITNE
                     LPESTSIHWHGIALHNAADGVPGMTQDPIEPGESFSYVFEVPHAGTYFYHSHTGLQLD
                     RGLHAPLIIRDPQDAEDQDVEWTIVLDDWVDGIQGTPDDELDKLTGMGSGDHNGRMGM
                     GGHGQMMHGTPDRVLGGDVGDVMYPHYLINGRIPRAHRTFEARPGDKARLRFINSGGD
                     TIFKVALGGHRMTVTHTDGFPVQPWETESIYLSMGERVDVEVILGDGIFPLTALAVGK
                     DDRAFAVIRTAGGQAPRPDVDFPELSSTGLLLSSLKPADRALLPEGTPDREVSIDLGG
                     QMMPYEWSILTDGQSSSATVQEGQRLRMVMRNRTMMPHPMHIHGHTWALPGSGGLRKD
                     TVLLRHGETMIADLIADNPGEWAFHCHNAYHMETGMVSSLRYE"
     CDS             complement(141293..141868)
                     /codon_start=1
                     /locus_tag="cgR_0121"
                     /product="hypothetical protein"
                     /protein_id="BAF53082.1"
                     /transl_table=11
                     /translation="MKRAAIAAAALALALTGCSAADPEPTADGTVSQDTFLTTHGLAA
                     MDAVEIIDHLDRQKVTERPTDLIASVRADELLLSSDDQEVVVDLPDNQTYVSVAPYIT
                     STHDCFYHSLTTCLGELDNEDIQVTITDEATGEVLIDEQTTTFDNGFVGFWLPDDATG
                     TIEITHQGRTGVTEFSTTEDGATCVTDLRLT"
     CDS             142272..142994
                     /codon_start=1
                     /locus_tag="cgR_0122"
                     /product="hypothetical protein"
                     /protein_id="BAF53083.1"
                     /transl_table=11
                     /translation="MADRTPTTATPPGRVLVVDDEQPLAQMVASYLIRAGFDTRQAHT
                     GTQAVDEARRFSPDVVVLDLGLPELDGLEVCRRIRTFSDCYILMLTARGSEDDKISGL
                     TLGADDYITKPFSVRELVTRVHAVLRRPRTSTTPPQVTTPLIVGDLILDPVAHQVWVG
                     ETTVELTRTEFELLVALALRPGQVLTRHDLVTEVWDTTWVGDERIVDVHIGNLRRKLG
                     TDTRGRGFIDTVRGVGYRVGQP"
     CDS             142991..144190
                     /codon_start=1
                     /locus_tag="cgR_0123"
                     /product="hypothetical protein"
                     /protein_id="BAF53084.1"
                     /transl_table=11
                     /translation="MNHGPGLTFRFLTAQVLVVVISLLVAAAVATMVGPTLFHDHMLM
                     TGREDPSLELFHAEQAYRDANLITLAVALPTALISALLASLWLSRRLRTPLQDLTRAA
                     TSLTAGNYRIRVPAGEAGPEVTTLAHAFNTMADRLEHTEQVRRQMLSDLAHEMGTPLS
                     VLTVYFDGLQDGVVDWNNATHTIMADQLTRLTRLMEDIDDVSRAQEHRIDLDLAEEGL
                     GDLLHTAAAAAGEAYADKGVDLQVETITDTVRVLVDRQRFGQVMSNLLSNALRHTPAG
                     GQVRISVRRQGASTALIHVADDGEGIPPGQLGHIFERFYRGDAARSRDNGGAGIGLTI
                     SKALIEAHGGTLTATSPGPGAGSVFTIRLPLHQENVSLMLGDPTPGDNNSDDLGSDPY
                     QPLDNTP"
     CDS             144249..144581
                     /codon_start=1
                     /locus_tag="cgR_0124"
                     /product="hypothetical protein"
                     /protein_id="BAF53085.1"
                     /transl_table=11
                     /translation="MTTPTSPLLPLASDGCGCCAPSTPSATVSAPAVAAATDATPEGP
                     TTYQVTGMTCGHCAGNVTEAVSALPQVDDVQVDLIAGGVSIVTVTGSVPLETVHRAIE
                     EAGYTVLS"
     CDS             144632..146854
                     /codon_start=1
                     /locus_tag="cgR_0125"
                     /product="hypothetical protein"
                     /protein_id="BAF53086.1"
                     /transl_table=11
                     /translation="MSTPHHHGDHPAPETDHTHHPNHAGHEHHADAATHGQAMPHDHP
                     HSTVDEEHQVHSHGEHAGHSAAMFRDRFWWSLILSVPVVFFSPMFADLLGYNIPEIPG
                     AYWIPPVLGTIIFLYGGTPFLKGAMTELKSRQPGMMLLIAMAITVAFIASWVTTLGLG
                     GFHLDFWWELALLVTIMLLGHWLEMRALGAASSALDALAALLPDEAEKVVDGTTRTVA
                     ISELAVDDVVLVRAGARVPADGTIIDGAAEFDEAMITGESRPVYRDTGETVVAGTVAT
                     DNTVRIRVEATGGDTALAGIQRMVADAQASSSRAQALADRAAAFLFWFALIAALITAV
                     VWTIIGSPDDAVVRAVTVLIIACPHALGLAIPLVIAISSERAAKSGVLIKDRMALEHM
                     RTIDVVLFDKTGTLTEGAHAVTGVAPATGIAEGELLALAATAEADSEHPVARAIVTAA
                     AAHPEASQRQLRATGFTAASGRGIRATVDGAEILVGGPNMLREFNLTTPGELADITGS
                     WAQRGAGVLHVVRDGEIIGAVAVEDKIRPESRAAVRALQARGVKVAMITGDATQVAQA
                     VGKDLGIDEVFAEVLPQDKDTKVTQLQERGLSVAMVGDGVNDAPALARAEVGIAIGAG
                     TDVAMESAGVVLASDDPRAVLSMIELSHASYRKMVQNLVWATGYNIVAVPLAAGVLAP
                     IGVLLPPAAAAILMSLSTIIVALNAQLLRRIDLDPAHLAPTDGKEEHSGSISPVTVTD
                     "
     CDS             146902..147516
                     /codon_start=1
                     /locus_tag="cgR_0126"
                     /product="hypothetical protein"
                     /protein_id="BAF53087.1"
                     /transl_table=11
                     /translation="MKRSITLAALVLTSTLALTACSDATDNSDDADTTSTTTATAETN
                     ETHQEDTTTADDGGHDMEHPEDGGPPPEGITEATDPTYPVGSEVMLTADHMPGMDGAQ
                     ATISGAFDTTTYSVSYTPTDGGEPVTDHRWVVHEELVDPGEAPLPGGTEVVLNAEHMP
                     GMQGATATIDYSTQETVYMVDIDTGEMTMINHKWVTESEIQPAE"
     CDS             complement(147872..148357)
                     /codon_start=1
                     /locus_tag="cgR_0127"
                     /product="hypothetical protein"
                     /protein_id="BAF53088.1"
                     /transl_table=11
                     /translation="MAVIISRRSSYCPNFATAPINTGRCDHAEQGHRGQGGRGSEHVS
                     GADQADASQWHIVATRAHVLPSLLGKGEQAFLGIQIRPQARDTANDFVHKALALPETL
                     ALYNVSGNEDYLVHVAVSDSTALQALIIDKFLALPQVAHCRTQLIFGDPWVAPLQHSP
                     E"
     CDS             148521..148640
                     /codon_start=1
                     /locus_tag="cgR_6005"
                     /product="hypothetical protein"
                     /protein_id="BAQ21067.1"
                     /transl_table=11
                     /translation="MPLSWTSTLGGTGRYLIGRLSSWRVDETYIRVGGRWCYL"
     CDS             148597..149076
                     /codon_start=1
                     /locus_tag="cgR_0128"
                     /product="hypothetical protein"
                     /protein_id="BAF53089.1"
                     /transl_table=11
                     /translation="MRPISGSAAGGATSDLAITAGGHTLDFYLSPKRNVAAAKRFLAK
                     ALRSNASAGFPRVINTDKAPSLARAIAELKSEGICPQTVEHRQVKYLNNILEGDHGRL
                     KRILGPKGAFKNLDICISDVEREGGDALIAERARHDVCPHGQPNPDAVIVNQVFETA"
     CDS             complement(149259..151136)
                     /codon_start=1
                     /locus_tag="cgR_0129"
                     /product="hypothetical protein"
                     /protein_id="BAF53090.1"
                     /transl_table=11
                     /translation="MKTWKTWGVVAVSGLLIILSWLTPAGWLSDGFMIAAAVVAGWQI
                     AVSAVQALRIRMISIDLLVIVAAIGALFINNYWESAAVTFLFALGKALEKATMNRTRK
                     ALSDLVDAAPETATVLRDGEPETVEIWELAPGNVVLVKNGEQIPVDGRVLSGHGGVDE
                     ATITGESVPAEKAEDSEVFAGTWLRSGVLRIEAIGIGSDSTLAKIIHRVEDAQDDKAK
                     TQTFLEKFSKYYTPGVMVAALAVGLITLNVELALTLLVIACPGALVISIPVSIVAGIG
                     RSAKDGVLIKGGEYLETSAKVDTVVVDKTGTLTNGRPELTNVDVLDPAYSDDEVLTLA
                     ARAETASEHPLAEAIIRGAENKGLTIEMVEKAKPVTGKGIIAKVDDHTVAVGSADLLD
                     HAPDTTRILELNDQGKTAMYVGVDGKAVGIVAVADTIRDDAPAAIRSLHDKGIRVVMA
                     TGDAERVARNVAAELGVDEVRAELMPEDKLEIVKELQAQGRVVAMVGDGVNDTPALAQ
                     ADIGVAMGAAGSPAAIETADIALMADKLPRLPYALGLAQRTVRTMRVNIAIALATVAI
                     LLVGVLLGGVTMSIGMLVHEASVLIVIAIAMLLLRPTLKEDKDKADVSTADAAKETLS
                     A"
     CDS             151173..151325
                     /codon_start=1
                     /locus_tag="cgR_5000"
                     /product="hypothetical protein"
                     /protein_id="BAF53091.1"
                     /transl_table=11
                     /translation="MTLIKLGQFRRNFLDLDQLPTHLRPDEVEQKSMPRGVDHAPFPG
                     TRIGGV"
     CDS             complement(151322..151591)
                     /codon_start=1
                     /locus_tag="cgR_0130"
                     /product="hypothetical protein"
                     /protein_id="BAF53092.1"
                     /transl_table=11
                     /translation="MPYATATPAYHSVAALYRVSRPAGQDDTIHLGHLKETRDAYQRR
                     VDDDLTLFPSLAAPDPHDRHPIREWLSTHTGPLMDAGCTAKPSAY"
     CDS             complement(151712..152029)
                     /codon_start=1
                     /locus_tag="cgR_0131"
                     /product="hypothetical protein"
                     /protein_id="BAF53093.1"
                     /transl_table=11
                     /translation="MAEVTFASLHEKMNFLLKDHGVENFDESDLDLESVSSLHAKANA
                     LCAAHGGDPSRMANDTLAQLHPKLDFLMKGHGVDTDTARLDLSTLEAVDAKVNAVVNA
                     HDH"
     CDS             complement(152234..152470)
                     /codon_start=1
                     /locus_tag="cgR_0132"
                     /product="hypothetical protein"
                     /protein_id="BAF53094.1"
                     /transl_table=11
                     /translation="MTAPATLKNTTLRSDEFTCPSCVAKIENKLNGLDGVENAEVKFS
                     SGRILITHDPQKVSVRDLVTAVAEVGYTAKPSAI"
     CDS             complement(152626..152898)
                     /codon_start=1
                     /locus_tag="cgR_0133"
                     /product="hypothetical protein"
                     /protein_id="BAF53095.1"
                     /transl_table=11
                     /translation="MQQHPTSTVEQRVAAALQHLDAKLGQIRQDGSSLLQVRLRRDDV
                     AGMAGTTVESASRAMARMKKTGVIDSGREWIAITNHQALADLVAGL"
     CDS             153048..153215
                     /codon_start=1
                     /locus_tag="cgR_0134"
                     /product="hypothetical protein"
                     /protein_id="BAF53096.1"
                     /transl_table=11
                     /translation="MAYLLSTIEPGTSWPRQLAELVEQFPTTEQIGIESMGLPPNWKD
                     LTLWAQTSPPS"
     CDS             complement(153413..154030)
                     /codon_start=1
                     /locus_tag="cgR_0135"
                     /product="hypothetical protein"
                     /protein_id="BAF53097.1"
                     /transl_table=11
                     /translation="MALIGYMWVSKADGSQTTDLQRDALIKAGVDPDHMYEDNASGKK
                     EDRPELASCLKALRAGDTLLVWKLDRLGRNLRHLVNVVHDLTARGVGLKVLTGQGAAI
                     DTTSAQGKLVFGIFAALAEFERELISERTKAGLESARARGRKGGRPFKMTPAKVRLAM
                     ASMGQTETSVAALCKELGITRQTLYRHVSPTGELREDGRKLLTGS"
     CDS             154523..154765
                     /codon_start=1
                     /locus_tag="cgR_0136"
                     /product="hypothetical protein"
                     /protein_id="BAF53098.1"
                     /transl_table=11
                     /translation="MHFTPTYSSWINQVERLFAEVTRDLLQRSEHRSVQALEKDLRNW
                     VKAWKGDPRLLILDQDIRGDPCIIARYLKRINGAGH"
     CDS             complement(155013..155615)
                     /codon_start=1
                     /locus_tag="cgR_0137"
                     /product="hypothetical protein"
                     /protein_id="BAF53099.1"
                     /transl_table=11
                     /translation="MTDHRGLPVFVRHRPFALLMLVTGAIGWVASAILVLERLALYED
                     TGYVTSCDINPWVSCGKVMDTWQSAVFGFPNPLIGIVAFAIVITTAMAALSGARFSPW
                     YWLGLQVGVSMGLLFVFWLWYQALFVIHVLCLYCMVVWAVMIPLFILLTARNLVYGII
                     PAPGPVVRFVPTWAGTLITVVYVAVAVSVFSRFFTVFTGL"
     CDS             complement(155671..156354)
                     /codon_start=1
                     /locus_tag="cgR_0138"
                     /product="hypothetical protein"
                     /protein_id="BAF53100.1"
                     /transl_table=11
                     /translation="MITPSSANSHRAKIIVWTVLAIIVIAGIVIFVVNRSDSSQSATP
                     ETMASDAGQIVRENSRVLSQAPNEKAVLVEFLDFECEACRAAYPLVEELREEHSDTVT
                     FVNRYFPLPGHRNSLTAATAVEAAAQQGQYEAMYQKMFETQDQWGESAEDKSAVFRGF
                     AQELGLDMAAYDTAVADPATEERIRLDVADGTALGVSGTPTFFLDGQPLLPESLEQFR
                     AEVAAAATD"
     CDS             complement(156396..156719)
                     /codon_start=1
                     /locus_tag="cgR_0139"
                     /product="hypothetical protein"
                     /protein_id="BAF53101.1"
                     /transl_table=11
                     /translation="MTVTHTSALSRIGHALYDDTRMAILLALRNGAARPSELAQQLGV
                     SKQVMSNQLSCLRGCGLVTSTPEGRHVWYTLADPRLRDALGDLLIPVLTIDPDCCSPE
                     GCTCA"
     CDS             complement(156873..157622)
                     /codon_start=1
                     /locus_tag="cgR_0140"
                     /product="hypothetical protein"
                     /protein_id="BAF53102.1"
                     /transl_table=11
                     /translation="MRTTTRQSTPGRHRKITASPTRKGRIALVAVAAGTISSAGAGGA
                     AAATLQTPDETPASAESTVGDIELATSDTALSSSAVELVPQILTIAEYKPVDNLDEQL
                     IKAVEYNNERAEAEQAARAPSVVKPTEGTFTSGYGVRWGSVHKGLDVANVVGTPILAA
                     MGGTVIDSGPASGFGQWIRIQHDDGSIAVYGHMETLDVTVGEQVTAGQKIAGMGNRGF
                     STGSHLHFELYPAGSDAVDPAPWFAEHGITF"
     CDS             complement(157789..158430)
                     /codon_start=1
                     /locus_tag="cgR_0141"
                     /product="hypothetical protein"
                     /protein_id="BAF53103.1"
                     /transl_table=11
                     /translation="MSNDHNRLTERPDHGFGRSRGGLSTKTHALVDGQCLPLVTLIGP
                     GHAGDNPQAVPLLEGIRVPRPVGRPRTVPDELRGDKAYSSREVRTWCRKRRVKVTIPE
                     PADRVRNRKRKGSKGGRPPAFDEQSYKGRNVVERRFYEFKQWRGVATRYDKLSVVFRA
                     GVMCKAHGHLAEAFIKHTLGDHPHCGDGLNVTVISRWGGTGVIDQPETSARPL"
     CDS             complement(158420..158788)
                     /codon_start=1
                     /locus_tag="cgR_0142"
                     /product="hypothetical protein"
                     /protein_id="BAF53104.1"
                     /transl_table=11
                     /translation="MSRFQLLTDDQWALISDKLPHRIGKKGRPFSDPRLMLEGIIYRL
                     RCGIPWRDLPECFGSWHTVYHWYNRMAKDGIFDEIVTTLIAAADHQGLVDWSVSIDST
                     ISRAHQHATNITRHTGGFVE"
     CDS             complement(158905..160926)
                     /codon_start=1
                     /locus_tag="cgR_0143"
                     /product="hypothetical protein"
                     /protein_id="BAF53105.1"
                     /transl_table=11
                     /translation="MTHPVNNTPTATDTTAGTTPTIGSRPQERVHPTWPLYLLFFTVA
                     GAIGGTVAYSFLGESLAALGIPNPGIATTFGLPFFRAVGWMLAALSAGSFLFAAFLIS
                     PRLPGGDHDRLHQASLSVDGHLASRTGAVAAICFGLIALLMIPLVLSDVSGTPLAQTL
                     GLETLTVAVEQVAMAQVWLIVALIALVTGGTGLMSRAWITQPLLLLGSILMIIPLGLT
                     GHSSSGGNHDHGTNSYLWHLVFLVLWVGGLMALLAHGRRLGPDLDIALRRYSTIALVS
                     IIVMAVSGLVNAAIRIELTDLLTTRYGLIIVAKTIGVIILGVFGWIHRAWVIPQVQAN
                     PADRRLFRQVAIVEVLVMAAVTGIAITMGRTPPPPPRIPNLSQMATKLGYELSEKPTI
                     LNVWGMWRFDLLFGALALLLAVGYLSAVWRTRQTGHTWSSTPTAWWLAGCVTLLVTMS
                     SGIGLNMPAVFSVHMVGHIILSLVIPIFLVMGAPLTLLMTAFAPGAPGRPNIHDWVRA
                     FTRSRLVGVITHPVVNTLQFLVFFYVMYLFIPLYELLISKYAGQLIMNTVLLVSGSIY
                     FWGLMEPDPVPHRRPAPVRLAWLLASLPVHVGFGVYLSQLTTVMGEEFYRSLLLPWDI
                     DLLADQHAAVTAWAIGGIPLLLAIILLIRQWRDIRRRPHDQAPLAVPAE"
     CDS             161224..161808
                     /codon_start=1
                     /locus_tag="cgR_0144"
                     /product="hypothetical protein"
                     /protein_id="BAF53106.1"
                     /transl_table=11
                     /translation="MIISPMLPRRVLATVVAVGALTVVATPVALAHDSVIGGNPADGD
                     VVEEFPRSIELEFSGLPQEGFSTVAITDQDSGDLLFSGEPTIDGRLVTLDLPADVSGG
                     PGDYTVGFQILSSDGHATRSATTFTVAGDAQTTATPTGADAKPVEETTAVENTAEGDT
                     SIVSNPIVLTLAGLALFGVIAGAIVLAVRNRDRR"
     CDS             161985..162350
                     /codon_start=1
                     /locus_tag="cgR_0145"
                     /product="hypothetical protein"
                     /protein_id="BAF53107.1"
                     /transl_table=11
                     /translation="MLTIASRLDVMNRLGRAMADPTRSRILLSLLESPGYPAQLAETL
                     GLTRTNVSNHLACLRDCGIVVAEPEGRRTRYEIVDAHLARALNALVEITLAVDEDAPC
                     LDPACPVAGCCDTEGGQQS"
     CDS             162347..164317
                     /codon_start=1
                     /locus_tag="cgR_0146"
                     /product="hypothetical protein"
                     /protein_id="BAF53108.1"
                     /transl_table=11
                     /translation="MTSACGCEPSAPMAREEEHTPWWRDRAILLPVASGVSLLVGLIL
                     EWFVPNAGMIALVLFWASLLLGASQFVPGALKGLFTRGKLGIGLLMTISATGAVLLGF
                     IEEAAALAFLYSIAEALEDKAMDKARSGLRSLLALIPSTATILVRGSTRTVPVEDLAP
                     GDVLRLAAGDRLATDGIIRSGHSSLDVSAITGESIPVEVGPGDAVLAGSINTTGALEV
                     EATAGGTDNSLTTVVALVEQAQSEKGQRARIADRLARPLVPGVLILAIFVAVIGSLFG
                     DPGVWIERALVVLVAASPCALAISVPVTVVSAIGAASKFGVVIKSGAAFERLGGIRHL
                     ALDKTGTLTRNQPTVAEVLTIDGISRADVLGWAAALEDHSTHPLAAAITAAAPQAPTA
                     QQVDETAGQGITGVIDGTQIKVGSPRWLSPGPLVGQVETLESQGMTVVIVYRDDHPVG
                     AVGVRDELRPEAPEVIRTLTDKGFGVTMLTGDNTRTATALAREAGITDVRAELRPEDK
                     ATAVAGLGTRGPVAMIGDGINDAPALARADIGIAMGAKGSDAAIESADVAFTGDDLRL
                     IPRALHHARRGRAIINQNIVLSLAIIIVLLPLAITGVLGLAAVVLVHEVAEVIVIANG
                     LRAARTQHPDLKPVEATTVTADEDAYGRSRVS"
     CDS             164347..165420
                     /codon_start=1
                     /locus_tag="cgR_0147"
                     /product="hypothetical protein"
                     /protein_id="BAF53109.1"
                     /transl_table=11
                     /translation="MYFPPDGAVDFMAVSSTHERRYGRAPQKKGWRTFLRPGWVFGVL
                     AIIAFSYVAFTFLAPWQLSRDSTIVERNEQIEAAFEVELVPAEEIFDAQGSIEPGKEW
                     ARVILQGHYLPEDEVLMRNRPVDSSPAFHALTPFQLNSGEIILVNRGFNPPLEGGVPP
                     MDTAPAGEQSIVGHARFTEQTPMSPPIEDQGYRQVYGINTAQISEVIGMDLAEDYVQL
                     AEGQAGEINAIPVPMLDRGSHLSYAFQWIAFGIMAPLGLGYFIWAELKERRRVRREEA
                     ELADGSASSQQTGDSQDEETDSDPVGALRTIHPENDTQGLAHAQATTSASSGARARML
                     HDRYGDSQPNHSRKFTNRRHERF"
     CDS             165544..167631
                     /codon_start=1
                     /locus_tag="cgR_0148"
                     /product="hypothetical protein"
                     /protein_id="BAF53110.1"
                     /transl_table=11
                     /translation="MSEHQHDHDPGHRTAPNGSPTTLPPTSAATHTQDHAHGSARWEL
                     WFAIAAGVTYTGGMIAEFALGLPMVGWPLAFFLATYFFGGFFTIRTAISSTLRGKFEV
                     DFLMLVAAVGAALIGRWAEGAVLLFLFSLGHALEEYALSRASKSIEALAELAPRSALV
                     RRGETEPVEVPVEELVVGDIVVIRPNSRIPSDGFVISGMSAVDQSAVTGESIPVEKEP
                     VSDPTRTMHTVGTLPATNRVFAGTVNGSGLLEIEVTATAADSTLSKVVELVRTADQAA
                     SPTQQFIDRFQRWYVPAVILGVIATLLVSMFAFAQPFRDAFYLAMTVLVAASPCALAI
                     ATPAAVLAGVARAARAGVLVKGGAPLETLGRVEAIAFDKTGTLTWGAPRVTSLVPADD
                     TSESELIPTLVSVESLSDHPLAAAIVRDLAPRVPETGRLVATDLSALTGRGITATIDG
                     ERVEIGNLRMFDEQQLELPSSLAKAYAEARDSGQTLMIVRRGDRFLGVVGVMDASRAE
                     SAQVLNALRDTGVGHLVMISGDNQRVADAVGQEVGVDTAIGELLPEDKVTHITSLAKT
                     YRPIAMIGDGVNDAPAMARADVGIAMGAAGSTVALETCDIALMSDDLGRIPFAVRLSR
                     AASRIIRQNLIASLAIVVFLIIATFLGLNIGAVVLIHEGSTLIVVANALRLLNFQKGQ
                     EHAGIDHEEKPTH"
     CDS             167920..169011
                     /codon_start=1
                     /locus_tag="cgR_0149"
                     /product="hypothetical protein"
                     /protein_id="BAF53111.1"
                     /transl_table=11
                     /translation="MAHRGPALAPLTLTDDERDQLQRWVRRRKTTQDLALRSRIVLEC
                     ATGASNSEVARRLGISLPTVGKWRARFIDKRLDGLVDEPRPGRPATIGIDRVEQVIID
                     TLESTPANATHWSRASMAEKSGLSKSTVGRIWKAFGLKPHLEEGLKLSNDPFFTEKIY
                     DIVGLYLNPPESAVVLCVDEKSQVQALQRSQPAFPMMPGTPERRAHDYVRHGTTSLFA
                     ALNVADGTVISQVHRKHRSVEFRKFLVKIDKTVPEGLDVHVICDNYATHKHPTIQTWL
                     GKHPRFHMHFTPTYSSWINQVERVFAEVTRELLQRSDHRSVQALEKDLRDWVRAWNEN
                     PKPFIWTKTAEDILDSIARSLQRINGAGH"
     CDS             complement(169111..169341)
                     /codon_start=1
                     /locus_tag="cgR_0150"
                     /product="hypothetical protein"
                     /protein_id="BAF53112.1"
                     /transl_table=11
                     /translation="MSTLPETTPIEQLVRLGKIRWRIEHDYRELKHGLGLDHFEGRHW
                     LGWHHHTTPVTAAHLFITMKRLAAGPKALPAA"
     CDS             complement(169439..169759)
                     /codon_start=1
                     /locus_tag="cgR_0151"
                     /product="hypothetical protein"
                     /protein_id="BAF53113.1"
                     /transl_table=11
                     /translation="MKFTENLALQGITPSIGSVGDAYDNALMESSNGLDKTECIGSRI
                     FTAQNLESIVDVELATMAWVQWHNHHRLHSTLGMVPPAEYEESYWAREATIPGSPATA
                     AHPI"
     CDS             complement(169746..170393)
                     /codon_start=1
                     /locus_tag="cgR_0152"
                     /product="hypothetical protein"
                     /protein_id="BAF53114.1"
                     /transl_table=11
                     /translation="MIVAFIDQMKKEGFAVESARHVLREQGVQVAARTYHHWKKVPAT
                     RTMTDAQILNALYELRDAPESLYGRRKMVAHLRRQGHARAHCTVGRLMRLAGMNGIFR
                     RRTTVRTTIPGSGDRAPDLLNRNFTAEASNRVWVADFTYARTGSGWVYVAFIVDVYSQ
                     RIVGWHAQTSRGVELVRIPRYPALWERDRTQRPVVRGELTHHSDAGSKSHRGEIH"
     CDS             complement(170447..171598)
                     /codon_start=1
                     /locus_tag="cgR_0153"
                     /product="hypothetical protein"
                     /protein_id="BAF53115.1"
                     /transl_table=11
                     /translation="MAKIGRPGLPQDQRQKVWDLWKTGSSISDISRDVGSPPGSIFSI
                     LLPRGGIYLPAQKHHPGTLTLAEREEISRGLSVGLSYRAIARLTGRSASTISREVTRN
                     RGRTAYRAIDADDRSWRQARRPQRCKLAKNPVLRGYVAARLREDWSPEQIAGRLKITY
                     ACTSRMQISHESIYKSLFIQSRGVLPKDLQKHLRSRRPIRKARSNTTSGQWRSQIKDA
                     VSISKRPKEAEARVQVGHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTA
                     GLIRELGQLPDQAKRSLTWDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNR
                     LLRQYFPKKTSMKGFSQTDLDQVADKLNNRPRKVLGFRTPAEQYEALLR"
     CDS             complement(171688..171885)
                     /codon_start=1
                     /locus_tag="cgR_0154"
                     /product="hypothetical protein"
                     /protein_id="BAF53116.1"
                     /transl_table=11
                     /translation="MVQQHREDYRSLTVTCTAVGDELGVSRETLRNWVRQAEVDAGHV
                     PGVSTEENEEMTRLRKENKRL"
     CDS             complement(171947..172573)
                     /codon_start=1
                     /locus_tag="cgR_0155"
                     /product="hypothetical protein"
                     /protein_id="BAF53117.1"
                     /transl_table=11
                     /translation="MVSGLLSAIGLFLATNIDDIIVLSLFFARGAGQKGATARILVGQ
                     YLGFVGILGAAVLVTLGAEAFLPEQAIPYFGLIPLLLGLWAAWQAWRSDDDDDDAGKV
                     AGKKVGILTVAGVTFANGGDNIGVYVPVFLNVGTATVITYCVVFLVLVAVLVLLAKFV
                     ATRPPIAEVLERWEHVLFPIVLIGLGIFILVGGGAFGLNRHGFLAAFQ"
     CDS             complement(172573..172932)
                     /codon_start=1
                     /locus_tag="cgR_0156"
                     /product="hypothetical protein"
                     /protein_id="BAF53118.1"
                     /transl_table=11
                     /translation="MLTIASCLDVMNRLGRAMADPTRSRILLSLLEAPGYPAQLAREL
                     ELTRPNVSNHLACLRDCGIIVAEPEGRQTRYEIVDAHLAQALNALLDVTLAVDEHAPC
                     LDSGCDVPGCVTGQEGM"
     CDS             complement(173112..173810)
                     /codon_start=1
                     /locus_tag="cgR_0157"
                     /product="hypothetical protein"
                     /protein_id="BAF53119.1"
                     /transl_table=11
                     /translation="MDLSEITPVAQDYLKVIWAATEWGGPPITATALAARMGTTTPNV
                     SDTVKRLAAQGLVEYQPYKPVMLTERGEKYAIAMVRRHRLLETFLATTLGYPWEEVHD
                     EAERLEHAASETMIERIDALLGNPATDPHGDPIPTATGHISRSIDAIRLTHVVPGDYV
                     IIRISDADSSQLAGFRRQEIVPGAIVNVAGADPRQDRVLLKGADGKEVILTTEQANAI
                     WVAPSPGLRGSTSL"
     CDS             complement(173840..175054)
                     /codon_start=1
                     /locus_tag="cgR_0158"
                     /product="hypothetical protein"
                     /protein_id="BAF53120.1"
                     /transl_table=11
                     /translation="MSRQPLPWLLGPAFVAAVAYVDPGNVAANITAGAQYGYLLVWVL
                     VVANVMAMLVQYLSAKLGLVTGYSLPELLGQRLPRGRRLMFWAQAETVAAATDLAEVI
                     GGAIALHILFGLPLLIGGLLIGLVSMLLLAIQSRHGQHPFEFVIVGLLVIITAGFLTG
                     MFIGTVSWGEALAGVIPRFEGTPTVVLAASMLGATVMPHAIYAHSSLARDRHGDTIAP
                     EALPRLLRVTRWDVLLSLLVAGSVNIAMLLLAAGNLNGIPGTDSIEGAHAVITDTLGP
                     VVGVAFGVGLLASGLASTSVGCYAGSTIMGGLLHRQIPQVVRRAVTLIPALIVIAAGV
                     EPTWALVLSQVVLSLGIPFALIPLVVLSSDQTLMGGFAIRVPLQVASWVVVALIVSLN
                     LALIGLLVTGRG"
     CDS             complement(175421..176038)
                     /codon_start=1
                     /locus_tag="cgR_0159"
                     /product="hypothetical protein"
                     /protein_id="BAF53121.1"
                     /transl_table=11
                     /translation="MALIGYMRVSKSDGSQTTDLQRDALIAAGVDPGHLYEDRASGKQ
                     EDRPHLDACLKALRPGDTLLVWKLDRLGRNLWHLVNIVHDLTAREVGLKVLTGQGAAI
                     DTTSAQGKLVFGIFAALAEFERELISERTKAGLESARARGRKGGRPFKMTPAKVRLAM
                     AAMGQPETSVAALCKELGITRQTLYRHVSPTGELREDGRKLLSGS"
     CDS             complement(176226..176858)
                     /codon_start=1
                     /locus_tag="cgR_0160"
                     /product="hypothetical protein"
                     /protein_id="BAF53122.1"
                     /transl_table=11
                     /translation="MVMDIGYARVSTAKQDLDRQIDALRKEGVADKYIYVDKKSGSTT
                     NRPGLQQALEQARAGDVIVVHTLDRLGRTVRDTLNLIHDLQEREVGVRTLADPIKVDS
                     SNPNDPMAQLAVVILSLFGQMERTYAVERAAHARAVAEAKGKRVGRPSVVDPDKLRYA
                     EHLRNEGYSMSKIVEKTGITRSSLYRHLPPRPVETHTAADIPDASHPTLG"
     CDS             177202..177561
                     /codon_start=1
                     /locus_tag="cgR_0161"
                     /product="hypothetical protein"
                     /protein_id="BAF53123.1"
                     /transl_table=11
                     /translation="MLTIASRLDVMNRLGRAMADPTRSRILLALLEGPAYPAALAQDL
                     ELTRSNVSNHLACLRDCGIVVAEPQGRQTRYEIVDAHLVQALNALLDITLAVDDNAEC
                     IDAGCAVPGCVTGQESA"
     CDS             177561..178154
                     /codon_start=1
                     /locus_tag="cgR_0162"
                     /product="hypothetical protein"
                     /protein_id="BAF53124.1"
                     /transl_table=11
                     /translation="MVTGLLSAIGLFIATNIDDIIVLSLFFARGAGQKGTTLRILAGQ
                     YLGFMGILAAAVLVTLGAGAFLPAEAIPYFGLIPLALGLWAAWQAWRSDDDDDDAKIA
                     GKKVGVLTVAGVTFANGGDNIGVYVPVFLNVDTAAVIIYCIVFLVLVAGLVLLAKFVA
                     TRPPIAEVLERWEHVLFPIVLIALGIFILVSGGAFGL"
     CDS             complement(178413..179834)
                     /codon_start=1
                     /locus_tag="cgR_0163"
                     /product="hypothetical protein"
                     /protein_id="BAF53125.1"
                     /transl_table=11
                     /translation="MPTKYDLAIIGSGGGAFAAAIRASTLGKSVVMIERGTLGGTCVN
                     TGCVPSKALIAAAGARHVAVDAATRFPGIATTADPVDMPALIAGKQALVESLRGEKYA
                     DVADSYGWQVLRGDASFVGTPDAPVLDVAGADRSVETIEAHHYLVATGSRPWAPPIDG
                     LEETGYLTSTTAMELTEVPESLLVLGGGYVALEQAQLFARLGSQVTLLVRSRLASKEE
                     PEVSKALQEVFADEGIRVVSRAVPTRVSRGTGGEAVVTAAVSGGSQEFRADQVLVALG
                     RRPVTDGLNLDAVGVKTGDSGEVVVSDRLQSSNPRIWAAGDVTGHPEFVYVAAHHGTL
                     VAENAFADADRSVDYARLPRVTFTGPAIGAVGMTEKDVLAAGIRCDCRVLPLHHVPRA
                     LVNRDTRGFIKIVVNAETNEILGLTAVAKDAGELAAAGVHVLGRTVAEVADAWAPYLT
                     MAEGIRIAAKAFTTDPSLLSCCA"
     CDS             179933..180322
                     /codon_start=1
                     /locus_tag="cgR_0164"
                     /product="hypothetical protein"
                     /protein_id="BAF53126.1"
                     /transl_table=11
                     /translation="MRIGELAERAGTTAKTLRFYEEQGLLPPTERTPSGYRDYAPETV
                     ARIDFVHRGQAAGLTLAQIRQILDIRDGGHAPCEHVRDLLDVRLAEIEQQIAQLSVLR
                     DTIADLRQDAAHPDPETCSTDQVCRYL"
     CDS             complement(180427..180819)
                     /codon_start=1
                     /locus_tag="cgR_6006"
                     /product="hypothetical protein"
                     /protein_id="BAQ21068.1"
                     /transl_table=11
                     /translation="MVKVSQAMADSFQQALSSNKYSSDRLYDSFDKTKSILTQVISDP
                     NSSEESRRDAFDRLERLDDKLMEHDVNNKRFNLQSLQINKEAFIIGSVLVASAVVATI
                     NPEAKNFLAQNAPKVLSSTAKMLLPGKK"
     CDS             181086..182033
                     /codon_start=1
                     /locus_tag="cgR_0165"
                     /product="hypothetical protein"
                     /protein_id="BAF53127.1"
                     /transl_table=11
                     /translation="MNLHSDAREFLKSRRDRVTPQAAGLPSYGRNRRVPGLRREEVAL
                     LAGVSVDYYTRLERGNLSGVSEEVLAAVAGALQLDEAERSHLFDLAKATNSQSLRRRN
                     TRGATRAQEKVRPEVQRILDAMADTPAFILTDRADMLTTNQLGRALFAPLYDSPVSPG
                     TSGQAETVNIARFTFLDPVAREFFPHWEHNAADLAASLRSTAGRHPHDTVFSNLIGEL
                     ATRSQDFAQLWADHNVRLHRVGRKTLHHPIVGDLELDFETLILPADPDQSLIVYSAAP
                     GSDAAQNLRLLASWTVTGTDKTGTDRAFHPADDVPSLEE"
     CDS             182030..182380
                     /codon_start=1
                     /locus_tag="cgR_0166"
                     /product="hypothetical protein"
                     /protein_id="BAF53128.1"
                     /transl_table=11
                     /translation="MTPQSAPSHPVPTIELNNNVSMPALGFGVFQTPPADTMTAVTTA
                     LGTGYRHIDTAAAYGNEREVGQAIATSGLSRQEVFIETKVWITDYGYDKTLHAFDKSA
                     GKLGVDTIDLLILH"
     CDS             182480..182938
                     /codon_start=1
                     /locus_tag="cgR_0167"
                     /product="hypothetical protein"
                     /protein_id="BAF53129.1"
                     /transl_table=11
                     /translation="MVPHLDRLMDRATVAPAVNQLEIHPYFQQREVLARNAELGIISQ
                     AWSPIGGITFYRDSGHGSTLEDPTIGEIAADHAKTPAQVMLRWHLQQGRQVIPKSVTP
                     SRIRENFAVFDFELSSDELASIDALDTGVRGGPEPEQVTLASFGIEIPEA"
     CDS             183403..184170
                     /codon_start=1
                     /locus_tag="cgR_0168"
                     /product="hypothetical protein"
                     /protein_id="BAF53130.1"
                     /transl_table=11
                     /translation="MDTDDSAHMPDAVIKASRQPANIEIAHQVGEVIAHMLGDGQSVI
                     DPTETIWTAEAAEDLRARIGDNPILGSDKGQWDKLDHQLDGAPRAVVLLAAELVFLRE
                     HALYVALPTTRLAHVERVLAHLDPPVAIKDPMATWLSRPVRTAGFDPGSWYNGALWRH
                     LIWAATFVRHWKELPEDKRETAKNNPWAFQQVMLASGTDRSDIRNALQFLAFPQAFEP
                     ISAASMKTEIRNGLAHLIGGATGSTPAAIDSDLLAIR"
     CDS             184222..185643
                     /codon_start=1
                     /locus_tag="cgR_0169"
                     /product="hypothetical protein"
                     /protein_id="BAF53131.1"
                     /transl_table=11
                     /translation="MERWNNKPQPEASEDSEDLELAEPRPRHYWLYSPGPQASEWDEF
                     SSESIMAIGWDDLDDLSTYPSREAIRQALNVDGAGGSQTNATLALWQFQNDMTVGDIV
                     YAKEGRQKIVGRGEITSNARFEPERESYRHVRSVKWTHIGKWDHPGDAVTKTLTDITK
                     DHDYVEKLEALITDEVDTEQLVSPSTAPIYDKAAFLSEVYLSETRYVRLRSLLGRKKN
                     VILAGPPGVGKTYAAKRLAYSIMGTKDPSRVQMIQFHQSYSYEDFMMGYRPTENGGFI
                     ISEGPFYRFCEKARADDADRPYFFIIDEINRGNISKIFGELLMLIESDKRGQELRLLY
                     KNETFSIPANVHIIGMMNTADRSLAVLDYALRRRFGFFELAPAYESAGFAQWIQSADN
                     PMLNRLVSVILDLNREIIDDPTLGQGFAIGHSFLSQPVGNADEAWLYSVVEDEIIPLL
                     NEYWFDEPVKAEQWADKLRAVVA"
     CDS             186192..186713
                     /codon_start=1
                     /locus_tag="cgR_0170"
                     /product="hypothetical protein"
                     /protein_id="BAF53132.1"
                     /transl_table=11
                     /translation="MKLASWLSDDVMSSLYERFLREYYRFHHPDLSPKGSVLSWHYDH
                     GSAFGAEQLPVMRTDLTLRKAGRTLIIDAKYYSQSMQSGMSGKETVHSAHLYQILAYA
                     KNADVDQNGSVSGLLLYARTEAVKQPDLDVVIQGNRIGARTLDLNCPWSEISAELESI
                     VRWLEDGAEYSRS"
     CDS             complement(187252..187968)
                     /codon_start=1
                     /locus_tag="cgR_0171"
                     /product="hypothetical protein"
                     /protein_id="BAF53133.1"
                     /transl_table=11
                     /translation="MTSEGRAGRSHHDSHRWVQKYAPELDKHTRWYRQAPDWQASSWR
                     VDETYIRVGGRWCYLYRAITAGGQTLDFYLSPKRNVAAAKRFLAKTLRSNASAGFPRV
                     INTDKAPSLAKAISELKEEGICPPTVEHRQVKYLNNVLEGDHGRLKRILGPKGAFKNL
                     DICISDAEGDGSDALLAERSGDDVCLRATEPGRGDRQPGLRDGLRTLSRRDHGEMKLG
                     RSWPLHPTLQQHLITHVNEE"
     CDS             complement(188307..188969)
                     /codon_start=1
                     /locus_tag="cgR_0172"
                     /product="hypothetical protein"
                     /protein_id="BAF53134.1"
                     /transl_table=11
                     /translation="MLKAQRTRFPLSLLIPPFCHLKQPLIFISYSLHRVEYMKNAKLF
                     LALISAPLILAGCSSTDTGTAESTISSETASAVDATTSTSSSTATSAVIDDDPVFDII
                     DIVLAQYPDGITTDIDREDSSDQYEVDVVVGQEVLELDVTTSGQIHTDDRDNDDDDDI
                     REAHAATVTAAQAIGLALDQYPDGIIDSVELDEDDGQLRWKIDLDDTSGNDLADVEIA
                     AV"
     CDS             189118..192576
                     /codon_start=1
                     /locus_tag="cgR_0173"
                     /product="hypothetical protein"
                     /protein_id="BAF53135.1"
                     /transl_table=11
                     /translation="MTSMNLPIELATLSDQAVNKVRSWLEYSKKESVPNADAKRLAAV
                     LQDPNGLEFTVGFVDRVVRTEDREAAAHALYELGKIAPSTMSFLDRAQIQAGSLVGRA
                     LPKVVVPAARARIRQMVGHMIVDARDKQFAKAVAEIQSDGHRLNINLLGEAVLGRKEA
                     AKHLDDTVRLLRRPDVEYVSIKVSSVASQISMWGFEDTVNYVVEQLTPLYIEAARAPQ
                     GTKFINLDMEEYRDLRLTMEVFKRLLSNPELHELEAGIVLQAYLPDALGAIQDLAEFG
                     RERVKTGGAGVKVRLVKGANLPMEHVHAQITGWPVATEPSKQATDANYKRVLYWTMRK
                     ENMEGLRLGVAGHNLFDIAFAHLLSVERGVADRVEFEMLQGMASDQARAVSVDVGELL
                     LYVPAVRPQEFDVAISYLVRRLEENAASENFMSAIFDLDADNPSFKREESRFRASISD
                     LATLIDVPAPGPNHTQDRSKETLLDAPLVPFINEPDTNPALIQNQQWATKALATAAEP
                     GWLEKQTKPEVLEEGDVDKLINDVRDAAEAWAARPARERAEILYKTAEILRVRRGHLI
                     SVAAAEVGKAVEQTDPEISEAIDFARYYAHLALELDDVDNAKFTPDRVVVVTPPWNFP
                     IAIPAGSTFAALAAGAGVIHKPSKPSQHCSAAVVEALWEAGVPREVLHCIYPANRDVG
                     RALISHEHVDRVILTGSSETAAMFSSWRPELTINGETSGKNAIVVTPSADRDLAVADL
                     VKSAFGHAGQKCSAASLGILVGSVYESERFRKQLVDAASSLIVDWPTNPSATVGPLTE
                     LPSDKLHHALTTLEEGESWLLKPRQLDDTGRLWSPGIKEGVKPGTFFHLTEVFGPVLG
                     LMKATDLNEAIEFQNGNDFGLTGGLQSLDADEVRTWLDHVDVGNAYVNRGITGAIVQR
                     QSFGGWKKSSVGLGSKAGGPNYVMLMGTWADAPSHHAPRETNPLISKLDLSGEDIEWL
                     EKANASDETAWNTEFGSPRDPSGLDVEANIFRYRPAEVVLRLDDSATPRETARVLLAA
                     RRAGVTPRVLQTPGVSEQVREVLSAAGVSAETVDDSVFISNVLRGEYDDNSSVRVRYL
                     GKVSETVRERLAVRPEVVLLDDAVTASGRVELRYWLKEQAISMTLHRFGNPVAAFHEL
                     AEELKR"
     CDS             complement(192648..192887)
                     /codon_start=1
                     /locus_tag="cgR_5001"
                     /product="hypothetical protein"
                     /protein_id="BAF53136.1"
                     /transl_table=11
                     /translation="MNSPTPLPDWLGSTTNCSDRSKRGGSLQVQRPILHESTTDPRFP
                     LKRGGSLPCKLPGFTTAPMAPNSTPSRIASKSLQN"
     CDS             193058..194005
                     /codon_start=1
                     /locus_tag="cgR_0174"
                     /product="hypothetical protein"
                     /protein_id="BAF53137.1"
                     /transl_table=11
                     /translation="MEHGVTVIKGTEFDVFPLNLGGNTFGWTSNREQTFAVLDAFVAA
                     GGNFVDTADSYSAWVEGNEGGESERELGAWIKERGADKLIIATKSGALEPVAGRSREA
                     TFKAVEGSLERLGVESIDIFYYHYDDEAVSIDEQVAIANDLIAQGKIKHLALSNYSAE
                     RLAEFFEKSVGTPAQPVALQPHYNLVSRKDYEENVQPLAEKHGVAVFPYFALAAGLLT
                     GKYTSKEDISGKARAGQLDRYASDEAFAVVTELRAVADELGVAPTTVALAWLVAHGVT
                     APIASVSKVEQLKDLMAVKDVELSAEQLARLDKVSEPFA"
     CDS             194153..195769
                     /codon_start=1
                     /locus_tag="cgR_0175"
                     /product="hypothetical protein"
                     /protein_id="BAF53138.1"
                     /transl_table=11
                     /translation="MSSTTSKTSERQQPDAPTSKLGKWSDKFLNGVETLGNKLPTPFT
                     LFLILFLITALASSIMAWMNVSVIVPGSDEELFVKGLFTGEGLTWLTTNLGANYIGFP
                     PLLTVLPILLAVGVAERSGMLAALIRKLFGSAKKIVLPYAVGVIGVTASIMADAAFVV
                     VPPLAAMVFKAAGRHPVAGLLGSFAAVGAGYSTAIVPTSLDALFAGITNAVMETLPGI
                     ATTEVNPVSNYYFNIASSIVLGLLCGFLIDKVLEPRMWRQDIATEYAESVEPISGTGD
                     EEISATLTVQENRALAISMWTTLVTAIVVLVVVLIPGSPWRNEDGGFLPTSPLLSSVV
                     FIVFLFFMVMGLAYGMVVGTIKNMDDVVNMMGEAIKDMIGFLVLAFILGQFVALFNWT
                     GIGTWTAVQGAAGLEAIGLTGFPAIIAFIILASCLNLLIISGSAMWTLMAAVFVPMFA
                     LLGYEPSFIQAAFRVGDSATQVITPLNPYMIVILGLLRRYEPDAGLGTLMSRLIPFVI
                     PFWLAWATLLAIWFYADLPLGPGSAIFLEG"
     CDS             195776..197164
                     /codon_start=1
                     /locus_tag="cgR_0176"
                     /product="hypothetical protein"
                     /protein_id="BAF53139.1"
                     /transl_table=11
                     /translation="MSTDNFSPQVPSTVYLDYMEQGIAARKAEAESNASTQGESPDYP
                     GQQVIWRLIQESGESLRDELRTLAFMLHDHPEEAFEEVFATEEITKLLQNHGFEVQSG
                     VYGVKTALETSFETPGYDPAQHPSIAILAEYDALPEIGHACGHNIIAAAGVGAFLAVT
                     NMIKTAEVKGVDHLDFEGRIVLLGTPAEEGHSGKEYMIRNGAFDGIDASIMMHPFGFD
                     LAEHVWVGRRTMTATFHGVSAHASSQPFMGKNALDAASLAYQGFGVLRQQMPPSDRLH
                     AIITEGGNRPSIIPDTATMSLYVRSLLPEALKDISKRVDDVLDGAALMAGVGVEKQWD
                     VHPASLPVRNNHVLARRWAKTQNLRGRTALSEGILPDTLAASTDFGNVSHLIPGIHPM
                     VKISPENVALHTKEFAAYARTEEAIDAAVDAAIGLAQVAVDALADPKMLIDATLEFTN
                     SGGVLKAGDYLA"
     CDS             197261..197629
                     /codon_start=1
                     /locus_tag="cgR_0177"
                     /product="hypothetical protein"
                     /protein_id="BAF53140.1"
                     /transl_table=11
                     /translation="MDERSRFARSVFPDGEEPDPRFTLANERTFLAWTRTSLAFLAGG
                     IAFEAFQISGLSDTVRTTIAVFIIAVGMIIAAGAAVRWMNVERAMRKQKPLPVPAIIP
                     FLSIAALVASAAVLVLIIVQ"
     CDS             197632..197949
                     /codon_start=1
                     /locus_tag="cgR_0178"
                     /product="hypothetical protein"
                     /protein_id="BAF53141.1"
                     /transl_table=11
                     /translation="MRIHEDPGLQPERTVLAWNRTTVSLAVCSAILLRWTNFYGIFAL
                     LPVVILSGMAIFILFTQRVRYERQAIGLADNKLPPNIVGVVSLTVTLLAFGAAGIVFV
                     FID"
     CDS             complement(198201..198542)
                     /codon_start=1
                     /locus_tag="cgR_0179"
                     /product="hypothetical protein"
                     /protein_id="BAF53142.1"
                     /transl_table=11
                     /translation="MTPLPDLHRRRPGNRENIDRIKAGMYSDAKAYRLRTLREESGLT
                     QESLAKKIGVGQNRISQIEHGHLTSARVSTVQKYVAALGGSLELTVKRADGSTVTLPA
                     EEDLEDLADSK"
     CDS             complement(198539..198811)
                     /codon_start=1
                     /locus_tag="cgR_6007"
                     /product="hypothetical protein"
                     /protein_id="BAQ21069.1"
                     /transl_table=11
                     /translation="MKELRPREKSRAKNIRIVFGFDPHRHAIFLVAGDKTSQWDKWYS
                     KHIPEQMKDLATTSNNSRKATNSYLLRENPLIETGTTHPQSLRRTP"
     CDS             complement(198981..199769)
                     /codon_start=1
                     /locus_tag="cgR_0180"
                     /product="hypothetical protein"
                     /protein_id="BAF53143.1"
                     /transl_table=11
                     /translation="MADSDHMEREQRHKVIMRTVDRPGITRIDALTELTGVSAVTIRR
                     DLADLEQAGFLARTHGGAKRVLKRGAPQPFAVRRAEDRAAKHILAQATARLIADDEAV
                     IIDNGTTCQAVAQELAGRPITALCLSLHSAVALGSRAGTHIFIPGGPVENDTLALSGP
                     AVITAVRDFSADAVILGSCSTSLSHGLATTTYDDAENKRAAINAATRRILVVAARKLN
                     HVSTFRFADVTDLHQLVTTSDAPREILAEIRDLGVQVITVPAPD"
     CDS             199956..200084
                     /codon_start=1
                     /locus_tag="cgR_0181"
                     /product="hypothetical protein"
                     /protein_id="BAF53144.1"
                     /transl_table=11
                     /translation="MVARTATGEKVVPTSPLAQWWAMRWEWFKRTGLQVTGAVLEG"
     CDS             200081..200854
                     /codon_start=1
                     /locus_tag="cgR_0182"
                     /product="hypothetical protein"
                     /protein_id="BAF53145.1"
                     /transl_table=11
                     /translation="MKIAAFDFDGTILFPNGIDDRTVEVIHAWQDAGHLAVAATGKSL
                     SAAHYALQEVDLVFDYSVLFTGAVVTDRDGTVLHSRSLETGTVRRIVEDLIEIEGAAV
                     FATMLQGRDVRFSSTVLPEVETSILQDFREITTEEIDDYEFIGIPIWVPGNEELKMRI
                     HDWLRNTYDVGCVINQDFVDIVPTGTTKGAGLEWLWHYLGRKRCEVEIYTFGDSWNDL
                     PMHDLADRSFSFPWSPPGVRVTTDEVIDSVADVLPRLLG"
     CDS             201053..201442
                     /codon_start=1
                     /locus_tag="cgR_0183"
                     /product="hypothetical protein"
                     /protein_id="BAF53146.1"
                     /transl_table=11
                     /translation="MRIEITSVFVDDQAKALDFYTTKLGFELKNDVSAGEYRWLTVVD
                     PENPNGVQLLLEPNQHPDATTYQAGIKRDGIPATQFFVDDLEAEFDRLKAAGVEFTME
                     PTDIGPSIIAMLDDTVGNLIQIVQLKK"
     CDS             complement(201445..201957)
                     /codon_start=1
                     /locus_tag="cgR_0184"
                     /product="hypothetical protein"
                     /protein_id="BAF53147.1"
                     /transl_table=11
                     /translation="MSPTHRLVILRHAKSSWSTGVLDHKRPLNERGLRDGVAAGQWLA
                     GNIGEIDHVLCSDATRTQLTWERVQLGGATAKGSSFHNDIYENQVSEFEHLITGLPEE
                     VGTALLIGHWPGVEELANHFGIRDSHPGWNQMDEKFPTSAIAVLEFHVPWSELVENSA
                     KLKDFVIPRG"
     CDS             complement(201983..203494)
                     /codon_start=1
                     /locus_tag="cgR_0185"
                     /product="hypothetical protein"
                     /protein_id="BAF53148.1"
                     /transl_table=11
                     /translation="MNTPLQLNTENLQEIASTSGVQIPVFNRADVTPGIVHFGVGGFH
                     RAHQAMYLNELMNEGKALDWGIIGMGVMPSDVRMRDALASQDHLYTLTTKAPDGTLDQ
                     KIIGSIIDYVFAPEDPARAVATLAQDSIRIVSLTVTEGGYNIDPATEDFDHTNPRIVA
                     DREALQAGDTSTLQTFFGLITAALIARKESGSAPFTIMSCDNIQGNGDLAKRFFLAFA
                     HSVSSELGEWVENNVAFPNSMVDRITPETTDGDRDDIKEIGYIDAWPVVSEDFTQWVL
                     EDAFTQGRPAYEEVGVQVVSDVEPYELMKLRLLNASHQGLCYFGHLAGHHMVHDVMAD
                     TRFQDFLLAYMEREATPTLKELPGVDLDAYRRQLIARFGNAAVKDTVPRLCAESSDRI
                     PKWLLPVVRENLAAGRDVTLSAAIVASWARYAEGTDEQGNPIKIVDRLSERVQENASG
                     NRTDILSFIRDRGIFGDLVDAEPFTKAYSETLSSLHDRGAEATIDALLTQVTV"
     CDS             complement(203539..204876)
                     /codon_start=1
                     /locus_tag="cgR_0186"
                     /product="hypothetical protein"
                     /protein_id="BAF53149.1"
                     /transl_table=11
                     /translation="MSVQQSGLLERLGIPRPLIFGFIGLTIFMIGDGVETNILEPFLS
                     SEHGFSVSLAGTLVTVYGVAVAIAAFFAAALSDLWGPRKVMILGASIWIVFELIFLTV
                     ALTTDHTWLIFLAYGLRGFGYPFFAYGFLVWITATASPKQLGTGVGWFYVAFSAGLPT
                     LGALVATISMQYVNLTFYETLWVSLVLVVIGSLIALLGVKERRGRHPLVANPDDVKQT
                     LGQGFKLLRNDRRARFVTYIRTINSIPTYAMAVFFPSFFTDDLKWQLSWFLILTTVIY
                     AVNLPFNPFFGSFGDRHGWARTVFWSGSIGGAVTLALVYFIPMFGVQAGMSNGVVFGI
                     TIAAGALFGVSLAGFVPLSAIAVSLDPKHPGAAMATYNLGVGGAVAVGPLLVAVFHPL
                     IGPTGLILVMIALYLLSGWMTLQLRGTQPGFDGVPALAEDAHIEDLADVNANA"
     CDS             205156..206004
                     /codon_start=1
                     /locus_tag="cgR_0187"
                     /product="hypothetical protein"
                     /protein_id="BAF53150.1"
                     /transl_table=11
                     /translation="MSQVIPASSQEKRRERIVSYVTRHGFARVEALAELFEVSAMTIH
                     RDLEALAADTLVERIRGGARSVSPSMSELAVEQRRHLHRTVKEALCTAAARLIPEGAV
                     VAIDDSTTLESLVEKLPQRSPSALITHSLKTMADHRVRAGMSDIRLIACAGLYFAETD
                     SFLGKATSAQLNELSADISFVSTTAVRATGEAPALFHPDMEAADTKRALIGIGSVRVL
                     VVDSSKFGSAGVFKVASIEEFDHIIIDQQCTREQRDLLRNSRAQIHVIDHNGDEILDT
                     PTEEDF"
     CDS             206006..207388
                     /codon_start=1
                     /locus_tag="cgR_0188"
                     /product="hypothetical protein"
                     /protein_id="BAF53151.1"
                     /transl_table=11
                     /translation="MALVLGIDSSTQSCKALLVDAATGQVIDEGRASHPSGSEVDPRA
                     WIAALDQATEGLLERADAVSIAGQQHGMVALDENDEIVRPALLWNDTRSAQAALDLNE
                     EIGGDQAAVDATGSVYVASLTATKMRWMRDHEPENAARTASVMLPHDFLTWHLMGRGR
                     KVTDHGDASGTGYYSTRDRAWRTDLAAWALGHEVELPELLAPNAIAGTTPGGVKVAAG
                     TGDNAAAALGLDLQPGDVSVSIGTSGVAGMTVQNSVHDTSGLVTGFADATGAYFPLAC
                     TLNGAPVLEFGRRILGVEWEEFDALALAAQPGSGGVTLQPYLEGERTPNRPAARGVLA
                     GLNSATTREDFARATVEGLLLALDDAVTALVEATGVPVQRIQLIGGGARSQAVREIAP
                     EIFGHEIVVPEPAEYVALGAARQAAWALSGEATPPQWPTPGSDPHRAPKNTELSTRYA
                     KLRAATQGWY"
     CDS             complement(207385..208224)
                     /codon_start=1
                     /locus_tag="cgR_0189"
                     /product="hypothetical protein"
                     /protein_id="BAF53152.1"
                     /transl_table=11
                     /translation="MQVATTKKALIDALLHHKSVGLVPTMGALHSGHASLVKAARAEN
                     DTVVASIFVNPLQFEALGDCDDYRNYPRQLDADLALLEEAGVDIVFAPDVEEMYPGGL
                     PLVWARTGSIGTKLEGASRPGHFDGVATVVAKLFNLVRPDRAYFGQKDAQQVAVIRRL
                     VADLDIPVEIRPVPIIRSADGLAESSRNQRLSADQRAQALVLPQVLSGLQRRKAAGEA
                     LDIQGARDTLASADGVRLDHLEIVDPATLEPLEIDGLLTQPALVVAAIFVGPVRLIDN
                     IEL"
     CDS             complement(208224..209039)
                     /codon_start=1
                     /locus_tag="cgR_0190"
                     /product="hypothetical protein"
                     /protein_id="BAF53153.1"
                     /transl_table=11
                     /translation="MPMSGIDAKKIRTRHFREAKVNGQKVSVLTSYDALSARIFDEAG
                     VDMLLVGDSAANVVLGRDTTLSITLDEMIVLAKAVTIATKRALVVVDLPFGTYEVSPN
                     QAVESAIRIMRETGAAAVKIEGGVEIAQTIRRIVDAGIPVVGHIGYTPQSEHSLGGHV
                     VQGRGASSGKLIADARAVEQAGAFAVVLEMVPAEAAREVTEDLSITTIGIGAGNGTDG
                     QVLVWQDAFGLNRGKKPRFVREYATLGDSLHDAAQAYIADIHAGTFPGEAESF"
     CDS             complement(209131..210369)
                     /codon_start=1
                     /locus_tag="cgR_0191"
                     /product="hypothetical protein"
                     /protein_id="BAF53154.1"
                     /transl_table=11
                     /translation="MLIKDFDMDYRTLEKEHYALHQSAAETLYQSRFNSEAALKWEFK
                     VKNNPLFCLITPEVYRLTERSHNLERTILYYWSRLPPGVIRHYYRSLTIDEVISTNEI
                     ENIHSTRRDIEIALDESSTSEPKRFSEISHLYLALAEGKISFPESPSELRELYDHLMH
                     GELGRENELDGEIFRQGPVEIRDSRQKVIHSGFSPESQIIEGINAIIKLAHSEEESNL
                     VGIMMSHFMFESIHPFYDGNGRTGRYLLGIQLSKILSPATALTMSSAINQFRNKYYKA
                     FHAVEHRLNRGDGTPFVFSMLELLIAAQEGLIENIKQRIDLLASLEEAIKTLRGTNSF
                     KKHQINLLYILGQIQLFGKDETLSLESAAKFLKVSKATATRYFRTLQEMDLVHEVSKR
                     PLRFALTDKGREMVGLEVKI"
     CDS             complement(210522..211154)
                     /codon_start=1
                     /locus_tag="cgR_0192"
                     /product="hypothetical protein"
                     /protein_id="BAF53155.1"
                     /transl_table=11
                     /translation="MYALVTLAWWDFRTVRPRIGAMPIDFLQPAEIVAPQLLGCTLTH
                     GGVGIRITEVEAYLDSTDEAAHTYRGKTPRNAAMFGPGGHMYVYISYGIHRAGNIVCG
                     PEGTGQGVLLRAGEVVSGESIAQNRRGERIPHARLAQGPGNFGQALGLEVSDNHASVF
                     GPSFLISDGVETPEIVRGPRIGISKNTEALLRFWIPNDPTVSGRRGYPKE"
     CDS             211181..211681
                     /codon_start=1
                     /locus_tag="cgR_0193"
                     /product="hypothetical protein"
                     /protein_id="BAF53156.1"
                     /transl_table=11
                     /translation="MSTSFESIPGVTISARKALSTAGFKDLESLAGTNYEEVAGLSGI
                     GARTLERLQAALMERGLSFGGEVPEAEQRTATWTALDSAAPEATETTESPEHFIQNLD
                     SPRRITHGQLLLEIFNRATGQKPFVAGSSIVGYGRVHYRYATGREGITIRVGLVPERQ
                     RFHFMD"
     CDS             211717..211836
                     /codon_start=1
                     /locus_tag="cgR_6008"
                     /product="hypothetical protein"
                     /protein_id="BAQ21070.1"
                     /transl_table=11
                     /translation="MGKHSVGVSCLYINKPEDVDLEVLEEMIRISWEVEPGEC"
     CDS             complement(211847..212764)
                     /codon_start=1
                     /locus_tag="cgR_0194"
                     /product="hypothetical protein"
                     /protein_id="BAF53157.1"
                     /transl_table=11
                     /translation="MFLHPDAQFYIDTLSTLSAEEQVNFGKDAVGSGVDATHSAADQD
                     IAGVPVRVYTPLSGAGDFPCLVYFHGGGWSGGTLDMIDATVRSLVVGLPIIAISVDYR
                     LAPAHPFPAAIDDAFVVASAVLDGVSGLSIDTSRVAIGGDSAGGNIAAVTAQQLRERA
                     VDSVSVSGLATALARQVLIFPVTDVSTTDTPSYLTFGKDCYLTKDAMERYIEQYADGH
                     DRTDPRLSPLLASDLSGLPPTTIVYGECDVLAHEVRAYGQALLEAGNSVTITEFMGQI
                     HAFINLGGISSDARAARRLIRAELEAALC"
     CDS             212876..213481
                     /codon_start=1
                     /locus_tag="cgR_0195"
                     /product="hypothetical protein"
                     /protein_id="BAF53158.1"
                     /transl_table=11
                     /translation="MSKTRTFLFDLYGVLIKEHGAAQFERVARAVGEPSKNDKLHEVY
                     ESLRLDLDAGRVSEVNYWNQIKLLVGLEFLDIQEVIAADYKGLYERDQDMVDYVLSLK
                     AKGHRIGILSNIPEGLAKLLKEHNSEWLDQLDAVTLSCDIGAAKPEPKSFHVALEALG
                     EKAEDVTFIDDRLRNIEAAREEGLSTIHFTGLDSLKESIQE"
     CDS             213478..214038
                     /codon_start=1
                     /locus_tag="cgR_0196"
                     /product="hypothetical protein"
                     /protein_id="BAF53159.1"
                     /transl_table=11
                     /translation="MTPQPLILPFGDKVPRIHESAWIAPNATIIGDVEIGPDASIFYG
                     VVLRGDVNKIAIGARTNVQDNCVLHVDGDAPCTLGDDVTVGHMALVHGATVGNGTLVG
                     MKSALLSGSHVGAGALIAAGAVVLEGQEIPAKALAAGVPAKVRRLLDDAQSQSFIPHA
                     GRYVETSKAQASIAEALSLDEVRVRG"
     CDS             complement(214022..215167)
                     /codon_start=1
                     /locus_tag="cgR_0197"
                     /product="hypothetical protein"
                     /protein_id="BAF53160.1"
                     /transl_table=11
                     /translation="MPNQAHFSASFARPSTPAAKCMHHIRLGQQLIRNELVEATGLSQ
                     PTVTRAVTALMQAGLVRERPDLTLSSGPGRPNIPLELAPSPWIHAGVAIGTKSSYVAL
                     FDTKGRTLRDAMLEISAADLDPDTFIEHLIAGVNRLTTGLDLPLVGIGVATSGKVTNA
                     GVVTASNLGWDGVDIAGRLNYQFSVPATVASAIPAIAASELQASPLPHPEQPTPITLT
                     FYADDSVGAAYSNDLGVHVIGPLATTRGSGLDTLGMAAEDALSTQGFLSRVSDQGIFA
                     NSLGELVTIAKDNETARAFLNDRATLLAHTAAEAAETVKPSTLVLSGSAFSEDPQGRS
                     VFASQLKKEYDADIELRLIPTHRENVRAAARAVALDRLLNEPLTLVP"
     CDS             complement(215258..216532)
                     /codon_start=1
                     /locus_tag="cgR_0198"
                     /product="hypothetical protein"
                     /protein_id="BAF53161.1"
                     /transl_table=11
                     /translation="MSFRDIFADTRPLKEPAFKRLWLGNVATVIGAQLTVVAVPVQIY
                     QMTGSSGYVGLTGLFGLIPLVIFGLYGGSIADAFDKRIVLICTTIGMCVTTAGFWVLT
                     ILGNENIWLLLINFSLQQAFFAVNQPTRTAILRSILPIDQLASATSLNMLLMQTGAIV
                     GPLIAGALIPLIGFGWLYFLDVVSIIPTLWAVWSLPSIKPSGKVMKAGFASVVDGLKY
                     LAGQPVLLMVMVLDLIAMIFGMPRALYPEIAEVNFGGGDAGATMLAFMYSSMAVGAVL
                     GGVLSGWVARISRQGVAVYWCIIAWGAAVALGGVAIVVSPGAVTAWAWMFIIMMVIGG
                     MADMFSSAVRNAILQQSAAEHVQGRIQGVWIIVVVGGPRLADVLHGWAAEPLGAGWTV
                     LWGGVAVVVLTAICMVAVPKFWKYEKPKITGI"
     CDS             complement(216569..217033)
                     /codon_start=1
                     /locus_tag="cgR_0199"
                     /product="hypothetical protein"
                     /protein_id="BAF53162.1"
                     /transl_table=11
                     /translation="MSSRALKASSTHSTTSIFAPPSTVTPDNAWYQFRVGKHLGRDAF
                     AEIVMCLGHVFCHHVPQVWSTTCASQDADPTTMLIEAEAAGALAIARVGGPTRRGGSF
                     FGDALLKEGTPLPAGFRLDVVLHAASEIEDLLRGDTTAVVSGAWSVEDRRGY"
     CDS             complement(216816..217217)
                     /codon_start=1
                     /locus_tag="cgR_0200"
                     /product="hypothetical protein"
                     /protein_id="BAF53163.1"
                     /transl_table=11
                     /translation="MNHPETATVLRSISDMVSTETNPRRKSRLEQLIYTTASAWPHYP
                     IAHAAQAAVQLARPMRVFELQSFEGVKHALHHIDLRPALDCHAGQRLVPVSRRQASWS
                     RCVRGNRHVPWPRVLPSCPPGMVDNLRISGR"
     CDS             217513..219456
                     /codon_start=1
                     /locus_tag="cgR_0201"
                     /product="hypothetical protein"
                     /protein_id="BAF53164.1"
                     /transl_table=11
                     /translation="MKIKSVFLSTALSASLLLGITPPVLGATINPSLPLSALSSSDDI
                     AVPNFAKELPLAFDVPAGTVPQSLSGTLQIPAEFSGGVVEFYDGDRLFHTLRLEVSDS
                     RAHIEVPLQSVPVEDGRATFWLRAMLDPVNNQWCYEEQEVRFLDGNVTFEGATINPAV
                     VADYFPSVLRALTIYVPENPSEAVQEATLEVATSLDSVYRRSGLDVNVETLPTGTDAP
                     PARPQDFERQIVLVDEATESNTQKTELVNPGQDNAFLRLNGNADELYDQARLLTDATL
                     PLAVDTEVTASGFGDVPNLSTDVATLQELGITQLTSESVARTSVTLGIERSRLRTYLQ
                     SMDLHITGTYTPLPPQNAGQITFSIGDTVLDSLTTDDTGIIDREFNVPGDLVNRYTAI
                     VVEFTSTGDVNCGVTQPVGLNIDSDSLVTSQHSDVPVLNGFRSLPQSFQPRVDVAFAD
                     PSVQELSRAVSVVLGIQSMSSQRIRPHLVNWDEAVASERPTIFIDAAGAKTDEVPSYL
                     AQQGQTLEITSKNDQNADGEQLTRSLQTNAALVVGSIQAVWDADKKRTVIVASSQDNP
                     ADLDALISWMGEDRERWSDLNGDLIVKVRDREPVQLTTVEASEQPGRSATVFIAIGVS
                     LVVIALIVAAVVSVSRRSQKGYK"
     CDS             219500..221050
                     /codon_start=1
                     /locus_tag="cgR_0202"
                     /product="hypothetical protein"
                     /protein_id="BAF53165.1"
                     /transl_table=11
                     /translation="MSNPSLEPLEPLEPIELSDGTEIEVPDVDPEPQAGNAQMEVPSL
                     RTYVFRGIIAIACLVIGFYESFVLLWQNLRIGVANYSLLVVLMAIVLFIGLDRKRARA
                     LNIHDREVDYIIGVIAVLIAITIKSQLLPRFVDWETLLRLDMFALLFFAFGISGLVFG
                     MRSTFSFAPGWILLFGYNAVAHLIISVIFGGGFWGPVMANIIGLSLAVLVSSNRDLVQ
                     ATYLALMTVLFGVIFAIIVWALTDGSKFLTLVPAVLATITVVLVSSRWRLGQWKIRRR
                     QPTVEKAGPALIAVVVATALLAWIPTPYVERVNNLPGLQMLAKPAPGVIAPIGWHIDD
                     VQYYNWASRYFGPGSSLLRQTMTADHYNEAWDPDGLDRTVVVDTLQSAERFQQHAFGD
                     ETLYSTLRGRKSDTVQVDLGYGVVGRAYTVLDETDFLTYTKLVFEWQTTNNTVEKISV
                     IAVDDHRAEAKFPELAPSVTRMFIQVVTILFRGNGVTIDTNTQLKDLDLVSQVGRQIV
                     AEQQVGRS"
     CDS             221047..222510
                     /codon_start=1
                     /locus_tag="cgR_0203"
                     /product="hypothetical protein"
                     /protein_id="BAF53166.1"
                     /transl_table=11
                     /translation="MMEQDLSYREILPLNASEEQKKAALIDAIEGLRVRDPLLSASIA
                     FTRGQKVAFIAVVVGFILMLIFARQAALIGLAATCTFMYLITLLDRFIMFSRGIRAES
                     IIQVSDEDALAFPEDKLKTYTVLVPAYGEPEVIAQLLASMRAFDYPKHLLQVLLMLEE
                     DDLPTIAAAEEAGVDQVATIIKVPPAQPRTKPKACNYGLHFATGDIVTIFDAEDMPDP
                     LQLRRVVVAFERSASNTVCVQSRLSYRNARQNLLTAWFTIEYDVWFNFLLPGVMRMNA
                     PVPLGGTSNHLLTGVLKDLGAWDPFNVTEDADLGVRIAAKGYSTAVLDSVTWEEANSD
                     TINWLRQRSRWYKGYLQTWLVYMRRPKWLVQELGIIPAVRFTFLMAGTPIIAVLNLLF
                     WYLSLAWILGQPGTIEQMFPPAVYYPALVCLVVGNTATIFMNLIGCREGRDPLLLIAV
                     LTFPLYWLLMSIAALKGTWQLITRPSYWEKTAHGLEA"
     CDS             222514..224247
                     /codon_start=1
                     /locus_tag="cgR_0204"
                     /product="hypothetical protein"
                     /protein_id="BAF53167.1"
                     /transl_table=11
                     /translation="MPIVKPMPALPRRAPVLASSQIEGFEHRRGWRRQANFWFAASLA
                     LYWCAALWIALDVGYFWGDALSRTQGALSALYSRNPTLSAIGYVFTPLTTVVQIPLVA
                     LSPWVPEFTRAGLAGALVSSVFMAASVRQLWLIASERNIRYWLAVVGLLLYALNPMII
                     LYGATGMSEAPFIYATLWAVRRLIRWTSTDDVHDLITCGFALALAFLARYDALIMAFV
                     AMWTVGFMTWRARYRRGFRDRIGFALVDMLLLVWPIGFAFVAWTGASWLTTGELFAQF
                     TSTDGNAAIIAASGGGATGPQALFDASVRTFLISPALLLVAVVAVFFAYRRRDPEPII
                     PLALIGSVVFFQIITYSLGSTFGLLRFFLTALPLTIILLFQIIPPRHRFPSLRPGACY
                     RDRVTGKYAPKKITGVLVLAIFGGTGITLYGMSSANWAPQEYAIQELVFNMESPSQDA
                     VHTLNTFSTEMDVADFVDSLNLGDGEVLLSTTYGFAVLTASNNQKQFIIPSDEDFITT
                     LNEPAEHGVKYILALPREGRGATDPINLRYPDMYETGSHIATMEIEFINQGQGQPNWR
                     LYRVLTTPEQS"
     CDS             224293..225360
                     /codon_start=1
                     /locus_tag="cgR_0205"
                     /product="hypothetical protein"
                     /protein_id="BAF53168.1"
                     /transl_table=11
                     /translation="MARKLKDKLPRNFDKIVESGDFGAFKEVFTERALDAKNRHGNTA
                     LHMRGVPEEFKIWMLDQGLDVDIRNEDGDTPLHVHSHDWNLSPDFLLKRGADVCAVNN
                     EGESVAYSAAFFPENLKKLIDAGADPYARANDGTTPLMRVIRSANTGQIIELAEITKL
                     LSGTEFTDAEFRETQERIIAMGERFEDVREVYNEESVDQASADMIWLYDRFDIPEELR
                     ANTPILHDGVSPIELPGDTWQEQFIEGYDLLVPAMGKAKSLQGEAIRIAGRVSNEFHG
                     NGGVNWDKDFKRMAKSLNHICEQGVPLGEPELEELAAAVKSVRKGEPNEEEIDTLPRL
                     ATKWVAQNPQPLPLGEVDYKR"
     CDS             complement(225357..226034)
                     /codon_start=1
                     /locus_tag="cgR_0206"
                     /product="hypothetical protein"
                     /protein_id="BAF53169.1"
                     /transl_table=11
                     /translation="MTVRRDIAALEESGQVVSIKGGVKLSEGISTPVPLDRASRLALE
                     LHRKEAIAREAADRVTDGMTIFLDAGTTLQALVPYLEPRQNLTVITNDLFVATTLFNY
                     PHIRTIQTGGTIDPEIGACQGHLAARSVEIFNFDIAFISSSGWSLNRGLTAPAEEKRL
                     LKRKVMEVSTTSTLLADTTKYGVISMVTVCPLDEIDAIITDWGLDSQTIERIHELGVN
                     LTVAQEI"
     CDS             226353..226940
                     /codon_start=1
                     /locus_tag="cgR_0207"
                     /product="hypothetical protein"
                     /protein_id="BAF53170.1"
                     /transl_table=11
                     /translation="MLIIRTPDADSAYQVARAAIEGGIRCLEIPFGVPGALQAIEKIA
                     TEYGDQGVYVGAGTVLDAQSAYAAVNAGSSLLVSPNVNDGVLEIAQRYQVVSMPGAFT
                     PTEIQTALEKGADVVKLFPAELHGPKYLKSLRTPLEHAPIAPTGGVDLDTVGDWFDAG
                     AFSVGVSSYICKAGSAEAITANAASLLQKIADVRS"
     CDS             226943..228262
                     /codon_start=1
                     /locus_tag="cgR_0208"
                     /product="hypothetical protein"
                     /protein_id="BAF53171.1"
                     /transl_table=11
                     /translation="MSTQATPRSQKASSSWDFTTIKKMRWFFIALIVIAGVINYLDRS
                     TLSIGNSTIAEELSLTTVQMGLLLSAFSWPYALANLPAGYLIDKFGVKKMFLVAAVGW
                     SIVAVGTAFANTFLALYIARVLLGIAESPFFAAGLKASQMWFSKRERSLPVSIVNTGS
                     QIGNAIAPPLLTFLLLGFGWRWMFAIVGVAGLIIAAVWWFSYRDPKPEEDALIHNEVG
                     DDLVTESENEIEKASWFSLLAKPNTWFMIIGAFGIFYTVWVYLTWLPRYLEESRGFSL
                     AATGWVAALPFMCGIAGVLLGGVVSKKLIDGGMKAVTARKIPIVGGAILAAIAVAPVA
                     YIENTTLNILLLCIGYFAAQIPIGCIWTLASDIAEPHQVASLGAIQNFGGFLGAAVAP
                     IATGYILEVTGTFNWVFILAGLLLLVGAFSYGVLVKDRREASLQATA"
     CDS             228259..228891
                     /codon_start=1
                     /locus_tag="cgR_0209"
                     /product="hypothetical protein"
                     /protein_id="BAF53172.1"
                     /transl_table=11
                     /translation="MSLGLGEDAIPAVFVIGTAGSGKSTVAKSIASAMGASYLDKDTV
                     ANIFTGAMLEANGESPAARDDSEFYTGTIRPLEYSTLLAIGSENLRLGNPIVLDAPFG
                     AYFQQTDYISAIAAEHQWSPQVFPFVVRVSSSEAVTKQRLRSRGLDRDLWKLNNWDHF
                     WSEVGKAHPEWDSVQIVDFTNDADLPAPELASVILQEIEKSLSGKDLATP"
     CDS             228948..229706
                     /codon_start=1
                     /locus_tag="cgR_0210"
                     /product="hypothetical protein"
                     /protein_id="BAF53173.1"
                     /transl_table=11
                     /translation="MIVLTIAIVLLASVLIGALLQRMTGLGVGLVTGPVLTSLLGPLA
                     GVTMVNGLSIINAVNNAWSVRKRTDWAKFRILAGALVLGSVPAVAVVYFLNGPWLLIF
                     VGAMVLLALGVSLFPTEKFALKQEAKLPMVIFGMIGGFMSTVAGIAGPSLTVYARLSR
                     WDYRDFVATLHPVLLVANTVSFLLKVILIGGLDFGGAPAWLWIGAVAMIFVGAWLGEI
                     VNAKVSTPMAKRIATLLAAAGAAVVLFRGIMELV"
     CDS             complement(229749..230630)
                     /codon_start=1
                     /locus_tag="cgR_0211"
                     /product="hypothetical protein"
                     /protein_id="BAF53174.1"
                     /transl_table=11
                     /translation="MATNRTSSAGVIMSVLASALFGAIFFISGAIEAKAETLVAWRVL
                     LTAACYLIALLHPAGRKVFKEFWDTLRSQPRQILYFICLVALIALQLWLFSWSPKSHA
                     LDASLGYLLLPIFLVIVGRFFFADYITRLQWIAVGIALIAVTLKFVTSAQLSWVTFAI
                     AAGYALYFALRKYSGLNNAFAYGAEVLALSPLAFFMLATVEDPLSNAMLSMVILAGLA
                     GALAMALYLAASTLLSMPMFGLLSYGEPILLFVAALLLGETLNLSDAIVYSLLACALA
                     LLGFDGMRRSRKNLESD"
     CDS             230756..231475
                     /codon_start=1
                     /locus_tag="cgR_0212"
                     /product="hypothetical protein"
                     /protein_id="BAF53175.1"
                     /transl_table=11
                     /translation="MDLALAQVDSTVSGLYDALDLIGVLLNGIIGGTIARQRGYDIIG
                     FLFLALFSALGGGMIRDMLIQQGTVAAIDNQIYLALAFSGALIAMAVNFKGRVWELFK
                     VHGDAIVLGVWAVTGSVKAMNAGVAPLPSIFMGVLTAVGGGMVRDVVTGQTPTIFGGG
                     TLYAVPATLSATSMVIFHSFDQVILGMIISPFLGIALAVTAYWCGWVIPVNTDFAPVN
                     LTVSQLRAMLSKAERKDKDQK"
     CDS             231472..231807
                     /codon_start=1
                     /locus_tag="cgR_0213"
                     /product="hypothetical protein"
                     /protein_id="BAF53176.1"
                     /transl_table=11
                     /translation="MKTYPVLIAVAGLALAGCSSSAPGIWRATEPADAYLEIADDGTL
                     SGSDGCNRLFGGWEKDGSTITFGAIGMTEMYCEGVNDWLSQMHTATVTDATMTIFNEA
                     GSNIGELKR"
     CDS             complement(231804..232214)
                     /codon_start=1
                     /locus_tag="cgR_0214"
                     /product="hypothetical protein"
                     /protein_id="BAF53177.1"
                     /transl_table=11
                     /translation="MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKV
                     AIVDITNGARLETYVIVGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYE
                     PKIVHVDADNRIVALGNDLAEALPGSGLLTSRSI"
     CDS             232356..234017
                     /codon_start=1
                     /locus_tag="cgR_0215"
                     /product="hypothetical protein"
                     /protein_id="BAF53178.1"
                     /transl_table=11
                     /translation="MTLQSSDKRSPSLLDASSEVFVHDLAALSPTDATAWGISGFEGE
                     LQDFSPDYWNAIAERNRDMVADVDAFDDGTDDNDDEEDFDDVDRVTADVLRDRVCLDL
                     ALHHQGETLANLNNIDSPVQTIRDTFLIMPRETDDDVENLRERLSRVPDALHGYCESL
                     AEAASQGHVAAVRQVEEVVSQCEDLADEDSVLQHLGLDEHDPVVVEAQEAFARVAGWL
                     AEQLAPHAPHVDAVGRDRYEMFSHLHVGEFVDLDEAYQWSLEQLRDIDAQQLQVAQQL
                     YGPGTTIREAMKKLNADERYLIRGTDALQEWMQKTADQAIADLDGVSFNIPEQARQVE
                     CLIDPAGTGGIFYTPPSDDFSRPGRMWWSVPKTQEVFHTWQELTTVFHEGVPGHHLQI
                     SQTLVEKDLNLWRRVACWNSGHGEGWALYAESLMKELGYHEDPGNLMGYLDAQRLRAA
                     RVAIDIGIHLNKRNPECTGLWDASYARSFLRENTSMNEDALYFELNRYLGWPGQAASY
                     AIGQRLWLNLRDEAISQGQTLAQFHSKALSYGSIPMGILRDQVLN"
     CDS             complement(234025..235164)
                     /codon_start=1
                     /locus_tag="cgR_0216"
                     /product="hypothetical protein"
                     /protein_id="BAF53179.1"
                     /transl_table=11
                     /translation="MSDKEPDPHEQIPEKPSRKVIALRWCIVAPLSLAVGWLFTMWGV
                     PAAWILGAILVAGVCALTTGQDLPMAKGVHVFGRSIVAMLAALPLISASGSELIRFLI
                     PGLVISFFTIAVGIVGGLLLARSRPEILPETGVLSMLAGGASVMPILARELGADFRYV
                     ALTQYLRLLVVSMTLPLVTHFFVPGGTDLGSPPEKWLDVLSLGEFGTSISVLSLLVLF
                     GIVLAGEPLGRLLRLPAPAVMGPLILTVLVSFVIPDDLSLQPPTVFKIIAFMAIGWMC
                     GGALNMTALKVFSKQLPATFLFIFALLAVCAGAAGLLTWWLDISFFEAYLATSPGALE
                     TVLALSSEGSAGPVVVTIQIIRLLAILTIAGLIPTLLRRILRRDR"
     CDS             complement(235197..235763)
                     /codon_start=1
                     /locus_tag="cgR_0217"
                     /product="hypothetical protein"
                     /protein_id="BAF53180.1"
                     /transl_table=11
                     /translation="MPVEVPFSRISMGNTSSSGRLRMIHMRNQTIAAVAALVLLTAAT
                     PAIAATPATAGNGLYSIDMGDEQKLTCVLFDEPSTEAHVVASCAATFPVTWKLLDGAH
                     EQAAKLEITQTQDGELSVTASKEPLITTMIVPTSITKPTTVNRLVVVPGENEVHFFAT
                     DPDVLPVLITPDSYEVLTDSAAKVKATL"
     CDS             235825..236607
                     /codon_start=1
                     /locus_tag="cgR_0218"
                     /product="hypothetical protein"
                     /protein_id="BAF53181.1"
                     /transl_table=11
                     /translation="MGLELAASGWGILIAGAAVAGWIDAVIGGGGLVLIPLILAVMPQ
                     LAPVTALASNKLAAVTGTASAAFTLVRRVKPDKKLLPLYVLVAAVCSGAGALAASLID
                     KQIMRPMIIVLMLVVGLIVVFKPNFGTGESKTLPTGWKRWAAIVAVGFIAAYDGIFGP
                     GTGMFLIMAFTALLSQNFLSSAAMAKVVNTATNLGALIVFIIGGHMWWTLGLVLAVAN
                     VAGAQLGARTVLGGGTRLIRYALLTLVVVMSVYLTWQQIQGM"
     CDS             236675..237052
                     /codon_start=1
                     /locus_tag="cgR_0219"
                     /product="hypothetical protein"
                     /protein_id="BAF53182.1"
                     /transl_table=11
                     /translation="MTKTKLESISERNSDDPLSYPELTLAPVSTTVTVVVAEDAPNDN
                     FSELLLGAAESTRLLGLDELHIIAPSVHLPALAVAAADIAHHLPEKFQFCEAETCSHL
                     HPDDDTYLTAESVAQLGTKLKSA"
     CDS             complement(237461..239989)
                     /codon_start=1
                     /locus_tag="cgR_0220"
                     /product="hypothetical protein"
                     /protein_id="BAF53183.1"
                     /transl_table=11
                     /translation="MGISASPRRKNYFPQPARKHIIALGFSVEVRKKMCSPSRFLMYR
                     QLMSSRIGNFLINRISTGLPVENIIPHLQEAFSAGPKNLVIQAPPGTGKTTLLPPLVA
                     NILCNEGAGNATPTKVLVTAPRRVAVRAAARRLAQLDGSQLGTKVGFSVRGEHIPGTH
                     VQFMTPGVLIRQLLNDPELPGIGAVIIDEVHERQLDSDLLTGMLAELSQLRDDFSLIA
                     MSATLDSETFADLLDAQVLRAEAPIFPLDISYAPARTPRLNAKGVDWNFLDHMAQKTH
                     EAIAHSEHSALVFVPGVREIDRVINTLKSLGHNNVFPLHGQLSPAEQDCALTPSAQQR
                     IIVSTPVAESSLTVPGVRIVVDSGLSRSPKRDSARGMTGLITSSCAQASAGQRAGRAG
                     REGPGQVIRCYSEADFSHFPRFVAPEIGSANLTQAALWLAQWGTSPADLPLLDQPPHA
                     AWSAAQQTLRHIGALEGDAITSLGHRLSTLPLSPQLSASLLRFGEQSAKILAVVSENP
                     QGDVEKQQPDKREVERLRRLAPASAEKASAGQIVGAAFPQLIGRKIDNGEYLLASGTR
                     ARLIDPDLKDAEWLSVAAINRSQNSAIIRAAAHISEADALEIIGVTEETRAVFVDGKV
                     QARKVKAAGAIELSSTPTKPTPAEASEAIATALAKGGIDLFHFSDKAASLRDRLKFIH
                     EHRGEPWPDIETADPHLWLSPEIEALSHGTRLNNIDMYPALQRLLPWPEATNFEEFAP
                     PHLAAPSGNQHRLDYSSGRPVVRVKLQECFGLEESPQLCGIPVQFHLLSPAGRPLAVT
                     DDLRSFWSGPYSQVRAEMRGRYPKHPWPEDPWTAPATARTKNRM"
     CDS             complement(240083..240493)
                     /codon_start=1
                     /locus_tag="cgR_0221"
                     /product="hypothetical protein"
                     /protein_id="BAF53184.1"
                     /transl_table=11
                     /translation="MIAGSNVRSYLKAFPWMRWGFFLQNHLGCQKILPKNIKYAGTKK
                     NAKLRLMPVSSGFFAMIPVIAPEIPKIKGQITWCKIHGLEEPWKTTKAKIATTIQPRE
                     ISAVGGHLVFCFDKSLVKSCFSAQPTMTSLLSIP"
     CDS             240090..240407
                     /codon_start=1
                     /locus_tag="cgR_6009"
                     /product="hypothetical protein"
                     /protein_id="BAQ21071.1"
                     /transl_table=11
                     /translation="MESREVIVGCAEKQDFTKLLSKQKTRWPPTALISLGCIVVAILA
                     LVVFHGSSRPCILHQVICPLILGISGAITGIIAKKPLLTGINLSFAFFLVPAYLIFFG
                     NIF"
     CDS             complement(240381..241058)
                     /codon_start=1
                     /locus_tag="cgR_0222"
                     /product="hypothetical protein"
                     /protein_id="BAF53185.1"
                     /transl_table=11
                     /translation="MDKDFESIEKMTSGDWYVATGAEREEVAQKTALLFHEYNQIGPT
                     DPARTDEILKTVLNPASGTCTIKAPAIIEYGFNTTIGEHVFINFGLTILDIAPVRIGA
                     RSMLGPNCQLFTAGHPVDDWEMRSGGWENGAPISIGEDTWLGGNVTVVGGVSIGDRCV
                     IGAGAVVTKDIPDDSIAVGNPARVVRKRDDSRLERSQLPEGVSVDALGILPTKSPRLS
                     ENIAEKY"
     CDS             241085..241777
                     /codon_start=1
                     /locus_tag="cgR_0223"
                     /product="hypothetical protein"
                     /protein_id="BAF53186.1"
                     /transl_table=11
                     /translation="MPTLFDDPLHQLPRPPRRVAAGVVHLPNFLGLAEQKALVAQARD
                     LAREVVGTPLAMVRPKLKSGQMSVHMLHLGKYWASNPYRYVDVVDGFPVPPLPDSFVD
                     LAHRALLSAGSLSNSLQSWSEAYRAEAALVNYYSPDASMGMHQDANEESEAPVISLSI
                     GDTGIFRLGGTLNRNKPWTDIPLMSGDLIVFGGANRRAFHGIPFIEANTAPAGCGLKE
                     GRINITIRQLAL"
     CDS             241821..242378
                     /codon_start=1
                     /locus_tag="cgR_0224"
                     /product="hypothetical protein"
                     /protein_id="BAF53187.1"
                     /transl_table=11
                     /translation="MSHAQIMVRTMTTNKANPNELVICADEKSRPRWASRSELCWEYF
                     DNEWGRPPVDLNTLFEILTLVVFQVGVTWHAVLSKREGFRKAFAQFDVAKVAAFNEND
                     VERLLDDLQIFRNRRKINAAITNAKALLELTDETGTFDSIIADRSTDATAMVKHLKAL
                     GFTHIGLTSLSILQQAIGVTELKAA"
     CDS             242391..243071
                     /codon_start=1
                     /locus_tag="cgR_0225"
                     /product="hypothetical protein"
                     /protein_id="BAF53188.1"
                     /transl_table=11
                     /translation="MTTAQFLALFLVWIAAIASPGPDLFQIIRLGAKNRRDGVLTAVG
                     IMVGNSIWIIASLLGLSALISTHPAILNLLQLVGGGYLTWMGIGAVRSWWTKRSTQQA
                     AADSQAVENTLVTATAASVGVWPAIRSGIATNLSNPKAVLFFGSVFAQFVRPDMGIGW
                     SIFIGVFLTLTGLLWFVGFAVLVRKLAVGITRNGAIIDLLTGVIFIGLGMFMIFEGVV
                     GIGGRVVG"
     CDS             243106..243399
                     /codon_start=1
                     /locus_tag="cgR_0226"
                     /product="hypothetical protein"
                     /protein_id="BAF53189.1"
                     /transl_table=11
                     /translation="MQPEEVHIKDETIKLGQFIKLANLVESGGAAKDAIANGDVTVNG
                     EVDTRRGKTLRDGDVVCIGEVCAQVSTGDAADDDYFDEATANDDFDPEKWRNM"
     CDS             243399..244253
                     /codon_start=1
                     /locus_tag="cgR_0227"
                     /product="hypothetical protein"
                     /protein_id="BAF53190.1"
                     /transl_table=11
                     /translation="MPAFEAMPGMPYWIDLSTSDIAKSAHFYGNVLGWEIEEVNDGYR
                     MARLQGLPVAGLIDQRGESSIPDTWITYFLSYDLDATAKKIAELGGRILAEPTDVHLG
                     RMILAVDTAGALFGVIEPGSEESFVAAGEPGTSVWHELTTVSKYSEAIDFYGELFTWT
                     TSEMASAEDDSFRYTTALADGSAFAGIFDAKGHFPPQVPSFWQSYLGVLNADDAAAKA
                     KEFGGDVIRKPWDSEFGRMVLISDSTGATITLCEVEEYVEEAAEGDDLFDIDLSAFEE
                     QFRKQEGQ"
     CDS             244266..244610
                     /codon_start=1
                     /locus_tag="cgR_0228"
                     /product="hypothetical protein"
                     /protein_id="BAF53191.1"
                     /transl_table=11
                     /translation="MEELEFDELTSMVLDCADLIPQGKVASYGDIAKIVGTGPRQVGR
                     IMATAGQFTSWWRVVRSDGGSQVAGTARSKWAEENIAFSELSAPKVRMQQHRLSEEEL
                     ETIAGKLQQIAD"
     CDS             244707..245600
                     /codon_start=1
                     /locus_tag="cgR_0229"
                     /product="hypothetical protein"
                     /protein_id="BAF53192.1"
                     /transl_table=11
                     /translation="MKTPRLLKFLSAMVAVTGLLIPTVVPMAAADAAELSDNVPDRTQ
                     IAIINPDGSVQESDNAEESRPALSLAKLYLGYYVLAQGAEEDIELVPDMIRYSDDFTA
                     DYLESEYPEAIPEVIDAFDLEDTEWAGFWGNATTSAVDIATFVAALIDDPTAQPLLDA
                     MSDTAEYAADGYAQNFGTFTLSDVTGTKFGWSDSLDVHSSVSFGPGFVIAANTYGDAE
                     TLTEDVQDSVSSLYPEEVTTAIEEQVDQLYECAAETTHLGMHTGAELKAQLEGTIYGK
                     TLSFLPNSAPVPAFIYNLLAR"
     CDS             complement(245597..246505)
                     /codon_start=1
                     /locus_tag="cgR_0230"
                     /product="hypothetical protein"
                     /protein_id="BAF53193.1"
                     /transl_table=11
                     /translation="MAENNTPQETEQDQEARFREEFEVGGQDRQLSEEEQLEQLGSYI
                     DAHYPVPDFTPPWAGGAGDPDPADRYIAHLPDRTTHTAMIMLGSGLDHSMPGVAFIGD
                     VSVDNIPEVGGAIFHPSNPTGRWAVSFHSGGWWRGSGDALEFQWRPEVAAAAELSGTT
                     ILDLDYPLAPGHNLHDMNEVVGKAVGYARHHNPVSITGWGYSSGAALAAINASLFDAL
                     VLTFPDLGSVEKLPAEIRGDAVVPAAAAWPTTFVQIAAQDEIAERPEELGDATVKEYV
                     SRHRISTPKVAREKITDVAEFLKTVG"
     CDS             246784..247098
                     /codon_start=1
                     /locus_tag="cgR_0231"
                     /product="hypothetical protein"
                     /protein_id="BAF53194.1"
                     /transl_table=11
                     /translation="MHISGMVAFDSDANIVGEGDIEAQTEQVFRNLQAVVEEAGGTIN
                     NIVSTTTYLADVTDAPVVNAARSRYFTGEVLPTHTVIGVAALARPQLLVEISAVAYLG
                     DL"
     CDS             247285..247518
                     /codon_start=1
                     /locus_tag="cgR_6010"
                     /product="hypothetical protein"
                     /protein_id="BAQ21072.1"
                     /transl_table=11
                     /translation="MSFVSNENRGTETSRVKKYFGGSGIIVLLIAAIVIMVSLVIDAT
                     TEIDSPRYVAIGAAIFFVVSTIVRAIAAGRKDN"
     CDS             248008..249012
                     /codon_start=1
                     /locus_tag="cgR_6011"
                     /product="histidine kinase"
                     /protein_id="BAQ21073.1"
                     /transl_table=11
                     /translation="MREWVLFLSISVMFILLAFFPKTSAVGLAILYLSLIPFDLRAGL
                     LILLAPVSVGILAFWNKLFWALVLVISALIAGLYSVAEQKFSFEPISLLIALIMFVLP
                     LFGGLWVGKLARTHQLAVSTAREQREELSMALHDDIATDLSSVVVRLEVLAMKHEELA
                     PKLSVDLWESVQSIRGTLLSLRVLIENLTLSLENNRQVNRLGLAQYILIKAKFLRKHG
                     FDVQCRIDNSVKVQLTQNSASLESALNEAFANVIKHGNLDEKVEISVESIAEKKLITN
                     ENYYISGESRGGSNLLGLDGMQKALIADSGELRIVDDGSRWTLSILVSPSLITSPVSN
                     "
     CDS             249120..249842
                     /codon_start=1
                     /locus_tag="cgR_6012"
                     /product="transcriptional regulator"
                     /protein_id="BAQ21074.1"
                     /transl_table=11
                     /translation="MIALAARENLLTSGVNKLEKLKTRLLLVDDDFYIRRDLPNYFSS
                     TEDLVVVGTAANGQEALDKMKSLHCEVILSDLRMPVMGGSELLLEVQKLEDSPIFIAM
                     TGFDTDQAMLDVLASGGVGYIVKSDPPSTILSAVRAAVKGGTALSPSCTSRLVNATVR
                     EGKNRRPRHSGQIIEVDLTKSEVQVVELLCRGMTNLQIAQTLHYSEAGVKKKISSMLR
                     KFQVDSRVGLAMKAGPLVGYPR"
     CDS             250011..250634
                     /codon_start=1
                     /locus_tag="cgR_0232"
                     /product="hypothetical protein"
                     /protein_id="BAF53195.1"
                     /transl_table=11
                     /translation="MSGTAIMYDTTVVPSKKEIAQAWTGYVDLQGSYRLVDTVDGEVG
                     VEVLISKDREGRLLQIPFSYRSAEINPEQTLSTLEHGVLGKRWVTNALGDPVAVREFI
                     RTILTGDDGAARSDGVKGYLDIKGSGDAESVDLQDVKLTEVTRQRAIGSVTINGERKQ
                     FSLRLPQLLKNFRKTAAGHTATTLRMVAAHPEKDDVELLVAEFNWIE"
     CDS             complement(250702..252771)
                     /codon_start=1
                     /locus_tag="cgR_0233"
                     /product="hypothetical protein"
                     /protein_id="BAF53196.1"
                     /transl_table=11
                     /translation="MRFQLVLALDYAHTDRLPSGVDMIPNAQPTCGTNHKPCAGKSPR
                     VGHMKDLYRFVNGPWLDTHIIPDDRAVDGTFHKLRDDAEEDVHEIVKEDTGRAGTLYA
                     SFMDTDTINAAGVAPLDADLNRLSVANSSFFAAALGELDREGVGAPVGFWVEKDSSSN
                     ESVAYVIQSGLGLPDEAYYREEAHAETLAAYKEHVERMLGYLDNSRLFGLSAASAAAR
                     IVALETEIAAGHWDVVKTRDAVATYNPTELGALPPKVRTLLSSAGLPDQRLVSMMPSY
                     LDHLNGLLVDDRLPDWQLWATWHILRSRAGLLTEEISQANFDFYGTKLSGATEQKDRW
                     KRAVGLAERMVGEEIGQRFVEKHFPASSKEHMLELVDYLVAAYRDRISNLEWMTPATR
                     ERALEKLGKFNAKIGYPDKWRSYEGLEFGSDLVDNSRKGSAFLHDYELSKIGKPADRD
                     EWVTTPQTVNAFYNPVVNDITFPAAILRAPFFDPEAEAAENFGAIGAVIGHEIGHGFD
                     DQGSQYDGDGNLNSWWTDEDRSAFEQLTSRLVTQFSGLVPAVLTSEGVDTDGVNGEFT
                     LGENIGDLGGLGIAVVAYEKYLADRGQTFETSPVQKFEAEGAEEGLAEQEFNGLQRLF
                     LSWARVWRTKIRPQMAVQYLAIDPHSPAEFRCNVIAGNVAEFYEAFDVPEDAPVYIKP
                     EERLAIW"
     CDS             252733..253476
                     /codon_start=1
                     /locus_tag="cgR_0234"
                     /product="hypothetical protein"
                     /protein_id="BAF53197.1"
                     /transl_table=11
                     /translation="MSVIEGKYQLKPQGRGGLWWSIVGVAVVLLLLPTLINLVVPDKA
                     NDYKQLEIDLLGVDWSVPITTEESAAVLCEETSDEITQKYWDCNGDTTVVTMIVEGVK
                     DPSNTLRRMVGSSLITSVDDSLEAVSSEDGRAHALYVPGQQEGSVWTLPIVALSVQGS
                     GDYEDLTAIAIINGTSLDYYSTHIWSSMAADRGLPYQQDFPLMLEEQPWQDTPSGDLP
                     FELPNDFFDQYPDLFGRDSVIPNLEGESL"
     CDS             253473..254438
                     /codon_start=1
                     /locus_tag="cgR_0235"
                     /product="hypothetical protein"
                     /protein_id="BAF53198.1"
                     /transl_table=11
                     /translation="MSRMFSITLWVAILLSTPALFLSLATFIFVDGISVLVNIVFAVL
                     YLVVIVFLLSRTPLWPRFKGSGSKKGGGFAWAASSLLWGAFVGFGIVMLFAGPVMDLT
                     DKLGWDFVAMSFTGAYPEEIAKALGVAIILLSFRQLNRPWHGFITGALVGLGFEVNEN
                     LLYGATGAIMDPNADLDGVLMMWQYRTMLGPLIHTLLTGFAGYGIALAFFRARKTVAW
                     RWGVAIGWTLIAFALHFSWNLMWENVIGSYVTIIVVSVVMYGLAIYIIWSNWAEARDD
                     SSYAFVPGIITNTKDLSLLDAPIPVGTEVPEPRIPQQIEEPKAEN"
     CDS             complement(254853..255614)
                     /codon_start=1
                     /locus_tag="cgR_0236"
                     /product="hypothetical protein"
                     /protein_id="BAF53199.1"
                     /transl_table=11
                     /translation="MTTEAPIWPAELFEDLDRNGPIPLYFQVAQRLEDGIRSGVLPPG
                     ARLENEISVAKHLNVSRPTVRRAIQEVVDKGLLVRRRGVGTQVVQSHVTRPVELTSFF
                     NDLKNANLDPKTRVLEHRLLAASSAIAEKLGVSAGDEVLLIRRLRSTGDIPVAILENY
                     LPPAFNDVSLDELEKGGLYDALRSRGVVLKIANQKIGARRAVGEESTLLDIEDGGPLL
                     TVERVALDNSGQVIELGSHCYRPDMYNFETTLVAR"
     CDS             256033..257013
                     /codon_start=1
                     /locus_tag="cgR_0237"
                     /product="hypothetical protein"
                     /protein_id="BAF53200.1"
                     /transl_table=11
                     /translation="MSEGLHRHMTNLTSTHEVLAIGRLGVDIYPLQSGVGLADVQSFG
                     KYLGGSAANVSVAAARHGHNSALLSRVGNDPFGEYLLAELERLGVDNQYVATDQTFKT
                     PVTFCEIFPPDDFPLYFYREPKAPDLNIESADVSLDDVREADILWFTLTGFSEEPSRG
                     THREILTTRANRRHTIFDLDYRPMFWESPEEATKQAEWALQHSTVAVGNKEECEIAVG
                     ETEPERAGRALLERGVELAIVKQGPKGVMAMTKDETVEVPPFFVDVINGLGAGDAFGG
                     ALCHGLLSEWPLEKVLRFANTAGALVASRLECSTAMPTTDEVEASLNQKV"
     CDS             256928..257938
                     /codon_start=1
                     /locus_tag="cgR_0238"
                     /product="hypothetical protein"
                     /protein_id="BAF53201.1"
                     /transl_table=11
                     /translation="MRLWRPVLNAPPQCLLPMRWKPPSTRKSDMTPPIISPESFEALR
                     RMRAAEPTMVAERFKQRRKRELLGEDGKLFIVAADHPARGALAVGDNETAMANRYELL
                     ERMAIALSRPGVDGVLGTPDIIDDLAALGLLDDKIVVGSMNRGGLRGASFEMDDRYTG
                     YNVSSMVDRGVDFAKTLVRINLSDAGTAPTLEATAHAVNEAAAAQLPIMLEPFMSNWV
                     NGKVVNDLSTDAVIQSVAIAAGLGNDSSYTWMKLPVVEEMERVMESTTMPTLLLGGEG
                     GNDPDATFASWEHALTLPGVRGLTVGRTLLYPQDGDVAAAVDTAARLVHTDIQQFTSQ
                     SI"
     CDS             257952..259466
                     /codon_start=1
                     /locus_tag="cgR_0239"
                     /product="hypothetical protein"
                     /protein_id="BAF53202.1"
                     /transl_table=11
                     /translation="MSEPQTISHWIDGAISPSTSGKTAPVYNPATGQVTANVALASQE
                     EIDATIASATKAAKTWGNLSIAKRQAVLFNFRELLNARKGELAEIITAEHGKVLSDAM
                     GEILRGQEVVELATGFPHLLKGAFNENVSTGIDVYSLKQPLGVVGIISPFNFPAMVPM
                     WFFPIAIAAGNAVILKPSEKDPSAALWMAQIWKEAGLPDGVFNVLQGDKLAVDGLLNS
                     PEVSAISFVGSTPIAKYIYETSAKNGKRVQALGGAKNHMLVLPDADLDLVADQAINAG
                     YGAAGERCMAVSVVLAIESVADELIEKIKERIDTLRIGNGAGDEQGEPHLGPLITDVH
                     REKVASYVDIAEADGAKIIVDGRNCAVDGHEEGFFFGPTLIDDIPLTSRAYTEEIFGP
                     VLSVVRVASFDEAIELINSGEFGNGTAIFTNDGGAARRFQHEIEVGMIGINVPIPVPV
                     AYHSFGGWKNSLFGDAKAYGTQGFDFFTREKAITSRWLDPATHGGINLGFPQND"
     CDS             259487..260377
                     /codon_start=1
                     /locus_tag="cgR_0240"
                     /product="hypothetical protein"
                     /protein_id="BAF53203.1"
                     /transl_table=11
                     /translation="MRWFHKKGELARDGWQSVVDATTPGWEYTGIRIAELGSGESLEL
                     NDTGVERIFIPLQGSFDVAHHDQVTHLHGRKSVFDGPTDVLYLPTGQTATLSGQGRVA
                     VAEAPTQEPKEWKYIAPAETPVELRGAGRSSRQVHNFGTPEALDAARLIVCEVITPGE
                     NWSSYPPHKHDEHIPGHESKLEEIYYFESAPSRVGGRAEAAEGAFGMFSTYSSPAGEI
                     DINAMVYSGDIALVPFGYHGPAVAAPGYDLYYLNVMAGPDPERIWLINDDPAHAWVRD
                     TWTGQAFDDRLPYENANKEG"
     CDS             260384..262297
                     /codon_start=1
                     /locus_tag="cgR_0241"
                     /product="hypothetical protein"
                     /protein_id="BAF53204.1"
                     /transl_table=11
                     /translation="MAETKRMTVSQALVEFLGHQWTVDGDIRERTIPGMFGIFGHGNV
                     AGIGQALKQYNVEQPELMPYYQARNEQAMVHQSVGYARMHRRRGTYASAASVGPGATN
                     LLTGAALATTNRLPALLLPSDTFATRVADPVLQQLEQPWDIGLTVNDAFRPVSKFFDR
                     VQRPEQLFSIALAAMRVLTDPAETGAVTIALPEDVQAEMLDVPVEFLQDREWHIRRPR
                     PERAALARAIEVIKNAKNPMIIAGGGVLYSDAETQLQALVEQTGIPVGTSQAGGGVLA
                     WDHAQNLGGVGATGTLAANRIAGDADVIIGIGTRYSDFTTASRTAFQNPDVTFININI
                     ASFDAYKHGTQLPVIADAREAIVELAEALQGFTVSQDFAQRIAEEKAAWDAEVDKSFA
                     PSGLALPGQPEIIGAVQASTSEKDVIVQAAGSLPGDLHKLWRVRDALGYHVEYAFSCM
                     GYEIAGGIGAKRGLDAAGDDRDVVIMVGDGSYLMLNTELVTAVAEGIKVIVVLIQNHG
                     YASIGHLSETVGSQRFGTWYREYDADAKNFQGEQILPVDLAMNARSYGMDVIEVEPSA
                     NAIEDLKAAMATAKASKKSTFIHINSDPLIYAPDGAGWWDVPVSETSTLDSTNAARED
                     YLKNQALQRPLLG"
     CDS             262338..263294
                     /codon_start=1
                     /locus_tag="cgR_0242"
                     /product="hypothetical protein"
                     /protein_id="BAF53205.1"
                     /transl_table=11
                     /translation="MTTSVPASTKAPSVAGENPGLRIGTAPDSWGVWFPEDPKQIPWE
                     RFLDEVVKAGYTWIELGPYGYLPTDANQLEDELGKRGLKLSAGTVFTGFHKGEEQWKR
                     AWDQALDVAGLASKLGAEHLVVIPDLWRSDATNEVLEARTLDDEKWAKLAAGHDRLGK
                     ALLEEFGMKQQFHSHADSHIGTTREVLRFLEETDARYTNLCLDTGHFAYYGGDNVKLI
                     EQHPERIGYLHLKQVDPTLLFDVLKNDTPFAEAVTQGIMIEPPHGIPDLAPIIEAVSK
                     IDSEIFAIVEQDMYGCDIDYPFPIAERTRKHIFGCTHFARVN"
     CDS             263327..264340
                     /codon_start=1
                     /locus_tag="cgR_0243"
                     /product="hypothetical protein"
                     /protein_id="BAF53206.1"
                     /transl_table=11
                     /translation="MSKSLRVGVVGAGAMGADHIDRINNRTSGAHISAIIEPDAARAA
                     AAAENAPGAQAFTRIEDAIAADAVDAVLIAVPGQFHEPVLVPALEAGLPILCEKPLTP
                     DSESSLRIVELEQKLDKPHIQVGFMRRFDPEYNNLRKLVESGEAGELLMLRGLHRNPS
                     VGENYTQSMLITDSVVHEFDVIPWLAGSRVVSVEVKYPKTSSLAHSGLKEPILVIMEL
                     ENGVLVDVEMNVNIQFGYQVATEAVFEKGLARIGQPSGMQRWRDGEFLINEHTDFTTR
                     FATAYDRQIQSWVDAVHEGTLVAGPNAWDGYLVALSCEAGVKAFDGGVIPVDAAPRPD
                     FYA"
     CDS             264353..265225
                     /codon_start=1
                     /locus_tag="cgR_0244"
                     /product="hypothetical protein"
                     /protein_id="BAF53207.1"
                     /transl_table=11
                     /translation="MVRIALDPTPFHHDYDLLDFPDVTARLGYEYMQLTPHVDFGPFF
                     RHPKADDDLVAALKKRAKDAGVTIPALLPVQRISWPEETQRVAAVRNIKRIIQLAVDL
                     EVDTLNTEFSGRPERSEDSEDAFYRSMEELLPILEKEGIKFNIDPHPDDFVENGIEAW
                     RVIRGLNSKQVGFVYVAPHSFHMGDQAEAILPAVGERLGAVYLSDTFDHHKSHGLRYI
                     TNPPGNAVRVHQHLKIGDGDVNFEEIFGLLRSTGYLDREDALLVSNVFAEDEAADEVS
                     RYQLEKIRSLIENA"
     CDS             265319..266680
                     /codon_start=1
                     /locus_tag="cgR_0245"
                     /product="hypothetical protein"
                     /protein_id="BAF53208.1"
                     /transl_table=11
                     /translation="MRNDRSFSVPIALLAAGALFLEILDGTILTTAVPAIARDFGIDA
                     VDVSIALVAYLAAAAAGIPAAGWLADRFGVRKVLLLALAVFTAASLVCAVAPGLTVLT
                     GARVIQGLGGALLVPVGRLAVIRGTDPKDLLDAIAFLTWPALVAPVIAPLLGGLIADT
                     IGWRWIFLLNVPLGIVAIIAGLFILPKHTAVEVKRFDLPGFLGAMLVMVGLTVAAELI
                     SRGSPAELVVAGCLIFSAAIVCGFVVRWLRVPGRLFDLSIMRIPGFRVGNSSGSVYRL
                     VITAAPFMFTLLFQVAFGWSATLAGAMVVALFAGNVAIKPFTTPIIKRWNFKPVLVFS
                     NAAGALVLASFLFVRVDTPLVLIALLLFVSGALRSLGFSAYNTLQFVDISPEQTSNAN
                     VLSATLHQLGMSLGIAVAVIAMSLAPTANWAFPLAAALFLIPLIGALSLPRDGGARAF
                     SSS"
     CDS             266708..267733
                     /codon_start=1
                     /locus_tag="cgR_0246"
                     /product="hypothetical protein"
                     /protein_id="BAF53209.1"
                     /transl_table=11
                     /translation="MTIRIGLVGYGVGGRLFHTPYIQASTHCELVGVVARSEGTKAAV
                     AEDLPDVAIVGSLTELLELGVDAVVISTPPATRRELALEAINAGVAVVADKPFAPSAA
                     DAMELVEAAEKAGVLLNVFHNRRNDTHIVTALGIQEELGAMRGLDLRLDLIEPDSLEA
                     GPEGGLLRDLGSHVVDQTLVLMGPATSVTAQLGSIDLPEGPTNARFRIVLEHESGAVS
                     HISASKIDRLESWEIRLVGERGSYVSNYTDVQTVAIKQGLRPINDREHWGYESEERWG
                     TLVTDEGSKVIPSAQGDYTRFYDAFALAVENGGAGPVPAREGVAVLKVLDAVSQSAAE
                     KRTIELS"
     CDS             267861..268319
                     /codon_start=1
                     /locus_tag="cgR_0247"
                     /product="hypothetical protein"
                     /protein_id="BAF53210.1"
                     /transl_table=11
                     /translation="MSKIVDLRYRTRRSSELSKRSAEVFAEAEEHPITVTRRDGEALV
                     LMSQREADGRARLLELAAQLITVATDHQGTLAERMAKVFPWMLALSVADREACAREIL
                     DAARASFATEQPHLALTELTSWKETAAAVAAGLSNTDLQWYDDPHLVERP"
     CDS             268283..268669
                     /codon_start=1
                     /locus_tag="cgR_0248"
                     /product="hypothetical protein"
                     /protein_id="BAF53211.1"
                     /transl_table=11
                     /translation="MVRRSASGGASLSVAGKKSELVPRPRKKNEFEIRFATTHAAKGW
                     RDLVASIRNHMAETWDFFTVTPLLTTPTNYRLKGELGIVHHNGKAHDRWQHKPTAKGS
                     ARIWFYVEKNTVFLEQVHTHHPNETK"
     CDS             complement(268703..269701)
                     /codon_start=1
                     /locus_tag="cgR_0249"
                     /product="hypothetical protein"
                     /protein_id="BAF53212.1"
                     /transl_table=11
                     /translation="MSTSRPTIYDVAKAAGVSKSLVSLVLRGSTNVSKESEAAVKTAI
                     KKLNYQPNRAASDLAAKRTQLIAVLIDDYSNPWFIDLIQSLSDVLTPKGYRLSVIDSL
                     TSQAGTDPITSALSMRPDGIIIAQDIPDFTVPDSLPPFVIAGTRITQASTHYSVANDD
                     FRGAEIATKHLIDLGHTHIAHLRVGSGAGLRRFESFEETMRAHGLEPLSNDYLGPAVE
                     HAGYTETLALLKEHPEVTAIFSSNDITAIGALGAARELGLRVPEDLSIIGYDNTPLAQ
                     TRLINLTTIDDNSIGVGYNAALLLLSMLDPEAPHPEIMHTLQPSLIERGTCAPRGG"
     CDS             269842..271071
                     /codon_start=1
                     /locus_tag="cgR_0250"
                     /product="hypothetical protein"
                     /protein_id="BAF53213.1"
                     /transl_table=11
                     /translation="MTQQELRVAVIGAGMAGKAHAAGYRTASSIYSTTLPNIRLVSIA
                     DANVQLAEETAARFGFERFDTSWQAIVEADDIDVVSVVVANFLHREIVEALLASGKHV
                     LCEKPLSDTIEDAEAMIEAAGRAATNGTIARIGLTYRRSPGVAHIRDLVQSGELGKVL
                     HVTGHYWTDYGSNAQAPISWRYKGPNGSGALADVGSHLTYLAEFVAGSDFADVRGGQL
                     STVITERPKPLGAIVGHEGGAVSDEYEAVENDDIASFSGSFISGGTATLQVGRISQGH
                     PNTLGFEVFCEKGSVLFDFRNSGEFKIFTPATSGDISQEAGYRTITIGPKHPYWRGGL
                     AMDAPGVGIGQNEGFVFQARAFLEEIAGIPEEESLPRCATLEEGLHNMQLIDAVAQSA
                     AADGATVAVPVLAPVQN"
     CDS             271087..272100
                     /codon_start=1
                     /locus_tag="cgR_0251"
                     /product="hypothetical protein"
                     /protein_id="BAF53214.1"
                     /transl_table=11
                     /translation="MKLGLYNAIFHDRTLPEALAAIKAAGLTGIELNTGGFLPATHIP
                     TIDDILVSDDARDEFLGVFEGTGVDIYGLNCNGNPLHPNKAIGDKHAEDIRRSIRLAE
                     RLGQTRVVTMSGLPGGEPGAKYTNWVVNAWNSAALDVLDYQWDIAADFWRETDRLAAD
                     HGVKVALELHPQNIVFNSADVHKLIDLTGATHVGVELDASHLFWQQMDPVAVIDHLGE
                     LIFHAAAKDVRVNKEWAQLNGVLDNSFRRLDPSENRTNLGGDEWANEWPKNSAWDFVA
                     LGRGHDVAYWTEFLRALHRVDPNMLVNIEHEDVSLGREEGVNEAAKVLIEANKALEES
                     LVS"
     CDS             272458..272661
                     /codon_start=1
                     /locus_tag="cgR_0252"
                     /product="hypothetical protein"
                     /protein_id="BAF53215.1"
                     /transl_table=11
                     /translation="MAQGTVKWFNGEKGFGFIAPNDGSADLFVHYSEIQGSGFRNLEE
                     NQLVEFEVGEGAKGPQAQQVRAI"
     CDS             273087..274805
                     /codon_start=1
                     /locus_tag="cgR_0253"
                     /product="hypothetical protein"
                     /protein_id="BAF53216.1"
                     /transl_table=11
                     /translation="MMAALFVYIMAIPVIMMIKDAVTVQPADGVKTGQGPGELTSYYL
                     WRTLRSPVSVDLFWRPLGNTLSIALVVIFLTLIFGTFLALLVQKSNVYGRKWFATALI
                     IPYVLPSWTFALAWQTIFTNRTTGGQSGWLENAGLNPPDWLAYGRIPMIIIFTLHYGP
                     LVFLLISNSLSRIDSRNEEAALNAGADRLTVLWKITLPLLRPAILSASTLVLAKSIGE
                     FGAAYVIGLPVNFSVLSTSLYQSINTRQTGVAAVLAGALILIGAIGLFADYLFLRNAR
                     KYVTITGKGNSSRVNPLGSWRIPATALVGLAFATSVLLPLGTLLLSTIMRYPGNFELS
                     NFTLDYWIGHNLPTQAFRDGLLINSKLWSALWNTVWIAAIAAAAAALMGMLTGYAVTR
                     TTSSPLANLLKQLAFIPYLVPGISFAVAYLSLFAVQRGPIPPLYGTTFILILILAADE
                     VPFASRSGISSMMQLGKESEEASLNAGASWGRTIAMIVLPIQKSALAAAFVLPFISAT
                     QALSPVIILATSETNLLTTLSMNLVDYGYTHAANGVTLMICLVALLGMVITRKVLKVD
                     MGKGIS"
     CDS             274917..276086
                     /codon_start=1
                     /locus_tag="cgR_0254"
                     /product="hypothetical protein"
                     /protein_id="BAF53217.1"
                     /transl_table=11
                     /translation="MKAKYLITTAAFAVSAIALTACTPSTAEADSESSQTSIANAAAV
                     ETVIEDVDLDALLEAAKDEPALQVYDGTSKIEKIAENFAEHYGLEITGSKADSSEVTE
                     MMIREHAAGNVQGDVFALSDLAAVNNELLANGSATAWLPADIAKNMDDSAINPPVVIN
                     DPSLFTYNAEVNDVCPADNIWEFTDAASGQRLAFQDPLNDSGTLDWFSQMSQFASDEL
                     ESSYASYFGEEFTGDDITEEFVAKLASNNPLLTKSSEEASEAVGAPGQTEPPMGLISS
                     AKFRNNDELGYKLAACDTLEPFVGYANPKAIVMASGTDSPNAAKLFIHWMYTQEGIEP
                     QIADGKISTNSEIVQPEDPANVGELTDRIFTFDGSGVDTDWANREDWSDLWRMNS"
     CDS             276131..277231
                     /codon_start=1
                     /locus_tag="cgR_0255"
                     /product="hypothetical protein"
                     /protein_id="BAF53218.1"
                     /transl_table=11
                     /translation="MPTIELSRLTKTYQRGQPPAVDGIDLRIEDTELLCLLGPSGCGK
                     TTTLRMLAGLESITSGSITVGDQVWDDSDKGITVPANRRQAPLVFQSYALWPHLSVAE
                     NVAFGLKTVGVPAAERSTRVRDVLSTLSINQYADRFPADLSGGQQQRVALARALALRP
                     EVMLLDEPLSNLDSQLRLRMRAELLDLHKDSGTTMVMVTHDQWEAMTLSTRIAVMNNG
                     HIAQVGTPQEIYANPQTKFIAQFIGNPPINMVDLDGDGPLAAELRSYLEARWGHGVVS
                     QVASVGIRPEDIRLGSHAMPGALELDASVVSAAPTGGSWIVETQLGRGAENRLLSSAL
                     HAPEARVNDQVTLTIEDSRILLFNSNDNRITA"
     CDS             277238..278038
                     /codon_start=1
                     /locus_tag="cgR_0256"
                     /product="hypothetical protein"
                     /protein_id="BAF53219.1"
                     /transl_table=11
                     /translation="MPTTTNLTTPKALLLDFGGVIATTVSVPGWEESIALKVIDLLSS
                     AGLNPPELSRVVADIQAGRVADNHWKNSMSRFRAPKELTYEEFWCEFVACDWEEATRD
                     VLREHSSNLCLEMGRVRQKRELRPGIVELLEYCTAHNIPVAIASNALSGEVHREFLAA
                     HDLSHFFVAECYSDELAVRKPNPALLEAAAQACDVPIGECWYVGDTLDRDVVAGQRAG
                     IGASVTMEVFTVGKPLYPSLTWLKPDVTVADPHALLSLLQTQIGTVRL"
     CDS             278035..279012
                     /codon_start=1
                     /locus_tag="cgR_0257"
                     /product="hypothetical protein"
                     /protein_id="BAF53220.1"
                     /transl_table=11
                     /translation="MNPRVTIIDVAKAAGVSKSTVSAALTNNPTVNTKTRDKVLAVAA
                     ELGYRPNRLARSLVRKNSGVIGVVVRNLRNPYYVDVVGGIEDACESLGLMPIISHSRD
                     KVEVASSAIDQLLELQVQGIIVISSRISMQTVRTAAKAVPVAVIGRFSDDDGEIFNIV
                     GDDFAGGSIGTAHLADLGHERIAYATTSVRLASTYRQSGYEQELNNRGLLPFTVNADN
                     PRDTITALLQNGVTGVVAHNDVTAVALINAAHEQGIELPKALSIVGYDDTSLCDSARP
                     TLTSINQPQKEMGRLAVEHLWSASHGENVGLQRIELKPSLHLRKSTIAI"
     CDS             279035..279607
                     /codon_start=1
                     /locus_tag="cgR_0258"
                     /product="hypothetical protein"
                     /protein_id="BAF53221.1"
                     /transl_table=11
                     /translation="MTPDLAAFLDQLYADGRDFDAGQPDRLDRRRNLEPESAALLRSL
                     IDGLTPKSVLELGTSNGYSTIWMADVTNLTTVDNDPGRSLDAAANLRAAGVEEKVQRI
                     VADGATVLTDSADEQWDFIFLDAERSLYVNWWPDLQRVLANGGLLVVDNVLSHADQVV
                     SFREHVDQTEGLRSLVLPIGAGLLIIAKQS"
     CDS             complement(279645..280073)
                     /codon_start=1
                     /locus_tag="cgR_0259"
                     /product="hypothetical protein"
                     /protein_id="BAF53222.1"
                     /transl_table=11
                     /translation="MKIEIFSPEALQSAEFAHLLWLASGYSAAQLDHTITHEISQMTT
                     IGIFEDASPIAFASYFNEPTRAVVEYIAVLESHQGMGLGSQLLKVVATSFPEIYLETD
                     DDAVDFYRKLGFVISPKERDPRWPDRERYACVWKRAEERV"
     CDS             complement(280092..281084)
                     /codon_start=1
                     /locus_tag="cgR_0260"
                     /product="hypothetical protein"
                     /protein_id="BAF53223.1"
                     /transl_table=11
                     /translation="MNVKLTHVAREAGVGYGTASRAISGRGSVDAATRDKVLAAAEKL
                     GNRTNAMARALRENKTRTVGLIVPDIINEFYTESAAVLQNELDKSGYQLVVSTIGNDA
                     EKERRAIESMLNRQVDAVVHVPVNPQAKFPKGFKVVELNRRSDLNRPTVTSDDATGLK
                     ELALHILDQGYRDIGIIVGPAELSTARDRKAGFINALETEATQRGIREELRFRVVHSR
                     YSPTGGYEAFAEFRDDLPQIVVPLSTQLTLGVLKATQENGIKIPDDLALACYGVAEWL
                     AVWGPDITVFAPDLPAMGAAAATQVLTLLDAAPLPENHLSIPGQLIVRGTTPKV"
     CDS             281268..281672
                     /codon_start=1
                     /locus_tag="cgR_5002"
                     /product="hypothetical protein"
                     /protein_id="BAF53224.1"
                     /transl_table=11
                     /translation="MTRKFRRLHDLGYFIIPFVEFLSIVAGYFLIKTAADEFGKLNFI
                     GTILVVRGVVSLFTGWPLLFARVNDFRWDAVYLVGGAVFLAFLFLGPKEMTVLGLVAM
                     FAGPGMLIAGFSYLSRRIIAYFVELRRLQPSD"
     CDS             complement(282048..283523)
                     /codon_start=1
                     /locus_tag="cgR_0261"
                     /product="hypothetical protein"
                     /protein_id="BAF53225.1"
                     /transl_table=11
                     /translation="MASTFIQADSPEKSKKLPPLTEGPYRKRLFYVALVATFGGLLFG
                     YDTGVINGALNPMTRELGLTAFTEGVVTSSLLFGAAAGAMFFGRISDNWGRRKTIISL
                     AVAFFVGTMICVFAPSFAVMVVGRVLLGLAVGGASTVVPVYLAELAPFEIRGSLAGRN
                     ELMIVVGQLAAFVINAIIGNVFGHHDGVWRYMLAIAAIPAIALFFGMLRVPESPRWLV
                     ERGRIDEARAVLETIRPLERAHAEVADVEHLAKEEHAISEKSMGLREILSSKWLVRIL
                     LVGIGLGVAQQLTGINSIMYYGQVVLIEAGFSENAALIANVAPGVIAVVGAFIALWMM
                     DRINRRTTLITGYSLTTISHVLIGIASVAFSVGDPLRPYVILTLVVIFVGSMQTFLNV
                     ATWVMLSELFPLAMRGFAIGISVFFLWIANAFLGLFFPTIMEAVGLTGTFFMFAGIGV
                     VALIFIYTQVPETRGRTLEEIDEDVTSGVIFNKDIRKGKVH"
     CDS             complement(284310..284747)
                     /codon_start=1
                     /locus_tag="cgR_0262"
                     /product="hypothetical protein"
                     /protein_id="BAF53226.1"
                     /transl_table=11
                     /translation="MVDFDTIAARLVTETEEAIIYATRDGIIRLWNGGSEKLFGYTAG
                     EALGKSLDIIIPEKHRKAHWDGWDRVMESGKTRYGSEPLNVPGIRADGSKMSLEFSIT
                     ILKDDSGKIEGVAAFLRDVTANWDEKKALRIRIKELERQIEGQ"
     CDS             284949..289481
                     /codon_start=1
                     /locus_tag="cgR_0263"
                     /product="hypothetical protein"
                     /protein_id="BAF53227.1"
                     /transl_table=11
                     /translation="MKPQGLYNPAHEHDACGVAFIADIHGRPSRSIVDRALEALRNID
                     HRGAAGAEKNTGDGAGILMQIPDGFYREVSGIELPEAGEYATGIAFLPRGRMAMMDAQ
                     KEIERIAKQEGADVLGWRMVPFDSRELGSMAEEAMPSFAQIFLTVPGKSGEDLDRVMF
                     FIRKRCERELGTTNGRDTVYFPSLSSRTIIYKGMLTTLQLEGFFEDLGDARLESAIAI
                     VHSRFSTNTFPSWPLAHPYRFVAHNGEINTVRGNENWMRAREALIKNDKLGNLSSVLP
                     ICTPEGSDTARFDEALELLHLGGYSLPHAVAMMIPQAWEHNKTLSPELRDFYEYHSCL
                     MEPWDGPAALAFTDGRFVGAVLDRNGLRPGRITITDSGLVVMASESGVLDLREESVVK
                     RTRVQPGRMFLVDTAEGRIVEDEEIKQKLSEAQPYGEWIRDNFVHLDRLPQTRYNYMA
                     HSRAVLRQRVFGITEEDVDLLLLPMARQGAEAIGSMGSDTPIAALSQRPRMLYDFFAQ
                     RFAQVTNPPLDSIREKPVTSMYTLLGAQSDVLNPGPDAARRIRLESPIIDNHELATLI
                     NANAHGEWDSFGAAVISGLYPVAHHGAGMKAAIARVRREVSEAIRNGKTLIVLSDRES
                     DERMAPIPALLLTSAVHQYLVQQRTRTQCSLVVESGDAREVHHLAMLIGFGADAINPY
                     MAFETIDELRMKGQLDDLSLDEASRNYIKAATTGVLKVMSKMGIATVSSYRGAQLADV
                     TGLHQDLLDNYFGGIASPISGIGLDEVAADVEARHRSAFLPRPEEHAHRELDLGGEYK
                     WRREGEYHLFNPETIFKLQHATRSGSYEIFKDYTRKVDDQSTRLGTIRGLFEFSTDRK
                     PISVSEVEPVSEIVKRFSTGAMSYGSISAEAHEVLAIAMNRLGGMSNSGEGGEDARRF
                     DVEPNGDWKRSAIKQVASGRFGVTSHYLNNCTDIQIKMAQGAKPGEGGQLPPNKVYPW
                     VAEVRITTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPRARIHVKLVAEQGVGTVA
                     AGVSKAHADVVLISGHDGGTGASPLTSLKHAGGPWELGLAETQQTLLLNGLRDRIRVQ
                     CDGQLKTGRDVVIAALLGAEEFGFATAPLVVEGCIMMRVCHLDTCPVGIATQNPDLRS
                     KFTGKAEHVVNFFTFIAQEVREYLAQLGFRSIDEAVGQAQVLRKRSGIPADSRAAHLD
                     LSPIFHRPETPHFPTQDVRCTKTQEHSLEKALDNAFIDKASDTITRAAAGVETSIVID
                     SSISNVNRSVGTMLGSAVSRVAGAQGLPDGTITLNLQGCAGNSFGAFIPRGITINLTG
                     DANDFVGKGLSGGKIVIKPSAQAPKQLKNNPNIIAGNVLGYGATSGELFIRGQVGERF
                     CVRNSGATAVVEGIGNHGCEYMTGGRVLVLGPVGENFGAGMSGGIAYLANSPDLNQKI
                     NGELVDVVPLSADDLTWADELIARHRELTGSETKLRAQDLVKIMPRDFQKVLNIIETA
                     HAEGQDPAIKIMEAVS"
     CDS             289481..291001
                     /codon_start=1
                     /locus_tag="cgR_0264"
                     /product="hypothetical protein"
                     /protein_id="BAF53228.1"
                     /transl_table=11
                     /translation="MADPQGFIKYSRREPAHRPVPLRLMDYSEVYEKAPAGQIEEQAA
                     RCMDCGVPFCHEGCPLGNIIPEWNDLVRQGRWKEAYDRLHATNNFPEFTGRLCPAPCE
                     GACVLGINDDSVTIKNVELEIVEKAFREGWVQPVIPSMSTGLSVAVVGSGPAGLAAAQ
                     QLTRAGHSVTVFERDDRLGGLMRYGVPEYKMENRWIDRRIEQMEAEGTTFQVGTSPRA
                     AELALFDAILLATGTPVARELSVPGDDLNGIHAAMDYLTAQNRINEGDGDVSPINAKG
                     KKVVIIGGGDTGTDCFGTALRQGAESVTQFDIRPRAPFQRADSTPWPMYPNLFRTATA
                     HEEGEYIITGDESADEIAALGLAERAAGSTLGERKFAVNTVEFHGNNGHVTGLTGNQI
                     RVVNGKREPIEGTEFPFEADLVLVALGFTGAEQGGLAHELGVGFDDRGRILRDSEYRS
                     PTNSRVYIAGDNGRGQSLIVWAIAEGRACAAAIDADLMGETALPVAVAPQDVPLAV"
     CDS             complement(291121..292608)
                     /codon_start=1
                     /locus_tag="cgR_0265"
                     /product="hypothetical protein"
                     /protein_id="BAF53229.1"
                     /transl_table=11
                     /translation="MGESVSTDRYTPQQRTRYRQLLMEDLEIFDRHLQHSDFEDQGSI
                     GLELELNLVDKHMQPALAGHAVLSHLDDEYQSEIGNFNVEMNHPPLSVKGDALRRLEQ
                     GITSRLGRVRAAATSENVNVAMIGTLPTITPEFLEDPAWMTQENRYRALSNAVMESRG
                     ELVHINIADREQIIHDFTDLAPESTCTSIQLHLQLAPNKFAAAWNASQAIAGVQAALS
                     ANSPLFLGRRVWHESRIPVFQQAIDTRTPELVNQGVRPRVWFGERWITSVFDLFEENV
                     RYFSPLIAESRALSGTPMMKGKSPALHYLNLHNGTVWRWNRPIYAPGEERSHLRLENR
                     LLPAGPTPIDITADAAFYYGLVKYLAEENRPVWSRLLFPDAEKNFQSGARSGLFARMT
                     WPTLGQVNVADLVQEHLIPQARIGLERLEVNKDLIDEYLGIITERARSRQNGATWQLR
                     TLNKLEAHGSMPGSDARKAGLAAMLQEYLRNQETGNPVHTWSIGN"
     CDS             complement(292902..296375)
                     /codon_start=1
                     /locus_tag="cgR_0266"
                     /product="hypothetical protein"
                     /protein_id="BAF53230.1"
                     /transl_table=11
                     /translation="MSNSSPNDPSPMRQVGGNGGHQLDSINVSDVVESKKLKGSAQEP
                     PQVAPGWLKKLAISSGLLGLLMFVLLPFLPVNQVQSSLSWPQNGELSSVNAPLISYAP
                     QSMDASIPVSALDSLNDNQSLVMGTLPLDSTDATNRGLFVRTIDGNLDVIVRGEVLLD
                     LSPTEVNRLPDDAILEISSTEETTSAEITGTAFSGETEGDERPQVTGVYTELVDDPST
                     ASALASAGLKVDIEINSRFTSSPSLLKYAAIFIGLASVLVSLWALHRMDILDGRKAHR
                     FLPANWYKLKPLDGVVVAILVFWHFIGANTSDDGFIMNMARVSQNADYMANYYRWFGV
                     PESPFGAPYYDLLALMAYVSTSSIWLRLPALLAGLIMWFVITREVMPRFGSLVNGRRV
                     AHWSAAMVFLAFWLPYNNGTRPEPIIAMGALLAWVSFERAIATSRLLPAAIGVIIATI
                     SLASGPTGLMAVAALLVSLSALIRILYRRLPLIGAPRGASKSKVFGASMAMLSPFLAS
                     GTAILIAVFGDQTLSTVMESISVRSAKGPSLTWYHEYVRYQTVMEQTVDGSFTRRFAV
                     LILMACLAIVVIAILRYGRIPGAAKGPSLRLMMVIFGTMFFMMFTPTKWTHHFGVYAG
                     LAGALAGLAAVGLSYVAVKSPRMRTISIGAFLFLLALALAGVNGFWYTSSYSVPWWDK
                     TIQIKGIEASTVVLVIAVIVLIIGVIQSFVHDVKTAQAETNHSMGELVAEDEAKRERA
                     SRFTGLAASPIAGVSALVVLITCASMGKGFVDQYPAYSVGLGNLRSLTGNTCGLASDA
                     MLETNSNDSFLTPVNSTLGESLESEDIRGFSASGIPPSISQDQANLSQVGAIANTDDS
                     TETGGSDESSGQSTGNTGGVRGSEGINGSNARLPFNLDYTQVPVVGSWSAGTQNPANI
                     TTDWYEIPEATEEAPIIVVSAAGRIEHYDINGVHQSGQSVVLEYGRLRDNGDVEDLGE
                     AMMYDIGPEPSWRNLRYPLDQLPEEADVVRIVATDVNLDEDQWVALTPPRVPNLDSLN
                     NVIGSETPGLLDWAVGLQFPCQRTFDHYAGVTEIPEYRISPDHGGKSTLSPFQDWAGG
                     GSMGTAEAVNNAYEIPSYLRNDWGRDWGSIERYSLRTNSNGDAPKVADINLETIQRSG
                     LWNPGHMKVDE"
     CDS             complement(296368..298401)
                     /codon_start=1
                     /locus_tag="cgR_0267"
                     /product="hypothetical protein"
                     /protein_id="BAF53231.1"
                     /transl_table=11
                     /translation="MINTSEDEGAVVVHEDLNPYGPSRVPEGEVYRPDRLNRKATLAA
                     IVGAAILAFAFALVLWMGLKQTNLPAFGPSNVTRAVASATIAAVLIVTGFLTWLWLRD
                     EHQSNPRWELEDVKPRPKWRTALTYLASYLSPAALVVAVLAIPLSATRLYLDGISVDQ
                     GFRTQFLTRMADDISLSDMNYIDMPTFYPAGWFWLGGRLANLLGLPGWEAFQPWAIVS
                     MAVAASVLVPVWQRITGSLPVATGIALVTTCIILAMNSEEPYAAIVAMGIPAMLVLAS
                     RIAKGDKFALASGIIYLGVSATFYTLFTGAIALSAVAVCIVMAAIVQRSIKPLLWLAV
                     LGGGSIVIALISWGPYLLASINGAERSGDSATHYLPLEGTQFPVPFLASSVVGLLCLV
                     GLIYLVVRFHNNEVRAMWVGIAVFYAWMGMSMAITLLGNTLLGFRLDTVLVLIFATAG
                     VLGIADFRLASVYQLYPTQITERTANYLTNFIVILVLLGGLYYAQDLPQKNARAIDLA
                     YTDTDGYGERADLYPAGAARYYKDINDHLLDQGFEPSETVVLTDELDFMSYYPYRGYQ
                     AFTSHYANPLGEFGNRNAFIEDLAIRSWDELADPQQFSNALNTSPWTIPEVFIFRGSI
                     DDPDAGWKYDVAEDLYPNNPNVRFRGVYFNPESFDQMWQTKQVGPFVVVTHNE"
     CDS             complement(298571..299332)
                     /codon_start=1
                     /locus_tag="cgR_0268"
                     /product="hypothetical protein"
                     /protein_id="BAF53232.1"
                     /transl_table=11
                     /translation="MLNAVGKAQNILLLGGTSEIGISIVSRFLKQGPSHVTLAARKDS
                     PRVDAAVAEIKAAGAASVTVVNFDALDTESHPAAIDAAFENGDVDVAIVAFGILGDNE
                     AQWRDQALAVEATTVNYTAGVSVGVLLGQKFEQQGHGTIVALSSVAGQRVRRSNFVYG
                     SAKAGFDGFYTQLGEALHGSGANVLVVRPGQVRTKMSADGGEAPLTVNREDVADAVYD
                     AVVNKKDIIFVHPLFQYVSFAFQFIPRAIFRKLPF"
     CDS             complement(299353..300819)
                     /codon_start=1
                     /locus_tag="cgR_0269"
                     /product="hypothetical protein"
                     /protein_id="BAF53233.1"
                     /transl_table=11
                     /translation="MNSSHGTSSSGASAGAHGALPLEAQKLNGWGRTAPTTAEVLSTP
                     DLDIIVDAVRQVAEQNDSKPDYLKRGVIARGMGRSYGDPAQNAGGLVIDMQPLNKIHS
                     IDPDSAIVDVDGGVTLDQLMKAALPYGLWVPVLPGTRQVTIGGAIGPDIHGKNHHSAG
                     SFGDHVVSMELLVADGRILHLEPEGTAEDPQGDLFWATVGGMGLTGIIVRARIRMTKT
                     ETAYFIADTDRTNNLEETVAFHSDGSEHNYTYSSAWFDVISPEPKLGRSTISRGSLAT
                     LAQLEELAPKLAKDPLKFNAPQLMKVPDIFPSWTLNKLTLSAVGVAYYAMGAPAKNQV
                     KNLTQFYQPLDLIGEWNRGYGSKGFLQYQFVVPTEAVEPFKDIIRDMQKSGHYSALNV
                     FKLFGPGNRAPLSYPMPGWNVCVDFPIRPGLGAFLDDLDKRVMEFGGRLYLAKESRTS
                     AENFHAMYPGMEGWLKTRNEIDPTGVFASDMSRRLELS"
     CDS             complement(300896..301123)
                     /codon_start=1
                     /locus_tag="cgR_0270"
                     /product="hypothetical protein"
                     /protein_id="BAF53234.1"
                     /transl_table=11
                     /translation="MFERFKKAKAPEVHIAAERTNLPLNDFMTRLFAQELPLLDSTSR
                     SEVYRLLREYDGPTISSQEEIPAEIRELMDL"
     CDS             301141..301650
                     /codon_start=1
                     /locus_tag="cgR_0271"
                     /product="hypothetical protein"
                     /protein_id="BAF53235.1"
                     /transl_table=11
                     /translation="MSSLGNMDTRMRLQVAAGSALIGAGVAVNDYVQSPVRRAISYGA
                     LALSGATVIAMGQDPTGERSIIAKDSATMVDQIRQEIGDLGVTPGPESDVDAITERGP
                     LVTWLLLAVFVVAFFTLAYFSIRMDVAVMRRIAKFFEKRGASRPFTCTGMVYAAFIYA
                     ICELEARTK"
     CDS             301647..302102
                     /codon_start=1
                     /locus_tag="cgR_0272"
                     /product="hypothetical protein"
                     /protein_id="BAF53236.1"
                     /transl_table=11
                     /translation="MTYPVLSVLDNSGDHNIIWHVQTYPAALPTGAWIADEQQLTDLL
                     KDTVVFLTPGSTAPENSPVATIEGVRVGVDKQVAEYNKHGIRLPSLGARTVEAQYRGE
                     PEAEAAWRTALELAEIASGWLEIEAKRRARKALAEAFGAEVQPLPLDTE"
     CDS             302089..303024
                     /codon_start=1
                     /locus_tag="cgR_0273"
                     /product="hypothetical protein"
                     /protein_id="BAF53237.1"
                     /transl_table=11
                     /translation="MTPNRTNGSILGRMPTNYARDNVISLASAREQRSGKPEPKPELT
                     LIVRATNVQADGEVHRQIGLNSAMSLDELHNVLNIVFGVGGEQSPWRFEDQFHQPSAP
                     DTNLGELLPEPGDFLFYFWGLWQFNLQCVEMYPRDNGTPRALCIGGSGGLGDDFDQAT
                     INAELTGTDTIRDVLSGVRPEVIDLVDRTGVFDFIPLLQALDLKREPLIDATRHHTCR
                     MLPVENSAEASDAFWSCVLALSCLGNDELFIEVIESTMSTLGWVADDGSPLRAPEIIS
                     ACEASLKILAEIGGYGPEQLAPVDRLDIYRELLCF"
     CDS             303040..303474
                     /codon_start=1
                     /locus_tag="cgR_0274"
                     /product="hypothetical protein"
                     /protein_id="BAF53238.1"
                     /transl_table=11
                     /translation="MPENPDVTIVRPMSLKTQAFRFILTGGLSAIVDLGLLSLLQLVF
                     GLPVPVARTISFIAGTTTAYMINRRWTFQAESSTSRFLAVVALYGVTFLINIGLQTLC
                     SALFENWGWNEAVAMVCAFVIAQGTGTVINFIVQRTIIFRVK"
     CDS             303485..303889
                     /codon_start=1
                     /locus_tag="cgR_0275"
                     /product="hypothetical protein"
                     /protein_id="BAF53239.1"
                     /transl_table=11
                     /translation="MKTFNPTMIAGLIGVLYFVLLTLIFSIQDMELAAEIAFGIVTIV
                     GLIAVWDNFRDRNNSTWKTWTGLVGGLLIAVPGICLLVGNLVLLAVDGNPSTMVNTLL
                     SVAGIGAIFLLPIGIIMCLIAGFNRFYAALKV"
     CDS             303891..304526
                     /codon_start=1
                     /locus_tag="cgR_0276"
                     /product="hypothetical protein"
                     /protein_id="BAF53240.1"
                     /transl_table=11
                     /translation="MPGLVLSTNVAHIQQDPGGDDRISGINKLPVATGIDVFIPGPNY
                     GDGSGVVGDAIGDSLHHGGAHKAIYAYSREELDFFDPTYRNGYFGENLTTSGIVLEDL
                     LINQQVRIGTTLLEVSIPRRPCRTFAHWLDIKGWLKTFTQRGLPGSYFRVIEEGHINP
                     GDPIEVLQAPDHDITMSMAFRAKMGNKDLARRVVAANCLPARYHEELLKLI"
     CDS             complement(304523..305464)
                     /codon_start=1
                     /locus_tag="cgR_0277"
                     /product="hypothetical protein"
                     /protein_id="BAF53241.1"
                     /transl_table=11
                     /translation="MYAMAKTGTHLQHGIDVAAVIVTHNRVELLRHSLEVVANQTYPV
                     KHIVVVDNGADPDVEKLVLEVAGDRAVYTPSRTNLGGGGGFAFGFLTALALGADAVWC
                     ADDDGRPEGPEVLKTLIDAASRHNLEEVSPVVCNADDPERLAFPLRRGLEWRRMRSEL
                     IDPANPEDDLLPGIASLFNGALISAYAMEHIGVPDYRLFIRGDEVEYHRRLVRSGLPF
                     GTCLTTAYLHPDGSDEFKPILGGRMHTQYPDNDFKRFFTYRNRGYLMSQPGMRKLLPQ
                     EYARFAWFFLVQKRDVKGFREWLRLHKLGRDEKFNRP"
     CDS             complement(305477..306076)
                     /codon_start=1
                     /locus_tag="cgR_0278"
                     /product="hypothetical protein"
                     /protein_id="BAF53242.1"
                     /transl_table=11
                     /translation="MGTQIDHIVIAAPNLEDLVSRFEKLTGVKAVAGGRHDTGTANAL
                     VPLKEPKGSYLELIGPDPEADAVTQDNFAIATTQSTEPRVAAWCVRPDDLEALAAKRG
                     TQSQLMSRHTPEGRTLTWRLILPEPGVDFAPVPFAIDWLGSPHPSKVTEPQVSVHSFT
                     VHGHSEPDELPEPAVFQEGKPLLELVLESPKGRVNLSDL"
     CDS             complement(306649..307440)
                     /codon_start=1
                     /locus_tag="cgR_0279"
                     /product="hypothetical protein"
                     /protein_id="BAF53243.1"
                     /transl_table=11
                     /translation="MVSIDTYNACVDFPIFDAKSRSMKKAFLGAAGGAIGRNQDNVVV
                     VEALRDINLHLREGDRVGLVGHNGAGKSTLLRLLSGIYEPTRGSADIRGRVAPVFDLG
                     VGMDPEISGYENIIIRGLFLGQTRKQMKAKMEEIADFTELGEYLSMPLRTYSTGMRIR
                     LALGVVTSIEPEILLLDEGIGAVDAAFMAKARDRLQALVERSGILVFASHSNDFLAQL
                     CNTALWVDHGQIRDAGLVPDIVESYEGKGAGDHVRRLLTRMEEEK"
     CDS             complement(307451..308347)
                     /codon_start=1
                     /locus_tag="cgR_0280"
                     /product="hypothetical protein"
                     /protein_id="BAF53244.1"
                     /transl_table=11
                     /translation="MQEQSKQKDLQADIARITAVKSDTVPNSQSMTFGAAWNDIVRGF
                     KQHELWLQLGWQDIKQRYRRSVLGPLWITIATGVMALALGLLYSVLFKIPIAEFLPHV
                     TVGLIIWNFISGCIKEGSDIFIDNEGLIKQLPSALSVHVYRLVWKQALFLAHNLVIWV
                     ILMMIFPRPLGWDVLLIIPAMFLLVINGVWVVMFFGIIATRYRDVSPLLEAGTQLLFY
                     VTPIVWMTSTLQSQSAEIGNRARLAELNPLYHYLEIVRAPMIGADLPAYHWWIVLAFT
                     FVGLGLALLAMKQWRFRVSYWV"
     CDS             308490..309665
                     /codon_start=1
                     /locus_tag="cgR_0281"
                     /product="hypothetical protein"
                     /protein_id="BAF53245.1"
                     /transl_table=11
                     /translation="MGFDVARVRGLYTSLGDGWTYLNSHQIPQVPERVASGVAAAFRT
                     HAQISEVTSRPIAVDQLEAAREAVASLAGVDPDCVVLGPTRQFLAHTLARGLGGFVRR
                     KAGVVLSRADADWLTAPFRSLDGVFSWAEPDLGTGMLPDWQYEKLVDGSTRLVVLSAA
                     HPLLGTVAPVGKIVDKVRARSRAWVLVDATTYAAYRPLRLDEWEADIVMLDLGELGGP
                     QISALIFRDTSMFPRLDRTVPLELPASSLPHGLLGGVPNLVRHLGNLDENAPSVVEAM
                     GEMAKFHKGLFEHLVESLEGLHAVHIVGISGDAAGQDAAFLDRVPRLTFTVEGVPADM
                     VYRRLVDNRLVTTVSPADPLLDAMGVTEAGGSITIGLSPFSTHYEVDQLTRVLASLA"
     CDS             complement(309662..310618)
                     /codon_start=1
                     /locus_tag="cgR_0282"
                     /product="hypothetical protein"
                     /protein_id="BAF53246.1"
                     /transl_table=11
                     /translation="MQAIVQTEEKVTASLELQEVPVPTLKPGEVLVEVKAAGVNRADL
                     LQTQGNYPVPAGASEILGLECAGVIVDAGDTGQTVGQEVACLLTGGGYAEYVAVPEGQ
                     LMPIPEGYSFVEAASIVEVACTVWSNIGMLAGLQKEDTFLIHGGAGGIGTFAIQMGKA
                     LGVTVAVTAGSTEKLKTCKNLGADILINYKEEDFAEVLKNKADVILDIIGAKYLSQNV
                     KAMAKDAHMVVIGMQGGVKGELNLGHLLAKRGTISATALRGRDEADKARIVSSTVENI
                     WPLLQSKEITPHIDHTLPLAEAAAALQKIQDGTITGKLVLTV"
     CDS             complement(310639..311223)
                     /codon_start=1
                     /locus_tag="cgR_0283"
                     /product="hypothetical protein"
                     /protein_id="BAF53247.1"
                     /transl_table=11
                     /translation="MKSYPIVSNILNHLIRGNYMDLLKIAIIAAVMIGVPVLVVFLIV
                     FAVHKLAKEVPQSGRRPGIGLGLLLGFVAGLIVWFVWLSWGGYYENEFGQMQGPYRPW
                     QVVACGVTMVAVTVILGLWTRWTASGPFYSALGGTSGFSFAWAMDALPQDETGLSAFG
                     LVMVIVGVGAGLNVVATLTSIGATIWNNRLPSNA"
     CDS             311608..311721
                     /codon_start=1
                     /locus_tag="cgR_0284"
                     /product="hypothetical protein"
                     /protein_id="BAF53248.1"
                     /transl_table=11
                     /translation="MLNNEVLSNYEIVSENQVLACQTIRDADGPYHCSFDD"
     CDS             complement(311718..313205)
                     /codon_start=1
                     /locus_tag="cgR_0285"
                     /product="hypothetical protein"
                     /protein_id="BAF53249.1"
                     /transl_table=11
                     /translation="MELLETFITDVINDNLWMILPFLLVAAGLYFGGRTLLVQIRMIP
                     EMFKAVVEKPAKDGEFADKQDISAFKAFTISAASRVGTANVAGVALAITLGGPGAVFW
                     MWIIALVGGATSFIESTLGQLWKVKDGDSYRGGPAYYMTLGLNARWLAVVFGVAITLT
                     FGFVYNALQSNAVVEAITVSLGTPSTTAKAFVGLGMAGLSALVIFGGVQRIANVTQWM
                     VPFMAGAYIIVGVVVIVINIQQVPTMINDIIAGAFGFRPVATASVWGAFWLAFMNGMR
                     RGLFSNEAGEGSVPNAAATATVSHPVKQGLVQTLGVYFDTLLVCSITAFVILLSGVEY
                     ATGDIQSSSLTQSALASVVGGWGTHFITAVMFFLAFSSVLGNYYLAQANIQYFTDSKT
                     VMTVFRLLVLLSVFSGAVASVPLIWALGDTFAGIMVLINLAAIIPLSGVAVKLLKNYT
                     TQKKAGLDPVFHRDMMPEVRNIACWNGKDAATSNYHEAMEVIKKN"
     CDS             complement(313300..313548)
                     /codon_start=1
                     /locus_tag="cgR_6013"
                     /product="hypothetical protein"
                     /protein_id="BAQ21075.1"
                     /transl_table=11
                     /translation="MQPFGRLICPVSRAWIPARAKQGGFLDGKGYPRPKPALIDPPRA
                     QQGKLARRSDHPELKPALFAPQRAKPGRLPSGAAHPGS"
     CDS             313925..314758
                     /codon_start=1
                     /locus_tag="cgR_0286"
                     /product="hypothetical protein"
                     /protein_id="BAF53250.1"
                     /transl_table=11
                     /translation="MKEGKLHRVLRGVYSLDPPSGEVVWSSIRLVRPSALLDGKSAVE
                     VYQGVPLSLPVRVRVSTSNVLRGSRNVVARRSQRTDGIAHRGFRVVSLVDAVATCLDE
                     GSVHPSDLRRLVEERYKSGSGVKQMAHDLKLLRTRRKAQLREFLEECIYGLDSGLEKV
                     MVQELRAAGFRTRQNVVVEGYRWDIQVVGVALIDVDSRKYHQANGRNFIIDRWKSNEA
                     AVQGHVPLRFTDDCVNYATREIIKLVKQVAEFKRKHPRRRVKTQGVGPVFRWHNALVL
                     P"
     CDS             complement(314750..315835)
                     /codon_start=1
                     /locus_tag="cgR_0287"
                     /product="hypothetical protein"
                     /protein_id="BAF53251.1"
                     /transl_table=11
                     /translation="MGRPVKNLDIARYRRQIMLGEIGQQKQQSLFDAKVSVIGAGGLG
                     SPALLYLAGAGVGHIHIIDDDLVDLSNLHRQVIHTTAGVGTPKAESAREAMLALNPSV
                     KVTVSVRRLDWSNALSELADSDVILDGSDNFDTRHLASWAAAKLGIPHVWASILGFDA
                     QLSVFHAGHGPIYEDLFPTPPPPGSVPSCSQAGVLGPVVGVMGSAMAMEALKIITGVG
                     IPLIGKLGYYSSLDGTWEYIPVVGSPEVLERVLGSAGVSGISGGFGEVLDVPRVSALV
                     DGVSLIDVREPSEFSAYSIPGAHNTPLSAIREGAIPPDVSAGKEVIVYCAAGVRSAQA
                     IAILESAGYTGMSSLDGGIEGWLDSLG"
     CDS             complement(315820..316278)
                     /codon_start=1
                     /locus_tag="cgR_0288"
                     /product="hypothetical protein"
                     /protein_id="BAF53252.1"
                     /transl_table=11
                     /translation="MNTDPAYVAEQTGKLIDAFLTTDPLEPLLDAAKTDVCTEAMGAL
                     VTFEGIVRDHDGGARVTSLTYTAHPTAPQVLSAVADSIVEKHPRTRLWTAHRTGALKI
                     RDAAFLVVAASAHRADAFAACSDLADAVKAQVPIWKEQTRLDGSTDWVGL"
     CDS             complement(316268..316729)
                     /codon_start=1
                     /locus_tag="cgR_0289"
                     /product="hypothetical protein"
                     /protein_id="BAF53253.1"
                     /transl_table=11
                     /translation="MTALVIVASTRAAAGVYEDRSGPILVSWLRAKGFDTPDPVIVAD
                     ADLPAFLDELKFPQVVLISGGTGLTPDDITVDTLIPRLDKEIPGIAHAFWNYSMDAVP
                     TAVLSRTVAGTIGSSFIMALPGSTGAARDATAVLDPLIDHITGTLQGHHEH"
     CDS             complement(316726..317196)
                     /codon_start=1
                     /locus_tag="cgR_0290"
                     /product="hypothetical protein"
                     /protein_id="BAF53254.1"
                     /transl_table=11
                     /translation="MSKLTHVREDGSAHMVDVTGKNETSRTAVAEGFVKMRGDVVKQL
                     FSAGLPKGDALPVARIAGIMGAKKTPDIIPLCHPLPLGKITVDFFELADGVRIEASVK
                     TRGVTGVEMEALTAVSTAALTVYDMIKAVDKMAVIDGIRVLSKTGGKSGDWSVQ"
     CDS             complement(317211..318398)
                     /codon_start=1
                     /locus_tag="cgR_0291"
                     /product="hypothetical protein"
                     /protein_id="BAF53255.1"
                     /transl_table=11
                     /translation="MMSRSPEQHLAEISALLPPQKSTFVNLREALGRRTFTAVTAQWD
                     SPRFDNSQMDGFALGPSHLNGGTFAVGPTIPAGHDPDQWYPRGIEKDIAPIMTGARLP
                     KNTAAIIPVEKTTPGNFDAPQVEIPATPQGQFIRLQGSDITAGDEIIPGGTELNSMHI
                     GVLASQSIKSIEVAAKPRVLIITGGSEISEQHGPATIPDANGPLLRSLCARNNIEVIA
                     GLHTNDDPERLRFELDNAIDQYQPDAIITSGGISHGKFEVFRQILEGSPNSWFGHVDQ
                     QPGGPQGISTFAETPVISLPGNPISTLVSFTLFVAPALNRQPLRHLDAHITAPVQGLQ
                     DNREQFLRGTINYANGKVLATPLLGTSSHLLVQAATANCLIRIPARTTVEENDIVKIY
                     PFN"
     CDS             complement(318399..319250)
                     /codon_start=1
                     /locus_tag="cgR_0292"
                     /product="hypothetical protein"
                     /protein_id="BAF53256.1"
                     /transl_table=11
                     /translation="MVLAQTKAPKTKTRRSENHILPGWLLIPATLAMLLIIGPIFALL
                     LQIPWDRSWELLTAPESLETARLSIGTALFSTALCAIVGFPLALALHLYERSHPRVTS
                     VLTVLVYAPLVLSPVVSGLALTFLWGRRGLLGSWFDQVGLPIAFTTTAVVFAQVFVAL
                     PFFISTVTTALRGIPKQFEEIAATEGATRWEIMHKMIIPLAMPGIFTGMILGFARALG
                     EYGATLTFAGNIAGATRTIPLHIELGLSSNDMDKALGAVIMLLAVYVLIIGAIGALRL
                     FSKVRKV"
     CDS             complement(319231..320037)
                     /codon_start=1
                     /locus_tag="cgR_0293"
                     /product="hypothetical protein"
                     /protein_id="BAF53257.1"
                     /transl_table=11
                     /translation="MNKSIRRALYSFITISAGISLVACSSSDTASTTTQNASATEAAR
                     VSGTASVFAAASLTNVAEDLAAAFHEDNPDTKLEFNFAGSSALVRQISEGAPSDLFIS
                     ADIANMDDALALPEFAGATSKVIATNKLVLVTADGNPGEISELADVKDSLVAICAPEV
                     PCGTITHEALDYADIELNTSSEEANVADVATKISTGAVDAGFVYQTDAQSLAKTQDNT
                     VIELEGIDANEYPMALTTSGEDNEVAKAFAEFLSSDRAKEILASYGFGTN"
     CDS             320065..320454
                     /codon_start=1
                     /locus_tag="cgR_0294"
                     /product="hypothetical protein"
                     /protein_id="BAF53258.1"
                     /transl_table=11
                     /translation="MLNQHNCGVGNFQWDWVEIKRSLFKYCAFPTISSVLNPEGNFNN
                     MDIHYFAAARAARGVAQETVAPSELTLSDLLKQLGEQHTETTAAGMTLAQVFDRCTFL
                     IDGRSADSSASLSGASRVDVLPPFAGG"
     CDS             complement(320451..321365)
                     /codon_start=1
                     /locus_tag="cgR_0295"
                     /product="hypothetical protein"
                     /protein_id="BAF53259.1"
                     /transl_table=11
                     /translation="MADLSIEHVSRFFGDATALNDVSLTVPSGSITAIIGPSGSGKTT
                     LLRLLAGLDSPDEGTVSIGNKIAKLGDTALCFQDSPLYPHLNVWENVAFPLKLKATNT
                     ADEVVKKRVSDVLEMLEIAPLARRKITELSGGQKQRVGIARALVRDVEVYLFDEPMAH
                     LDQALARDIVADLRKIQQSLGLTFVYVTHSKSEAFALADQIVVLVDGQVAQVGEAEEL
                     VDKPKTLEIAEFLSPTELNVRRRGDAVEAWRPEDTQLTRGGTATVEAVTYLGREWLVQ
                     TTEGHAVSEEKFDVGESVTLTQKKVFSF"
     CDS             complement(321368..321790)
                     /codon_start=1
                     /locus_tag="cgR_0296"
                     /product="hypothetical protein"
                     /protein_id="BAF53260.1"
                     /transl_table=11
                     /translation="MLGSLWRFAVRTAAGAVALWVVIKLIDGISLSFPTTPLYQDGQH
                     DNLLTFLAVAAIIVVLNATVKPVLKLLGLPLTIITLGLFSLVINAVIMLLAEYVSDLI
                     GFGLHIETFGAAFWGAIVLALVNWVLGPITGLLGAKKD"
     CDS             complement(321780..322805)
                     /codon_start=1
                     /locus_tag="cgR_0297"
                     /product="hypothetical protein"
                     /protein_id="BAF53261.1"
                     /transl_table=11
                     /translation="MIRADLATIPTYVPGRRLNNATKLSSNEVSFSPLPAAVDAVTEA
                     TQGANRYPDMGAVELREALAEHLEVEFDQVTVGCGSSALCQQLVQATCAQGDEVIFPW
                     RSFEAYPIFAQVAGATPVAIPLTADQNHDLDAMAAAITDKTRLIFICNPNNPSGTTIT
                     QAQFDNFMEKVPNDVVVGLDEAYFEFNRADDTPVATEEIHRHDNVIGLRTFSKAYGLA
                     GLRVGYAFGNAEIIAAMNKVAIPFAVNSAAQAAALASLNSADELMERVEETVEKRDAV
                     VAALGTAPTQANFVWLPGEGAAELAAKLAEHGIVIRAFPEGARISVTNAEETDKLLRA
                     WEAINAG"
     CDS             323698..325008
                     /codon_start=1
                     /locus_tag="cgR_0298"
                     /product="hypothetical protein"
                     /protein_id="BAF53262.1"
                     /transl_table=11
                     /translation="MKELDLGEAHGVAATLEAMPIQEVIDQVERTPIAEGAVLLRLLS
                     KDRSLLVFDALNPRLQADLIGAFQDAEVLDYFADLDPDDRVSLLDELPASIADELLRS
                     LDPQAKQVTELVLGYAKRSVGRWMSPQVLLLYDDMSVAEVLDYVRNHAAEAETIYALP
                     IVNRARQVVGVVSLRKLFIADPALKVSEVMVRPVSVLASADAEETARWFLQLDLVAMP
                     VVDESDMLVGVLTFDDAQDIVEQAESEDSARSGGSEPLQQPYLSTPIRKLVKSRIVWL
                     LVLAVSAILTVQVLDVFEATLAEAVVLALFIPLLTGTGGNTGNQAATTVTRALALGDI
                     RKSDVFRVLGREIRVGLMLGALLGGVGFVIASLVYGMPVGTVIGLTLLAVCTMAASVG
                     GVMPIIAKAIGADPAVFSNPFISTFCDATGLIIYFAIAKLVLGI"
     CDS             325415..326998
                     /codon_start=1
                     /locus_tag="cgR_0299"
                     /product="hypothetical protein"
                     /protein_id="BAF53263.1"
                     /transl_table=11
                     /translation="MSTPDIKEGSAESPGEVMVVGDRREWRRQATGIIAGLVLAALVY
                     LLFPSNSVETVMQSSGVDPETEYTNNAMRLTAAVTILMAVWWMTEAIPLAATALIPLV
                     AFPAFQVVDFGKAAAPYANPTIFLFLGGFLMALGLQKWNLHRRMALAVVLAVGTKPKQ
                     LVLGFMVATGFLSMWVSNTATAVVMLPIGMSVLALTAETVGGMKNQKKFATGLMLSIA
                     YSASIGSLGTLIGTPPNALLAAYMSESHDIHIGFGQWMILGVPIAVVFTIIAWLVLTT
                     VFKPEMKEIPGGRELIKREIAEMGPWTAPQVTVGVIFAAAALAWVFIPLTLDWTGSQL
                     SINDSLIGIAAGLLMFIVPANFKTGERILDWRTAGELPWDVLLLFGGGLSLSAMFTST
                     GLSLWIGELAKGLDALPIFILIFAIAVLVLFLTEFTSNTATAATFLPIMGGVAVGIGL
                     TAGGEQNVLLLTIPVALSATCAFMLPVATPPNAIAFGSGYIKIGEMVKGGLWLNIIAV
                     ILISISTYFVAIPLFGIML"
     CDS             complement(327359..328381)
                     /codon_start=1
                     /locus_tag="cgR_0300"
                     /product="hypothetical protein"
                     /protein_id="BAF53264.1"
                     /transl_table=11
                     /translation="MTTKDISRPVCILGLGLIGGSLLRDLHAANHSVFGYNRSRSGAK
                     SAVDEGFDVSADLEATLQRAAAEDALIVLAVPMTAIDSLLDAIHTHAPNNGFTDVVSV
                     KTAVYDAVKARNMQHRYVGSHPMAGTANSGWSASMDGLFKRAVWVVTFDQLFDGTDIN
                     STWISIWKDVVQMALAVGAEVVPSRVGPHDAAAARVSHLTHILAETLAIVGDNGGALS
                     LSLAAGSYRDSTRVAGTDPGLVRAMCESNAGPLIKALDEALAILHEAREGLTAEQPNI
                     EQLADNGYRSRIRYEARSGQRRAKESVSPTITSSRPVLRLHPGTPNWEKQLIHAETLG
                     ARIEVF"
     CDS             328389..328913
                     /codon_start=1
                     /locus_tag="cgR_0301"
                     /product="hypothetical protein"
                     /protein_id="BAF53265.1"
                     /transl_table=11
                     /translation="MWHIPTTVISMNTEEDGLSFAVTATLVEGKWQVREFEDHFSKLS
                     TSINAVRSLRSEGPAFALLCVDDEYFVMVRPTPSRVFLFLSDAPMAVDDDFAAAVMDE
                     LDADLPDINPDDLDDIDPWPEGDFDILADLGLSEEVLSVICDDMDLDPSEQLLRIAEE
                     LGFDNDLARVVGFD"
     CDS             328913..329392
                     /codon_start=1
                     /locus_tag="cgR_0302"
                     /product="hypothetical protein"
                     /protein_id="BAF53266.1"
                     /transl_table=11
                     /translation="MGVLPVQARIKDDERRMRHALDIARQTPEGDVPVGAVIYAPTGE
                     ILATATNRREADRDPTAHAEIIALRRAARRFSDGWRLSDCTAVVTLEPCSMCAGALVG
                     ARIGRIVFGAFEPRTGACGSVFDVVRDPAVLHKVEVSGGILEPECAALMTEFFELHR"
     CDS             329494..329697
                     /codon_start=1
                     /locus_tag="cgR_0303"
                     /product="hypothetical protein"
                     /protein_id="BAF53267.1"
                     /transl_table=11
                     /translation="MSDFSNKAEDLTGKAKEGFGEATDNESLADEGRADQAKADIKDA
                     AENAGEKVKDAANKVLGAFKKDD"
     CDS             329967..330320
                     /codon_start=1
                     /locus_tag="cgR_0304"
                     /product="hypothetical protein"
                     /protein_id="BAF53268.1"
                     /transl_table=11
                     /translation="MLYSVVMNLALFFAIAVTGLVGVSLLRKQASEERVFPWFWVFFP
                     LTLMSISGIFMKLELRTSFDFGWTMYEPSIYSSEFQPDFFDLYNATTISIIIYIVTLI
                     VGVIGSVIAWKKRRI"
     CDS             330412..332817
                     /codon_start=1
                     /locus_tag="cgR_0305"
                     /product="hypothetical protein"
                     /protein_id="BAF53269.1"
                     /transl_table=11
                     /translation="MAKLLFRLGRWSYNRKWIVISAWLLILAIVGGLALTMQKGFSNS
                     FTIEDTPSIDATVSLVENFPDQTNPVTAAGVNVVFQSPEGTTLDDPSMMTAMDAVVDY
                     IEDNLPDFGGGERFGNPVEVSPALEEMVIEQMTSMGLPEETAAKDAANLAVLSEDKTI
                     GYTSFNINVEAAEYVEQKHRDVINEAMAIGDDLGVRVEAGGPAFGDPIQIETTSEIIG
                     IGIAFIVLIFTFGSLIAAGLPLITAVIGVGIGALAIVLATAFTDLNNVTPVLAVMIGL
                     AVGIDYALFILSRYRAEYKRMPRADAAGMAVGTAGSAVVFAGATVIIALVALIIADIG
                     FLTAMGISAAFTVFVAVLIALTFIPALLGVFGGHAFKGKIPGIGGNPTPKQTWEQALN
                     RRSKGRSWVKLVQKAPGLVVAVVVLGLGALTIPAMNLQLSLPSDSTSNIDTTQRQSAD
                     LMAEGFGAGVNAPFLVIVDTHEVNADSTALQPLIEAQEPEEGEFDREQAARFATYMYV
                     TQTYNSNIDVKNAQIISVNDDFTAAQILVTPYTGPADKETPELMHVLRAQEAQIEDVT
                     GTELGTTGFTAVQLDITEQLEDAMPVYLAVVVGLAIFLLILVFRSLLVPLVAGLGFLL
                     SVGAAFGATVLFWQEGFGGFVNTPGPLISFMPIFLIGVTFGLAMDYQVFLVTRMREHY
                     THHDGKGQPGSKYSPVEQSVIEGFTQGSRVVTAAALIMIAVFVAFIDQPLPFIKIFGF
                     ALGAGVFFDAFFIRMGLVPASMFLMGKATWWMPKWLDRILPSLDIEGTALEKEWEEKQ
                     AAR"
     CDS             332820..334085
                     /codon_start=1
                     /locus_tag="cgR_0306"
                     /product="hypothetical protein"
                     /protein_id="BAF53270.1"
                     /transl_table=11
                     /translation="MAPMSDLSFTLNNKLADDAPGKHGRTGVIHTPHGDIATPAFIPV
                     ATKATVKTLTPEQIRETGAQAILSNAYHLYLQPGPDIVDEAGGVSAFENWHGPTYTDS
                     GGFQVMSLGSGFKKVLAMDTTNLTRNDIKAAKKERMALVDEDGVDFKSVIDGSKHRFT
                     PEVSMQIQHQLGADIIFAFDELTTLVDTYDYQVESVERTRRWAQRCLLEHERLTQERV
                     GKPLQSLWGVVQGAQFEDLRRQAVKGLLDLDRQAADEGRRGFGGFGIGGALEKENLGT
                     IVGWVCDELPDEKPRHLLGISEPDDLFVAVEAGADTFDCVAPTRLGRRGGVYTLDGRM
                     NLTGARFKRDFKGIDEEVGGYASENYSRAYIHHLLKAKEFLAGTLCTMHNLYFMITLV
                     DKIRASIDDGTYYEFKEEFLGRYYASKVS"
     CDS             complement(334064..334816)
                     /codon_start=1
                     /locus_tag="cgR_0307"
                     /product="hypothetical protein"
                     /protein_id="BAF53271.1"
                     /transl_table=11
                     /translation="MVVDVQNQSHTPETQPQPGQGAAKKTPVASGNSTFIHIQPSLYP
                     ILLALFVAVFLISNITATKGVEIGPLVTDGAFFLFPISYVLGDVLAECYGFKSTRRAI
                     LTGFGITILAAISFYISIWLPGASFWEGQEAFEATLGLVPQIIVASLAGYIVGQLLNA
                     KVLVAIKKRTGEKSLWARLIGSTVVGEFADTLLFCAIAAPVIGIATAPDFINYVVVGF
                     VWKTLLEVILMPITYAVIRWVKRREGYETFDA"
     CDS             334938..336020
                     /codon_start=1
                     /locus_tag="cgR_0308"
                     /product="hypothetical protein"
                     /protein_id="BAF53272.1"
                     /transl_table=11
                     /translation="MTIALEHPVLHSTAIALPARFQASYTTRLVAVGVDKRPSDFWLE
                     TAGAPQAGDVVIARVTAINNHKRVETPESRKAILFEGALVMLAYGHRYAADQFLAHVP
                     EDLEPCHLVAAGGIAGVVTALHDQMDEPTEIEPLGLLTNARGTVNVRDFAAFDNPLKV
                     EAPKKRAQVIAVLGTSMNSGKSTTLACLVNGLAAAGQKVAAGKITGTGAGNDRMIYHD
                     AGAHSVIDFTDFGYPTTFKLNFAEIRALSVNMINVLADSGADTVIVEIADGIYQGETS
                     RLLRDQVFQESVDHVVFSAVDALGAKAGVQELQAAGLHVAAASGVMTASPLATAEAAA
                     VLEVPVVPTFDLTNPEIVTAVLTDHA"
     CDS             336013..337452
                     /codon_start=1
                     /locus_tag="cgR_0309"
                     /product="hypothetical protein"
                     /protein_id="BAF53273.1"
                     /transl_table=11
                     /translation="MPRLWRARRRLLLITLGVLGVLQAALAIIMSLSVSAVLSGDRGL
                     IALLLATTLGLGAAQWIQKVVAEDLGQHYVHEVRRELVGAALVPGNANSLGVTVTRAS
                     NDLTAVRNWVTLGIVSLATGVPLIAIVLAALFVHDIRTGIAVAVPLLMCVAVLPVVAR
                     WTLKRARELRKKRGRMAARIADSVMAGELLHATGAIDRELNAVTRDSDRVVIAAVRRS
                     WATGFSRALMAMAASLGTVSIVISGHLEVSEVAGIMMLLGVLATPVAELGRVVEYRQN
                     YKAATRILIPLLQRGSEFKRSQQKLPGLQATEGIPGVYVKGISALPGERIYLHGSADA
                     TRKWVTSLSAMEEGTDAIVNGQRLSQLPLKQRRALIGIASAHHHLSRGSVSRLVGLRV
                     PDATVEEIEQALEQVGLNNTGKQRLKNGGHPWSTSQINKLKIASATLRTPPLLVLEGI
                     TPENLLNYPGVIISTVQENPSETWRQVNI"
     CDS             337462..338343
                     /codon_start=1
                     /locus_tag="cgR_0310"
                     /product="hypothetical protein"
                     /protein_id="BAF53274.1"
                     /transl_table=11
                     /translation="MAGRYAPSPSGDLHFGNLRTALLAWLFARSEGKQFLMRVEDIDE
                     QRSSKESAESQLADLSALGLDWDGDVLYQSTRYDAYRAALEKLDTYECYCSRRDIQEA
                     SRAPHAAPGVYPGTCRELKEEERVEKRASLAAQNRHPAIRLRAQVTSFDFYDRLRGPQ
                     TGPVDDFILLRGGQEPGWAYNLAVVVDDAYQGVDQVVRGDDLLDSAARQAYLGSLLGT
                     PAPEYIHVPLVLNAHGQRLAKRDGAVTLKEMLIDATLPTIFSRLAHSLGYEEVDSAPQ
                     LLEVFDPTNLSREPFIY"
     CDS             complement(338337..339344)
                     /codon_start=1
                     /locus_tag="cgR_0311"
                     /product="hypothetical protein"
                     /protein_id="BAF53275.1"
                     /transl_table=11
                     /translation="MAEQLRQFEGRVLPNQSEDLEDQGLGFDLGTVFSRRKVLGFIGV
                     GGAGVALAACSPSGSSAASSTSSASSSAAATSSAAAETLTEMKSETAGPYPGDGSNGP
                     DVLEVSGVERQDITKSIDTDTVAEGVPLTLTMTILDMNNNNQPMEGAAVYIWHCDAPG
                     RYSMYDDELLEETYLRGVQITDKYGQVTFDTIFPGCYAGRWVHIHFEVFPDRESISDS
                     TNNILTSQIALDEASAASVYALDVYGDSLTNLNNITLESDNVFSDGWDQQMANLTGDA
                     TSGFIASIDVPIDPTTEQDQSMNMPSGGGMGGGPSGGGMGGPGEGMTPPDGMTPPSEP
                     Q"
     CDS             340573..341853
                     /codon_start=1
                     /locus_tag="cgR_0312"
                     /product="hypothetical protein"
                     /protein_id="BAF53276.1"
                     /transl_table=11
                     /translation="MSSVSLQDFDAERIGLFHEDIKRKFDELKSKNLKLDLTRGKPSS
                     EQLDFADELLALPGKGDFKAADGTDVRNYGGLDGIVDIRQIWADLLGVPVEQVLAGDA
                     SSLNIMFDVISWSYIFGNNDSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVP
                     MNEDGPDMDAVEELVKDPQVKGMWVVPVFSNPTGFTVSEDVAKRLSTMETAAPDFRVV
                     WDNAYAVHTLTDEFPEVIDIVGLGEAAGNPNRFWAFTSTSKITLAGAGVSFFMTSAEN
                     RKWYSGHAGIRGIGPNKVNQLAHARYFGDAEGVRAVMRKHAASLAPKFNKVLEILDSR
                     LAEYGVAQWTVPAGGYFISLDVVPGTASRVAELAKEAGIALTGAGSSYPLRQDPENKN
                     LRLAPSLPPVEELEVAMDGVATCVLLAAAEHYAS"
     CDS             341855..342487
                     /codon_start=1
                     /locus_tag="cgR_0313"
                     /product="hypothetical protein"
                     /protein_id="BAF53277.1"
                     /transl_table=11
                     /translation="MNTAETAHWINRLLPGQPEFHQVGAFKVAGYTLDDESIACSVDF
                     GRVNTGLVTETGAETVDVRSEILSLARADVSVPGRAVGAAATMLLDASLSFKSATDSS
                     VTPMHAQPGQILPCVGIMANLPQEGFSVVHGILADPRIWGPEIPYVREEAGQVNVEAP
                     DEAGDLARLTLPLQLILLTEEEFAIALNEGSDVMFERMAEQEVDLLDLKR"
     CDS             342566..344791
                     /codon_start=1
                     /locus_tag="cgR_0314"
                     /product="hypothetical protein"
                     /protein_id="BAF53278.1"
                     /transl_table=11
                     /translation="MTDPLSAALDSGRINHAYLFSGPRGCGKTSSARILARSLNCVEG
                     PTSTPCGVCNSCVALAPGGPGTLDVTELDAASNNGVDDMRELRERANYAPAESRYRVF
                     IIDEAHMISTQGFNALLKIVEEPPAHLIFIFATTEPDKMIGTIRSRTHNYPFRLLTPG
                     DMRKVLKNAVDGEGVHVDDSVYPLVIRAGGGSPRDSLSILDQLIAGSGPEGLTYERAL
                     PLLGVTSFTLIDDSIHALASKDNASMFTTIDNVIEEGLEPRRFTIDLLDRLRDLMVLQ
                     AVPEALNLGLVDAPTDRADVLIEQSTLFKGNELANLASMVNSGLDDMRGATSPRLLLE
                     ILCARLLLASNTVAVPVASSSSEATPAASPGGLTGIAAARAKAREYGQKKAAPTPAPA
                     PEPTPAPEPTPQPAPEPEPAREPVVEVREASVEKQPASSDPLETIRSHWSELRSIVEK
                     QSVRTSIMLTEARVLGLRGDTLVLGHSTGALAARLNAADHNGILVKVLAEETGLQLKV
                     ECIVGTNPAEAGFTAQPAVQKSSWNPNHDSKPATPSAPAQPQTPKQESVPTEPEEPES
                     SAETSGWGQPVKIGGPEPEAQTPTPPPAPVVPATPAAPAAGSAKPAWKERVEQAAANA
                     AQQRQHRQGSSEPFERGVPLPPEPDLPPDPYGYPADEGFPERNQGFQQQPAPPVEQPA
                     PAPVVEPVPAVAPEPEVSQLSEEEQLIREADEEPGEMDRRDAKTIAMELLAQELGAKP
                     L"
     CDS             344900..345211
                     /codon_start=1
                     /locus_tag="cgR_0315"
                     /product="hypothetical protein"
                     /protein_id="BAF53279.1"
                     /transl_table=11
                     /translation="MTQPDMSQILAQAQQMQAQLQAAQQEILATTVVGNAGNGLVTVT
                     MAGNGEVSAVTVDPKVVDPEDVETLQDLLLGAFKDAHNKVANVAEEKMGPLSQGMGGL
                     F"
     CDS             345315..345971
                     /codon_start=1
                     /locus_tag="cgR_0316"
                     /product="hypothetical protein"
                     /protein_id="BAF53280.1"
                     /transl_table=11
                     /translation="MFEGPLQDLIDELSRLPGVGPKSAQRIAFHLLNVDPTDITRLQE
                     ALGGVRDGVQFCRICCNISREEVCRICSDSGRDGGTICVVEEPKDIQVIERTGEFSGR
                     YHVLGGALDPLANIGPRELNISTLLQRIGGVLPDRELADSTPENKLFDATPTVREVIL
                     ATDPNTEGEATASYLGRLLKDFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLQI
                     "
     CDS             346716..347705
                     /codon_start=1
                     /locus_tag="cgR_0317"
                     /product="hypothetical protein"
                     /protein_id="BAF53281.1"
                     /transl_table=11
                     /translation="MWIGEEKLRRPKRSVRTLSVLVIVTVLALVALVIPFVVSEDDGF
                     DSAADCTAYGIPAGDPLATADPVMHSTSSGLFSIFSKDEEETSWYTNPWDTEDYVEAE
                     GVALGRSFGERHDRSNYHLFTRGVDFTEPVGLLVRLHGDGAEEYLSPEGLSACLALVA
                     ETYNMITLVPRTPDERSMTWWRNLEENVDWLNSLVAQISAEYSLDAESVWWMGYSGGA
                     ELISYGLIPYSAESVTGGAILLGGGGAPERNRLDVAASLRERMPLYWVTGQRDDGTDP
                     AEPFNAIEAATEGAQWYRNHGFARVHTDFPAEYDHFTLPHAAILQEVLLTEIK"
     CDS             348307..352272
                     /codon_start=1
                     /locus_tag="cgR_0318"
                     /product="hypothetical protein"
                     /protein_id="BAF53282.1"
                     /transl_table=11
                     /translation="MSTQDHPKYAVYGVEAPPPECTLIDIVDATVAMYPEVRGLEGTN
                     GTLTYSELRDTIEVEVSRLRSAGVGRGDRVGIRVPSGTVDLYVAILATLYAGAAYVPV
                     DWDESDSRAQTVWEEADVAVVYGLSLSIDVRRHEPNTDHSRATLDDDAWIIFTSGTTG
                     KPKGVAITHRSAAALVESERLLYLVDAPLGPQDRVMGGLSVAFDASCEEMWLAWRNGS
                     TLVAAPRDLVRSGEELGQWIVDEKITAVSTVPTLAAMWDPDSLTAVRLLIFGGEACPL
                     PLIEKLFVPGRELWNTYGPTETTVIVSGQLMTPEPPVRIGRPIVGWELAVVNEDGIPV
                     NWGETGELVVGGIGLGRYLDEEKDRESYRALPALGWNRSYHTGDLVKAEPEGLIFAGR
                     VDDQIKIGGRRLELGEVDGYLNDIPGVDAAAAAVRTTESGNDVLVGYLSGADPDAIDL
                     QQARKLVAEKMPKGVVPLLCVLDELPMKTSGKVDRKALPWPLATQQDTGGLPERYAAL
                     GELWIEQLGPVSLTSDSNFFELGGGSVAVARLAARIRETHPGAEIGELYQNPFLGRMS
                     HYLESLVSDSEERPMPKRIPRIGVLFQGFWVLFLYLINALRYVTGVLIVVWLLERFFD
                     AGWVPGISGFPLLIAWLVLYSLPGKVMITALITRPLTFRMKAGRYRRGGWTHLRLWAS
                     QRTLTFMQLENLNGTPFAPMMHRLLGTKVGRNTSLSHSPSVTGLLTIEKGATVEFEAD
                     LEGYWIDGDTLIVDTITIGENVRVGARSIIQPGVRIAPGAEILPGTNVDRDIEGPETW
                     SGSPMTYQGPAGETWPATTPSNTRETPVMGRLRSGLTYGGGLLVLRILQVAALVPGFM
                     LVFPFVSRLEFYELVFPILIVWVPVFTILMVFTWLLGVVIVIRILSVFIRPGYFPQRS
                     FTGFAVWLTHTLMQRTLISTYPIYASSFTPLWFRLLGARVGKNVEISTVETIPHLTWI
                     RSGSFLADHALANSTRMCRGWLHVGTTVIGEGSFVGNSAIVGPDRDVSDGALMAVLST
                     APYHPEAGSSWLGRHPMQITRQRVKGEDSLTYKPPFQRKVLRAGVELCRIIPAMISNW
                     MDLLSVYILTSIYMYYWLGGETQLDSLMFASLWSWPVLVASGSLAALVALIAKWLLVG
                     RFRERSVPLFSSLVWRGELADVFIESLAIPGFVRMSLGTPMLNLWHRCLGVKIGRSVW
                     CETWWLPEFDLIRISDLASVNRGTVLQTHLFHDRVMSMEPVVLEDGATLGPNSFVLPG
                     AVIGECTTVRTGSLVQRQEALPDNSEWAGNPVRYLGSTSSNAGRAETGQETLVMEGED
                     Q"
     CDS             352269..353720
                     /codon_start=1
                     /locus_tag="cgR_0319"
                     /product="hypothetical protein"
                     /protein_id="BAF53283.1"
                     /transl_table=11
                     /translation="MTSHLEEKQVRVLEGDLPVDVRPHSGWSEERSVWTGHGDEAQPI
                     KFGTTAVGTYRAEEEYGAERQWSKGRIIGINVARGLALFGMFSVHTLDPWNEEAERVT
                     VLWMMTAGNAAALFAVLAGVGIALSTGGSKGLRPERRINARVQLFVRALLILFIGLLS
                     NLWLDPPVFNILPYYAVLFLLASLFLGVRKRTLCTWALLMMLAGPIAQYFVRSAEPYE
                     RILSPVPADLISNPADVLGTLLFTGTYPVTTWSAYMLVGLALGRMQLNRIQVQLGLFG
                     FGAFAAVSGWLMSRMAVNFLGGYEGMLYSEVRITQEMVEAFLTEGPDEDLPTSSFWWL
                     TVAGPHTNTFFSLLLSTGVAVSVLGATFLICRVFPRLLWPLAAAGSMTLTLYVCHMAF
                     LHFYAIGDYSTDQELNLALAIQILGVLIISGLWSLLFRRGPLEWLVGELSKRIADPRR
                     KSAETGGALKSGSRGMTGSGWWRHRAVSGRHRM"
     CDS             complement(353841..354593)
                     /codon_start=1
                     /locus_tag="cgR_0320"
                     /product="hypothetical protein"
                     /protein_id="BAF53284.1"
                     /transl_table=11
                     /translation="MTTLNIGLILPDVLGTYGDDGNALVLRQRARMRGINAEIQRVTL
                     DDAVPSTLDLYCLGGGEDTAQILATEHLTKHNGLQTAAAAGRPIFAVCAGLQVLGDSF
                     RAAGRVIDGLGLIDATTVSLQKRAIGEVETTPTRAGFTAELTERLTGFENHMGATLLG
                     PDAEPLGRVVRGEGNTDVWAASENTDDQRQQFAEGAVQGSIIATYMHGPALARNPQLA
                     DLMLAKAMGVALKDLEPLDIDVIDRLRAERLA"
     CDS             complement(354593..355864)
                     /codon_start=1
                     /locus_tag="cgR_0321"
                     /product="hypothetical protein"
                     /protein_id="BAF53285.1"
                     /transl_table=11
                     /translation="MKLSLPAPLRRLRSTAAIVSAKVATSASKATGRGSGGMIGGLVA
                     SKVDPDIMSNLINNRPTVLVTGTNGKSTTTRMLAAAMRSTYTVATNEGGDNMDAGIIS
                     ALLAGRNASHVVLEVDELHVPAAIERLKPDALVLLNLSRDQLDRVGEINKIERVLRDA
                     VRSRPEMTVIANCDDVLVTSVAFDAENVIWVGAGTGWQGESVTCPRTESRILHDGRHW
                     SAEKTLLDGRTFARPTPSWEVDGDTIHSPSGDLTLDLNLPGQANRGNAAQAIAASTVF
                     NVPVSSALPAVNSVNNVAGRYSTITVGEHKVHLLLAKNPAGWQEALSMVDRTADGLVI
                     VVNGQVADGEDLSWLWDVRFEDFENLSVKASGERGTDLAVRLTYAEINHELISNPVDA
                     IAACPPGRIEVLANYTAFRDLKKALEKGTEQ"
     CDS             complement(355894..356976)
                     /codon_start=1
                     /locus_tag="cgR_0322"
                     /product="hypothetical protein"
                     /protein_id="BAF53286.1"
                     /transl_table=11
                     /translation="MSTTSESQDHAARVEAERQEAIKAAPFVSVTIQSSGIHPSTSRM
                     VTIDLVTLSPTLEPVETFHAVLDSKTDPGPFHLHGVTEEEFAGAKKFGQILKSLDRLI
                     DGRTLLIHNSARTWGFIVSEAKRAMNDAARANRNNNRGNRRGGRGRRRQRVGHIPKPL
                     VIVDTLASARRQAIALDDVRIRGVAHTLGLGAPAAEASVERAQVPHRQLCREETLLVA
                     KLFSSLRESGPLAEIDPQTVRADKFGLQRSIVRVQAQEATPTLVNPGTYEPGKTLIAG
                     MEVVVAPEIEMDPDIIIQASVDADLAYSEKLTRQTSVVVCNQTRDIDGKAMHAQRKGI
                     PLLSDVAFLAAVKRVKEGKKVDVEKH"
     CDS             complement(357357..359207)
                     /codon_start=1
                     /locus_tag="cgR_0323"
                     /product="hypothetical protein"
                     /protein_id="BAF53287.1"
                     /transl_table=11
                     /translation="MSPNDAFISAPAKIETPVGPRNEGQPAWNKQRGSSMPVNRYMPF
                     EVEVEDISLPDRTWPDKKITVAPQWCAVDLRDGNQALIDPMSPERKRRMFELLVQMGF
                     KEIEVGFPSASQTDFDFVREIIEKDMIPDDVTIQVLVQAREHLIRRTFEACEGAKNVI
                     VHFYNSTSILQRNVVFRMDKDQVKKLATDAAELIKTIAQDYPDTNWRWQYSPESFTGT
                     EVEYAKEVVDAVVEVMDPTPENPMIINLPSTVEMITPNVYADSIEWMHRNVNRRDSII
                     LSLHPHNDRGTGVGAAELGYMAGADRIEGCLFGNGERTGNVCLVTLALNMLTQGVDPQ
                     LDFTDIRQIRSTVEYCNQLRVPERHPYAGDLVFTAFSGSHQDAVNKGLDAMAAKVKPG
                     ANSTDVSWEELRDTEWEVPYLPIDPKDVGRDYEAVIRVNSQSGKGGVAYIMKTDHGLQ
                     IPRSMQVEFSAVVQNVTDAEGGEVNSKAMWDIFATEYLERTAPVEQIALRVENAQTEN
                     EDASITAELIHNGKDVTVDGHGNGPLAAYANALEKLGIDVEIQEYNQHARTSGDDAEA
                     AAYVLAEVNGRKVWGVGIAGSITYASLKAVTSAVNRALDVNHEAVLAGGV"
     CDS             359851..365052
                     /codon_start=1
                     /locus_tag="cgR_0324"
                     /product="hypothetical protein"
                     /protein_id="BAF53288.1"
                     /transl_table=11
                     /translation="MVELSTRINPNERRFVVFIAAFLAMILVASGLATPAYAQQENAF
                     VVTLPSASSHNGKPVYESGKKLRVEVGYGVMDDGYTGVITVPEQIDPSSIVADLSGNT
                     ALESVTPNGDGTITFQFTDPFPAGIQQGLFWLDVELKEFETSGEQELKWEFPDGSTQT
                     IDIVVKSKDDEFKTVSDYENKAISSDPWLEATVENGVVSVDSAAFLGAEIEYRININT
                     AEGGTFKIKDNLDEGLVFIDGSFNATRKTWDSNGMNKEEATVSFPQQSGSSFTESIDL
                     PANSEFVLLYKAQIKDQSAVDAIVDKLQSEYERKREEAGDDEFATIYFSTSFVNSATI
                     NDGSEKAASFAINGSESGRVGPEVNGVFSKTSDFAFAEIEDPETNDFEEVDLTYTLKV
                     DLTPYAGFENTSKGLGGNVVIVDTLPSDIKWRDGESDFLVADGMVLTRENSSEPLTAQ
                     QFESDEYVGKYYVDGKNLFINIGQDTTTIVSIDVKATITGVNEVWRSGGNSPMEEARY
                     WGPDNTAVLTYPNDKIIRTAKHSFAVMKDGSSGINDPQKFSKTTTNNGPIEITQGEPA
                     LIEFKFTIGAGIGDARKSIIVDKIDHDVFDVSEETLAAIKASITGNYHWNYPIDGDTM
                     DVTIDGDGNLVFAPNDQFPKAANWGAEASAPFTETFTFAVTIPTHPLYGKQTLQVENK
                     ASYRGSDFETVFDSGTEATATSYGNEMELRKRVYNEDSKTFVSQLRVELNEDGELIND
                     EFIYAVELIPHGQFKNMVLDVEDFLPAEVDFVGFINANDFNSGNLDRVTTDPVTLTNT
                     NAKATYVAGERKVHIGRDVLTSGQTSTLYFKVKLTDFEKDQPIANVIGNAEATIVPSN
                     DYPLNIVKVDTSNEENKITDTNAIFQIKKGDDVVVDNVYVVNGNLVVSGDNGAHKPVA
                     VKEPGEYTIVEVKAPAGFLLTDQEFNVSITEQGVQTPDQVRINNQPGQDVADPVIGTS
                     VAVEGSDVKVLPVSGGTVIDTVTYEGLTVGQKYILEGELFTKAGVATGIKGSREFIAE
                     AADGSVAVAFEISADQIAEYAGEKLVAFESLFELNDDVKSEDPVAEHRDVEDEAQTFT
                     VDELPVADPVIGTSVAVEGSDVKVLPVSGGTVIDTVTYEGLTVGQKYILEGELFTKAG
                     VATGIKGSREFIAEAADGSVAVAFEISADQIAEYAGEKLVAFESLFELNDDVKSEDPV
                     AEHRDVEDEAQTFTVDELPVADPAIGTTAKVTGTTDKVLPLTGGQVIDSVAYKDLQPN
                     TKYVLQGVIQHVATDGTVTSTDVVASTVFTTGDAPAGEFFVSGNAEVKFNIDQATAAE
                     YAGERLVVFEQLWLADDNGNKTGDEPVAVHEDPTDEAQTFYAGEKPDAIPGIGTTAKV
                     TGSADKVLPLTGGEIVDTVAYKDLQPNTEYVLNGEIQHVAEDGTVTSTGVIATATFTT
                     GAAKSGEFYVSGTTTVTFDIDEQTAIKYAGEKLVVFETLYTAGNPETPVASHVDPEDE
                     AQSFTVAPQPEADVVVEKTVTGPKGAQVEADENALFQITATWTDELGRNFSKTFNVVP
                     GKPVSLEGLPTNTEIYLSETGATTDVKNVKWGDVIWTGEGVVDETGTSKGATVTFTGE
                     GPFEIGLENKTSSNGMIIIPIPIPLFPIDGGSSTNPIQPDPTQPDPKESVDPTNPTPS
                     EGSEAGTSPSKDKGAEQPETVKPRTPSEKVGLAQTGANVAWVAGIAILLLLAGAALIV
                     RGRRKDA"
     CDS             365122..365259
                     /codon_start=1
                     /locus_tag="cgR_0325"
                     /product="hypothetical protein"
                     /protein_id="BAF53289.1"
                     /transl_table=11
                     /translation="MLSIPLIFTVENIETTGSSVVDFLGSISIWLYDIFGDTGSATIE
                     A"
     CDS             complement(365345..365953)
                     /codon_start=1
                     /locus_tag="cgR_0326"
                     /product="hypothetical protein"
                     /protein_id="BAF53290.1"
                     /transl_table=11
                     /translation="MPEGKPRRLGRPRNENLDSKILQATRNIIEKDERVSIEAIVQES
                     GASRASVYRRWPSLNNLIANALDEGRKSEVLIDLSGTVKDGFIAMFFGDLSVAHGEDY
                     TMERFRKRMELAMSDPKVQQVYWSSYVEKRRKYPLQALQLAKDRGEIREDVDIDAALD
                     SIYGALYYQFLIRGQDITSKDCRGRARAAFELIWRGMETQEK"
     CDS             complement(366355..367074)
                     /codon_start=1
                     /locus_tag="cgR_0327"
                     /product="hypothetical protein"
                     /protein_id="BAF53291.1"
                     /transl_table=11
                     /translation="MWWAGMSTAMLAYFLQTVALGFGTLLVVQPVLVLSLMFTLPLSA
                     RFNGYRLRRTEIFWATLLTVAVGIMIVLGRPLPGNPHPPLDRWIPALLVGVAVMGGMW
                     LLAEYVLKKDKALILGLVTGALFGYVAVMSKAAVDLFVHQGITGLILNWEGYGLILTA
                     LLGTVVQQYSFNAGELQKSLPAMTIAEPIVAFSLGYLVLGEKFQVVDWEWIAMGIALL
                     VMIVSTIALSRTSTMPAGSKK"
     CDS             367471..368736
                     /codon_start=1
                     /locus_tag="cgR_0328"
                     /product="hypothetical protein"
                     /protein_id="BAF53292.1"
                     /transl_table=11
                     /translation="MALVVQKYGGSSLESAERIRNVAERIVATKKAGNDVVVVCSAMG
                     DTTDELLELAAAVNPVPPAREMDMLLTAGERISNALVAMAIESLGAEAQSFTGSQAGV
                     LTTERHGNARIVDVTPGRVREALDEGKICIVAGFQGVNKETRDVTTLGRGGSDTTAVA
                     LAAALNADVCEIYSDVDGVYTADPRIVPNAQKLEKLSFEEMLELAAVGSKILVLRSVE
                     YARAFNVPLRVRSSYSNDPGTLIAGSMEDIPVEEAVLTGVATDKSEAKVTVLGISDKP
                     GEAAKVFRALADAEINIDMVLQNVSSVEDGTTDITFTCPRSDGRRAMEILKKLQVQGN
                     WTNVLYDDQVGKVSLVGAGMKSHPGVTAEFMEALRDVNVNIELISTSEIRISVLIRED
                     DLDAAARALHEQFQLGGEDEAVVYAGTGR"
     CDS             368760..369794
                     /codon_start=1
                     /locus_tag="cgR_0329"
                     /product="hypothetical protein"
                     /protein_id="BAF53293.1"
                     /transl_table=11
                     /translation="MTTIAVVGATGQVGQVMRTLLEERNFPADTVRFFASPRSAGRKI
                     EFRGTEIEVEDITQATEESLKGIDVALFSAGGTASKQYAPLFAAAGATVVDNSSAWRK
                     DDEVPLIVSEVNPSDKDSLVKGIIANPNCTTMAAMPVLKPLHDAAGLVKLHVSSYQAV
                     SGSGLAGVETLAKQVAAVGDHNVEFVHDGQAADAGDVGPYVSPIAYNVLPFAGNLVDD
                     GTFETDEEQKLRNESRKILGLPDLKVSGTCVRVPVFTGHTLTIHAEFDKAITVEQAQE
                     ILGAASGVKLVDVPTPLAAAGIDESLVGRIRQDSTVDDNRGLVLVVSGDNLRKGAALN
                     TIQIAELLVK"
     CDS             369874..371295
                     /codon_start=1
                     /locus_tag="cgR_0330"
                     /product="hypothetical protein"
                     /protein_id="BAF53294.1"
                     /transl_table=11
                     /translation="MKWNFLQVLSFFSRENTADSTSDKEHENATELAAEALADVIFQW
                     KNWVYRRVDSVHPSEGARGRLRHSMDCEPPPDPRLAYNEVERRYNDINDVKGQLMVPL
                     AFIEKGPMRHLDVWRNDGTSIPVLGSEETGELMVAVLMLFLKKNGIERTSELEDAMRA
                     LVISREKGNLAKATNLIESGMWEGKTLWDSNDPAVRFDVGTKDLLLNLSTDFLLIGLL
                     PAETSGIRQVLKFSYHWVVELPDRGLLRSLWGSVCVAFRAAPMQIELPTHMPTDAKSY
                     HLEFHTPPELDTQELSLPVDSKNKGHRVGYPTDSSRTPIAHVHSHFSEIMTTNAKVKL
                     EVPKRGIWVTALLSNALTAGIFILALLLPNVTDALRSVGGNAAALMLAAPAVFVSFLI
                     FPKEHIFVSSMLNPLRIVVGICALLLFMMAGSLVGGLERPFLILLWSFGAGFSLLVVS
                     ALVLGPLLGKFFERLHLRPSTKN"
     CDS             complement(371643..372224)
                     /codon_start=1
                     /locus_tag="cgR_0331"
                     /product="hypothetical protein"
                     /protein_id="BAF53295.1"
                     /transl_table=11
                     /translation="MKSKERNDAHVTELALAAGRGDRAALTDFIRETQDDVWRLLAHL
                     GGHEIADDLTQETYLRVMGALPRFAARSSARTWLLSLARRVWVDNIRHDMARPRKSIV
                     EYEDTGATDASNAGIWSEWIDVRTLIDALPPERREALILTQVLGYTYEEAAKIADVRV
                     GTIRSRVARARADLIAATATGDSSAEDGKSAQG"
     CDS             372428..373978
                     /codon_start=1
                     /locus_tag="cgR_0332"
                     /product="hypothetical protein"
                     /protein_id="BAF53296.1"
                     /transl_table=11
                     /translation="MSEKSAADQIVDRGMRPKLSGNTTRHNGAPVPSENISATAGPQG
                     PNVLNDIHLIEKLAHFNRENVPERIPHAKGHGAFGELHITEDVSEYTKADLFQPGKVT
                     PLAVRFSTVAGEQGSPDTWRDVHGFALRFYTEEGNYDIVGNNTPTFFLRDGMKFPDFI
                     HSQKRLNKNGLRDADMQWDFWTRAPESAHQVTYLMGDRGTPKTSRHQDGFGSHTFQWI
                     NAEGKPVWVKYHFKTRQGWDCFTDAEAAKVAGENADYQREDLYNAIENGDFPIWDVKV
                     QIMPFEDAENYRWNPFDLTKTWSQKDYPLIPVGYFILNRNPRNFFAQIEQLALDPGNI
                     VPGVGLSPDRMLQARVFAYADQQRYRIGANYRDLPVNRPINEVNTYSREGSMQYIFDA
                     EGEPSYSPNRYDKGAGYLDNGTDSSSNHTSYGQADDIYVNPDPHGTDLVRAAYVKHQD
                     DDDFIQPGILYREVLDEGEKERLADNISNAMQGISEATEPRVYDYWNNVDENLGARVK
                     ELYLQKKA"
     CDS             373995..374339
                     /codon_start=1
                     /locus_tag="cgR_0333"
                     /product="hypothetical protein"
                     /protein_id="BAF53297.1"
                     /transl_table=11
                     /translation="MRAYPPMVDRPSFDFEAIERKLARQQIRNSQGHCSGTNGGGAES
                     NGKETSGALNCSFDLRSLSSRQEAQQIGDFLWKLDPRAEVGGTSSRASFLCASDSSAT
                     SQGGGSDCNCCD"
     CDS             complement(374058..374351)
                     /codon_start=1
                     /locus_tag="cgR_6014"
                     /product="hypothetical protein"
                     /protein_id="BAQ21076.1"
                     /transl_table=11
                     /translation="MRMKSIAAIAIATAALAGGTGVASAQEAGSTAGSSNLSSGIQLP
                     QEVTDLLSFLPAAQAAQVEGAIQSTAGFFAVGLGSTAIGSTAVTLGIADLLSS"
     CDS             complement(374403..374867)
                     /codon_start=1
                     /locus_tag="cgR_0334"
                     /product="hypothetical protein"
                     /protein_id="BAF53298.1"
                     /transl_table=11
                     /translation="MQYMKLDSIDRAIIAELSANARISNLALADKVHLTPGPCLRRVQ
                     RLEAEGIILGYSADIHPAVMNRGFEVTVDVTLSNFDRSTVDNFESSVAQHDEVLELHR
                     LFGSPDYFVRIGVADLEAYEQFLSNHIQTVPGIAKISSRFAMKVVKPARPQV"
     CDS             374885..375688
                     /codon_start=1
                     /locus_tag="cgR_0335"
                     /product="hypothetical protein"
                     /protein_id="BAF53299.1"
                     /transl_table=11
                     /translation="MQTGNKTIRQLCDDCSVQKTQEIHSSLEVSPSKAALGPGDKGYP
                     RYEIAQGLKTSLAAGLGMYPIGIAFGLLVIQYGYEWWAAPLFSGLIFAGSTEMLVIAL
                     VVGAAPLGAIALTTLLVNFRHVFYAFSFPLHVVKNPIARFYSVFALIDEAYAVTAARP
                     AGWSAWRLISMQIAFHSYWVFGGLTGVAIAELIPFEIKGLEFALCALFVTLTLDSCRT
                     KKQIPSLLLAGLSFTIALVVIPGQALFAALLIFLGLLTIRYFFLGKAAK"
     CDS             375685..376011
                     /codon_start=1
                     /locus_tag="cgR_0336"
                     /product="hypothetical protein"
                     /protein_id="BAF53300.1"
                     /transl_table=11
                     /translation="MTTDFSYILLVVAVCAVITFALRAVPFLILKPLRESQFVGKMAM
                     WMPAGILAILTASTFRSNAIDLKTLTFGLIAVAITVAAHLLGSRRTLLSVGAGTIVFV
                     GLVNLF"
     CDS             complement(376086..376379)
                     /codon_start=1
                     /locus_tag="cgR_0337"
                     /product="hypothetical protein"
                     /protein_id="BAF53301.1"
                     /transl_table=11
                     /translation="MRFKSVAAIALSTAVIMGGTASVANAQQVSPSSMIEIPQEFVQT
                     VQNFVPGMSYADAESAIQSTAGSVALNSTAGIILPIVLPFLGLGAAGSAVLSA"
     CDS             complement(376486..376761)
                     /codon_start=1
                     /locus_tag="cgR_0338"
                     /product="hypothetical protein"
                     /protein_id="BAF53302.1"
                     /transl_table=11
                     /translation="MDDAERYAEIFKVLGEPVRLRILSHLAAEGCTPTTVNELTEIMG
                     LSQPTISHHLKKMTDAGLLARIPEGRTVFHQVQPETFTSLRTILQIG"
     CDS             376815..377996
                     /codon_start=1
                     /locus_tag="cgR_0339"
                     /product="hypothetical protein"
                     /protein_id="BAF53303.1"
                     /transl_table=11
                     /translation="MDGRGHVRHYILTYIDIEGIFISTNINMIESWLMTLTKEHSTPR
                     AAGSMSFLDRWLAAWIFLAMAAGLLIGKVFPGIGALLSAVEIGGISIPIAIGLIVMMY
                     PTLAKVRYDKTKEITTDRTLMVVSIMLNWIVGPALMFSLAWLFLPDQPELRTGLIIVG
                     LARCIAMVLVWSDLACGDREATAVLVAINSVFQILMFGVLGWFYLQILPSWLGLDTTS
                     VTFSVVSIVTSVLVFLGMPLVAGVLSRVIGEKIKGRRWYEDTFLPKISPLALIGLLYT
                     IVLLFSLQGDEITAQPWTVARLALPLLMYFAGMFFISLVVSKLSGLTYERAASVSFTA
                     AGNNFDLAIAVSIGTFGATSPQALAGTIGPLIEVPVLVGLVYAMLWLGPKIFKKENAG
                     S"
     CDS             377993..378127
                     /codon_start=1
                     /locus_tag="cgR_0340"
                     /product="hypothetical protein"
                     /protein_id="BAF53304.1"
                     /transl_table=11
                     /translation="MKSVLFVCVGNGGKSQMAASLAQKYASDSVEIHSAGTKPAQGLN
                     "
     CDS             378128..378382
                     /codon_start=1
                     /locus_tag="cgR_0341"
                     /product="hypothetical protein"
                     /protein_id="BAF53305.1"
                     /transl_table=11
                     /translation="MSVESIAEVGADMSQGIPKAIDPELLRTVDRVVILGDDAQVDMP
                     ESAQGALERWSIEEPDAQGMERMRIVRDQIDNRVQALLAE"
     CDS             complement(378446..378766)
                     /codon_start=1
                     /locus_tag="cgR_0342"
                     /product="hypothetical protein"
                     /protein_id="BAF53306.1"
                     /transl_table=11
                     /translation="MTIPEIIVSILVILAGLFSLGTAIALWRAPDPLTRANLLGPTVG
                     VSIPLLIIALLIHTWSVDGFNPNNFIRAIIAIIGVWVIGSVGSYYMGRAIYGVTVVDN
                     RRSK"
     CDS             complement(378767..379039)
                     /codon_start=1
                     /locus_tag="cgR_0343"
                     /product="hypothetical protein"
                     /protein_id="BAF53307.1"
                     /transl_table=11
                     /translation="MTAFGIVTTVGICMFALSLLSALVLILRTKDFLTRVVLSDMVFY
                     SMIAIYLIWVLNNPTSIAFEIALLAAVLGGVLPTLSMARIISKGRR"
     CDS             complement(379046..379501)
                     /codon_start=1
                     /locus_tag="cgR_0344"
                     /product="hypothetical protein"
                     /protein_id="BAF53308.1"
                     /transl_table=11
                     /translation="MLNALKFIPWLIGQIFIAGFSVITAAVKKDTGFNPVVIRYPLRV
                     TTDFQIAALSTCITATPSTLSLGLREPRKPGDPTILLIQAVFGSDPVEVFESIADMEQ
                     RLVPSVASIDHGVPGQGPYKEIRPGDAEWPSSEIADTAQNTVSQDKREF"
     CDS             complement(379501..381033)
                     /codon_start=1
                     /locus_tag="cgR_0345"
                     /product="hypothetical protein"
                     /protein_id="BAF53309.1"
                     /transl_table=11
                     /translation="MAMDILLPIFVAVPLAASAIAVLLPWRLIRDILHIIVPFAGIFA
                     GIWLFAHTAEHGPIAHNVGLYVGGVAIPFAADTFSAIMLITTSIVAVAANWFATIVGE
                     TRARFYPALTLMLITGVNGALLTADLFNFFVFIEVMLLPSYGLIAMTGTWARLASGRI
                     FVLVNLSASTLLVAGVGIVYGVIGSVNIAALQDVVEGNPLVASAMGIVVIAIAVKAGV
                     FPVHTWLPRTYPGTSAAVMGLFSGLHTKVAVYMLYRIWVHIFDMDPTWNWLIVAFMVI
                     SMLVGGFAGLAENSIRRVLAYQMVNGMPFILIMMAFTSDDPQRALAAGLLYTLHHMIT
                     IAALVLTSGAIEETYGTGMLSKLSGLARREPVVAAVFAAGAFSVVGFPPFSGMWGKAL
                     ILLEIARVGNIAAWIAIAAIIIASLGALLSMIRVWREVFWGGTMHQRGVSPQLRISAA
                     KIAPALSLIILSVGMFIFAGLLIDATLTATDGLLNTDAYQQAVLGENAIGVPSPSYQG
                     GN"
     CDS             complement(381034..381417)
                     /codon_start=1
                     /locus_tag="cgR_0346"
                     /product="hypothetical protein"
                     /protein_id="BAF53310.1"
                     /transl_table=11
                     /translation="MILALTVAILFGGGVYLIQQRGMVRIVFGMSLIGHAANLTILYA
                     GVPTWRGEAFPDRTPLTDAADPLPQAFVLTAIVIAMATTTIMLALAALGRSDDTRSIE
                     PDDDQSPLTTSARSVTNPTDQEDRA"
     CDS             complement(381414..384308)
                     /codon_start=1
                     /locus_tag="cgR_0347"
                     /product="hypothetical protein"
                     /protein_id="BAF53311.1"
                     /transl_table=11
                     /translation="MSLLFVVALAVISVFLAPISVKVIDRKAGWPLAVIFAVAAYFLV
                     REAGPILDGQALTWDITWVRDILGSGVDVKFALRADALSLFFALLALVIGAVVFVYSA
                     EYLPRKKGNTSFYTIMTAFTAAILLLVLADDVFVLFVGWELVSLASFMLIARSGSSGE
                     SGSIRTLILTFFGGLTLLTAVAIAATQAGTTSLDGILHSDFWAEKPVLTGVIAVLIAM
                     SAFTKSAQFPFHFWLPEAMAAATPVSAFLHAAAAVKAGIYLLLRFSIVFHDVAVWNWL
                     LIIVGMGTAIMSAYFAVQKTDLKKLTAYSTVSHLGWIVATIGVGTPFALGAAIVHTLS
                     HALFKSSLFMLIGVIDHQTGTRDIRRLGFLVKQMPFTFVSVLIGALSMASVPPLLGFV
                     SKEGMITAFMDAPIGNSYVVLLLVGAAIGAVLTFTYSAKLVLGAFVDGPRDMSHVKEA
                     PVSLWLPAALPGLMSLPLVLVLSLFDAPLSAAATSAAGETAHMHLALWHGINTPLLIS
                     LGVLVAGILGVLFRKELWKIAETSPFPIATGNDILSMLVYRANLLGKFFGRMADSMSP
                     RRHLVSLIVLLWALAAFATIHPSVQLAPKQPGIDRWIDLIPLAIITLSVFGLVTTRNR
                     LSAAVLVGTVGVGVSFQMLLLGAPDVALTQFLVEGLVVVIIMMVVRHQPANFKRIKHS
                     RRRSTVLVAVLAAFAAFMAVWGLLGRHERSELAMWYLNQGPEITSGANVVNTILVEFR
                     ALDTLGELSVLGMAAVVIGAMVASMPRHPFAKGTHPRPFGQSQLNSIPLRMLLKVLVP
                     ALCFLSFIVFMRGHNDPGGGFIAALIAGGALMFLYLSKAKDGRIFRPNVPFILTGAGI
                     LMAVFSGVLGLTHGSFLYAIHFNFAGQHWTTSMIFDLGVYLAVLGMVSMAINGLGGYL
                     RPGTDIADLDYARRSGPLPATPTVEPEPEGDEDWPEPINPASDNKEEANR"
     CDS             384473..385948
                     /codon_start=1
                     /locus_tag="cgR_0348"
                     /product="hypothetical protein"
                     /protein_id="BAF53312.1"
                     /transl_table=11
                     /translation="MHTMSAAASRSRKILTALLLLVPLIAGTIYASAMGLDVSRAWSS
                     ADEVTGAPAASVATNNQELIEARRAAGEAGAQAGFLTSGTEELTSGTQELIDGAAPLE
                     EGVSAAADGAAQLHDGLIQLQAGTGQMGTGATEIADGVQNAVEQLGGLVVVQQQLLGA
                     LNEADKQLASSKIPEAEDLRKQITEVRGHLENFGISVEMTDQLDQLRSGTRDLANQLA
                     VPGYGFHDGIYSATNGAAELSAGLQELEAGVGTAVEGFTALDEGANRLDSMATLNEEK
                     TAAVQRALPVPQVPAGTIEGTADEERTSALAPMYAFLISALVMLAGAALGWATLKNKW
                     LMAFAVIGVTAIGGIILFTVALGMSVVALFGALGILLLATVVAGILSRVLLDVLGTTG
                     AIVVSVLGWVAQAAVIGHVWSVTAVSDIALVWRVVAGMMPLHYPTFAVTSIGNGGSAA
                     AIWMSVAVLLAMGVIGMVALRKPKAVETISTEEESHDEVEG"
     CDS             complement(385910..386671)
                     /codon_start=1
                     /locus_tag="cgR_0349"
                     /product="hypothetical protein"
                     /protein_id="BAF53313.1"
                     /transl_table=11
                     /translation="MDIVNEIIQKNGLVFAFACVGALMLVSNFISRKATKGRLHGSAI
                     AITLALVLAFFAGNYTGGTKGISDIAAFSGMAILGGSMLRDFAIVSTAYGVDVREIKR
                     AGAAGVIALFIGIFGSFAIGAIIAFAFGYRDPESLATVGAGAATYIVGPVTGTAIGAS
                     SEIIALSVAIGLVKSVLVMVGTPLAAKYIGLNNPKSAMAFGGLMGTTSGVAGGLAATD
                     QRLVPYGAMTATFYTGLGCLLAPSAFYFVMRLFFG"
     CDS             complement(386681..387121)
                     /codon_start=1
                     /locus_tag="cgR_0350"
                     /product="hypothetical protein"
                     /protein_id="BAF53314.1"
                     /transl_table=11
                     /translation="MILYGTAALAICMLIGQILGTFLGNLLGVDADIGGVGFAMVMLI
                     FVTSWLRKKGLMPEPTKQGILFWSSMYIPIVVGMSSIQNVAGAIDGGVMALVTGVVTA
                     VGCAGMVPILSKIGKPSEPLPPLHQEDAQLEVEKPLVSNSAEKN"
     CDS             387519..388280
                     /codon_start=1
                     /locus_tag="cgR_0351"
                     /product="hypothetical protein"
                     /protein_id="BAF53315.1"
                     /transl_table=11
                     /translation="MRLVERRGRGIELTAEGAALADAAIEALSVFQPALENLLGDRNL
                     RPVRLGTLRSIAGELGPLIGRSSLPTNVSITEGSSDDLLRLIERGEIDAAIIGPKPTD
                     TRFTWQFIRDQEIVLVVPKDHRLSHHDAVELKEVEGEHFVAMTNKYTTRDLADQLCAE
                     AGISPTISVESDSSYTLRTYVASGLGLCILPEIMADLDPNIATVQVRRPNGELATREI
                     GLVKMAGRPLPTQVNATLRMLLARPIKAFRRPPSQ"
     CDS             complement(388249..389175)
                     /codon_start=1
                     /locus_tag="cgR_0352"
                     /product="hypothetical protein"
                     /protein_id="BAF53316.1"
                     /transl_table=11
                     /translation="MVLTLLFGGQGSQKIGMLHSWLALEKVKECVTIASAVLGEDALL
                     IDREESLANTRGVQLSLLILQSGMALELQQRGLVPQFGAGHSLGAWSAAVAAGSLNFE
                     DAVRLVDIRARTMHDAAPGDYGMSAVIGLNRVALSKAVDSLRAEGEEIWLSNLNSAEQ
                     STVSGSHAALEKMEAIGAGLGARKIKRLKVAVPAHSELMSPARFAVAKAMEDITVESP
                     RYPLLANSSSRMIRTGPQVKNDLIEVIDQPVQWGPGIASLAERGVTDWIQVSPGNTLI
                     GLLRGLDTDYTGWCVDNVGVEETIAKVGVEKL"
     CDS             complement(389178..389807)
                     /codon_start=1
                     /locus_tag="cgR_0353"
                     /product="hypothetical protein"
                     /protein_id="BAF53317.1"
                     /transl_table=11
                     /translation="MVKTPRVHDLVCLHPDAIPQVVYQARTENNAWLENSGDKASWAV
                     VRRAHPTTSGHVAVGFRGSSRNQRWGTEIPAEYITAVTAPYEISSKVLPDGAAFQAFN
                     AFDEMPYKFGPGGSVGFELASGIQSTHPDSDLDLVIYADSPLSVQDIRTIRHFHQRAA
                     VFATVDILIETPLGGVAFSELERAMSYSPMPSMMLRTHQGPELSNIIWR"
     CDS             complement(389801..390568)
                     /codon_start=1
                     /locus_tag="cgR_0354"
                     /product="hypothetical protein"
                     /protein_id="BAF53318.1"
                     /transl_table=11
                     /translation="MTTTLNSAELGTTWFNTLSTQITSTEGSLRTGTMPLNGQTAAVA
                     AIVPDPESPFPRARHGEVGIKESLELAAWLKTLEDPKQPIILIIDVPSQAYGYFEELF
                     GINFALATSVNALAEARLDGHPLVSLIVGNAISGAFLATGLQSNRILMLDSDAVQVQV
                     MSKKAAARITQRSIEELDKAAESIPAMAFDGRSFVTLGAIHEVITDDSTTGVIRALER
                     ALSDISDKKIISRLQSAEAQKTRAQSILIRTAVNDQW"
     CDS             complement(390578..391705)
                     /codon_start=1
                     /locus_tag="cgR_0355"
                     /product="hypothetical protein"
                     /protein_id="BAF53319.1"
                     /transl_table=11
                     /translation="MQIINETFPATIPFQHDIHVGVVGSGDMEILISAPRNAGKTTVK
                     VATSVDGFDTVWRNVLKRFFGRNPLEADITINDFGATPGMAMLRLTQAFEQATSPQTI
                     EISDSSPFTELSARQRVQSLLDPGTFRELLDPFQEIQSPHLEPQGIVPQLDDGAVLGR
                     GTINGDSAIVVGLEGKFQGGGIGEVSGAKIAAALERALVDAKAGHNIRVVLLLETGGI
                     RLQEANLGLLAIAEIHSAIVELQRYTPVVCVVAGMVGCFGGMGIAAGLCDHIIMTREG
                     RLALNGPEVIETEAGVQELNASDRPAIWKMIGGEQRVATGRAEVLSDDTVESIRAAVV
                     AAPVMAYTYHRANNLDSFNAQLENLNPSARPTAEELRTVSV"
     CDS             complement(391692..392549)
                     /codon_start=1
                     /locus_tag="cgR_0356"
                     /product="hypothetical protein"
                     /protein_id="BAF53320.1"
                     /transl_table=11
                     /translation="MHNTVKVQQAPIGRLATQALLAEVNLPHKPGLVGPDGSRGHQDM
                     DIELMRKSAKVLEPTFSELAEAGKTIELGQELRDEIGKIGRRGEATMMNATGGVNTHR
                     GAIWNVGLLVTAASGLMTQEDQPFTAFSITQRAGSLASIPDSFIDSSPRPGATARKKY
                     KVGGAVSEAASGFPHVIAILQAMGFYAGNFTPSRELQIKGLITCMSSLDDTCILHRGG
                     AEALAFVHGWATDLLVESPPNEGLDVEKLSAFDQHLTNRNLSPGGSADLLAGALFLTS
                     IFGESHANH"
     CDS             complement(392555..393967)
                     /codon_start=1
                     /locus_tag="cgR_0357"
                     /product="hypothetical protein"
                     /protein_id="BAF53321.1"
                     /transl_table=11
                     /translation="MLFPSISRPEHLDLFEDGIASKVDFAFSGQQSARTAQLVEDGTM
                     QVGAIHTYLELYSRMFLDLAPRVSLVAAVSADKDGNLFTGPNTEDTPTISEATAYRSG
                     IVIAQVNEIVDSLPRVDIPGSWVDFVVEADKPFEVEALFTRDPRQLTDVHVLLAMLTI
                     RGVYEKHQVTSLNHGVGLDTAAIELLLPTYAERYGLKGKICTHWALNPHPNLIPAIET
                     GWVQRISAFGGEVGMSDYVAARPDIFATGPDGSLRSNRMAAQSAGLYATDMFVGSTLQ
                     IDPYGNSSTVTAGRLAGFGGAPNLGSDPRGRRHSSPAWLDMAQGEGQLGIQRGQKLVV
                     QIAETFNAGSDPKFVEQLDAVAVGKKAGMEIAPVMIYGDDVTHLVSEEGVAYLYKAQS
                     LEERRLAVSAISGVSPLGGIANADDIAELRRNGLVGFPEDIGVNPSEASRTLLAAHSM
                     ESLVEWSGGLYEPPAKFKSR"
     CDS             393968..394081
                     /codon_start=1
                     /locus_tag="cgR_0358"
                     /product="hypothetical protein"
                     /protein_id="BAF53322.1"
                     /transl_table=11
                     /translation="MQIMDAFWIDPGQRSREEICLFLIVAFERYAITWLDE"
     CDS             complement(394298..394966)
                     /codon_start=1
                     /locus_tag="cgR_0359"
                     /product="hypothetical protein"
                     /protein_id="BAF53323.1"
                     /transl_table=11
                     /translation="MSKILLAEDDAGIADFIVRGLIREGFECEITESGAEAFARAHSG
                     DFDLMVLDLGLPHMDGTDILEQLRNLQVTLPIIVLTARTNIEDRLRTLEGGADDYMPK
                     PFQFAELLARIKLRLAKHTAQESPTDARVLRNGDVELDLRTQRVLIDGSWHDLSRREV
                     DLLETLMRHPGQILSRAQLLRLVWDMDWDPGSNVVDVYVRALRKKIGAHRIETVRGSG
                     YRLR"
     CDS             complement(394944..396413)
                     /codon_start=1
                     /locus_tag="cgR_0360"
                     /product="hypothetical protein"
                     /protein_id="BAF53324.1"
                     /transl_table=11
                     /translation="MAKSTPLSASLRWRIVLWMTAVVFLTLASVVIITRSVLLSEVTN
                     TANSAVEQEIEEFRRFAAEGIDPTTAQPFESGHRLMEVYLSRQIPDENEAIVGIFPGE
                     LIQVDYSQLSGAHPLPLEHSDPLISEIRQTTLNSGVFSDLERGTTHWGKVNFQTASGE
                     ADGEFVVAFFADNLKDQVNGQIQILILIGTGGLIASILIAWLIAGQIIAPIRKLSSVS
                     AKISNSDLTWRVPVEGRDEIAQLARTFNAMLDRIEIAYNDQRQFVDDAGHELRTPITV
                     VRGQLELLATTPPEEQARSIELATTELDRMSRMVNDLLTLAVADSGTFIHAHPTDVTD
                     LTIDIEDKARTISDRILLVDAAEGLVSLDEQRVTEAVLELFGNALRYSDDVVELGSDF
                     RGSGPDRVFRIWVRDKGNGVDMDEQEALFDRFSRGSQKNSRRPGGAGLGLSIVKAIGE
                     AHGGRAFVNSTPGLGSIFGLEIPAPQQSKEYTHEQDPAR"
     CDS             complement(396440..396760)
                     /codon_start=1
                     /locus_tag="cgR_0361"
                     /product="hypothetical protein"
                     /protein_id="BAF53325.1"
                     /transl_table=11
                     /translation="MKSLPRFTPLITILALLVLVAIGGSALANNRATPNVGSEPATVN
                     QRSTPTTSAYEPPATEAPEEPTTQIQESPVQPPIPAPAQIPQAPQVPLNYQYYDDDWD
                     DDDD"
     CDS             complement(396757..396975)
                     /codon_start=1
                     /locus_tag="cgR_6015"
                     /product="hypothetical protein"
                     /protein_id="BAQ21077.1"
                     /transl_table=11
                     /translation="MFPPNSPTDHSMGIPLIKKSLNEPILMINPGNSLMIPPQTTTSR
                     TWSENSHLHFILVPNNGIQIELIKENPQ"
     CDS             396942..397562
                     /codon_start=1
                     /locus_tag="cgR_0362"
                     /product="hypothetical protein"
                     /protein_id="BAF53326.1"
                     /transl_table=11
                     /translation="MNDQLVSWVETLMTASVFYPVLSVVVLIDCILPLIPSETVLALA
                     GAWSGARGTPNLWLVISVATFAAILGDNLCYFFGTRLINMVNRIPGESRRGKALEWAR
                     KNLNERDVSTIIIARFIPWARWFVTIILGSVGYSWSRFIVWDSIGALIWATQATLLGY
                     VGGWLFQEQPLIGLVVGAALGIFFGFFLQWLNKMWERRRLAKVAAE"
     CDS             complement(397736..398653)
                     /codon_start=1
                     /locus_tag="cgR_0363"
                     /product="hypothetical protein"
                     /protein_id="BAF53327.1"
                     /transl_table=11
                     /translation="MNKVSTIAKTLTFSSAALLGAGIATAAWGYSELKKFELKTVELP
                     ILKPGTLRGKKEFRLLHISDLHMIPGQETKKAWVSALDSLSPDLVINTGDNLSDEKAV
                     PDVLRALGPLMNRPGAFVFGTNDYWAPRPVNPFGYLFGKKREVSHIDLPWRAMRAAFI
                     EHGWQDANQKRLEFQVGSVRLAISGVDDPHHDLDDFSEIAGAPNVDADLSIALLHAPE
                     PRVLAQFEADGYQLSLSGHTHGGQLCLPGSKPIVTNCGIDRTRATGLNKFGDMWMHVS
                     NGLGTSKYVPFRIFCRPSATLIKITEQAL"
     CDS             398681..399136
                     /codon_start=1
                     /locus_tag="cgR_0364"
                     /product="hypothetical protein"
                     /protein_id="BAF53328.1"
                     /transl_table=11
                     /translation="MSELKDKIRADLTTAMKARDKDTTGTLRMLLSALTQEETSGTKH
                     ELNDEEVLKVIAREIKKRRESAEVYTENGRQELADVELKEAAILEGYQPEQLDDDQLN
                     ALIDEAIAEVGGEADMKKMGQIMKAATAKAAGRADGKRLSTAVKSRLSN"
     CDS             complement(399143..401530)
                     /codon_start=1
                     /locus_tag="cgR_0365"
                     /product="hypothetical protein"
                     /protein_id="BAF53329.1"
                     /transl_table=11
                     /translation="MSTTNSLTKLVASTVAAGVLGALALVPFASLSGVAVARTNDTMQ
                     TNLSDLTDGRGPGVTTITDSTDQPIAYIYAQRRFEVGGDQISTSMKDAIVSIEDRRFY
                     EHDGVDLQGFGRAILTNLVAGGVEQGASTINQQYVKNFLLLVEADDEAEQAAAVETSI
                     PRKLREMKMASDLEKTLSKDEILTRYLNIVPFGNGAYGVEAAARTYFGTSAAELTIPQ
                     SAMLAGIVQSSSYLNPYTNHDAVFERRNTVLGAMADAGAISPEEASAFQQEPLGVLET
                     PQGLSNGCIGAGDRGFFCDYALQYLSEQGITQDMLAKDSYTIKLTLDPDVQDAAHNAV
                     SSHVDPTTPGVAEVVNVIEPGENSRDILAITSSRNYGLDLDAGETMLPQATSRVGNGA
                     GSIFKIFTAAAAIQQGAGLDTMLDVPSRYEVKGMGSGGAANCPANTYCVENAGSYAPR
                     MTLQDALAQSPNTAFVEMIEQVGVDTVVDLSVKLGLRSYTDEGSFDGESSIADYMKDN
                     NLGSYTLGPTAVNPLELSNVAATIASGGMWCEPNPIASVHDREGNEVYIDRPACERAI
                     DAETASALAVGMSKDTVSGTAASAASMYGWSLPTAAKTGTTESNQSSSFMGFNSNFAA
                     APYIYNDGTSTTPLCSGPVRQCSSGNLFGGNEPAQTWFNMASNVPAASQGTLPSSSDS
                     FRLGTSGELLNQVVGQSEASARRTLEAKGYKVTTRSVSGAGSARGTVVSATPQGAVLI
                     DGGTVILNISDGTSPAPAATNNDDSDDGDTPAPSTNNRGTTIEDAINDAINQFFR"
     CDS             402219..402779
                     /codon_start=1
                     /locus_tag="cgR_0366"
                     /product="hypothetical protein"
                     /protein_id="BAF53330.1"
                     /transl_table=11
                     /translation="MTSVIPEQRNNPFYRDSATIASSDHTERGEWVTQAKCRNGDPDA
                     LFVRGAAQRRAAAICRHCPVAMQCCADALDNKVEFGVWGGLTERQRRALLRKNPHITN
                     WAEYLAQGGRDRRGLVNFKGWPLTWSAFLIQGAPQRTPAHHRRTPAHPSAHQPSTRAN
                     ASVRHASKGASKKHAPEALEMRSPVG"
     CDS             402776..402940
                     /codon_start=1
                     /locus_tag="cgR_0367"
                     /product="hypothetical protein"
                     /protein_id="BAF53331.1"
                     /transl_table=11
                     /translation="MIAMTKWEYATVPLITHATKQILDTWGEDGWELVSVMPGMNPEN
                     LVAYMKREVA"
     CDS             402946..403407
                     /codon_start=1
                     /locus_tag="cgR_0368"
                     /product="hypothetical protein"
                     /protein_id="BAF53332.1"
                     /transl_table=11
                     /translation="MASNSERLAELGISLPSVAAPVAAYVPAIQTGNQVWTSGQLPFV
                     DGQLPATGKVGAEVSAEDAEKLARAAALNALAAIDALVGIDKVTRVLKIVGFVASADD
                     FSGQPAVVNGASNLMGEVFGEAGAHARSAVGVAELPLNSPVEVEVIVEIAQ"
     CDS             complement(403483..404838)
                     /codon_start=1
                     /locus_tag="cgR_0369"
                     /product="hypothetical protein"
                     /protein_id="BAF53333.1"
                     /transl_table=11
                     /translation="MTTSSTASPIAELQNLSPKQRKSESRRAIISSYLGSTIEFYDFL
                     LYAAASATVFPAVFFTNLDPLAGTIAAYGTFAAGYLARPLGGAIFGHFGDRLGRKKML
                     VLSMLIMGVASTCIGLVPSAEMIGSMGAVILIMLRICQGIAVGGEWGGAALMALEHSD
                     SKKRGFAASFTNAGAPTGAALGTFALGTASAVLTQEQFLSWGWRIPFLLSFVLLIVGL
                     VIRAKVSESPLFAAAAAAEKAKPTERKVPLLQVLRRPKALILTMLGGASGFGLQVLLS
                     TFSISYATQSGIERSSVLYAFAVASVFSVFFVILFGRVSDLFGRRPVMIIALVLFVAY
                     LPAFFRMLTSDNWFILLSAFTIALALHAMLYGPLAAFISEQFGTSARYTGASLGYQLA
                     TLIGAGFTPTILASLYAGPGGGTSVTPVIVFLATMSLVSIIAIAITRESKDHDLSTYE
                     H"
     CDS             complement(404877..406415)
                     /codon_start=1
                     /locus_tag="cgR_0370"
                     /product="hypothetical protein"
                     /protein_id="BAF53334.1"
                     /transl_table=11
                     /translation="MKVNLGIGSYPRRRATVRPESTAIEFEGTSITYGEFSKRINRLG
                     HALLDLGVVHQDRVAYVGFNHPALLEVFFSTNLIGATPVLVNPRLSANEIDYIIQDSG
                     ASIVFYGIDLIEHATYLQELHPEIIMVAVEGDEGPGLRRKALIEAASDADIDLEVSDD
                     DIALLMYTSGTTGRPKGAMLSHRNLFFNYFNALLSQEIEQGAVLLSTAPLFHIAGLNM
                     TTIPVMMKGGKVIIHREFRAEHVLDEIERSKVSESFMVPAMIDMLSNHPSFAERDLSS
                     LRAIMVGGSPLSERALRIWQGRDVKIVQGFGMTETAPGACLLEATDTSTHLGTAGRAH
                     FFTDIKLVDPKTGEEVPTGEAGEVLIRGPHVMTGYWNRPEDTASALQNGWYHSGDIAI
                     KDADGYYTIKDRIKDMYISGGENIYPAEVEQALQELEAVLDAAVIGVPDERWGETGIA
                     FVSLRESHLANPPTGPELRELLGSVLARYKLPREIHIIEELPRNATGKIQKNILRDFT
                     IPVS"
     CDS             complement(406663..407190)
                     /codon_start=1
                     /locus_tag="cgR_0371"
                     /product="hypothetical protein"
                     /protein_id="BAF53335.1"
                     /transl_table=11
                     /translation="MHVQMIEDRNYFSASSHGATMTTSNPTAEIIGGPERFLEAELSQ
                     QIQFLTARARAKGSAKGNEALVDLGLKVRQYSTLSLAASGLKPTQRELGAFLDLDPSQ
                     IVALVDFLEKRGLVVREVDPRDRRSKIIVATEEGLAVHDEATKRLLIAEGESLKNLTS
                     DEQEQLRELLLKIAF"
     CDS             407321..408256
                     /codon_start=1
                     /locus_tag="cgR_0372"
                     /product="hypothetical protein"
                     /protein_id="BAF53336.1"
                     /transl_table=11
                     /translation="MSLNGKVAIVTGSGAGLGRSFAQELARQGASVIVNDVNQAAADE
                     TVAAITEAGGKAAAVIAPVGPSESAALLVREAVDKFGSLDILVTNAGILRDRSLLKMT
                     DDDFDAVINVHLKGTFTCVREAFGYFKENGIAGRIVTIGSPTGQRGNFGQSNYAAAKA
                     GIVGMVRTWALEMKRAGVTINAIIPEAATDMTKTVPYFQKAVEADERGEAMPAFFRET
                     LGFGTPQDVAGLVAFLSSDEAANISGQAIGAGGDRMQVWKHPEPAVTEFNPGGWTYEA
                     LQERGKNIIEDNLQSVGVVFPELPAELQPQIPVKA"
     CDS             408287..409231
                     /codon_start=1
                     /locus_tag="cgR_0373"
                     /product="hypothetical protein"
                     /protein_id="BAF53337.1"
                     /transl_table=11
                     /translation="MSNNVVKYECAVDADNIVAVDMHVHLEVDSCGHESMPADIMEAS
                     SKYFKAAERTPSADAIADIYREHKMAAVVFTIDARTQMGHLPNSIDDLVASCARNNDV
                     LIPFGSVDPRTGEDALVEARRQVEELGVRGFKFHPSVQGFDPSAPEFYPLWELLESFG
                     LPCVFHTGQNGMGAGLPGGRGIKLRFSNPLLLDDIAADFPNLTIIMAHPSVPWQDEAN
                     SIATHKANVFIDLSGWSPKYFPESLVRQSNNVLSKKVLFGTDFPLITPEKWLAAFANL
                     PLKDEVRPGILKDNAVKVLGLAASTERGSQAEKAVQHA"
     CDS             409224..410420
                     /codon_start=1
                     /locus_tag="cgR_0374"
                     /product="hypothetical protein"
                     /protein_id="BAF53338.1"
                     /transl_table=11
                     /translation="MRDPIQGAVIPSDLFGFAEVLTEAERAVLLETRRVLEEEVKPYI
                     NEAWDKAVFPNAIMQPLQDLQLLDPPALREAGESVRDIFTGFRNFELARCDINVGTYY
                     NASAGLFRTACMVGGSPEQAQRLDAQIKSGEVKGVFALTEPDHGSDIAGGLATTATKD
                     ADTGEWIINGEKRWIGGASTADLIATFARDTADNQVKCFLVAPQAEGVSMEIIDRKAS
                     LRIMQNAHITYNNVRVSEDARLHNINSFKDVSECLRRMRSDVAWMAVGAQAGAYEAAV
                     KYVRSREQFGRPIAGFQLIQEKLALMLGNLTASLGMMVKLTEQQQAGIFKEENSALAK
                     MFTSLKLRETASWAREICGGNGIILDNDVARFHADAEAVYSYEGTHEINALIVGRAIT
                     GVSAFI"
     CDS             410442..410915
                     /codon_start=1
                     /locus_tag="cgR_0375"
                     /product="hypothetical protein"
                     /protein_id="BAF53339.1"
                     /transl_table=11
                     /translation="MTTSTTPNTIISFEDAPTLTGQDLGFSQWRTVTQEMVNTFADAT
                     DDQQWIHTDPERAKDGPFGGAIAHGFLTLSMIIPFWGELLDVTGVTTKVNYGLDKVRF
                     TSPVKVGSRIRMGAVVREISEVKGNGLHLVADGTIEIEGQERPAVVATFLTRFYA"
     CDS             411012..411857
                     /codon_start=1
                     /locus_tag="cgR_0376"
                     /product="hypothetical protein"
                     /protein_id="BAF53340.1"
                     /transl_table=11
                     /translation="MTKLERMEHPAYSQLRPVTPSASVVLCPNPGYSSLEGTNSWVIR
                     APEDPRSIVIDPGPEDEGHLNVLHSKAEEVGLILLTHRHYDHADGAQRFRQLTNAPVR
                     AMDPTYCAGAEEIHDGEIITIDGVTPQIEVVATPGHTRDSVSYFIWSGVPHESTLEGI
                     VSGDTIAGRHTTMISETDGDLGEYLNSLAILEERGKDIPLLPGHGPDGQDVSSFARKY
                     IERRELRLNQIREVWETRGRDVSMKDLIDAIYDDVDPVLRGAAEQSTHVAIRYLQAQE
                     ASASN"
     CDS             complement(411933..412616)
                     /codon_start=1
                     /locus_tag="cgR_0377"
                     /product="hypothetical protein"
                     /protein_id="BAF53341.1"
                     /transl_table=11
                     /translation="MEGVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEG
                     EPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEV
                     HAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQL
                     ANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVD
                     TEHLARRAR"
     CDS             complement(412878..413063)
                     /codon_start=1
                     /locus_tag="cgR_0378"
                     /product="hypothetical protein"
                     /protein_id="BAF53342.1"
                     /transl_table=11
                     /translation="MTGLLVVIIPLLLMLFAFAMERIESSFLHSNTPQSTEVKLAKDA
                     IGAENLNDDDVQEASAA"
     CDS             413109..413891
                     /codon_start=1
                     /locus_tag="cgR_0379"
                     /product="hypothetical protein"
                     /protein_id="BAF53343.1"
                     /transl_table=11
                     /translation="MGSITPQKRPRVGSHIANKGQETDIGRKRRARRINRTLTVAYPD
                     AHCELDFTNPLELTVATILSAQCTDVRVNQVTPALFKRYPTAADYANADRTELEEFIR
                     PTGFYRNKATSLIGLGEALISLHDGQVPGTLEQLVELPGVGRKTANVVLGNAFGVPGI
                     TVDTHFGRLVRRLKLTDEEDPVKVEKVMNELIEKPEWTMFSHRLIFHGRRICHSRRAA
                     CGACMLAADCPSFGLEGPSDPFEAQKLIKSDDREHLLKMAGM"
     CDS             413899..414459
                     /codon_start=1
                     /locus_tag="cgR_0380"
                     /product="hypothetical protein"
                     /protein_id="BAF53344.1"
                     /transl_table=11
                     /translation="MTSSAKWSIVGVVAILAVIVALIPQLVGGESAEEAQGETSTSKI
                     TTRPDCVASGAAGVDLPCLGGANGVGNELATVVNLWAWWCEPCRAELPIFDEFATTHP
                     ELNVIGVHADQNAANGAALLEDLGVNLASYQDDSNLFAGALGLPGVVPITIVVSPDGN
                     VVDTFPQPFETIDDLETAVAGALQNA"
     CDS             414452..415195
                     /codon_start=1
                     /locus_tag="cgR_0381"
                     /product="hypothetical protein"
                     /protein_id="BAF53345.1"
                     /transl_table=11
                     /translation="MRNYPDLPHDFPGQNTELTPAKAPVWMHRLIDRIHAGHMANPLD
                     GAEPLGDTDSEKRAAVLMLFSGSETSFDLPNDASVLLTHRTPTMRSHAGQIAFPGGRI
                     DTTDTNAVDCAFREAWEETGLDRRTATPLAQLNEVHIRATGYPVYPILGHWHTPSPVA
                     VASPHETDEVFDAPLYDLIDPKNRLMVGWREWHGPAFRINDYIIWGFTGGLLSAILDT
                     AGWATEWDTDRIFDLENTLSTSRNNERMR"
     CDS             415286..416482
                     /codon_start=1
                     /locus_tag="cgR_0382"
                     /product="hypothetical protein"
                     /protein_id="BAF53346.1"
                     /transl_table=11
                     /translation="MLSPSLVVDAVIVLVMAFALWGGWRQGAFTSLLSTVGVVSGLVV
                     GAAAAPFVMGLTDSTALRFLLAIGTVVLLVGLGNLIGAHLGAAIRDNIKFRSSRTLDS
                     GLGAIFQVLATLIVVWLVAIPLATGLPGTVASGIRDSRILGFVDKYTPQGLDTLPSKI
                     AAMLSESGLPPLISPFTGGSSVEVDAPEINVTNVDLVEAMRPSVIHVMGDAQECSRRL
                     MGSGFVASPDYVVTNAHVVAGTSTVSLDTMIGTRSAEVVFYDPNLDIAVLYSPDLGLD
                     PLPWASTPLDTGDEAIVMGFPQSGPFNASPARVRERIMITGSNIYANGQHEREAYSVR
                     GSIQSGNSGGPMANEMGEVVGVVFGAAIDGSDTGYVLTAEEVQERIGDITSLTQPVDT
                     MQCAVS"
     CDS             complement(417049..418044)
                     /codon_start=1
                     /locus_tag="cgR_0383"
                     /product="hypothetical protein"
                     /protein_id="BAF53347.1"
                     /transl_table=11
                     /translation="MAFFSFSTSPLTRLIPGSRSKATGAKRRLNSTIASIERSPGIIA
                     LDGPFTHDHVSVRGIRLHLAEAGSPTKPLVLLIHGAFGGWYDYREVIGPLADAGFHVA
                     AIDLRGYGMSDKPPTGYDLRHAAGELSSVIAALGHDDAFLVGSDTGASIAWAIASMYP
                     ERVRGLISLGAIHPLDMRRAIRRKPHLHVSDLSRLAPFRLPSFLHNLFQFGITRAARR
                     EIVNNTSSSYQRSNAFTEAVLLRKKALSIDHTITPIIRTNRYLVGSIPSKTVSAPVWL
                     LRTNSRRWEHLANTARTRTTGPFTTIAIPGGYELPYLENPSEFAATIAEFARTTF"
     CDS             complement(418059..418610)
                     /codon_start=1
                     /locus_tag="cgR_0384"
                     /product="hypothetical protein"
                     /protein_id="BAF53348.1"
                     /transl_table=11
                     /translation="MSNKDGLFTDGSSTFAPKVDSIPLSDVDTSVSGEASIGTLISNA
                     TSQMSSLFRAEVELAKTELAGEAKKAAIGGGAFSVAGVIALYSSFFFFFFVAALLSEW
                     IKPWAAFLIVFLFMLVIAAALALFGWRKVKKMGAPKNTIQSVNQLKNLVPGQASEKLE
                     KANKRGLYTSASFHSPGAITGDH"
     CDS             complement(418775..419752)
                     /codon_start=1
                     /locus_tag="cgR_0385"
                     /product="hypothetical protein"
                     /protein_id="BAF53349.1"
                     /transl_table=11
                     /translation="MWQMTLPARLLHSQCATPARHFNLIGNFSFSLSLGKLPKSAKLC
                     GVKHPDPAQKVEGTTATTPTKVAAFFDLDKTIIAMSSTYAYGREFMNSGLISPVEALQ
                     LSLAQATYMFAGHTSEQMDNTRDQLTAMIHGWEVQQVRSIAEETMHSVVTPTIYAEAR
                     ELIEHHQELGHDVIIISASVKELVEPIARELGVHKTVTTVLEAHDGMYTGEVLFYCKG
                     DAKAQSILDLAEANNYDLSLSFAYSDSFTDLPMLEAVGNPAAVNPDRALKKIALEQGW
                     KILSFKNPEPLFQMPSTRDVGIGTGVVAGIAAVAAGSIWWMKRARRGSA"
     CDS             420097..421158
                     /codon_start=1
                     /locus_tag="cgR_0386"
                     /product="hypothetical protein"
                     /protein_id="BAF53350.1"
                     /transl_table=11
                     /translation="MNTTTHQAILIAVEDPVLHPEAMHVAAATGRPVIETTNLMDISR
                     HFHRASAVLIDTSMASQLSPGKRRDRVFLLDSDPGPSDWKTAMKIHAEQAMLLPAQAG
                     ELLSALGRDDKQLPVASGHVIGVAGVVGGTGASTFAAALAKRRAESATTVLIDADPSS
                     GGIDLLLGIEDVPGARWPDVGLRRGTVQAADVLKALPSTPDEVVVLSTARSNVLDPFA
                     LSESDVSAAIDCFLSADRSVDVVVDLPHARVHPDIAERLSHLVLVIPAEVRAVAAARA
                     RYMELQQLHVSITCVLRHRGWSGLDVAEVEEILGADITAEVGSIQRLAKSVEMHGLTG
                     SLPRVLSSACDAVIGEVAA"
     CDS             421155..422288
                     /codon_start=1
                     /locus_tag="cgR_0387"
                     /product="hypothetical protein"
                     /protein_id="BAF53351.1"
                     /transl_table=11
                     /translation="MTDIDLVVENVQRIIATKATPPTSAEIASLIREQAGVISNEDIV
                     MVLRRLRSDSVGVGPLESLLALPGVTDVLVNAHDSVWIDRGQGVEKVDMDLGSEEAVR
                     RLATRLALTCGRRLDDAQPFADGRITRDDGSVLRIHAVLAPLAESGTCISVRVLRQAR
                     LSLDDLINSGTVPEDIAPALRNIINQRRSFLVVGGTGTGKTTLLSAMLTEVPADQRII
                     CIEDTAELHPGHPSIINLVSRQANVEGAGAVSMADLLKQSLRMRPDRIVVGEIRGAEV
                     VDLLAAMNTGHDGGAGTIHANSISEVPARMEALAATGGLDRMALHSQLAAAVDIVLVM
                     KHTPFGRRLAQLGVLCGNPVTTQVVWDLDHGMHEGSEEAWFMP"
     CDS             422273..423049
                     /codon_start=1
                     /locus_tag="cgR_0388"
                     /product="hypothetical protein"
                     /protein_id="BAF53352.1"
                     /transl_table=11
                     /translation="MVYALGLLSVAVLISGSRGPGARTRPPTPGNGVHLFALIALFCL
                     ATVLFIVVDAYTMIAGIIIATTLFWYLRQTHAAAQRTKQSLQLASFLSLCAGNLRAGV
                     TMVDAMDYALDNTTPDKFLSPTLQTAARQARSGGSGPRVLIDASLPDLQRLGHLWETS
                     ERHGIPLVALIDQMRSRISSKQRHGESTRAALQGPQATAVILTVLPLAGLLMGTAMGA
                     NPLGILTGGGIGGLLLVIGVGLDAAGFVVTHKILQSASPS"
     CDS             423046..423621
                     /codon_start=1
                     /locus_tag="cgR_0389"
                     /product="hypothetical protein"
                     /protein_id="BAF53353.1"
                     /transl_table=11
                     /translation="MITALVIAAVAMFLGSPNPGVRGGLISPKSGKSLRIRAGPKKLG
                     NADPVDVSADIELFSACLDAGLNTRDAAQVVAHVAAKTHRELWTHVVALLSIGVSAPQ
                     AFALMAGVDGLDELANLATVSHRSGSALSDGCRNISTSLLASAGDKRTAAAERAGVFI
                     AMPLALCFLPAFMIVGLAPVVLSLGTQLINF"
     CDS             423645..423845
                     /codon_start=1
                     /locus_tag="cgR_0390"
                     /product="hypothetical protein"
                     /protein_id="BAF53354.1"
                     /transl_table=11
                     /translation="MSNNLELLRLRTRAILAQDDGLTTVEYALGTLAAAALAAVLYMV
                     VNSDAVSSAFESIISDALSARP"
     CDS             423849..424169
                     /codon_start=1
                     /locus_tag="cgR_0391"
                     /product="hypothetical protein"
                     /protein_id="BAF53355.1"
                     /transl_table=11
                     /translation="MRTKQQREPPELCSDDGSVSIEAALALSSLVIVCGLIIAAMATL
                     AAYLAAVDAAGAAARAHAIGESFEPARGHVDMHEAGGMLTATATIPAPIGQVSASAVF
                     PVEN"
     CDS             424144..424491
                     /codon_start=1
                     /locus_tag="cgR_0392"
                     /product="hypothetical protein"
                     /protein_id="BAF53356.1"
                     /transl_table=11
                     /translation="MRCSRWKTSCANDEGYMTIASAGVASILISLLVVLAWQAGNLVA
                     REQAQVAADVSAVAGAYAFARGELPDAACATAKHTAEANNAQLENCATEGEDLTLTVT
                     VRGQEAHAKAGPL"
     CDS             complement(424486..426843)
                     /codon_start=1
                     /locus_tag="cgR_0393"
                     /product="hypothetical protein"
                     /protein_id="BAF53357.1"
                     /transl_table=11
                     /translation="MRPSFGEELAAIVSKRYSESTLTHMVTLPASKAKYVDWPSWVPA
                     SLRDALVNRGINKLFSHQEQTAHLAWNGQHVVVATGTSSGKSLGYQLPILSALGTDPT
                     ACALYLTPTKALGSDQLTSTSTLLRDIPDFHPINPAPYDGDTPSEARSGIRDLSRFVF
                     TNPDMVHASMLANHSRWARLLRHLKFIVIDECHAYRGVFGANVSMVLRRLLRLAAFYG
                     SHPTVILASATSSDPEIHASRLLGAPVKAVTEDGAPTGERTVLLWEPGFIEGAEGENG
                     APVRRAASTEAANIMATLISEGARTLTFVRSRRQAEIVALRAQEELSTLGRPDFARRV
                     ASYRAGYLAEDRRRLERLLDDGTLLGVASTNALELGIDVGGLDAVVTAGFPGTVASFW
                     QQAGRAGRRGQGSLVVLVARDEPMDTYLVHHPAALLEKPVEAAVFDPTNPHVIRGHVY
                     CAAVEKPLTEVEVAAFGAQKVVEKLEIEGLLRKRPRGWFAVEKPMSEDPDELIPDSAH
                     QQVSLRGGSGSEFMIVDISDGRLLGTIDSAKAMSQTHPGAVYLHQGESFVIDELDLEE
                     NLALARPELPDYTTYARSDTDIRITSAPLEDEVFDAGGGLWVANVEVQVTDRVTGYVT
                     RLSDGTTLDATPLYLPPQILQTRAVAYTIDPLALEAMGIPAADIPGALHAAEHAAIGM
                     LPLLATCDRWDIGGVSTALHADTGYPTVFVYDGMDGGAGFADTGFRRFAQWIEATFEV
                     VRSCSCESGCPSCVQSPKCGNGNNPLDKAGAIKLLGAMVTLLGTS"
     CDS             427160..427363
                     /codon_start=1
                     /locus_tag="cgR_0394"
                     /product="hypothetical protein"
                     /protein_id="BAF53358.1"
                     /transl_table=11
                     /translation="MAQGTVKWFNPEKGFGFIAPSDGSADVFVHYSEIQGNGFRTLEE
                     NQLVEFEIGEGAKGLQAQAVRAI"
     CDS             428027..431041
                     /codon_start=1
                     /locus_tag="cgR_0395"
                     /product="hypothetical protein"
                     /protein_id="BAF53359.1"
                     /transl_table=11
                     /translation="MADTAGTTGTAGSKKKYLVIVESATKAKKIQPYLGNDYIVEASV
                     GHIRDLPRGAADIPAKYKKEPWARLGVDTDRGFAPLYVVSPDKKKKVADLKAKLKLVD
                     ELLLATDPDREGEAIAWHLLEVLKPTVPVRRMVFNEITKPAILAAAENTRELDENLVD
                     AQETRRILDRLYGYEVSPVLWKKVMPRLSAGRVQSVATRVIVERERERMAFVSADYWD
                     LSAEFNAGESGKADSDNPSSFTARLSTIDGNRVAQGRDFNDRGELTSEAVVVDKQRAE
                     ALAEALEGQEMAVVGVEEKPYTRRPYAPFMTSTLQQESGRKLHYTSERTMRIAQRLYE
                     NGHITYMRTDSTSLSEQGMKAARDQALELYGAEYVSPSPRTYDRKVKNSQEAHEAIRP
                     AGETFATPGQLHGQLDAEEFKLYELIWQRTVASQMADAKGTSMKVTIGGTAKTGEKTE
                     FNATGRTLTFPGFLRAYVETTRTADGRDVADNAEKRLPLLSEGDLLKVLGIEADGHST
                     NPPARYTEASLVKKMEDLGIGRPSTYASIIKTIQDRGYVYSRGNALVPSWVAFAVVGL
                     LEANFTSLVDYDFTSSMEDELDNIAAGREGRTEWLNGFYFGDAEADQSMAESVARQGG
                     LKALVDANLEHIDARSVNSLKLFDDAEGRAVNVRVGRYGPYIERIVGTTAEGEPEFQR
                     ANLPEETTPDELTLEVAEKLFATPQGGRELGINPANGRMVVAKEGRFGPYVIEQVTDS
                     ERAGAEAQAEEVVAAERKAEDEQRAADGMRPKNWETKTAANQKEKRINQLVEENLKPA
                     TASLFSGMEPATVTLEEALKLLSLPREVGVDPSDNEVITAQNGRYGPYLKKGSDSRSL
                     NSEEQIFTVTLDEARRIYAEPKRRGRAAAQPPLKQLGDNDVSGKPMTVKDGRFGPYVT
                     DGTTNASLRKGDVPESLTDARANELLSERRAKEAADGGAPAKKTSTKKTAAKKTTAKK
                     TTAKKTTAKKTVRKAPPKTTKNVVKAGARKKS"
     CDS             431045..431758
                     /codon_start=1
                     /locus_tag="cgR_0396"
                     /product="hypothetical protein"
                     /protein_id="BAF53360.1"
                     /transl_table=11
                     /translation="MLNGFVTKTRQGASALVKAVSKSVSEPERAAYVAAAGAHVCASL
                     MGVSKVKTLSKPALMPLLAGRVLRSSCAPLEKGLGLVGLAGGWAGDLVLMKPDSLPKG
                     AAGFAINHAAYIALLLRGGARPSAVRAGIRAVPLLGAAGFAAIREPKMLPIVLGYGGL
                     LATTSMLADDSKLHDSSNLASFGMGHGGNLFLISDAVLFARELFLEDGTVAAQLADGA
                     VMGTYTIAQLLLVDGLFSD"
     CDS             complement(431833..433338)
                     /codon_start=1
                     /locus_tag="cgR_0397"
                     /product="hypothetical protein"
                     /protein_id="BAF53361.1"
                     /transl_table=11
                     /translation="MKWLWGTSWPLYAATVLGTNVFGALAVMLFVRFLIPQPDASNFN
                     AEISYLPAVGFAYLAFAIVAGMLVTFLMFRPVLDWQRSPEDHDRNMVRNLVMRIPIYQ
                     AILCAVVWLIGIAIATLISASVSTSLALVVAFSTLMAAAIVVLLTFLEAERLVRPVAA
                     SALARRFEDSTLEPPVSQRLRMTWLLTLGIPVMGILLLIWGYSQGIFGSDASGIMPAI
                     AALAFASLVTGYLGNRLVVSSVVDPIRELQEAINRVRRGENDVQVDIYDGSEIGVLQA
                     GFNEMMRGLRERQRVRDLFGRYVGAEVAKRALEERPTLGGEDRKVAVLFVDVIGSTTF
                     AVNHTPEEVVEALNEFFEHVVEVVHRNKGVINKFQGDAALAIFGAPLPLSDATGHALA
                     AARELRAELKDLQLKAGIGVAAGHVVAGHIGGHARFEYTVIGDAVNQAARLTEIAKTT
                     PGRTVTNASTLREANEAEQARWTLMKSVELRGRGQMTQIARPIRPTLADRS"
     CDS             433424..434683
                     /codon_start=1
                     /locus_tag="cgR_0398"
                     /product="hypothetical protein"
                     /protein_id="BAF53362.1"
                     /transl_table=11
                     /translation="MTNSSVFDSLAGSKTVSKTLFDAASSARALVRARTTERARARAE
                     HQNPAMIHDSGFAQSWLFTGPPGSGRSVAAKVFAATLVCSNPDVVGCGQCEDCRAAMG
                     GSHPDIEHIVPQQLSIGVDAAREVIKAAAVSPVAGNWRVVIFENADRLTMQAANALLK
                     TVEEPTESTVMILCAPTTDPRDIAITLRSRCRHLYIPTPSIAEVARILVAEGNVSQAD
                     AELAAAASGAHIGRARYLAHNNAAQRRRASILNLAELIFHGDVAFRSVNTLVKMVETE
                     AKDSNKEKEEAELEAVRISLGMGAKGKGVHKAVRGGAGDFKALEDQQKLRRTRFLRDS
                     LDLALVDLAGIYRDAIIISSQAQVGLTHPDMEGLSQELATKVSQEGLLACLDAISKCR
                     ESFGFNVRPIVAMDALVGRLRKAYKVS"
     CDS             complement(434985..435434)
                     /codon_start=1
                     /locus_tag="cgR_0399"
                     /product="hypothetical protein"
                     /protein_id="BAF53363.1"
                     /transl_table=11
                     /translation="MKKFIAASTILALSLIGAPQAAAFSSGSSGSNIVQPLPEPKPTD
                     LNEVLRIIASGYFTHYSNRGYTYDASAENIAQMYFEGTPSQKEYLRQELAAIGAEVIV
                     ETYPTSTYQDKYTQLVNTPRQPINGTLWGAYIGVNEYTITATLVVTH"
     CDS             435767..436330
                     /codon_start=1
                     /locus_tag="cgR_0400"
                     /product="hypothetical protein"
                     /protein_id="BAF53364.1"
                     /transl_table=11
                     /translation="MKTASDPIDWNPQRVAVSGVSGVGKTTLCKQIEEISGFSRVELD
                     SLYHGENWIPRETFVEEVQDFIKGPQWVMELQYRQVRPLIVERADTVLWLDYSTPRQM
                     FRLIKRTIPRSLFKTKLFNDNIEPPLWTIFKDPDHIVRWGWRTRNSLKKVTPTFEGRF
                     APLTVVRLSSPKETKRWLRAYGESVKL"
     CDS             436346..437230
                     /codon_start=1
                     /locus_tag="cgR_0401"
                     /product="hypothetical protein"
                     /protein_id="BAF53365.1"
                     /transl_table=11
                     /translation="MAESFIEVSAGHADRRIDKFLRAQLKGVSASLIFRQMRKGDIRV
                     NGRKVDPNYRLQEGDRIRMWQMDLPADLPPPVVDKHIFKAVADSVLFEDAELLVINKP
                     AGIPVHGGTGHGGGVIEALRQKFPQERDLELVHRLDRDTSGLLLVSKTTSVLRELQEI
                     LRDREEEIFRGYLLKVEGAWPGDLRQIDVPLKRTETTVVPHSDGLRARTYFEVVKRLP
                     GATLVKAQLATGRKHQIRVHAQYAGHPIVGDPRYGSRGGRAATMHLHAAELVVPRGAG
                     KRQKFTAPLPKEWGMGRV"
     CDS             437648..439684
                     /codon_start=1
                     /locus_tag="cgR_0402"
                     /product="hypothetical protein"
                     /protein_id="BAF53366.1"
                     /transl_table=11
                     /translation="MSQEQPQIGSRLSRVIEQDGLQFRDLDGDGVLAPYEDWRLTPAE
                     RAADLVKRMNVEEKAGLMIIGSHYPGYSPLAPESEGKDAEKCEPLLNPVDMWREDNPI
                     TGVPFTEPVLATSSTENAINLRNQRYLIVRDNLPARELATWTNAVQEVAERSRLGIPV
                     VFASNPRNHVALVAQFGVNESAGVFSEWPGELGLAALRDAELMETFGTEAAKEWRAGG
                     VHKLYGYMADLASEPRWSRFNGTFGEDPELISDYIAAVVRGLQGPELSKNSVSTTIKH
                     FPGGGVRLDGHDPHFHWGQTNEYPTEDALGKYHLPPFQAAIDAGCASIMPYYARPMNN
                     SANQLDQQLWQNPTTQFEEVAFAYNRAFIQDLLRDAMGHRGYVNSDSGVIDAMMWGVE
                     ELSEPERFAAAVRAGTDIFSDMANPRRLLEAVAEGHLDESELNQPVQRLLEEIFQLGL
                     FENPYVSEDEAEKIIGAPEVSALGNKAQLDSVTLLRNNPSVLPLDPAASLKIYPLVTG
                     RTKIDEVQLQLEAAIRAELPGVTLVSSESEADLAIVWARPEIALFEDDLEGVSLSVDP
                     RANGVDVERVQAVEAAVPTILAVNFTNPWVLSEIEPGAAAVVGTFEIKPEFLLKALTG
                     QEGGPKGKLPLTVPASMQAIADSPRDIPGKFLDESYTYVDSAGMAYKYGHGLNF"
     CDS             439737..440843
                     /codon_start=1
                     /locus_tag="cgR_0403"
                     /product="hypothetical protein"
                     /protein_id="BAF53367.1"
                     /transl_table=11
                     /translation="MSTVVPGIVALSKGAPVEKVNVVVPDPGANDVIVKIQACGVCHT
                     DLAYRDGDISDEFPYLLGHEAAGIVEEVGESVTHVEVGDFVILNWRAVCGECRACKKG
                     EPKYCFNTHNASKKMTLEDGTELSPALGIGAFLEKTLVHEGQCTKVNPEEDPAAAGLL
                     GCGIMAGLGAAVNTGDIKRGESVAVFGLGGVGMAAIAGAKLAGASKIIAVDIDARKLE
                     WAKEFGATHTIDSSGLGGEGDASEVVAKVRELTDGFGTDVSIDAVGIMPTWQQAFYSR
                     DHAGRMVMVGVPNLTSRVDIPAIDFYGRGGSVRPAWYGDCLPERDFPTYVDLHLQGRF
                     PLDKFVSERIGLDDVEEAFNTMKAGDVLRSVVEI"
     CDS             440844..441479
                     /codon_start=1
                     /locus_tag="cgR_0404"
                     /product="hypothetical protein"
                     /protein_id="BAF53368.1"
                     /transl_table=11
                     /translation="MAHDGLRVENIVTSGIFALDGGEWEVDNNIWVVGNDDEVFIIDA
                     AHTAAPIIEAVGGRTVKGILCTHAHNDHITVAPELAKEFDAPIFVHPGDQMLWEETHG
                     NLAHEDLADQQKFHIAGTELIVLNTPGHSPGSSCFYLPEANELFSGDTLFQGGPGATG
                     RKYSSFDTIIESLKTSILDLPAETTVRTGHGDHTSVGAEAPHLEEWIKRGH"
     CDS             441509..442180
                     /codon_start=1
                     /locus_tag="cgR_0405"
                     /product="hypothetical protein"
                     /protein_id="BAF53369.1"
                     /transl_table=11
                     /translation="MDLKLGGQVILVVGGAGTIGSEVVKLLTEEGATAVAASRSTPLS
                     IDASDEASVRAGIGQVIAEHGRLDGLVVSSAPAAQTLSAETADDPDTVLAAIEGKAIT
                     FMKAATVALEKMREAGYGRIVALSGMNSYKTLSTAASARNAALNVVVKNLADRHAGTG
                     ITVNAISPGFVVAEPDAEVNRANGDTTVGEVAEAIAFLLSPRTASISGEIISVGHKAK
                     GVILP"
     CDS             442267..443499
                     /codon_start=1
                     /locus_tag="cgR_0406"
                     /product="hypothetical protein"
                     /protein_id="BAF53370.1"
                     /transl_table=11
                     /translation="MGVSAFNISDMVANKRAQRKVWLAVALSVFTVAWGGNEFTPLLV
                     FYRGEGFFSNLFIDLLLVFYAIGVAVGLLAAGPLSDRYGRRAVMLPAPLIAILGSALI
                     ALGEETAILIAIGRVLSGISVGMVMTVGGSWIKELSSSRFEPGVKTSAGAKRASMSLT
                     GGFALGPALAGVMAQWLPLPGQLAYVLHIILTLILFPLLITAPETRQSAHLKTKGSFW
                     SDVLVPSALDKRFLFVVAPIGPWVFGAAFTAYAVLPSQLRDMVSAPVAYSALIALVTL
                     GSGFGIQQFGPQIMGTSKTRGPILAMFVTVIGMIGAVIVVMNPHPWWALVVCMALGLS
                     YGLCMFMGLAETQNIAPPVDMAGLTGIFYCLTYVGMVFPALMTWLNQWLSYPFMLGFG
                     AVMATICLIIVSFSARRF"
     CDS             443521..444456
                     /codon_start=1
                     /locus_tag="cgR_0407"
                     /product="hypothetical protein"
                     /protein_id="BAF53371.1"
                     /transl_table=11
                     /translation="MRTVVTGGAGFIGSHLVDLLIKEGHEVVVIDNLSRGRLENLSDA
                     ETTGKLTFVEADLLDVDFNEFLGEHKPEVIFHLAAQIDVRHSVVDPLHDAETNILSTI
                     RIADAARQHGVRKVVFTSSGGSIYGEPSEFPVAETVPVDPHSPYAASKVSGEIYLNTF
                     RHLYGLDCSHIAPANVYGPRQDPHGEAGVVAIFALRLLGGLDTKVFGDGGNTRDYVYV
                     GDVVRAFYLASGEIGGGERFNIGTSVETSDRQLHTLVATAAGSKDDPEYAPARLGDVP
                     RSALSFGKAKEVLGWEPEVNIEQGVAKTVEYFRTH"
     CDS             complement(444908..445285)
                     /codon_start=1
                     /locus_tag="cgR_0408"
                     /product="hypothetical protein"
                     /protein_id="BAF53372.1"
                     /transl_table=11
                     /translation="MTQTTTQIIIQILLLLATAALALYFLRNRRKARAKAWVKIGFVV
                     FIFAAVWAVIRPDDLTQLANFVGVDRGTDLMLYALVVAFMFTTLSSYVRFREQELRCS
                     KLARAVALQNVVLPEDSQDSDPA"
     CDS             complement(445282..446118)
                     /codon_start=1
                     /locus_tag="cgR_0409"
                     /product="hypothetical protein"
                     /protein_id="BAF53373.1"
                     /transl_table=11
                     /translation="MRDCVPASCSRSMDFMTIKLSSLGSVAPNRKIGHHALGSIPIMD
                     ASKNSDFKDTWLVVPCYNEATVIREVLENALKTFPNIVAVNDGSPDNSAEEIHAAGAH
                     LVNHPVNLGQGAAIQTGIEYARKQPGAKYFVTFDADGQHQVKDVVRMVERLRAEDVDI
                     IVGTRFGRPRQADDQVPLIKRLVLRTVVLLSPKTRRLGLTDAHNGLRVFNQKVAQEMN
                     IRMNGMSHASEIVDQIDERGWRISEEPVDILYTEYSMSKGQSLLNGVNILADGFLARR
                     LP"
     CDS             446063..447094
                     /codon_start=1
                     /locus_tag="cgR_0410"
                     /product="hypothetical protein"
                     /protein_id="BAF53374.1"
                     /transl_table=11
                     /translation="MIVMKSIDLEQLAGTQSRTYQSRKITDDMVARPVHVAIALWEVP
                     WESAKSGKIEGWVIAVDSPRGRFVRSGQTKNGDAVNRTVSMLKSALKGVRGKAWIVTG
                     RRQAALRAALVRENYLVTGSFAEQNRAGVKASAISRRAEQSALYKAKKIGEFAERAPR
                     VKERQEAHWWPRLSRTQGTAGVLRLATDASTDGVFRGAMCFVASNGDYLLETQDTTAS
                     SDELELESITHALIYLKSIGATQAIIESDSKAALEAIDFILNTRPRRGRWRGITARAR
                     NRFRDAWEALIDDCVVELSRVLGHAGDPLNQAADQIAYMGMRAVIFEQKSAHPTLLKG
                     IDKALRKAE"
     CDS             447133..448170
                     /codon_start=1
                     /locus_tag="cgR_0411"
                     /product="hypothetical protein"
                     /protein_id="BAF53375.1"
                     /transl_table=11
                     /translation="MSNKRIGVVIVSYGHEQDVANLVDTFADQLKTGDRVVVVDNRKP
                     WVLKDAVGERLEKHGAEIINHDNGGFAAGCNVGAAHIVDDVDLLFFLNPDTVIDDPTL
                     FNSLRRVDEQWAAFMPYLLLPDGTINSAGNALHISGLSWVTGLDEKPVEGSSEVTDIS
                     IASGACLAVRVDWWKRLGGMEELYFMYHEDTDFSARLLLAGGRIGLLHSAYVTHHYDY
                     AKGDYKWIYIERNRHVLLLSVLPLPLLFVLIPQILGVNLGLWAIAAKEKRVGLKMKSL
                     RLLIRDLPAIFKLRRSTQELAELTPSQYLAKMEWRLDNPNLGNIGSNKIVATGYKTYY
                     KLCMSILKLLA"
     CDS             448329..450395
                     /codon_start=1
                     /locus_tag="cgR_0412"
                     /product="hypothetical protein"
                     /protein_id="BAF53376.1"
                     /transl_table=11
                     /translation="MKRLSRAALAVVATTAVSFGALAVPAFADEANNVELNILGVTDF
                     HGHIEQKAVKDDDGVITGYSEMGASGVACYVDAEREANPNTSFITVGDNIGGSPFVSS
                     ILKDEPTLQALNAIGVDASALGNHEFDQGYADLTDRVSLDGTGSAQFPYLGANVEGGN
                     PAPAKSEIIEMDGVKIAYVGAVTEETATLVSPAGIEGITFTGDIDAINAEADRVIEAG
                     EADVVIALLHAEAAPTDPFSNNVDVVFSGHTHFDYVAEGEARGDKQPLVVIQGHEYGK
                     VISDAEISYDREAGKITNIEAKNISATDVVENCETPNAEVDTIVAAAVDAAEEAGNEV
                     VATIDNGFFRGANEEGATGSNRGVESSLSNLIAEAGLWAVNDATILNADIGIMNAGGV
                     RADLEAGEVTFADAYATQNFSNTYGARDLTGAQFKEALEQQWKLTGDRPRLALGLSSN
                     VQYSYDETREYGDRITHITFNGEPMDMKETYRVTGSSFLLAGGDSFTAFAEGGPIAET
                     GMVDIDLFNNYIAAHPDAPIRANQSSVGIALSGPAVAEDGTLVPGEELTVELSSLSYT
                     GPEEKPSTVEVTVGSEKKTADVDNTIVPQLDQTGTASVTLTVPAGATSVEIATDNGTT
                     FTLPVSATGMDDSEQLSSGSSDAGSLVAVLGVLGALGGLVAFFLNSAQGAPFLAQIQA
                     VLAQFM"
     CDS             complement(450979..452049)
                     /codon_start=1
                     /locus_tag="cgR_0413"
                     /product="hypothetical protein"
                     /protein_id="BAF53377.1"
                     /transl_table=11
                     /translation="MARVSIPVKALQKTGPDAPFEVKIIERRDPRADDVVIDIKAAGI
                     CHSDIHTIRNEWGEAHFPLTVGHEIAGVVSAVGTGVTKWKVGDRVGVGCLVNSCGECE
                     QCVAGFENNCLRGNVGTYNSDDVDGTITQGGYAEKVVVNERFLCSIPEELDFDVAAPL
                     LCAGITTYSPIARWNVKEGDKVAVMGLGGLGHMGVQIAAAKGADVTVLSRSLRKAELA
                     KELGAARTLATSDEDFFTEHAGEFDFILNTISASIPVDKYLSLLKPHGVMAVVGLPPE
                     KQPLSFGALIGGGKVLTGSNIGGIPETQEMLDFCAKHGLGAMIETVGVNDVDAAYDRV
                     VAGDVQFRVVIDTASFAEVEAV"
     CDS             452116..452964
                     /codon_start=1
                     /locus_tag="cgR_0414"
                     /product="hypothetical protein"
                     /protein_id="BAF53378.1"
                     /transl_table=11
                     /translation="MLELNRIIQEIEDDLEVDVDKLARRALTTEYHLRKMFGTLAGMS
                     LAEYIRNRRLTLAAADLKAGQAVLDVAVKYGYASSEAFARAFRRFHAVNPSQARSDSI
                     MLSSQPRLRFHIHVKGVTDLRYRIIEKQAFYLTGFHTQVQLVFKGDNQGIVDFEKSLG
                     KEAKARLLSLNDIEPKGALSISDEIENQQAEGSTLDYWHAVATSNPVEEFESMEVPAG
                     TWVMFESEGAFPESIQQMWADAATEWFPANSYSWAPGPQLLHTEYSEDFSTASAQLWL
                     PITRNS"
     CDS             complement(452968..453825)
                     /codon_start=1
                     /locus_tag="cgR_0415"
                     /product="hypothetical protein"
                     /protein_id="BAF53379.1"
                     /transl_table=11
                     /translation="MKGIILAGGSGTRLYPITKGISKQLMPIYDKPMVYYPLTTLIQA
                     GIKDILIITTPEDSASFERLLGDGSSWGINLTYAVQPSPDGLAQAFIIGEDFIGDDDV
                     ALVLGDNIFDGAQLGRALKQCSNPDGGIVFAYEVSDPERYGVVEFDAANKAVSIEEKP
                     TAPKSNFAVVGLYFYDNRVVDIAKSIKPSSRGELEITSINDAYLQQGALTVQRLDRGD
                     VWLDTGTIDSMSEASSYVEVLQKRTGNIIGSPEVAAYREGFITASELTALGEELKKSG
                     YGNYLLRAV"
     CDS             complement(453826..455178)
                     /codon_start=1
                     /locus_tag="cgR_0416"
                     /product="hypothetical protein"
                     /protein_id="BAF53380.1"
                     /transl_table=11
                     /translation="MFNKELTSRDTDIEGLLVFDFPVHGDNRGWFKENWQRTKMTNLG
                     LPDFGPVQNNMSYNATAGTTRGMHAEPWDKFVSVAVGSVFGAWVDLRAGSSTYGNVVT
                     QKITPDVGVYVPRGVANGFQALEDGTLYTYLVNDHWSPDAHYANVNLNMIDWPLPITE
                     ISEKDKKHPTLDHATPLPARQVLVVGAGGQLGTALRAQFPDAEFVTREELDITSDLTG
                     ARAWKQYSTIINAAAYTAVDQAEHDRAAAWAINATAVANLATIARENNLTLVHVSSDY
                     VFDGAAESYDENAPFSPLGVYGQSKAAGDIAAATAPRHYIVRTSWVIGDGNNFVRTMK
                     SLDERGIAPSVVDDQIGRLTFTEDIAAGIAHLLEVGAAYGTYNLTNTGEPASWADVAR
                     AVFSDPSKVTGVSTAEYFADKDAAPRPLRSVLNLGKIEATGFSAPTWQTRLNNYLKEL
                     "
     CDS             complement(455178..456197)
                     /codon_start=1
                     /locus_tag="cgR_0417"
                     /product="hypothetical protein"
                     /protein_id="BAF53381.1"
                     /transl_table=11
                     /translation="MTSLLVTGGAGFIGANFVRQTVEQHPEYTHITVLDKLTYAGNAD
                     NLKGLPDSKVTLIEGDICDAELVDSLVKDHDITIHFAAESHNDNSLNDPSPFVHTNLI
                     GTFVLLEAVRKHNKRFHHISTDEVFGDLELDDPNRFTETTAYKPSSPYSATKAGSDHL
                     VHAWIRSFGIQATMSNCSNNYGPYQHIEKFIPRQITNILAGLTPKLYGTGEQVRDWIH
                     VDDHNDAVHLILSKGKIGETYIIGADNDHVNNKQVIELICELMGLDKNAYEHVADRPG
                     HDMRYAMDSTKLRTELGWAPKYTDVDSGMRKGLEQTIDWYRENEAWWRGTKDNVEATY
                     AKQGQ"
     CDS             complement(456235..456816)
                     /codon_start=1
                     /locus_tag="cgR_0418"
                     /product="hypothetical protein"
                     /protein_id="BAF53382.1"
                     /transl_table=11
                     /translation="MSLSVVEAITNRRATRKYTDEAPTPELIDKIVDLALEAPSAFNA
                     QQREIVVITDPAQKQKLYEASHQKQFLTAPVTFIAVARVENEPEDLEEILGAERAERV
                     AGFINGRSIQQAREATLRDASLAAAFLILAAQAEGLSTSPTTGWDEKKVKEAIGIGGR
                     DDRAIALVIATGFPNEQPEHPGRLQNRRIDNSY"
     CDS             457571..458518
                     /codon_start=1
                     /locus_tag="cgR_0419"
                     /product="hypothetical protein"
                     /protein_id="BAF53383.1"
                     /transl_table=11
                     /translation="MHFCLLSLARPAKVVAPLLGAALLLSSCSSTSSDEPIQPEVAST
                     GYSVEHAMGTTEIPETPKRVVVIDSPHLDALLALGITPVGATESGSENGFPTYLADEL
                     KDTESVGLTSEPNLEKIAALDPDLIIGAKVRHEAIYDQLSDIAPTVMSEGSGTNWNEQ
                     AEITAAAVNKSDEMDKLIADLDTRAKDLGEEIGAEGQTASMVRFRPDNFRLYGPETFS
                     GSVLEQVGFDLGERDWNEYSMMELSPENFGQIDGDLIFYTIPGSPEATTYPQVSELWV
                     DSPAVQQGKTYEFEDETWMVGIGVLGANEILDDLEETLS"
     CDS             complement(458624..459265)
                     /codon_start=1
                     /locus_tag="cgR_0420"
                     /product="hypothetical protein"
                     /protein_id="BAF53384.1"
                     /transl_table=11
                     /translation="MLPNRLFLRLFALIALIGVVTGGILLLIDWRNGEQTSSSTRTTV
                     NDSMVIRALQREEEIVLLSAGALGIHEKTVERTIRGKRIPGTQKTVHVQYSYTGKLGI
                     DASDVEIKSAGDNKLSITIPEFIFIGYDDLEFKTIAEDDGWISFSTGDIDTAEVVSEI
                     MSQENFVEQVTTNREMLEDQAADFYNDLLHEFTEKLDTDRYEDPKIELEFEFE"
     CDS             complement(459474..460736)
                     /codon_start=1
                     /locus_tag="cgR_0421"
                     /product="hypothetical protein"
                     /protein_id="BAF53385.1"
                     /transl_table=11
                     /translation="MRYLTLATIIAGLSGFVVIIIAAWALGDSSQLSEEFTAYWGLFF
                     AGTGVLTGLTQETTRAVTAGRARGGVAGVSGASGASVGFRPFLFSFVVAAIVLVVLGA
                     SAPLWIGQLLSELQGVGVGLLAVGLASYAIQATISGILSGCQLWKEYASLISLDTGVR
                     MVLAVVAWLLGYQLLAFLVITVVGSISWLVIVLCFGSVRSVLGSVADVSRGVFIRQAL
                     LAMAASGATAVLITGFPTLLKFTNPSAVAGGVSMAAVSYAVILTRAPLLVPLQQFQSA
                     IIVRFVKGTSGPLKTLAGPLAIVWAVGIVGAGLAWLAGPWILDVVLQKELFAVPGWLL
                     AMLTLGATTTASLMVSGCAAIAFERHGIYLTGWVVATVVAVGFLLGPFDLGVAAGLAL
                     IVGPLCGLLVHMGAFVGGARKERAVAAS"
     CDS             complement(460736..462118)
                     /codon_start=1
                     /locus_tag="cgR_0422"
                     /product="hypothetical protein"
                     /protein_id="BAF53386.1"
                     /transl_table=11
                     /translation="MIMRRLRSTPVPGTRDSYTGIDFNLGFHIRRYELDLTYRVAPNL
                     LMGTATLHMDNYRALDALTLDLGGSLRVEKVTAKGTAGTHIQVARFRHAGRKLRITFR
                     NQIPVDQEFSLIIRYRGNPRPLRSEWGMIGWEELDNGALVAAQPCGAPSWFPCDDTPD
                     EKALFDVHFHTDNGYAAIITGDFISKNVSGSMTTWHYQSREPMATYLAAVHVGEYDTV
                     SLGVSESGVVVEAYVPVGDAALRGRILADFAKQVDMLDAYEKLFGPYPFRSYRVVITE
                     DELEIPLEAQGLSSFGANHATGEGTWERLIAHELSHQWFGNSLGLAQWNDIWLNEGFA
                     CYAEWLWFEAAGVKSAAESALEFYRGLEALPQDILLGDPGAHDMFDDRVYKRGALTVH
                     ALRVLLGDEAFFKAVQAYVSEGRHGLVEPRDLKRHLYAVSTDHAALDAVWHSWLRDLE
                     LPEFPSGGLD"
     CDS             complement(462124..464139)
                     /codon_start=1
                     /locus_tag="cgR_0423"
                     /product="hypothetical protein"
                     /protein_id="BAF53387.1"
                     /transl_table=11
                     /translation="MTDYTFLEDIDTPEALAWAEKWSGESVEKLKSPDKDALEARLLA
                     ALDTDDRIAYVSRRGEKLYNFWRDAQHPRGVWRTTTLESYYSAQPKWDVLIDVDALAE
                     AEGENWVWKGAVVRSPERDLALVKLSRGGADATVIREFDLATREFVGADAFELSEAKS
                     SVTWIDADTLLVGTDTGEGSLTDSGYPARAVTWKRGTPIEQADVFFEGAREDVATHAW
                     RDSTPGFERIFASRSLDFYNSETYLETADGLVLLEVPTDCDVIVKNQWLFVNPRTDYA
                     GILAGGLGVLELDAFLGGARDFAAVFTPSASTSLQGLATTKNFLVLTLLNNVSTEIVS
                     VPLADPVAEPTRMELPDHVTAHVVATSPLDGDEIWVQAASFTEAPTLLRTELPGALEA
                     VKKAPLQFENAGQETRQHWATSADGTKIPYFITGNFAGTSAAQRKTLVHAYGGFEVSL
                     TPSHSPTRGIAWLEKGYYFVEANLRGGGEFGPEWHSQATKLNRMKVWEDHRAVLADLV
                     ERGYATPEQIAIRGGSNGGLLTSGALTQYPEAFGAAVVQVPLADMLRYHSWSAGASWM
                     AEYGNPDDPEERAVIEQYSPVQAVVGVEKRIYPPALVTTSTRDDRVHPAHARLFAQAL
                     LDAGQAVDYYENTEGGHAGAADNKQTAFVESLIYTWIEKTLDQQGSI"
     CDS             complement(464210..464623)
                     /codon_start=1
                     /locus_tag="cgR_0424"
                     /product="hypothetical protein"
                     /protein_id="BAF53388.1"
                     /transl_table=11
                     /translation="MAHAELSFGSSSFGSSGLSATRDKKAVEFENALEEFFITTGRTK
                     TDNAEAIADDYYQRAVNGELEFMEDMFFTDYIESERLYVVANSIPPERIDDEIAIIKQ
                     NTSFLNPDGEKDTGAIGVRVDFENGHYYSVQVYVG"
     CDS             464839..465144
                     /codon_start=1
                     /locus_tag="cgR_0425"
                     /product="hypothetical protein"
                     /protein_id="BAF53389.1"
                     /transl_table=11
                     /translation="MTVPEKLPEQLSEQVSDQPQQRNYVAIVALTLAVVGFVLACTPS
                     AVLVGLIALVIAFFIAIISLCIPGGPKRQGVYALVLSVVGFAVGVVKIMVILEDMMS"
     CDS             complement(465346..465837)
                     /codon_start=1
                     /locus_tag="cgR_0426"
                     /product="hypothetical protein"
                     /protein_id="BAF53390.1"
                     /transl_table=11
                     /translation="MQNITRKIAALAIAGTLILPATAHAQSNFSAGSSSFDFGSSGPE
                     EPQVEPLEVRLEVAYERLIAANGHVLHADQELEATGLLNRAFAGEFEFVDGKFYVYDE
                     EKLTEYWIDLLTEEQAEEILDNIEADIKWAEENPEDSDKEFGLEVGKLGDYYYIAGVE
                     TYV"
     CDS             complement(466051..466533)
                     /codon_start=1
                     /locus_tag="cgR_0427"
                     /product="hypothetical protein"
                     /protein_id="BAF53391.1"
                     /transl_table=11
                     /translation="MRNIVSTVAATIIASSLLLPTTAVTASAQSSFSSGTFDLGMSHD
                     SDPVAVQLEKAFEDYGLSRGHSLDLNAEMRAELLLRSVIKGHTITRNGRYLQLDPASN
                     TLSSVSTVTPKEIQDFLEGINGGERIATSYFSGAPFRFGVAVGVKSGTYYLVTTKFTN
                     "
     CDS             complement(466641..466745)
                     /codon_start=1
                     /locus_tag="cgR_0428"
                     /product="hypothetical protein"
                     /protein_id="BAF53392.1"
                     /transl_table=11
                     /translation="MADFGVSVAQEGDLYYVAIVQKETSGGTGPIIGG"
     CDS             complement(466875..467156)
                     /codon_start=1
                     /locus_tag="cgR_0429"
                     /product="hypothetical protein"
                     /protein_id="BAF53393.1"
                     /transl_table=11
                     /translation="MRNLTRKFVAFAVAGALLLPTAAVANAQSSFGFGSSSFDTGSST
                     ADLPTTTRLEKGFERLGEAYGQKLNQTEEDKATELLQQALNNELPIIEG"
     CDS             complement(467311..467787)
                     /codon_start=1
                     /locus_tag="cgR_0430"
                     /product="hypothetical protein"
                     /protein_id="BAF53394.1"
                     /transl_table=11
                     /translation="MKVSNKRLISTALSLSIIFAGTQGIAHAQSSFVSGSSSVETNIN
                     RDAKSLRYTELYKKVFLALGHELNPLAQAKADDLLQRALRGELVFENGSYVEQNSPGI
                     HYASVDQISSDDLDFELSLLEIVYADLEIYPNEDLIQIGVASGKDRQYYYIVHVAL"
     CDS             complement(468140..468706)
                     /codon_start=1
                     /locus_tag="cgR_0431"
                     /product="hypothetical protein"
                     /protein_id="BAF53395.1"
                     /transl_table=11
                     /translation="MTARVKMISMRKTIITMLATTAIAFSAISPVQAQTVDTDTDASV
                     SSELSSGTSSGSSEDSEDSDLSNRDIIFGVAAIAAVGGLIAGGVHWAVQQRMIPNPLP
                     GIIPNPPALAPQAPAPAPAPAPAPQAVAPQAVAPAPAPAPVQTNRTYKNCTEVWNVLG
                     RSIRQGEPGYGTHLDRDRDGIGCESRPR"
     CDS             complement(469179..470390)
                     /codon_start=1
                     /locus_tag="cgR_0432"
                     /product="hypothetical protein"
                     /protein_id="BAF53396.1"
                     /transl_table=11
                     /translation="MCIEGSRFCHLYCLVILGSLFSTGSRIGFCETIPVEERLVAEIT
                     TPLMEKIRSPAVQSDALQVFKSALAATITWWISVNLLHSQLPFLAPWVALMTMQFTVY
                     HTFISGIQTAIASAIGVGLSFVIGTYLDVNVWTFGLAMVIGLIGARVPKLRAEGIGIA
                     TTSIFLLASGFDDQQPLLYDRILEILLGVAVAIAINLIIFPPLRDREANMVVESLDRR
                     MGEVLKKMADELAEKWNIDNADEWLEEIHSINNDLEKAWHSVRFARESRRVNPRKIRI
                     RGGRPQPTETSYESNLTRIDEGIAHLRHLARTLRDTPNIDSDWDPVFQKQWVSLMHDA
                     GALLADRNQEIDPIRDRLSKLSSEMSEDQQLTSKKWPIYGSLLTSLFHLSALVDDAVT
                     TRKAEDKEHNS"
     CDS             complement(470422..471519)
                     /codon_start=1
                     /locus_tag="cgR_0433"
                     /product="hypothetical protein"
                     /protein_id="BAF53397.1"
                     /transl_table=11
                     /translation="MKLLRRIAAPAIALGIAMSTIVTPSTAGAAEVTPADVAGNTPLS
                     TISDSAPADEASAPRWRAYVNEADDRVKEMWAYSPSMDRNVPLVVITADESAGPRPVI
                     YLLNGGDGGEGAANWVMQTDALDYYLDKNVNVVIPMEGKFSYYTDWVEENANLGGKQM
                     WETFLVKELPGPLEEKLNTDGQRAIAGMSMSATTSLIFPQHYPGFYDAAASFSGCAAT
                     SSLLPWEYLKLTLDRGNATPEQMWGPRGGEYNIYNDALINSDKLRGTELYVSNASGLA
                     GEWESVDSPRFEGLNQQVQSVAMAETVITGGIIEAATNKCTHDLKAKLDSAGIAADWN
                     LRPTGTHSWGWWQDDLRGSWDTFARAFELEA"
     CDS             472085..473281
                     /codon_start=1
                     /locus_tag="cgR_0434"
                     /product="hypothetical protein"
                     /protein_id="BAF53398.1"
                     /transl_table=11
                     /translation="MRKPKIMTVYGTRPEAIKVAPVIKALEQDERFESVAVSTGQHKE
                     MLDQVNEMFSIKPAYDLGLMNKVSTLSGVVSKALEGLDEIIEAENPDVIISQGDTSTA
                     MSAALAGFHREVKIVHLEAGLRTGNIHSPFPEEANRRIIGQVSELHLAPTEISRENLR
                     RENFRSADTVVVGNTVIDALLEAATWETTFEDQRLNDLVESDQRIVLVTTHRRENLTA
                     MSEIGGAVQQLAEAYPDVIFALPLHLNPKVRDMVLPKVDALPNVIITDPLPYDQFTKL
                     MASSTLVLTDSGGVQEEAPAFGKPVLCMRENTERPEAVLAGTVKLVGTNQARIITETR
                     LLLDDPTAFSAMAQAINPYGDGKAAKRSVAAIAALLGVGERLPDFQPEKPIEPGLDEP
                     RLSDQL"
     CDS             474507..474755
                     /codon_start=1
                     /locus_tag="cgR_0435"
                     /product="hypothetical protein"
                     /protein_id="BAF53399.1"
                     /transl_table=11
                     /translation="MANGIHITGVVKGETASLIKELNCGVVVDPEDPEALALSWKRLL
                     NDRSQLQVSDTAREWVVTQRDEVVPQELYAFLSKLGIE"
     CDS             474752..476251
                     /codon_start=1
                     /locus_tag="cgR_6016"
                     /product="glycosyltransferase"
                     /protein_id="BAQ21078.1"
                     /transl_table=11
                     /translation="MKRIIFLITAVISYLWLDWRGFMKKLGERARLSNLKIPKFLFPA
                     ESISISPAHQLVELGELSKAQEYLAAKGKLTISERKLKNRVTQTLFELGLKPVEVTEK
                     IPSKKGVKALYFLTNSLPFTTSGYTKRSQSLMEAVAENGVVIHAATRLGYPLTIGKWP
                     KSSTYLLGGIRYHNIFPWVFSRSPAKRYGKTIELLARLAVDLGVTVIHTTTNFPNAIV
                     ANRVAAKLGLPWIYEVRGELESTWLSKLPKDKQRSAEKSEYYQLARAQETNYANAANA
                     VVVLSEISKSQLIRRGITPEKIFVIPNSVEQKLFDKEYDKSALREKHGIAEDAVVVGT
                     VSSIVGYEGLDTLLRALVSLPDQYRGLIVGDGVDRPRLENLAKSLGVNSRLDFVGNQN
                     PQTIDEWYKLLDIFVVPRKDTAVCRTVTPIKALTAQALGIPVITSDLPALREVTGGVE
                     SYAIPEDSRDLMEKIIAIKPHSQGVEWAASRTWNQAAKKLVQIYRGITS"
     CDS             476622..477506
                     /codon_start=1
                     /locus_tag="cgR_6017"
                     /product="hypothetical protein"
                     /protein_id="BAQ21079.1"
                     /transl_table=11
                     /translation="MQTSGPKILIYGSCVTRDIQRISDDRFRVLDYIARQSFVSANSP
                     SLPDPDTSAIAGKFLARAIASDFASNAFERIISNIRKSDVLLIDLASERHGVVPYQNS
                     LISRTNDLAKSGLLTPREFNKHIAFDTPEHRKKFRAAAIKLKEELMREKAFRKTLVIA
                     TPFTDVTSDGSKMPLSRGKTAEMINNEYAYYYELLRNMGFAILTLPDELCVASPSHKW
                     GISQNHYVSEAYEYLADQIELFMAEPVVAKRVFKALNSGRIFRIEVKHENLEKEILCP
                     KMTKIKNWIRIKKQGNLK"
     CDS             477470..478354
                     /codon_start=1
                     /locus_tag="cgR_6018"
                     /product="ABC transporter permease"
                     /protein_id="BAQ21080.1"
                     /transl_table=11
                     /translation="MDTDQKTGQPKIVTIVVDDSDLAPLDGKPRLGQYCANLWRSRSF
                     IRTHALTKVHKNSRDRYLGNLWVILDPIFQVSIYALIFGLILKVDRGMSNFVGFLVIG
                     VVFFGIFSSGITGGSNLIQNSRSLITSFTFPRIAVVTSGIVKLFLDNLVPCLLAVIIA
                     IAFQWGEPIHWSVIFVIPLYLLAHLFAFGTTAIIARITAFIPDFRSVVTLLSRGLFFL
                     SGVFFEISRFDASPLLQSIVESNPIYQFLKAFRSCIIDGSIPGISSWVFLTVWSVSIA
                     TFGFIFFYLAEERYSVVK"
     CDS             478344..479201
                     /codon_start=1
                     /locus_tag="cgR_6019"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="BAQ21081.1"
                     /transl_table=11
                     /translation="MLNKPTVMVRNLSKTYSVGKNGSERSIFQRSNRIRVEALKDVSF
                     VTYTGESIGILGRNGSGKTTLLNLIAGNETASNGEILVSAQPTYLGVSAALQNHLSGA
                     ANVRLGLLAMQLSREEVLAKEEQVLEWAELQEASDRPLRTYSSGMRARLQFAISTAVK
                     REILLVDEALSTGDSTFSAKARNRMNEFLEESGTVFIVSHAPGTIERYCKRSIWLHKG
                     EIIADGRTRMVTKYYRQWAEREAKGNFRGAEIVIENMKLRYEPKNLILASEEKTVFGN
                     TELKSSHSQ"
     CDS             479268..481928
                     /codon_start=1
                     /locus_tag="cgR_6020"
                     /product="hypothetical protein"
                     /protein_id="BAQ21082.1"
                     /transl_table=11
                     /translation="MNRPIPESGSLFVHYANQQASLKVTREFLSSGLVALKDSSKTDL
                     SNGSAWRSDVSRADGREAHSWFFARPWYSAESELTEDEKTTLSQKIEQAIDTWTEHAE
                     DEASMAFHDETTAQRAMVFTALLFAFQKSFSRETKTKLLTVLNRDIDLLESDSFYAGL
                     NNHGMFQDVALLVAVDYGYASKKAKLLEDKAFGRLEQYFSKSFTADGIHTENNPTYHV
                     MVARYLSRVIAFAETRGRSGQFKDLKNLMGKADLYAAFAVTPFGDFPPISDTNLQRLN
                     ALSARATFDEGYLLGVLTNGKEGTIPTSRVYVAEDSGYGIARSGWTSTEDTYLFFNAA
                     YNADYHKHSDELSVYFSSRGFELLTEAGPNGYQYNDPFTKYAFSSFAHNTLVVDGEGL
                     PRTDGNAHLTELTDQGSSFSKLNVTGRTQRFDGVDWTRSVTLDVDSPEEGDLQISDAI
                     SSDQRHTYKFCWHIGSEIIPYVRGSFIEFYSKNTQEKIAEMEWTGETASTIHVVNGQR
                     HPRVQGWQFPLMGEKTPTYSVEIEFEGRSISVEWTLRVNDFVLRNHGMNPFNPEWKTF
                     YGEKPVHYLLEMPDNNQNPESLAIVFSGVNSVGDFPLNYRESFASFKGAVLYVLDDFG
                     RQGTYYLSSSRNLAEFRAVQGLLKSVISELGITTDEVTTFGYSKGGTSALLHGVTLGV
                     SDVFAGAPQYLIGNFLKKSYSEVLQYISGGVSKGDIHWANKIAQNILSSAVRSTQIHV
                     VVGLADSHYREHAIPLIDDARSLGYQAKLLTIPGATHSEFRTCFREIIRTWIEADVSE
                     EEFLVPYTVGFDSGKKLFGVCLALPIGARARGQLFYGSERVGSVRAFTGSSASWEISE
                     PGPYRIRIYVDLPNGAERKAFGTSRRQLRW"
     CDS             482091..483905
                     /codon_start=1
                     /locus_tag="cgR_6021"
                     /product="hypothetical protein"
                     /protein_id="BAQ21083.1"
                     /transl_table=11
                     /translation="MSYLAPVLSRGFVQTANASEAVVHSTTNHVAPSRGRYQVVSVQG
                     FASLFGVPFTSADELALILNGRIDSPEQLVKELRGTATITLRETDTGAFYVITDMYGA
                     GKIFIWQDSVRWAVSSSVKDLVSFLNQNGIKAKKSIENAGLLGFVGYGGGAISSPYED
                     ILCVDQFKYVIVAANGKLNQRDYSFKEELVGPSAPNSSNQEDLLQSVAIEIRRNTSVF
                     SSYKAESYICHLTGGLDSRVVFAALVGTPYKDQYSTFTYGLEESPDMVIARRLTAEFG
                     LTASTYSGMRYSVVPQDPALQVLWSLNQTGGMTSLGPASIGGYPRPDSVVLAGGWGEM
                     YRGGYPDFVSADASHEEKIKWVVNWVLRSGSPYGPRISYDGLFSDAMVQRARDFGQLM
                     LSEIQHLEIGDELLAEWMYLRWSTRFNVGEITRTCLPFTHRADPLCVPEMMKLVYATP
                     FSDRKNGNLELDLVKALYPGMESYPYDKDYLTEDYLRTRGISDVASFDESLPLEIKWH
                     FDDKPHYLEAITPVARPTQAQKAEALRVKMPLRFIVRAEENRRRIQNYVRDVPEEMSQ
                     VFNLKNLKNVTDRNPKTRPEYRRLETLNSALSWYFEQE"
     CDS             485113..488796
                     /codon_start=1
                     /locus_tag="cgR_0436"
                     /product="hypothetical protein"
                     /protein_id="BAF53400.1"
                     /transl_table=11
                     /translation="MYTVHSTPIFNSNGYSTRTRGVAEGMKKQGGDVVVVARSGYPWD
                     SSVDIKKPAQKRYSESLNGVTYVHTPGGNLNRDGLDSYVLKAADTFVREAKLLRPSVI
                     QSASNHRTALPALIAARRVGVPFVYEVRGLWEITEITKRPSLKGSERFNAQVQLETLV
                     ASEADAVLAITEQVADELVSRGVPREKIHVVPNAVDPHEFMPLPADLEYAVSKKLDTQ
                     IPTIGFAGSIVEYEGLDTLVQASWLLNQKKIAHQVVVAGSGESEAALKEKVAKLKLNN
                     VHFLGRLPQSEIPRLMSTFDIVACPRLSNEITELVSPLKPLESFASGKPTVLSDVQPN
                     IDLAGKEMSRARLFNSGNAEDLAEVIASLIKDRQSATEMARQARLWVVRSRQWNMIGK
                     MMLEQHLIAAERFAESALVGKPVHGLKVGLISDDFTAATLSGTFDVEKIGRATWRDQI
                     QATSFDLIFVESAWEGNDTEWHRGVGYYSDEESADLRGMLSLAKEEGIPTVFWNKEDP
                     VHFSRFAPNAVLFDHVATTDANLIEKYFNFPGAVLKTVSALPFYAQPSIHNPLRVERE
                     IHNTVAYAGTYYGERYAERSKDLEKLLNAALPHGLEIYDRQADNPDSPYKFPSRYEKS
                     VRGAIPYQEVVESYKTHLAHLNVNSVTNSPTMFSRRVIEIPASGGLVLSSEGRGILES
                     LGSTIAVSNDADDHKAFLHSWVTDPEARLQEIWLQMRTVYRAHTTETALTILCRTMGM
                     PVSPSVSVTYGVSVDYLDSKVAASILKQSVLPSIILANSVELDAVEQLHSSGIRVIDS
                     DEEVKQEVDYLGKWMPECHRTYFEDLLFSSAFGDWDFIRPVLGEFDPAEDFIAEEISG
                     VIQETDLVKLSRASTEINRGVALHLPSRTNETVKRLSVDDFDEPSKLAPGTRVLIAGH
                     DLKFASFLIDELESHGIQVDIDKWSGHAKHDEKVSLEKLASADVVFCEWGLGNAVWYS
                     KHLQDHQRMVVRVHLQELTLPYLRKINHSKVNKYLFVGELIRQSAIVSHGIPAQLTTV
                     IPNAVSVAKLKIPKVAAARFRIGIVGIVPQRKRLDSALDLLERLQKEDDRYHLRIKGK
                     LPSDYPWMKDRKEEFAYYEEQFNRIEAMNQNQPGSVIFDDFGPDMSDWYSKVGIVISV
                     SDFESFHLTIADGAASGSLPVSIAWDGADLIYPDEWLVSNIDEMAEVIRSWNGKDNGY
                     SQFIKDNFESDLVADRILTLLAG"
     CDS             complement(488902..490158)
                     /codon_start=1
                     /locus_tag="cgR_0437"
                     /product="hypothetical protein"
                     /protein_id="BAF53401.1"
                     /transl_table=11
                     /translation="MTNQTVAFVGLGYIGLPTAVVMANSGVDVTGVDVNEKNVERINR
                     GEVTIVEPGLEEELKQAIESGNFRATTTQVHAQTYIIAVPTPFTDDYGVDMKYIYSAA
                     EAIAPKLEGNELVILESTSPPLTTKKMADKILELRPDLVADGAENPEGKPVIYFAHCP
                     ERILPGKAMEELRTNDRIIGGQTEEATKRATAVYATFCEAELLPTNDVTAEMAKLTEN
                     SFRDVNIAFANELSLIADNLDINVWELIELANHHPRVNILQPGPGVGGHCIAVDPWFI
                     VSSDPQNSRLIRTAREVNDGKPKWVIDKVAEALNGYQTGAKIATLGMAFKADIDDLRE
                     SPALNITKELANRFVDQTILAVEPNVSKLPTDLEGIKNITLTAYDQAIADADIVVLLV
                     DHHEFKGVSAAQLKDKTIIDTKGLWV"
     CDS             490598..490711
                     /codon_start=1
                     /locus_tag="cgR_0438"
                     /product="hypothetical protein"
                     /protein_id="BAF53402.1"
                     /transl_table=11
                     /translation="MYQIFEQILFAINEILGYGLHAGSSASSNLSHGLGLF"
     CDS             490847..492256
                     /codon_start=1
                     /locus_tag="cgR_0439"
                     /product="hypothetical protein"
                     /protein_id="BAF53403.1"
                     /transl_table=11
                     /translation="MTEHYDVVVLGAGPGGYVSAIRAAQLGKKVAVIEKQYWGGICLN
                     VGCIPSKSLIKNAEVAHTFTHEKKTFGINGEVTFNYEDAHKRSRGVSDKIVGGVHYLM
                     KKNKITEIHGLGNFKDAKTIEVTDGKDAGKTVTFDDCIIATGSVVNTLRGVEFSKNVV
                     SFEEQILDPVAPKKMVIVGAGAIGMEFAYVLGNYGVDVTVIEFMDRVLPNEDAEVSKV
                     IAKAYKKMGVKLLPGHATTAVRDNGDSVEVDYQKKGSDKTETLTVDRVMVSVGFRPRV
                     EGFGLENTGVKLTERGAIDIDDYMRTNVPGIYAIGDVTAKLQLAHVAEAQGIVAAETI
                     AGAETQALGDYMMMPRATFCNPQVASFGYTEEQAKQKWPDREIKVASFPFSANGKAVG
                     LAETDGFAKIVADAEFGELLGGHLVGANASELINELVLAQNWDLTTEEISRSVHIHPT
                     LSEAVKEAAHGISGHMINF"
     CDS             492413..493336
                     /codon_start=1
                     /locus_tag="cgR_0440"
                     /product="hypothetical protein"
                     /protein_id="BAF53404.1"
                     /transl_table=11
                     /translation="MSLPIDEHQNAVKTVVVPAAGMGTRFLPATKTIPKELLPVVDTP
                     GIELVAKEAADLGASRLAIITAPNKDGILKHFEPFPELEATLEARGKTDQLNKVRAAR
                     ELIDTVPVVQEKPLGLGHAVGLAESVLDQDEDVVAVMLPDDLVLPFGVTERMAEVRAK
                     FGGSVLAAIEVAEDEVSSYGIFELGDLDAESESEGIRRVVGMVEKPAPEDAPSRFAAT
                     GRYLLDRAIFDALRRIEPGAGGELQLTDAIALLIEEGHPVHIVVHEGKRHDLGNPAGY
                     IPAVVYFGLRHAEYGSRIHRAVKEILAEFES"
     CDS             493385..493906
                     /codon_start=1
                     /locus_tag="cgR_0441"
                     /product="hypothetical protein"
                     /protein_id="BAF53405.1"
                     /transl_table=11
                     /translation="MQLKSGFMAKKVDTSNATPALALLTEKQIPFELDVHDVDPKSLK
                     GFALDASEVMGVEPEVVFKTLMADIDGEHVVAIVPASSTLNLKQLAKAGKGKHANMMD
                     RSRAQVVTGYVPGGISPIGQKNKHRVFLDESAILQDRIYVSAGRRGWSLIIAPDDVLL
                     ATDGVYADIADHS"
     CDS             complement(494025..495449)
                     /codon_start=1
                     /locus_tag="cgR_0442"
                     /product="hypothetical protein"
                     /protein_id="BAF53406.1"
                     /transl_table=11
                     /translation="MGKTYVGSRLRQLRRERDLSQASLAATLGLSASYVNQIEHDVRP
                     LTVPVLLRITEAFGVDATFFSRDDDSRLLAEVQDVMLDREINPANVELQELSEMVYNH
                     PQLARAMVEMHQRYRNVRDKLSIAVDNRTNTPEERRPIAEAVSMPHEEVRDFIYARQN
                     YFDALDRRAEAIAAQLGWQPYDSRAMEDSIARRLQMDHDVTITSSKEESGTLHHFDPE
                     TRLLTIHARLNPGQRAFRMATELGYLEANDLIEGIVDDGIWSTPEARTLAIRGVASYF
                     AAAVMLPYKIFHAEAEKSGYDIEYLGQLFGVGYETTAHRLSTLQRPNLRGIPFTFVRV
                     DRAGNMSKRQSATGFHFTHYGGTCPLWNVFETFTNPGQVLRQFAQMPDGRNYLWISRT
                     VRHHEARFGEVDKMFAIGLGCEARHADRTVYSRGFNLQDLSTATPIGSGCRVCTRENC
                     AQRAFPSVHGRINIDAHESTIAPY"
     CDS             495946..496719
                     /codon_start=1
                     /locus_tag="cgR_0443"
                     /product="hypothetical protein"
                     /protein_id="BAF53407.1"
                     /transl_table=11
                     /translation="MTVRNPDREAIRHGKITTEALRERPAYPTWAMKLTMAITGLIFG
                     GFVLVHMIGNLKIFMPDYAADSAHPGEAQVDVYGEFLREIGSPILPHGSVLWILRIIL
                     LVALVLHIYCAFALTGRSHQSRGKFRRTNLVGGFNSFATRSMLVTGIVLLAFIIFHIL
                     DLTMGVAPAAPTSFEHGEVYANMVASFSRWPVAIWYIIANLVLFVHLSHGIWLAVSDL
                     GITGRRWRAILLAVAYIVPALVLIGNITIPFAIAVGWIA"
     CDS             496736..498757
                     /codon_start=1
                     /locus_tag="cgR_0444"
                     /product="hypothetical protein"
                     /protein_id="BAF53408.1"
                     /transl_table=11
                     /translation="MSTHSETTRPEFIHPVSVLPEVSAGTVLDAAEPAGVPTKDMWEY
                     QKDHMNLVSPLNRRKFRVLVVGTGLSGGAAAAALGELGYDVKAFTYHDAPRRAHSIAA
                     QGGVNSARGKKVDNDGAYRHVKDTVKGGDYRGRESDCWRLAVESVRVIDHMNAIGAPF
                     AREYGGALATRSFGGVQVSRTYYTRGQTGQQLQLSTASALQRQIHLGSVEIFTHNEMV
                     DVIVTERNGEKRCEGLIMRNLITGELTAHTGHAVILATGGYGNVYHMSTLAKNSNASA
                     IMRAYEAGAYFASPSFIQFHPTGLPVNSTWQSKTILMSESLRNDGRIWSPKEPNDNRD
                     PNTIPEDERDYFLERRYPAFGNLVPRDVASRAISQQINAGLGVGPLNNAAYLDFRDAT
                     ERLGQDTIRERYSNLFTMYEEAIGEDPYSSPMRIAPTCHFTMGGLWTDFNEMTSLPGL
                     FCAGEASWTYHGANRLGANSLLSASVDGWFTLPFTVPNYLGPLLGAERLAEDAPEAQA
                     AIERAQARIDRLMGNRPEWIGDNPHGPEYYHRQLGDILYFSCGVSRNVKDLQDGIDKI
                     RALREDFWKNMRITGSTDEMNQVLEYAARVADYIDLGELMCVDALDRDESCGAHFRDD
                     HLSEDGEAERDDENWCFVSAWEPGKNGTFVRHAEPLFFESVPLQTRNYK"
     CDS             498757..499506
                     /codon_start=1
                     /locus_tag="cgR_0445"
                     /product="hypothetical protein"
                     /protein_id="BAF53409.1"
                     /transl_table=11
                     /translation="MKLTLEIWRQAGPTAEGKFETVRVDDAVAQMSILELLDHVNNKF
                     IEEGKEPFAFASDCREGICGTCGLLVNGRPHGADQNKPACAQRLVSYKEGDTLKIEPL
                     RSAAYPVIKDMVVDRSALDRVMEQGGYVTINAGTAPDADTLHVNHETAELALDHAACI
                     GCGACVAACPNGAAHLFTGAKLVHLSLLPLGKEERGLRARKMVDEMETNFGHCSLYGE
                     CADVCPAGIPLTAVAAVTKERARAAFRGKDD"
     CDS             499556..499894
                     /codon_start=1
                     /locus_tag="cgR_0446"
                     /product="hypothetical protein"
                     /protein_id="BAF53410.1"
                     /transl_table=11
                     /translation="MNTMSSAKKKPAPERMHYIKGYVPVAYSSPHSSLERSATWLGMG
                     FLLTALAGVGAVLFAVGANSVGQQQEHWVLYSIIGVVFAVVCTVLGTVLIMKGRAPYN
                     RYVKETGRTQ"
     CDS             500065..500946
                     /codon_start=1
                     /locus_tag="cgR_0447"
                     /product="hypothetical protein"
                     /protein_id="BAF53411.1"
                     /transl_table=11
                     /translation="MKKYAVAALALLTLAGCSTSEEVAVSSDSAPQRIVIAQANFLDL
                     ALALDLEPVGTTYWGGAGGVQDYLLDSVPASMEVVGNDDEPNFETVAKLQPDLIIGDE
                     EIETNLAKYEAIAPVSIIKSVDDNGSNSWRDQLTALAELTGTQEKAAAVIEEADKSVA
                     SLDSKITSPGEKTMLLRIREEQVRQYFPDSFVGAGVPQRLQNITLVESAVPSENGQWS
                     VIPPENIGLLDADRIIAFIDSPQALENAESNPLWRQLPAVKNGQLCTTENLTPWILTG
                     PAAAEIVTSDLEACFAA"
     CDS             complement(501405..502448)
                     /codon_start=1
                     /locus_tag="cgR_0448"
                     /product="hypothetical protein"
                     /protein_id="BAF53412.1"
                     /transl_table=11
                     /translation="MTAQMWGIHNDKLTHELVDQGFISIGWDGAPNLGSIPSNRETVK
                     RILSSAYTEASPRSISSQAGVVYRFAHVVAINDIVIAPEKSNSTINIGVVTGEYYYEA
                     DAPIHKHRRPVRWVKTGIPRAVFSQAALYTLGSMLTLFQINRNTEEFLTVMNSTTDDA
                     DAIAETIDVLRAPIEEADPVDEQEPEQPRASTITQYTRDFILDILTSKITPREFEELS
                     AALLRAIGYEARVTQYSQDGGVDVIAHKDPLGIEPPHIKAQCKQRISTIGAPEVNQLI
                     GTLGNGELCLFFTLGGYSKDAQSIERLQSGLRLLTGDDIVDLIMNNYDNLPERWRRTI
                     PLSPVLVVADKAE"
     CDS             complement(502499..503476)
                     /codon_start=1
                     /locus_tag="cgR_0449"
                     /product="hypothetical protein"
                     /protein_id="BAF53413.1"
                     /transl_table=11
                     /translation="MPALSLGRVRALRLISQLLAPSAALKMKPERNAVDVAKHMLASQ
                     AQQRGSALVALDARAENADAATAVEQSLLIRSWTQRGTHQILAAEDVRWMTLLCSPRI
                     LAASAKRRPSLSLDSAAVQRARDALATAAEKSPVSRTQAYEIFRSADVDPGENRGQHL
                     LRHFGGEGDIVQGPPINGEDSFVLLDSICPLSLALTGDEALTEMTRRYFYSRGPATQK
                     DLVWWTGLTVRDVKKGIAAVSAEGSIAAVQGPNGEEMWIPTWAQDVTETEVNDALALE
                     LTLPAFDEYLLSYTDRSHVMDPEHLFSIGPGKNGVFKPFKVIHGEALPV"
     CDS             503548..504852
                     /codon_start=1
                     /locus_tag="cgR_0450"
                     /product="hypothetical protein"
                     /protein_id="BAF53414.1"
                     /transl_table=11
                     /translation="MGKHEVAQQTVPGPSPEMEAQRRKELRKHKAIATGLLIFAAAVY
                     FLCRFVETRPGETAAWVGFVRAAAEAGMIGGLADWFAVTALFRHPLWLPIPHTAIIPR
                     KKDQLGEALSGFVGDNFLNAQLITEKVSQAQIPERAGEWLAQPENGEKVSREVGKLTA
                     NIVRAIDPSDAEAVIKSAVIDKLAEPTWGPPAGRLLEQLLAEGKAEPVVQELAQWLHK
                     KALGSEPLIDRLLNERRPIWAPKFTAQLVSGKVYGEVIKFTEAVAADPNHEARKSLRR
                     FLNKLAQDLQHDPGMIIKVEEIKRDIMGSGAIAQAAPTIWASASESLIESAEDESSIL
                     RRKIAEAATSWGQRLLVDDSLRHSLDTRLTAAAAFLADNYAPEVTGIISETIERWDAE
                     EASEKIELMVGKDLQYIRLNGTIVGALAGLAIYAISHILFGA"
     CDS             504868..505290
                     /codon_start=1
                     /locus_tag="cgR_0451"
                     /product="hypothetical protein"
                     /protein_id="BAF53415.1"
                     /transl_table=11
                     /translation="MSDAKDDSILSKWSNAASELSGAVSGVAKKLREELSEKETFSKL
                     KTEASEAVDQAKSGSYLDAGKEFARDAGSIIKDAAKTVKGAVSDSDKNDVKSAFGDAV
                     EASRDKFDDTLEKHKAKKDSPEPGDDDIIDGEVIPPQN"
     CDS             505309..505614
                     /codon_start=1
                     /locus_tag="cgR_0452"
                     /product="hypothetical protein"
                     /protein_id="BAF53416.1"
                     /transl_table=11
                     /translation="MDISMLNVITSYTVWAIFAIIGICGFVGAFLAATTREDAFEVAD
                     RQKKIVWVAILIASGFVLTVLGPSIPILPWVAIIMIGLYWFDVRPQIKSILEGAGGW"
     CDS             505767..506420
                     /codon_start=1
                     /locus_tag="cgR_0453"
                     /product="hypothetical protein"
                     /protein_id="BAF53417.1"
                     /transl_table=11
                     /translation="MDIEEQPSLRETKRQKTLEAIEDNATRLILERGFDNVTVEDICA
                     EAGISKRTFFNYVESKESVAIGHTAKLPTDEEREGFLATRHENIIDTVFDLVINLFGN
                     HDNSKSGVAGDIMRRRKEIRVKHPELAVQHFARFHQAREGLEHLIVEYFEKWPGSQHL
                     DEPADREAIAIVGLLISVMLQGSREWHDMPQGTQADFQACCRKAIKNTFLLRGGFSE"
     CDS             506417..508066
                     /codon_start=1
                     /locus_tag="cgR_0454"
                     /product="hypothetical protein"
                     /protein_id="BAF53418.1"
                     /transl_table=11
                     /translation="MTSQVKPEDERPVTTISKSGAPSAHTSAPYGEAATKEAVEEKTT
                     GRVGFIIAALMLAMLLSSLGQTIFGSALPTIVGELGGVNHMTWVITAFLLGQTISLPI
                     FGKLGDQFGRKYLFMFAIALFVVGSIIGALAQNMTTLIVARALQGIAGGGLMILSQAI
                     TADVTTARERAKYMGIMGSVFGLSSILGPLLGGWFTDGPGWRWGLWLNVPIGIIALVA
                     IAVLLKLPARERGKVSVDWLGSIFMAIATTAFVLAVTWGGNEYEWASPMIIGLFITTL
                     VAAIVFVFVEKRAVDPLVPMGLFSNRNFVLTAVAGIGVGLFMMGTIAYMPTYLQMVHG
                     LNPTQAGLMLIPMMIGLIGTSTVVGNIVSKTGKYKWYPFIGMLIMILALVLLSTLTPS
                     ASLALIGLYFFVFGFGLGCAMQILVLIVQNSFPITMVGTATGSNNFFRQIGGSVGSAL
                     IGGLFISNLSDRFTENVPAAVASMGEEGAQYASAMSDFSGASNLTPHLVESLPQALRE
                     AIQLSYNDALTPIFLALTPIAVVAAILLFFIREDHLKETHE"
     CDS             508066..509700
                     /codon_start=1
                     /locus_tag="cgR_0455"
                     /product="hypothetical protein"
                     /protein_id="BAF53419.1"
                     /transl_table=11
                     /translation="MTHETSVPGPADAQVAGDTKLRKGRAKKEKTPSSMTPEQQKKVW
                     WVLSALMVAMMMASLDQMIFGTALPTIVGELGGVDHMMWVITAYLLAETIMLPIYGKL
                     GDLVGRKGLFIGALGIFLIGSVIGGLAGNMTWLIVGRAVQGIGGGGLMILSQAIIADV
                     VPARERGRYMGVMGGVFGLSAVLGPLLGGWFTEGPGWRWAFWMNIPLGIIAIGVAIYF
                     LDIPKKSVKFRWDYLGTFFMIVAATSLILFTTWGGSQYEWSDPIIIGLIITTIVAAAL
                     LVVVELRAADPLVPMSFFQNRNFTLTTIAGLILGIAMFGIIGYLPTYLQMVHGINATE
                     AGYMLIPMMVGMMGTSIWTGIRISNTGKYKLFPPIGMIVTFVALIFFARMEVSTTLWQ
                     IGIYLFVLGVGLGLAMQVLVLIVQNTLPTAVVGSATAVNNFFRQIGSSLGSALVGGMF
                     VGNLGTLMEERMPAAMAQLSPEEQAAMAAQGGLDSNELTPAIVNQLPTALHDAFAGSY
                     NDALIPVFYVMMPLIGIALLLLLFIKQEKLRETTTD"
     CDS             complement(509773..510687)
                     /codon_start=1
                     /locus_tag="cgR_0456"
                     /product="hypothetical protein"
                     /protein_id="BAF53420.1"
                     /transl_table=11
                     /translation="MTPSSPEVRNRPSTAPEERQFVLTFGCPDSTGIVAKLSSFLAER
                     GGWITEAGYFTDPDSNWFFTRQAIRAESIDTTIEQLREEFAPLAEEFGPRAKWSFTDT
                     AQVKKAVLLVSKEGHCLHDLLGRVAENDYPMEVVAVVGNHENLRYIAENHNVPFFHVP
                     FPKDAVGKRKAFDQVAEIVNGYDPDAIVLARFMQILPPDLCEMWAGRVLNIHHSFLPS
                     FMGARPYHQAYSRGVKLIGATCHYATGDLDDGPIIEQDVIRVTHKDTPTEMQRLGRDA
                     EKQVLARGLRFHLEDRVLVYGNRTVVFD"
     CDS             510742..511416
                     /codon_start=1
                     /locus_tag="cgR_0457"
                     /product="hypothetical protein"
                     /protein_id="BAF53421.1"
                     /transl_table=11
                     /translation="MDMTISRATMAQILDYTLLGPEVTNSELAAFIDSAIELGVGTIC
                     VPNSMVNLTAKAQEAGIRVATVAGFPHGKTPALVKAAEARLAVQSGASEVDVVLDIAV
                     VKEGDANRLLQEIVAIREAVPSPVVLKFILETAVVSDDAIVTAVNALIAAGADFAKTS
                     TGFHPAGGATVEAVRVMASASRGRVGIKAAGGVKTWEDAVAFVEAGATRIGTSNAGAI
                     LEGAPE"
     CDS             511667..512512
                     /codon_start=1
                     /locus_tag="cgR_6022"
                     /product="hypothetical protein"
                     /protein_id="BAQ21084.1"
                     /transl_table=11
                     /translation="MKPVTYSELSDQMTRRQFHQKYSRVVGSIYIDKKFVDDPIAIVD
                     ALLRRFPEGVIRGFAGLHLRGFKLLDEGWVPEISIPQNSSNVATVIGKAIRRKAPEVY
                     FVKDRRTVSVQQAIKDVLVKMEFEQQIALLDFLVRQNPRLYAILEESREFKGTLEWVS
                     HFAESRPESILRVRIRQAGILGFEPQVGVSVGGHMRFVDLGNAELQVGLEYLGAVHFD
                     NAEKRAQDSDRQNELRAVGWVLIEVTWRDLKEHARWLDLVKKLKFQIREAEKLRNARL
                     PFRPY"
     CDS             complement(512499..512801)
                     /codon_start=1
                     /locus_tag="cgR_0458"
                     /product="hypothetical protein"
                     /protein_id="BAF53422.1"
                     /transl_table=11
                     /translation="MSNSECHTHGYIEEKQRYLARLKRIEGQTRGIHRMIDEEQYCID
                     ILTQISAVNSALKNVAFGLLDDHLAHCVKEAADLGGDELDAKLKEVSDAIARFSKA"
     CDS             complement(512801..515068)
                     /codon_start=1
                     /locus_tag="cgR_0459"
                     /product="hypothetical protein"
                     /protein_id="BAF53423.1"
                     /transl_table=11
                     /translation="MAQTPAKIPAALNFIDVDLGVTGMTCTSCSARVERKLNKLDGVE
                     ATVNYATESAQVSYDPSKVSPEQLIKTVEDTGYGAFTMASAAAESEEDNAPADSGQSR
                     IDAARDHEAADLKHRVIVSALLSVPVVLVSMIPALQFNNWQWAVLTLVTPIFFWGGSP
                     FHKATWANLKHGSFTMDTLVSLGTSAAYLWSLWALFIGNAGHPGMKMEMHLLPSASTM
                     DEIYLETVAVVITFLLLGRWFETKAKGQSSEALRKLLDMGAKDAVVLRNGAEVRVPVN
                     QLKLGDVFITRPGEKIATDGEVVEGSSAVDESMLTGESIPVEVTKGSKVTGATLNTSG
                     RLMVKVTRIGADTTLSQMAKLVTDAQSKKAPVQRLVDQISQVFVPVVIVIAIVTLIAH
                     LVFTDAGLAPAFTAAVAVLIIACPCALGLATPTALLVGTGRGAQLGLLIKGPEILEST
                     KKVDTIVLDKTGTVTTGTMSVTDVTAINYSETEILEFAAAVESASEHPIAQAIAKATD
                     HEQVTDFQNTAGQGVTGVVRGHEVRVGRPSSTLIDALLHPFQHAQKIGGTPVVVTIDG
                     VDSGIITVRDTVKDTSAEAIRGLKELGLTPILLTGDNEGAAKSVAAEVGIDQVIANVL
                     PHEKVQNIEALQAQGKNVAMVGDGVNDAAALAQADLGLAMGAGTDVAIEASDITLMNN
                     DLRSAVDAIRLSRKTLGTIKGNLFWAFAYNVALIPVAAIGLLNPMLAGIAMAFSSVFV
                     VSNSLRLRGFKARSN"
     CDS             complement(515117..515569)
                     /codon_start=1
                     /locus_tag="cgR_0460"
                     /product="hypothetical protein"
                     /protein_id="BAF53424.1"
                     /transl_table=11
                     /translation="MTFQNAAFPNLYPDVDPLTPIPITFGERLAACVAAGTIAFGAAS
                     GDLLITGVGLVLVLFATLVPASKTARRIRREARARFPQEGWIDEEITRNNRTSIFVPL
                     IWFLIAAISFAIYRFVDATWGSIVAAVIAMILTWFTPGLFPRRVDPYP"
     CDS             515803..517635
                     /codon_start=1
                     /locus_tag="cgR_0461"
                     /product="hypothetical protein"
                     /protein_id="BAF53425.1"
                     /transl_table=11
                     /translation="MKLAPRMRMRSHKTFAALASLALVIGLGQVPIAQAQTEYRTASD
                     GSLNWGFRQSFRNYIQTGVAKGSITLGDGASDNGGNFAFTPRTNGTTVTSDSQGTVEF
                     NGSVHFLGHQADDKWILDTTMSDIKMVFNGSSAQLVVDLVAREFKGTTYDDIGEYIIS
                     DDIVLADVSLNSAADFSQDSIDLSGTTTLTAAGAQAFGGFYETGDALDPTGGSLTISS
                     TTTAPSTSTTSTSASTSGGTADCSSGALGVVTTGTNDGMLGTIQEVNNTFAIWNNLIV
                     NTERMFCNIDTLKARFDTDNSSDSVTTATSGTTASTGTTAATTAGTTGTTGTASTASG
                     TPGTSGTAATVAGTTPTDNGVCTASGSLGVTQASAQWGVKASFQNYIRGSIANGSWTL
                     NGVGFDNQQFQFSGNSGAVDAENKTGSINFPGSIHFTGHGGILDMQIANIEISFNGNS
                     GELIADVVSSDMEGNSTNYGRTVVGTLNFSALNVSATEASGSASVSLSQSGSQAFADF
                     YTPGTQLDPISFSATLGGDASCATESTSTTGAAATANTDNTEGVAGEESTTPANQNSQ
                     FQIRQAAADSTGLDTTTTLLLILAAFVVAGGSMTRFTVGNPTGK"
     CDS             517644..518723
                     /codon_start=1
                     /locus_tag="cgR_0462"
                     /product="hypothetical protein"
                     /protein_id="BAF53426.1"
                     /transl_table=11
                     /translation="MNNAFRRTLTSVVLAASLALTACASWDSPTASSNGDLIEEIQAS
                     STSTDPRTFTGLSIVEDIGDVVPVTDNASPALPVSLTDADGNDVVVEDVSRILPLDLY
                     GTYSKTIAGLGLVDNIVGRTVSSTEPALADTEVVTTGGHTLNAEAILNLHPTLVIIDH
                     SIGPREVIDQIRAAGVATVIMSPQRSISSIGDDIRDIASVVGLPEEGEKLAERSVAEV
                     EEASTVVDELTPEDPLKMVFLYARGTGGVFFILGDAYGGRDLIEGLGGVDMAAEKGII
                     DLAPANAEALAELNPDVFVMMSGGLVSTGGIDGLMERPGIAQTTAGQNQRVLALPDGQ
                     SLAFGAQTGELLLRASRELYVQGGE"
     CDS             518724..519800
                     /codon_start=1
                     /locus_tag="cgR_0463"
                     /product="hypothetical protein"
                     /protein_id="BAF53427.1"
                     /transl_table=11
                     /translation="MVVKEVDVEKQKAGRVPGAIAKRRTVRIVLFVALGAIVIAASLW
                     SILVGQYTIPIRDLPAILNAGPTGAQTMAEQVVWQIRMPRIVLGLLVGAALGVAGALL
                     QAVFSNPLAEPSIIGVTSGAGVGAAAVIVFNLTFLGTSTVAVGAFITAVITTILVYQL
                     ARSRGRVQVINLILTGIAINAVSGALTSFFIYIAPTSSREEIIFWQMGSLNGSQWAHV
                     NVVFVIVTIGLVAAFGLGKQLDVLALGESAAGHVGLNVKKLRIIAIAVSTLLTAGAVA
                     YAGLISFVGLIIPHLLRTVTGPANKILVPASALGGAALISVSDILARTLIPYADLPIG
                     IFTALVGGPTFFIMLRRMMKKGVH"
     CDS             519801..520616
                     /codon_start=1
                     /locus_tag="cgR_0464"
                     /product="hypothetical protein"
                     /protein_id="BAF53428.1"
                     /transl_table=11
                     /translation="MAIVSLDNVTVSIEGKKLLDAVSLKAYPGEVLGLIGPNGAGKST
                     LLSVLSGDRLPDSGEVNVGGLDPATAAASDMARVRAVMLQDVSVAFSFLVWDVVEMGR
                     RPWQKVSTPEEDHEIIEAALAATSVSHLAEREITTLSGGERARVALSRVLAQQTPIVL
                     LDEPTAAMDISHQEQTLGTARALAAAGAAVIVVLHDLNAAAAYCDSIVCLSDGRVIAS
                     GSVDQVYSTETLSRVYGWPIRVDHSGKYVRVEPDRSEADLPPVLRIKNTVSPA"
     CDS             520730..521662
                     /codon_start=1
                     /locus_tag="cgR_0465"
                     /product="hypothetical protein"
                     /protein_id="BAF53429.1"
                     /transl_table=11
                     /translation="MNKLATRALVALTGSAIAMTGLAVVSANAAEETGECRVTTTGTA
                     DWALKTSFNSYLEGPIANGTAYKYKGGIEVRDGVETSGERTTRQFTWPVEGSEEGTVN
                     LGGGVHWTGHNHYDGDDESQVAGNFLLDLDFSNPAVKFDGNKGTLLVDFKSREFVDFT
                     NAGEFLTGTQAELAKITFDAPIDLNKESVTVTGQTILSELGVGVMGNFYGAGDELAPI
                     TLNLTNEVVCEDPGTPVEPETPVDPETPVDPETPVDSEEPGDDTDGNKDDNASNSSGN
                     GDILGILGTLAALGGVGALVYNFLVASGFLAAFK"
     CDS             521663..522535
                     /codon_start=1
                     /locus_tag="cgR_0466"
                     /product="hypothetical protein"
                     /protein_id="BAF53430.1"
                     /transl_table=11
                     /translation="MTRLSSALLAASVAGAALATPATTAHAAESVCTFTGDVGWNVRD
                     SFNSYLLGNIANGSAYKHKGGLDVRDGVQTDGNGRTPALTWPVDSVTSSKISTSGGAH
                     WTGHNLYTGDDLAEVPNNFTLDLDFSNITMELNGSTGRLLVDYTSREYIDTHTLGEFQ
                     SGEQAELATITFAQAPDLSSNSVNVTGDVALTADGVEVFGGFYTAGEELAPITLNLTA
                     DEGCGSTPEPEDTEDPETPSTSSSDFSLGSSPDVSSSSFGDTVTQVLSIGSMVGMAGL
                     LFTIVNYFIQSFAP"
     CDS             complement(522635..523447)
                     /codon_start=1
                     /locus_tag="cgR_0467"
                     /product="hypothetical protein"
                     /protein_id="BAF53431.1"
                     /transl_table=11
                     /translation="MGVAKSKKSALPKVLLTIVVILLLLVLVAEFGLRFMIGKQLKDE
                     FQAQAASQGISATEEPSISFGASPLLLGIARGSINEVTIDTPDSVSITNQDGVPSISG
                     TPESTIQLQGLDIGDRDNPVADHLTLTTFATDDFILATIQQQMAEATGGNSTSQGFAE
                     QLIQELIKVTDITSDAANQTIEVEFTDGAARASLHPIVTNGQLGFEIVDSQLFGFGLP
                     DEISQMLTDALQSSINEVAGGLQIQSLEVVDAGINVTLTGDNINIQTLEAAQ"
     CDS             complement(523531..524346)
                     /codon_start=1
                     /locus_tag="cgR_0468"
                     /product="hypothetical protein"
                     /protein_id="BAF53432.1"
                     /transl_table=11
                     /translation="MADHAHNLRASFRKGANGKQKPIGVITRGTTGVNRLRRFDRWCF
                     HHPKIRSLLDATSLALDVGYGASHTTTVEWGRWLHRLQPDMDVIGLEINPERVLEPQN
                     GVSFELGGFELAGYTPQLVRAFNVLRQYDVDQVEAAWETVTSRLAPGGLFFEGTCDEI
                     GKRCTWITLNAEGPQELTLAWDPWGISTPSDVAERLPKILIHRNVPGEKIHSLLAAAD
                     LAWDHSAGWEPHGPRVRWEKAREMLIDQGWPITVSRRRVGDSLLTVPWETVAP"
     CDS             complement(524347..524850)
                     /codon_start=1
                     /locus_tag="cgR_0469"
                     /product="hypothetical protein"
                     /protein_id="BAF53433.1"
                     /transl_table=11
                     /translation="MATRTENTITINQPVGKVHQALTTEAYWAYIAENLSPEAGEVNE
                     FTAADGGATATLFEVLPLEVLPEAVRAMISQALKVKRVLTVPALTNNATTVEYNADVK
                     GTPVDFKGTIAINGDDAATTFDYSNEVSVNIPFMGPAIEPKVADALGELFANEGALTE
                     KWISENL"
     CDS             524875..525981
                     /codon_start=1
                     /locus_tag="cgR_0470"
                     /product="hypothetical protein"
                     /protein_id="BAF53434.1"
                     /transl_table=11
                     /translation="MLDSSLAQEIAAIDGVELDSKVTFADLTTLRIGGKPRSAVRCQT
                     TEALVSAIKLLDDASLPLLIVGGGSNLVVADGDLDVIAVIIETDDVSINLTDGLLTAD
                     AGAVWDDVVHLSVDAGLGGIECLSGIPGSAGATPVQNVGAYGTEVSDVLTRVQLLDRT
                     THQVSWVDASELDLSYRYSNLKFTNRAVVLAIELQLLTDGLSAPLRFGELGRRLAISE
                     AEPHPRRPVRMVRDAVLELRRAKGMVVEHTDHDTWSAGSFFTNPIVDPALADAVFEKV
                     GEPTMPRFPAGDGKEKLSAAWLIERAGFKKGHPGAGAKASLSTKHTLALTNRGDARAS
                     DLVALAKEIRDGVLETFGVTLVPEPVWIGISIDD"
     CDS             525974..526612
                     /codon_start=1
                     /locus_tag="cgR_0471"
                     /product="hypothetical protein"
                     /protein_id="BAF53435.1"
                     /transl_table=11
                     /translation="MTKFSSVPGTAAPLHRALENAGYPSLESLDGVPYKTLIALHGVG
                     KAGLGRIQAALLERGLSLGEETKGATITPGHTGKVASDIKTHITSVDPVEYVDGLEGR
                     RVAHGHQLLSIFGRVTGAEPKMWGPSMIGYGSVHYVSHTGREGDWFQCGFSPAKSKIS
                     LYGLKDSPRGEELLQKLGKYTEGRGCVYINKPEDIDLDVLEAMISESWAGQG"
     CDS             complement(527180..528886)
                     /codon_start=1
                     /locus_tag="cgR_0472"
                     /product="hypothetical protein"
                     /protein_id="BAF53436.1"
                     /transl_table=11
                     /translation="MSAYETKEWLQHYPEWTPHSLEYGDTTLLDVYDNNLAINADKPA
                     TYFFGRSQTYGELDKEVRKTAAGLRALGVRPGDHVAIILPNCPQHIAAFYAVLKLGAV
                     VIEHNPLYTAHELLEPFKDHGARVAIVWDKASPTVEQLRGQTQLETIVSVNMINAMPP
                     LQRLALRLPIPALRKSRESLSGAAPNTVPFETLTSAAMGGDGDDVVSEPTVTKESVAL
                     ILYTSGTTGRPKGAQLTHGNLFSNLLQGKHWVPGLGDKPERMLAALPMFHAYGLTMVG
                     TLSVFIGGEMVLLPTPRIDLIMNVMKKHTPTWLPGVPTLYEKIVDASEKEGIPIKGVR
                     NAFSGASTLSQRTVERWEKHTGGRLVEGYGLTETSPIIVGNPMSDHRRQGYVGIPFPD
                     TIVRIANPENLDETMPDGSEGEVLVKGPQVFKGYLNQEEATKNSFHGEWYRTGDVGVM
                     EEDGFIRLVARIKEVIITGGFNVYPAEVEEVLAEHPDIEDSAVVGIPREDGSENVVAA
                     ITLVEGAALDPDGLKEFARKNLTRYKVPRTFYHFEEMPRDQMGKIRRREVQAELLKKL
                     GK"
     CDS             528971..530227
                     /codon_start=1
                     /locus_tag="cgR_0473"
                     /product="hypothetical protein"
                     /protein_id="BAF53437.1"
                     /transl_table=11
                     /translation="MRVAMISMHTSPLQQPGTGDSGGMNVYILSTATELAKQGIEVDI
                     YTRATRPSQGEIVRVAENLRVINIAAGPYEGLSKEELPTQLAAFTGGMLSFTRREKVT
                     YDLIHSHYWLSGQVGWLLRDLWRIPLIHTAHTLAAVKNSYRDDSDTPESEARRICEQQ
                     LVDNADVLAVNTQEEMQDLMHHYDADPDRISVVSPGADVELYSPGNDRATERSRRELG
                     IPLHTKVVAFVGRLQPFKGPQVLIKAVAALFDRDPDRNLRVIICGGPSGPNATPDTYR
                     HMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQASGTPVIA
                     ARVGGLPIAVAEGETGLLVDGHSPHAWADALATLLDDDETRIRMGEDAVEHARTFSWA
                     ATAAQLSSLYNDAIANENVDGETHHG"
     CDS             530270..531016
                     /codon_start=1
                     /locus_tag="cgR_0474"
                     /product="hypothetical protein"
                     /protein_id="BAF53438.1"
                     /transl_table=11
                     /translation="MTNGKLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGEL
                     LVEAGVLPGVVYTSLLRRAIRTANIALNAADRHWIPVIRDWRLNERHYGALQGLDKAA
                     TKEKYGDDQFMEWRRSYDTPPPELADDAEYSQANDPRYADLDVVPRTECLKDVVVRFV
                     PYFEEEILPRAKKGETVLIAAHGNSLRALVKHLDGISDADIAELNIPTGIPLVYEIAE
                     DGSVVNPGGTYLDPEAAAAGAAAVANQGNK"
     CDS             531027..532268
                     /codon_start=1
                     /locus_tag="cgR_0475"
                     /product="hypothetical protein"
                     /protein_id="BAF53439.1"
                     /transl_table=11
                     /translation="MSTLLAFVLGVVLMGLALPAYTKIKDRMRRHKSAVTLSENQVTT
                     VGQVLHLAIQGSPTGITVVDRTGDVILSNGRAHELGIVHERSVDGNVWRVAQEAFQDQ
                     ETHSLDVHPDRNPRRPGSRITAVQAVVKPLTLIDDRFVIIYASDESENVRMESARRDF
                     VANVSHELKTPVGGMALLAEALMESSDDPEQVEYFGSRLHREAHRMADMINELISLSK
                     LQGAERLPDMEPVQADDIISEAIERTQLAADNANIEIIRGDRTGVWVEADRSLLVTAL
                     ANLISNAINYSPKSVPVSVSQSIRNDVVMIRVTDRGIGIAPEDQGRVFERFFRVDKAR
                     SRQTGGTGLGLAIVKHVMANHGGSISLWSRPGTGSTFTLELPVYHPESKEPAGSKQGP
                     SLDSPIRTTASKASGRRKEKS"
     CDS             532265..532963
                     /codon_start=1
                     /locus_tag="cgR_0476"
                     /product="hypothetical protein"
                     /protein_id="BAF53440.1"
                     /transl_table=11
                     /translation="MTTILIVEDEESLADPLAFLLRKEGFDTIIAGDGPTALVEFSRN
                     EIDIVLLDLMLPGMSGTDVCKELRSVSTVPVIMVTARDSEIDKVVGLELGADDYVTKP
                     YSSRELIARIRAVLRRRGVTETEAEELPLDDQILEGGRVRMDVDSHTVTVDGEPVSMP
                     LKEFDLLEYLLRNAGRVLTRGQLIDRIWGADYVGDTKTLDVHVKRLRSKIEEEPSRPR
                     YLVTVRGLGYKFEL"
     CDS             533654..534535
                     /codon_start=1
                     /locus_tag="cgR_0477"
                     /product="hypothetical protein"
                     /protein_id="BAF53441.1"
                     /transl_table=11
                     /translation="MDNNNSYLWPVTYDEVSHELTKWKFYKHFTKISGSVYLKNDLID
                     DPVLVTQALIKRCPQGVLRGYAALNRRGYQLFDDPWMPIISISGEPRTRKTTNVGKII
                     RRETPENLRRSGEFTLVSDSQALLDVFSLHGLDSFEHQVALIDHLIRQCPDLKQEIAN
                     VPELRKHAEFTDEFAESPPESRLRVRLHMQGYRNFMPQVRVELEGRRFYLDLADPVWG
                     VALEYNGGWHYTAEQRSKDAFRKNALKNAGWDVFEVTSKTLQSQQAWDYFFQQVRVAI
                     QRKFAERRRRLPMQTVS"
     CDS             complement(534528..537098)
                     /codon_start=1
                     /locus_tag="cgR_0478"
                     /product="hypothetical protein"
                     /protein_id="BAF53442.1"
                     /transl_table=11
                     /translation="MALTVLSVVLGTAFLCGSLLLTHSLERTFSSIVDAGVEGVDVGV
                     IAQQNNPDGVPFSVIAEIEQYPEVRAVNIIGDGPGMPSGTTMTGQSALILTDSDGNPL
                     QAGSSGTHPLAIYPQGEWVSPEPMLIDGHFPTKPDEVVVNASAAKRGGLSLGDHLTIV
                     TPTERIDATLSGTFESNTDVAGWVGVGFTPQRYVELFTNGTDASQITIAVNDGADPMA
                     VRNRIGKNHRDLLPLLPEQIIDQTTGDTARQLEFMTYVLLAFAAIALIVGSFIIANTF
                     AMIVAQRTGEFALLRSIGVSTFQIGFSVIMEAVFVGLIGGFIGIAVGFGVVNALVQVL
                     NQFGDTLSSIDITYNAGSFIFPVLFAVTATVLSAISPAHRAGNLPPVQAFESSDARSD
                     ALGRIRFLVAAVMLTLGISLTIAGAVVSAINGDEFKTETRLAFIGAGLLLVFFSLSLS
                     GPALMVATSQTLGVAIMSPFRAVGKLAQRNTLRNPRRSATTALAVTLSVGLVACVGVI
                     GATTRASVFGSMESTIKSPYVLDSIGGTMIPGQPAGGSRSLSMSAAVAPEIAQTRGVG
                     EVGTLMTGSVQVNGWDNENTTIFDGDLSQFLDLAVRSGDAFDDETPGVMISTTYADQS
                     DLEVGDTVTVNPYGSDDGIRVPITGIYAETNLVGHLMVNAAATNRVLTSADTYHRSQI
                     FVNGDGSTTNEELRDILVDAVAPFLIVQVKSKDEFRGSLGTQINQLLGIIYGLLALAV
                     IIAVLGIVNTLFLSISERTREIGILRATGVQRGQIRRMITLESVILSIHGAIHGLLLG
                     TFIGWAIVSCLRTRGMAPVEFPWTQIGLMLISAIIIGGIAALIPANRASRISPLEAIS
                     "
     CDS             complement(537216..538121)
                     /codon_start=1
                     /locus_tag="cgR_0479"
                     /product="hypothetical protein"
                     /protein_id="BAF53443.1"
                     /transl_table=11
                     /translation="MNRSNSSSVFLGFPESSPAAASIRTGEELPLDFPREWYEFTDPT
                     DVEHVFSIDLTWLESNWNCTFGTPDCLGIDSENADVGCCGHGAFLADETDRDQLYDAV
                     AQMPAKYWQLRPASTDSFLASDDGTDIEPWLTWDELDDEDGNPEPALKTTVVNGACIF
                     ANRAGWETGAGCALHQWGVDANEDLTVVKPEVCWQLPLRRLEAWEERPDGQEILRTTI
                     TEYNRRGWGNGGEDFDWYCTTSPRCHTNAEPMWKTQETELRALMGPNSYEVLREYLEA
                     RSAIPAHLRAQHPASASNNNETPRG"
     CDS             538176..539084
                     /codon_start=1
                     /locus_tag="cgR_0480"
                     /product="hypothetical protein"
                     /protein_id="BAF53444.1"
                     /transl_table=11
                     /translation="MGSNTVHLVAVDARPGGHPTPMSNWRTPLRLVELLDDSGAISEK
                     GINKLTSAVGEAADLAKTLGCAELMPFATSAVRSATNSEAVLDHVEEETGVRLSILSG
                     EDEARQTFLAVRRWYGWSAGRITNLDIGGGSLELSSGTDESPDLAFSLDLGAGRLTHN
                     WFDTDPPARKKINLLRDYIDAELAEPARQMRTLGPARLAVGTSKTFRTLARLTGAAPS
                     SAGPHVTRTLTAPGLRQLIAFISRMTAADRAELEGISSDRSHQIVAGALVAEAAMRAL
                     DIDKVEICPWALREGVILTRIDKGLE"
     CDS             complement(538955..540079)
                     /codon_start=1
                     /locus_tag="cgR_0481"
                     /product="hypothetical protein"
                     /protein_id="BAF53445.1"
                     /transl_table=11
                     /translation="MVTRIFCGFMLAAIKPETKASPICPPPITAIVVMVPTLPLTTPV
                     LQQRGPKTTNYMTIASGPNVMTRPTIPARTMLKPSREVRKAWMMPTIPKVTPTARTAT
                     IHLFRRSHSISKPRNTTTPRTTPTIAIMMIANTDILFSCSGSSSTSSTTAICVVSVLS
                     TSTSAKSAFTAVSTSASFSARTTGAGLAATAGTTGNAPVVKLIGSFSSTMRSTMVSSL
                     LGAGRSGVSCLSTSPSTEATSTSSAGSVLGASTTSGSAGASMGTLECLDSAGFSLTAG
                     MEPVSSATDTPPSSMLRRLRRRGASAERPSFAARAISSATVSFSSLIFANSFPGKCYS
                     SPLSILVRITPSRSAHGQISTLSISNARIAASATSAPATI"
     CDS             539112..539918
                     /codon_start=1
                     /locus_tag="cgR_0482"
                     /product="hypothetical protein"
                     /protein_id="BAF53446.1"
                     /transl_table=11
                     /translation="MSEEKLTVAELMARAAKEGRSADAPRRRRRRSIEDGGVSVAELT
                     GSIPAVKEKPAESKHSSVPIDAPAEPEVVEAPKTEPAEEVEVASVEGDVDKQETPERP
                     APSNEETMVLRIVDEKDPISLTTGAFPVVPAVAAKPAPVVRAEKDADVETAVKADFAE
                     VEVDNTDTTQMAVVEEVDEEPEQENKMSVFAIIMMAIVGVVLGVVVFLGFEMLWERLN
                     KWIVAVLAVGVTLGMVGIIHALRTSRDGFSMVLAGIVGLVMTFGPLAIVM"
     CDS             539970..540791
                     /codon_start=1
                     /locus_tag="cgR_0483"
                     /product="hypothetical protein"
                     /protein_id="BAF53447.1"
                     /transl_table=11
                     /translation="MGTMTTIAVIGGGQIGEALVSGLIAANMNPQNIRVTNRSEERGQ
                     ELRDRYGILNMTDNSQAADEADVVFLCVKPKFIVEVLSEITGTLDNNSAQSVVVSMAA
                     GISIAAMEESASAGLPVVRVMPNTPMLVGKGMSTVTKGRYVDAEQLEQVKDLLSTVGD
                     VLEVAESDIDAVTAMSGSSPAYLFLVTEALIEAGVNLGLPRATAKKLAVASFEGAATM
                     MKETGKEPSELRAGVSSPAGTTVAAIRELEESGIRGAFYRAAQACADRSEELGKR"
     CDS             541042..541233
                     /codon_start=1
                     /locus_tag="cgR_0484"
                     /product="hypothetical protein"
                     /protein_id="BAF53448.1"
                     /transl_table=11
                     /translation="MAREDNGTFLTVAEVAEIMRVSKMTVYRLVHSGELPAVRVGRSF
                     RVHEKAVNEYLDSSFYEAG"
     CDS             complement(541193..541375)
                     /codon_start=1
                     /locus_tag="cgR_5003"
                     /product="hypothetical protein"
                     /protein_id="BAF53449.1"
                     /transl_table=11
                     /translation="MSTKNTSKTPQQNPKIIMPGEQTEKPLYVTFGGVIRELRGEVFA
                     VVESSQPRRRRSPGTR"
     CDS             541557..541658
                     /codon_start=1
                     /locus_tag="cgR_0485"
                     /product="hypothetical protein"
                     /protein_id="BAF53450.1"
                     /transl_table=11
                     /translation="MGSVIKKRRKRMSKKKHRKMLRRTRVQRRKLGK"
     CDS             complement(541663..541905)
                     /codon_start=1
                     /locus_tag="cgR_5004"
                     /product="hypothetical protein"
                     /protein_id="BAF53451.1"
                     /transl_table=11
                     /translation="MVSFAHFVRGGEPADSDQKLVQSSAPWFNTDVFQNPSTRIAFPG
                     SLRPPNPQRTHKNPQRTPPKTQKSTAPEGGASLKLN"
     CDS             541741..541860
                     /codon_start=1
                     /locus_tag="cgR_6023"
                     /product="hypothetical protein"
                     /protein_id="BAQ21085.1"
                     /transl_table=11
                     /translation="MGSLWVRGSQTPRESDSGAGVLENVRIEPRSTALDELLV"
     CDS             complement(542074..543141)
                     /codon_start=1
                     /locus_tag="cgR_0486"
                     /product="hypothetical protein"
                     /protein_id="BAF53452.1"
                     /transl_table=11
                     /translation="MSSEGRNHNWDYAAIGTPEDFLASWSASRGNLRRFFEDHAAAPI
                     NDAAQRQAGEAAATQAVAAIYGMELNEFNAGVDAVAGAIESAGAIHVSIPDPDVPQDV
                     GAAAFFDVDNTLIQGSSLIVFAQGLFRKKFFTIKEILPVVWKQVKFKLTGSENAEDVS
                     RGREQALEFIKGRPVQELVDLCEEIVDQRMADKMWPGTKQLADMHIAAGHQVWLVSAT
                     PVQLAQILAQRLGFTGAIGTVAEAKDGVFTGRLVGDILHGPGKRHAVAALASIEQLDL
                     TRCTAYSDSINDLPMLSMVGTAVAVNPDSKLRKEAETRGWDVRDFRSIRKATREYGIP
                     ALVTAAFSVAGWRLRRRWRKQ"
     CDS             complement(543138..543296)
                     /codon_start=1
                     /locus_tag="cgR_5005"
                     /product="hypothetical protein"
                     /protein_id="BAF53453.1"
                     /transl_table=11
                     /translation="MAHGCAHSLTFRYPSRAYPPRKLYHGYDTQWRYPLSVWRLCAHE
                     PGRFLFVS"
     CDS             543207..543524
                     /codon_start=1
                     /locus_tag="cgR_0487"
                     /product="hypothetical protein"
                     /protein_id="BAF53454.1"
                     /transl_table=11
                     /translation="MSIVSMVKLSGRIRSRRVAKCEGVGATMGHSVEIIVRDNCGSCV
                     RVKAQILPIVGAAGIKLTERNVDQDASLKLEFGDRVPVILVDDEEFACWEVDNDELAN
                     ALL"
     CDS             543610..545004
                     /codon_start=1
                     /locus_tag="cgR_0488"
                     /product="hypothetical protein"
                     /protein_id="BAF53455.1"
                     /transl_table=11
                     /translation="MVSVLIVGMSHRSAPVSLLERLSMDDSVRGETTQALLGRASLSE
                     ALIVSTCNRLEVYTVTSSFHTGVNDVVEVLHEASGVDIETLRGYLYVRYADAAAEHML
                     VVTSGLDSMVLGEQQIIGQVRTAYQAANEYGSVGPALHSLTQTALHTGKRVHSETAID
                     DAGASMVSFAVDRALVQMGLDSEAEAPLSGKTALVLGAGAMSSLAATHLGRAGISKLI
                     MANRTLERAERLAEHSLEAGVPAEVVEYDQRASAYNRVDLVVSATGADDFTVKPEDIP
                     EGASLMLVDLSMPRDIDDACADLPGVDLVNIERLHKASREGGSGMAPSEEEALAIVRE
                     ELDSFTSEQRIRDIVPAVSALRRQAASVGSDELDRLRQRAPGISEVEWGEVEKTVRRV
                     VDKLLHQPTVRVKELAARSGSISYDSALQELFGLESLASTAAPATTSVNASELPDAGI
                     VAFVNAPSATQTRE"
     CDS             545006..545914
                     /codon_start=1
                     /locus_tag="cgR_0489"
                     /product="hypothetical protein"
                     /protein_id="BAF53456.1"
                     /transl_table=11
                     /translation="MTLKIGTRGSKLATTQAGTIRDQLKYFGRDAELHIVTTPGDVNM
                     SPVERIGVGVFTQALRDVLHAGECDVAVHSMKDLPTAADPRFHLVVPTRADSREALIA
                     RDGLTLAELPEGAKVGTSAPRRISQLKAIRPDLEILPLRGNIDTRMGKVTSGELDAVM
                     LAYAGLTRVGMQDRATEVFDADIIMPAPAQGALAIECRADDTETVRALNMLMHADTFV
                     SAVAERTVLNRLEAGCTAPVAAHATLDGYSGDTMTLTAGVYALDGSDQLVFSAEGDGA
                     RPEELGELVAQQLIDAGAANLLGDRS"
     CDS             546317..546691
                     /codon_start=1
                     /locus_tag="cgR_0490"
                     /product="hypothetical protein"
                     /protein_id="BAF53457.1"
                     /transl_table=11
                     /translation="MIVVAELRINNRIVTVHLSWWEKLSARRSHLRIPRKAIRNIQVV
                     DNVISSVDRPIKRTGRLRIPGVFVAGTHAYVNETLSENEFSMCRKNEPGLVIELENIS
                     IDRIVISTPDAHRYADELMAAV"
     CDS             complement(546695..547579)
                     /codon_start=1
                     /locus_tag="cgR_0491"
                     /product="hypothetical protein"
                     /protein_id="BAF53458.1"
                     /transl_table=11
                     /translation="MHLNQLEFFITVAQHGQINRAAEELLISQPALSRQISALEKSVG
                     APLFERHSRGVSLTKAGEILHEEALRTLSRMQSVVDEIQSGEHLITSINIGVPPGIPI
                     DWLRCQLIDLGPETRISLIESPTDDQLKLLKQRELDIALCRRQSEAFATTLVHEQELG
                     IVVRKNSELHQKVAGKDNATLFDLEGLRVLAHSRGEVRIQEEILKNAMLAAGVNATWI
                     FRKFGQYSSLIADLVQADVALTTEESARTNFPSWQWVPIEGEDASGNDLVVRTWITWN
                     PQPTPAVKALIQKFIDGN"
     CDS             547855..549258
                     /codon_start=1
                     /locus_tag="cgR_0492"
                     /product="hypothetical protein"
                     /protein_id="BAF53459.1"
                     /transl_table=11
                     /translation="MSEQLQGVTHSESTQGKTPKRAALSSWIGSALEYYDFAVYGTAA
                     ALVLNHLFFPADTSPGIAILAAMGTVGVAYVVRPLGALIMGPLGDRYGRKFVLMLCLF
                     LIGASTFAVGCLPTFDQVGYLAPALLVLCRVIQGLSASGEQSSAISVSLEHADERHRA
                     FTASWTLHGTQFGTLLATGVFIPFTLFLSEDALMSWGWRVPFWLSAAVVLVAFLIRRG
                     LEEPPAFRENKEAVAGAASPLAMTLRYHKAAVARVAIAAMINSVNIVFTVWALSFATN
                     IVGLDRSTVLLVPVVANLVALIAIPLSGMLADRIGRRPVFIMGAIGGGLAMNGYLGAI
                     YSGNWTMIFFMGVLMSGLLYSMGNAVWPAFYAEMFPTSVRVTGLALGTQIGFAVSGGF
                     VPVIASALAGDQGDQWMKVSIFVGVVCVISALVAMTAKETKALTLDEIDALHTARGEA
                     ADLAAANKASEAQLAAK"
     CDS             549294..551150
                     /codon_start=1
                     /locus_tag="cgR_0493"
                     /product="hypothetical protein"
                     /protein_id="BAF53460.1"
                     /transl_table=11
                     /translation="MRTSIATVCLSGTLAEKLRAAADAGFDGVEIFEQDLVVSPHSAE
                     QIRQRAQDLGLTLDLFQPFRDFEGVEEEQFLKNLHRLEEKFKLMNRLGIEMILLCSNV
                     GTATINDDDLFVEQLHRAADLAEKYNVKIAYEALAWGKFVNDFEHAHALVEKVNHKAL
                     GTCLDTFHILSRGWETDEVENIPAEKIFFVQLADAPKLSMDILSWSRHHRVFPGEGDF
                     DLVKFMVHLAKTGYDGPISLEIFNDSFRKAEVGRTAIDGLRSLRWLEDQTWHALNAED
                     RPSALELRALPEVAEPEGVDFIEIATGRLGETIRVLHQLGFRLGGHHCSKQDYQVWTQ
                     GDVRIVVCDRGATGAPTTISAMGFDTPDPEAAHARAELLRAQTIDRPHIEGEVDLKGV
                     YAPDGVELFFAGPSPDGMPEWLPEFGVEKQEAGLIEAIDHVNFAQPWQHFDEAVLFYT
                     ALMALETVREDEFPSPIGLVRNQVMRSPNDAVRLLLSVAPEDGEQGDFLNAAYPEHIA
                     LATADIVAVAERARKRGLDFLPVPENYYDDVQARFDLPQEFLDTLKENHLLYDCDENG
                     EFLHFYTRTLGTLFFEVVERRGGFAGWGETNAPVRLAAQYREVRDLERGIPN"
     CDS             551197..551634
                     /codon_start=1
                     /locus_tag="cgR_0494"
                     /product="hypothetical protein"
                     /protein_id="BAF53461.1"
                     /transl_table=11
                     /translation="MLGKILLLNGPNLNMLGKREPDIYGHDTLEDVVALATAEAAKHG
                     LEVEALQSNHEGELIDALHNARGTHIGCVINPGGLTHTSVALLDAVKASELPTVEVHI
                     SNPHAREEFRHHSYISLAAVSVIAGAGIQGYRFAVDILANLKK"
     CDS             551649..552500
                     /codon_start=1
                     /locus_tag="cgR_0495"
                     /product="hypothetical protein"
                     /protein_id="BAF53462.1"
                     /transl_table=11
                     /translation="MNDSILLGLIGQGLDLSRTPAMHEAEGLAQGRATVYRRIDTLGS
                     RASGQDLKTLLDAALYLGFNGLNITHPYKQAVLPLLDEVSEQATQLGAVNTVVIDANG
                     HTTGHNTDVSGFGRGMEEGLPNAKLDSVVQVGAGGVGNAVAYALVTHGVQKLQVADLD
                     TSRAQALADVINNAVGREAVVGVDARGIEDVIAAADGVVNATPMGMPAHPGTAFDVSC
                     LTKDHWVGDVVYMPIETELLKAARALGCETLDGTRMAIHQAVDAFRLFTGLEPDVSRM
                     RETFLSL"
     CDS             complement(552506..552790)
                     /codon_start=1
                     /locus_tag="cgR_5006"
                     /product="hypothetical protein"
                     /protein_id="BAF53463.1"
                     /transl_table=11
                     /translation="MGAMFGRKDINLSALEARVAALERRLAEQDQIIAQLGGDSSTPL
                     SLQRPQSGLHPDVVALLQQGKKIAAIKRHRELTGAGLKEAKETVEASRFY"
     CDS             complement(553413..554465)
                     /codon_start=1
                     /locus_tag="cgR_0496"
                     /product="hypothetical protein"
                     /protein_id="BAF53464.1"
                     /transl_table=11
                     /translation="MSSIKLRDLSVSFRDGTFGLQDINLKIEPEEFVVLIGPSGSGKT
                     TMLRTIAGFVEPSSGSVLIGGEDMTHVPPERRRMGMVFQQHAVWPHMSVAKNVGYPLA
                     RSGQKGASISKRVERTLALVGLEGFGSRRPASLSGGQRQRVALARAIIADPTVLLLDE
                     ALSALDEPLRDALRRELVSLSRREGLTTVHVTHDRAEAISIADRIVVLGNGRIQQVAT
                     PTELLSAPATADVARFIVDATVLNGIVRNGRVMCPDLDTSWDLDAVQAIDDIFDGDLV
                     DIAIPPHSVGIGPAHHPDYIFAEITSVLFQVTSYSATAKTQSGHSFRMSITCSVPEIG
                     ETIGLSIDNPMVYRAD"
     CDS             complement(554466..556112)
                     /codon_start=1
                     /locus_tag="cgR_0497"
                     /product="hypothetical protein"
                     /protein_id="BAF53465.1"
                     /transl_table=11
                     /translation="MQLSPSNTSTQRFHISALASLSFMRLGMWLIVAGLFITPLALVV
                     GLALGGNQFPALWDSGLGKALWNSAYTTVLSAVGATIIGTIMALTLDRTDVFGRTALR
                     LFLLSPLLIPPFIGAIAWLQLFGKNQGINRFFGTEVWDIYGADGVTFLLIVHSYPTVY
                     IIVSAALRQLPSDLEQAARIAGADTFTVLRTITLPLLKPALLSAFTLTAVANLADFGI
                     PALLGSPARFETLATMIYRFMESGTVSNPLQVVSTIGVVLLFLGIAAVTADYLVSLYA
                     ASKLQDAGTPHRFTLNKSRIPVSVITWIIALIITAAPLLGLAYRALLPAPGVPFNLDN
                     ITLNNFEAALSNPRVIEGFGNSLMLSLGAALICGVLGWLIGVLITRTQHFANVPLTLT
                     VLLPTALPGMIIGVGWLILGRYTGIYNTPWVILGAYVCAFTALVVQAVRGPLSQAPEA
                     IEEAARISGAGRLRSIMDTTGAMAIPAAFAGAVLVAVTAVRELTVSILLIAPGTTTLG
                     VQVFNLQQAGNYNQASALSLMFAIIGIVALALTVRSQKEF"
     CDS             complement(556120..557199)
                     /codon_start=1
                     /locus_tag="cgR_0498"
                     /product="hypothetical protein"
                     /protein_id="BAF53466.1"
                     /transl_table=11
                     /translation="MSSKHPLKRTATTVFALGASAALLVACSEPSEDVSTAETTTASS
                     SANASDAAGEKVTITVYTSEPEEKVDEINKAFMEANPDIEVEVYRAGTGDLTARIEAE
                     KASGSIEADVLWAADAATFETYAAQGDLAELEDVDTSDLIEEALDAENFYVGTRIIPT
                     VIAYNTEVVDQAELPTSWADLTDPKYAGQLVMPDPAVSGAAAFNASVWKNDPALGEVW
                     ITALGENQPMIAQSNGPTSQEIAGGGHPVGIVVDYLVRDLAAAGSPIDTIYASEGSPY
                     ITEPAGVFADSEKKEAAERYINFLLSVEGQEIAVEQAYLPVREDVGTPEGTPELADIE
                     LMTPDLEVVTADKAAAVEFFQNAMN"
     CDS             557927..559723
                     /codon_start=1
                     /locus_tag="cgR_0499"
                     /product="hypothetical protein"
                     /protein_id="BAF53467.1"
                     /transl_table=11
                     /translation="MTIAHKPEMAETTGIETNQVSETIGVESLTHGNLRPVSSFEGQH
                     EGQTEELLPGKVIFVGAGPGNPDLLTVRAREVLGNAVRAITDEQVLSGVRAFVATEIP
                     VPEDKLQAAEDEYERICIEAKENGARRKPPRPAPPTAAEITEVSEATPAQIVELVQNA
                     LSYGGDVIRLVTGNPLSSDTTLAEISAVSEAGLEFQVVPGMSLPATVPAFAGIALGST
                     YTETDVNGQNVDWDQLASAPQPLVLQARVQDLSRIAQELKARNMPLETPVSVTANGTT
                     RLQRTYDTTLGLLHKLDAELNGPLVVTLGKGVDDRSKYSWWENRALYGWRVLVPRARE
                     QAASMSARLSSHGAIPQEVPTISVEPPRNPAQMERAIKGIVEGRYQWVVLTSVNAVKA
                     VWEKITEFGLDSRSFAGVRIAAVGEKTAAEIRALGITPELLPARTRQNAQGLVDVFPE
                     YFEELDPVGRVLLPRADIATDVLVDGLTHLGWEVEDVVAYRTVRAAPPSADIRDMIKT
                     GGFDAVAFTSSSTVKNLVGIAGKPHPRTIVACIGPMTAATAEELGLRVDVMPEIAEVP
                     ELIDALAEHVADLRAKGELPPPRKKRRRRKAS"
     CDS             559749..560168
                     /codon_start=1
                     /locus_tag="cgR_0500"
                     /product="hypothetical protein"
                     /protein_id="BAF53468.1"
                     /transl_table=11
                     /translation="MDIQQLDAETTAWKDSLLCATQEAGFHFEPPKLFEDFEAMVEQY
                     KQAAASDPDIDVTDIQQMWGIVVGEYLREKMGMDWVIITDDYGTDLAILATAPNGDHV
                     YSCPIIVVGKRFSTDYEPGQLEFFCNQFIVTSLAQLQ"
     CDS             560257..561276
                     /codon_start=1
                     /locus_tag="cgR_0501"
                     /product="hypothetical protein"
                     /protein_id="BAF53469.1"
                     /transl_table=11
                     /translation="MSTSSDYSHALIRRPRRLRANPAMRELVAETALRPADLILPMFF
                     ADGITEAREISSMPGVYQHTEDSLLRAAHEALDAGVRCVDLFGVPMDADKDFNGSQAW
                     SETGVLNRALASLRKEFGDDLLIMADTCLDEFTDHGHCGVVTEDRHGNAIVDNDATLP
                     LYQQMAVAQARAGAHIVSPSGMMDGQIAAIRAALDEEGYQDVAIMAYSAKYASAFFGP
                     FREAVGSSLQGDRRTYQQDPANLRESLLEAELDIAEGADFIMVKPALPYLDVLTRIAD
                     TSPVPVAAYQVSGEYAMIQAAGRNGWVDLDAVMMESLTSIKRAGANQILTYFAVDAAR
                     ALRNA"
     CDS             561306..561890
                     /codon_start=1
                     /locus_tag="cgR_0502"
                     /product="hypothetical protein"
                     /protein_id="BAF53470.1"
                     /transl_table=11
                     /translation="MSMLPNLTPKKSAPPSSSASAKNAGEKKEDTVKLLIQMWAVMIG
                     LELLHQILNVVMSFTDPTALRTVAKEQAAAQGLSEGIVNATVIAAILVMGFFNLIVIA
                     ILSWMVVMVKNRSKRLPTAFLLLTIFSFFFILRVLMLFFASPGGTDVPMALFAIDGCV
                     QILVGVSAGVAYALSRTEQPVKMLTDYAPEDAKR"
     CDS             561931..562443
                     /codon_start=1
                     /locus_tag="cgR_0503"
                     /product="hypothetical protein"
                     /protein_id="BAF53471.1"
                     /transl_table=11
                     /translation="MPSMFPSPATGGDDINRRPLNEPNADATTIPTALKVVFWMLFAT
                     AAFMIFTGLVMYTAGYTGPDDVDESYKAVVVNNQEFIGGINAFAGIVIAALTSQLPKG
                     GKNPRRLLLAIMLLVLLTDLLSFATRAGGFALAIIAVLLALEALLMFRPAVNDHIDRN
                     HMARVMNREK"
     CDS             562557..565193
                     /codon_start=1
                     /locus_tag="cgR_0504"
                     /product="hypothetical protein"
                     /protein_id="BAF53472.1"
                     /transl_table=11
                     /translation="MSTPDSSSVDKAVNTAISDAKTAALKAGVGLNRATAPEEEEDLS
                     SSIKVSLAFELEGLSNAPSLMAVEKALEKIPGVSADLIYPSQTAWITATDRVHPETLI
                     GVFEQFGIKAQLSNSSLLRRHQQLSAEVNREARIDRYRSRMDAKRISPRVRRHNRQEM
                     VHAVRARESGWIKRMNHTTSQHEDPMSGDVLFTARALITPMRLWVSLPFALIVLALSL
                     NPSWQFDYWQWLSAVLAIPVVVWGAWPFHRAAAGGIRRGISALDATSSIAIAAAYAWS
                     IAMLLFETPGNKSWRSYPSWFAFNHGTLTQNEIYFDVACGITVLLLGGRLLTRRRSQS
                     SLLAELGRLQIDPQRIVTVVRKHRLKRVVQELNIPVQEVRVNDDVKVPPNTTIPVDGT
                     VIGGGSRIAASIIMGQDQRDVKVNDKVFAGSLNLESEIKVRVIRTGHRTRIAAVHRWV
                     KQATLQENRHNRAAIRSAGNLVPITFTLAVVDFCLWALISGNINAAFTTTLAVLACVA
                     PVALALSAPLATRNSIEAAARHGILVRSGEIFRVLDDVDTAVFNRVGTLTDGEMTVET
                     VTADKGEDPELVLRVAGALAMESHHAISKALVKASREARDTGAGGEDVPHWIEVGNVE
                     ITEAGSFQATIELPLIKPSGEKIMRTTEALLWRPRSMTEVREHLSPRLVAAATSGGAP
                     LIVRWKGKDRGVITLSDHVRSDSSDAIIAIEEQGIETMMLSRDTYPVARRYADSLGIT
                     HVLAGIAPGKKAQVVRAVHTRGSTVAMIGDESVMDCLKVADVGVLMGVDRPSELRDDS
                     DDPAADVVVMREEVMSVPTLFKLARRYAKLVNGNIALAWIYNGVAMVVAVSGLLHPMA
                     ATVAMLASSLLIEWRSGRARKY"
     CDS             565309..566385
                     /codon_start=1
                     /locus_tag="cgR_0505"
                     /product="hypothetical protein"
                     /protein_id="BAF53473.1"
                     /transl_table=11
                     /translation="MSALTIPAARRTLNNAPIIDAANGKTPTRTPVWFMRQAGRSLPE
                     YKKVREGISMLDSCFMPELLAEITLQPVRRHDVDAAILFSDIVVPLRAAGVGVEIVAG
                     RGPVLDAPVRSREDVLNLPILEGNVPEVEQGIGIILDELSDSQALIGFAGAPFTLASY
                     LVEGGPSKNHEKTKAMMHGDPETWHALMARLVPTIVNSLKSQIDAGIDAMQLFDSWAG
                     FLTERDYTEFVLPYSTEILEEVGKYQLPRIHFGVGTGELLGAMSKAGSEVMGVDWRVP
                     LDKAAERIAAVSGPKVLQGNLDPALLFAGRAPLTKEIERIKAEAQTAIDAGHATGHIF
                     NLGHGVLPNTVAEDITEAVSIIHS"
     CDS             566401..567747
                     /codon_start=1
                     /locus_tag="cgR_0506"
                     /product="hypothetical protein"
                     /protein_id="BAF53474.1"
                     /transl_table=11
                     /translation="MRFAIIGAGLAGLTAAYEIHKADPTAQIDVLEAGERIGGKLFTV
                     PFASGPTDIGAEAFLAARSDAVEFFTELGLADSLVSPSAAKSQYFAGGALHAFPAGGV
                     MGIPSNPPAGAQDTAFDWTPGHDISVGALVRRQYGDEIVDTVVSSLLGGVYSSTADDL
                     GVRASVPALAAALDQLAEAGEPVTLSAAVKAVEAQREAAKTTSETRPVFQTFKGGYAE
                     LYEALAEQCGADIHLDSFVSAITKDGEGFAIKGGGEGTYDKVILAVPAPTAAVLLRDL
                     APTAAPHLRAIKLASSAVVGMRFDSSEGLPDNSGVLVAVNEPGITAKAFTFSSKKWPH
                     LEARGGALVRASFGRLGDEASARMDEDLLVDAALDDLLTITGFDGRAAGLGEIFVQRW
                     FGGLPAYGVDHIAAVSAARAEIAAVPGVEAIGAWAGGVGVPAVIADAQAAVHRLLG"
     CDS             567846..569159
                     /codon_start=1
                     /locus_tag="cgR_0507"
                     /product="hypothetical protein"
                     /protein_id="BAF53475.1"
                     /transl_table=11
                     /translation="MTHMTSSNTARSAEWFEKAQKLTPGGVNSPVRAFGSVGGQARFI
                     EKAHGSTLIDVDGNEYVDLVCSWGPMLMGHAHPAVVEAVQKAVVDGLSFGAPTIGEVE
                     LAQDIVKRTSVEEVRLVNSGTEATMSAVRLARGYTQRSKILKFEGCYHGHVDALLASA
                     GSGVATFALPDSPGITGAQTSDTIVVPYNDIEAVRNAFAEYPGEIACIIAEAAGGNMG
                     TVAPKDNFNDKLLAIAHADGALLILDEVMTGFRTSYRGWFGIDKVAADLVTFGKVVSG
                     GLPAAAFGGKAEIMNMLAPQGPVYQAGTLSGNPVAVAAGRASLKLADESLYTTINANA
                     DRLHGLISDALTHEGVAHHIQRASNMLSIRFAEGEGHNFSDMKAADTFRFAPFFHTLL
                     DNGVYAPPSVFETWFVSSALTDDDFSKIEQALKPAARAAAEAKAS"
     CDS             569156..569764
                     /codon_start=1
                     /locus_tag="cgR_0508"
                     /product="hypothetical protein"
                     /protein_id="BAF53476.1"
                     /transl_table=11
                     /translation="MTQTIVHLVRHGEVHNPEKILYGRMPGYRLSSRGRSQAARTAAS
                     FEGHDVTYIAASPLQRVQETSEPFIKVTGLELITDEDLLEAGNRFEGLRTKGWRSQLW
                     NPVRWPLMYNPTLPSWGEHYTDILERMMAAVERARVAAEGHEAILVTHQLPIVCVQRH
                     ARGQSLSHNPATRQCDLASVTSLVFQDDQIVGVHYNEPAQEI"
     CDS             569771..570394
                     /codon_start=1
                     /locus_tag="cgR_0509"
                     /product="hypothetical protein"
                     /protein_id="BAF53477.1"
                     /transl_table=11
                     /translation="MRLTKLAATIGCVTLSGLALVACSSDSTAGTDAVAVGGTFQFHS
                     PDGKMEIFYDEADRQQLPDIGGDSLMEEGTQINLSDFENQVVILNAWGQWCAPCRSES
                     DDLQIIHEELQAAGNGDTPGGTVLGINVRDYSRDIAQDFVTDNGLDYPSIYDPPFMTA
                     ASLGGVPASVIPTTIVLDKQHRPAAVFLREVTSKDVLDVALPLVDEA"
     CDS             570395..571201
                     /codon_start=1
                     /locus_tag="cgR_0510"
                     /product="hypothetical protein"
                     /protein_id="BAF53478.1"
                     /transl_table=11
                     /translation="MSEIVVAQSIGQQFADVAASGPLFLGILAAALAGLVSFASPCVV
                     PLVPGYISYLAGVVGGEVEYSAQGTKVKTKRFAVGGAAMLFILGFTVVFVLATVSVFG
                     AISVLTLNADTLMRIGGVVTIIMGIVFMGFIPGLQRDTRMAPKRWTTWLGAPLLGGVF
                     ALGWTPCLGPTLAAIISISAGTEGMTAARGVILIVGYCLGLGLPFLLIALGSSKALTG
                     VEWLRKHSRTLQIIGGVLLILVGVALLSGSWAIFINWVRQWTVEYGATLL"
     CDS             571238..572863
                     /codon_start=1
                     /locus_tag="cgR_0511"
                     /product="hypothetical protein"
                     /protein_id="BAF53479.1"
                     /transl_table=11
                     /translation="MLKTVKLYARKAWNWLTSMRTALALLFLLAIAAIPGALLPQRSL
                     NESNVIEYIENNGKLAEFYDKIQLFDVFSSTWFTAIYVLLLISLVGCILPRSWEHYKA
                     MRAPVVRAPRNLARLAHNGEGLVEKREEEVEKDARKLLKGWKITEYSAEEDRAGVRSI
                     AAEKGYTRELFNLIFHLGIVGMIVTAGLGRLFYYEGHVIVVTDGEQNQQNSVFCNTAT
                     ANYDSFRAGANFDGTGLTTFCFEAHDFSADYLANGQAEMFRSNISYAVGDDIQNDPET
                     WEDYELRVNHPLRIEGDRVYLQGHGFAPTFTVTWPNGETRTQTVQWRPDDPTFFLSSG
                     VVRFDPPAGMYPDLYERRQNQLAIQGLFAPTAEWEGDNNELLTSSYPAMRDPAVAIDI
                     YRGDNGLDTGIGQSLFSLDSTLMHSGVLQKIERVNLQIGDTVTLDDGTTVSFDGASEF
                     ANYQISRDPTQNWVLVTTVISLVSLVGSLMIRRRRIWVRFYPQENGTTRVETGGLART
                     DRAGWGGEYEKFHRELLGLKEEDEDEEYFDHDD"
     CDS             572923..573936
                     /codon_start=1
                     /locus_tag="cgR_0512"
                     /product="hypothetical protein"
                     /protein_id="BAF53480.1"
                     /transl_table=11
                     /translation="MLPVNQTYAQFSDTAFVSAYIIYVLALILSLVYYVKQQGIIDAR
                     REQTRVSELVGAGGSADVDTDLPDDIADGVLADEDLAKREETARKLANMTQSLMWLGV
                     MAHLVSVVMRALSASRFPFGNLYEYILMVTLFAMIGAVLILQRPQFRVVWPWILTPML
                     ALLFYGGTQLYSDAAPVVPALQSFWFPIHVSSVSIGASIGIVSGIASLLYLLRMWQPK
                     GKEKGFFGAVAKPLPSGKTLDNLAYKTAIWTVPIFGLGIILGAIWAEAAWGRFWGWDP
                     KETVSFITWVLYAGYLHARATAGWRNTNAAWINILALVTMIFNLFFINMVVSGLHSYA
                     GLN"
     CDS             574792..575595
                     /codon_start=1
                     /locus_tag="cgR_0513"
                     /product="hypothetical protein"
                     /protein_id="BAF53481.1"
                     /transl_table=11
                     /translation="MTSTAPEPVRKKPLIPRNTLVTAIKAVVGIAGLFVVWELIVLIT
                     NPPRFLLVGPSAAFAELFNRPGYFASNAWVTLQEALAGFVLGTALGVLCGAALHYFPA
                     VRTFLYPALVAIDTIPKVALAPLFIVWFGFGFESKVFVAMAIAFFPLVINTFDGLSSV
                     PHELKELARINRATTWQRLSKIEFIYAVPSIFSGMKISISLAVGGAVVGEFISGSKGL
                     GYVILLANSQVDLASMFAAFIVLASISLALFYAVDLAAKRLVPWKTYAK"
     CDS             575637..576674
                     /codon_start=1
                     /locus_tag="cgR_0514"
                     /product="hypothetical protein"
                     /protein_id="BAF53482.1"
                     /transl_table=11
                     /translation="MNMKKVAAITAALALTIPLVSSCSSNSTGDSIDVMMDVGYLPKH
                     APFFAAVAEGFFDEEGLDVSLMPGSGSNNTVTSVETGRVFAGFADFGVTVMNQGRGAQ
                     VRQVNLLQARSSYAAVADKASGIESWDDLKGKTVATEGAGAMVSMWPYALNQLGYSEG
                     DINVVHASSESKIPGLLAHQWDANLALAVSDAPALAALGLEPVVLNWADIGISLYGNG
                     MVVSNETIENEPEKVERFNRALQKGFLWACENPEQTYKDFNAEVQGYEESTILLALEE
                     QCALNWQSDTTKDPFGTMTDEGVQEMIDVAQEYLGMDPSVTITPDQVYTNEFITPITQ
                     GTVIAAPSQEK"
     CDS             576769..577461
                     /codon_start=1
                     /locus_tag="cgR_0515"
                     /product="hypothetical protein"
                     /protein_id="BAF53483.1"
                     /transl_table=11
                     /translation="MDFDVKPGEFVSIVGQSGSGKTTLLKTISGLQQATEGEVLVNGK
                     PIAEQVEDIAMVFQAPVLLPWRNNVNNVLLPLEFRGTKTRESTDRAYQLLEMAGLKGK
                     ETRYSYELSGGMQQRVAICRALVSNPQLLLMDEPFGALDAMTRDSMNFELQKIWMREK
                     CSVLFVTHSISEAVWLGDRVIIVGDRPGHIVADIKIDIPRPRAKEHRFSEVFSDYVAE
                     IESFIGVTTGIS"
     CDS             577493..579139
                     /codon_start=1
                     /locus_tag="cgR_0516"
                     /product="hypothetical protein"
                     /protein_id="BAF53484.1"
                     /transl_table=11
                     /translation="MHLTSNPARLKELFNLDAQKSLLFSAIRLDSHPLVAPIIATVKD
                     QDPILLVRQQEQGNIFSSGVPRNKIRFYAPWVTIDDAPLEGVEAASSLQELIKELADE
                     TPVCFAPDIAYAHYLVAQDQVQIAVESLSPEAIDVVELEKGLVEKRFADWRRAGVEEA
                     KKLVSGIAHLEGLDQELDRVGADTRFELLQEIASQHALSAIYVASPPNFSEITGIAAT
                     EGASVLWSADTQSVFLFLPQGAPAPEGSEAVGSFGSVSEAVALLIGEDKAVGVEEEFI
                     GTALALSLTEGEIIPIQTELGHWRDVRDSEDLPFQVIASRTSVTIMENTLEWTNNRLE
                     RGEEFTELDIYAHYLEELEDYALQFTFDVEPYFTNLHSSNRMLFPGPPVDFPINAETR
                     CIQLDAGIAVKKDGVVLGTSDMARSLPRTAAGQEAYEYFFKVVREGIIGQLRPGVICA
                     DVHEATLDYLSPQLPRMIDIGMLGADTDFNTIYRKRNVGHLMGKQESFANELRPGYKH
                     ILHHGSYGAAEIPWRYNGVAIGTEDLWYIGADKTYILSQR"
     CDS             579150..579623
                     /codon_start=1
                     /locus_tag="cgR_0517"
                     /product="hypothetical protein"
                     /protein_id="BAF53485.1"
                     /transl_table=11
                     /translation="MTEIAENLQRLGIELPDLPAPQYSYVPFNRQGNTLYVSGQISRT
                     AAGDILAGRVGEDATLEEGIHAAEAATINLLARIHQSIGLDNVAQILKLNVWVNSSDD
                     FIQQPQVADGASQLLEAVLGEAGKHARTALPTNTLPQGALVELDAVVAITEASEA"
     CDS             complement(579620..579979)
                     /codon_start=1
                     /locus_tag="cgR_0518"
                     /product="hypothetical protein"
                     /protein_id="BAF53486.1"
                     /transl_table=11
                     /translation="MTSVIPSSADSATEQRFAPLKSVPSRITDIAEEASDFYKALGDT
                     TRLEILYLIFTTKSSRVSANALAHTLNISAPTVTHHMKKLIAANLVNREQCGKWAYFS
                     INSAHIDTVAEIFAHSS"
     CDS             complement(580069..580371)
                     /codon_start=1
                     /locus_tag="cgR_0519"
                     /product="hypothetical protein"
                     /protein_id="BAF53487.1"
                     /transl_table=11
                     /translation="MGRLLLIILVIVAIVLLWKAFKPSTWKRNAEINQGQAPRAVKGP
                     DDDEEFLWNIEKNRFKQRRAEEAAQLEEEERLKRARERYAKPEASDDGTEKPTEDS"
     CDS             580448..580801
                     /codon_start=1
                     /locus_tag="cgR_0520"
                     /product="hypothetical protein"
                     /protein_id="BAF53488.1"
                     /transl_table=11
                     /translation="MSRVEYVSESNTPNIQTHQAPELNPELQKAARKNVLIYGLARLL
                     LFVVLTLIIHGLALLISAPVPLVMSAMLALIVAFPLSMLVFSKLRMNATQAVSQWDAQ
                     RKAHKEWVRSELADR"
     CDS             complement(580863..581759)
                     /codon_start=1
                     /locus_tag="cgR_0521"
                     /product="hypothetical protein"
                     /protein_id="BAF53489.1"
                     /transl_table=11
                     /translation="MSHTEPQPNSVTLSDWIQGARPHTWANAFAPVIAGSGVAAFHDG
                     FVWWKALLALVVAWALIIGVNYANDYSDGIRGTDEDRTGPLRLTGSGLAEPKKVKAAA
                     FISFGIAGVAGTALSLLSAWWLILIGILCVLGAWFYTGGKNPYGYRGLGEIAVFIFFG
                     LVAVMGTQFTQTGSVSWAGLAAAVGVGSMSAGVNLANNIRDIPTDSKTGKITLAVRLG
                     DAGARKLFLALISTPFIMSICLAFVAWPALIAIIIFPLALKAAGPIRNNAAGKDLIPV
                     IGSTGRAMALWAVLTGLALAFS"
     CDS             581899..582765
                     /codon_start=1
                     /locus_tag="cgR_0522"
                     /product="hypothetical protein"
                     /protein_id="BAF53490.1"
                     /transl_table=11
                     /translation="MWVGYAVRQIASVFLTLLRMLPLAARNRVARGRIPETGDVVISL
                     TTHGKRINYVHFTIESIARGHVKAPIVLWLDKPDFDAPWPATIKRLVARGLQVRCSDG
                     FYGPHTKYWNQFREIHGTGVRVATVDDDMIYPEWFLQRLLFIGDLRMDAVVAYRAHRI
                     ELRDDRMLPYVKWSAADTSKASFLHFATGVSGVLYPVTFIDYVVSQGDVFLENCKRAD
                     DVWLHACALRSDHPIRQVYAQPRHFAVVPTTQVGALVVGNTLMGGNDEQIAKVYTDED
                     VAKLVAASKNED"
     CDS             complement(582762..583997)
                     /codon_start=1
                     /locus_tag="cgR_0523"
                     /product="hypothetical protein"
                     /protein_id="BAF53491.1"
                     /transl_table=11
                     /translation="MAQVHGASTGFWQNARPKPSATTPNSEPSALESRNMNTRVLEAL
                     PVDLADPTAILGDLEDAISGKKTFLPIPVQDKTRAQLLRDSQRVGLAIDPSIALVMAT
                     SGSTGTPKGAQLTPLNLVSSADATHQFLGGEGQWLLAMPAHHIAGMQVLIRSLIAGVE
                     PLAIDLSTGFHIDAFADAAAELKNTGDRVYTSLTPMQLLKAMDSLQGIEALKLFDVIL
                     VGGSALSKQARISAEQLDINIVTTYGSSETSGGCVYDGKPIPGAKVRISDEHIELGGP
                     MIAQGYRNAPEHPDFANEGWFTTSDSGELHDGILTVTGRVDTVIDSGGLKLHPEVLER
                     AIADIKGVTAACVVGIPDPRLGQAIVAAYSGSISPSEVIEGLDDLPRWQLPKRLKHLD
                     ALPSIGPGKADRRAIAKLF"
     CDS             complement(583945..584358)
                     /codon_start=1
                     /locus_tag="cgR_0524"
                     /product="hypothetical protein"
                     /protein_id="BAF53492.1"
                     /transl_table=11
                     /translation="MTMSTTREIAFLIARILLGVILIAHGWDKFAITGLEGVTGFFDS
                     LGIPAAGIAAIAAAVVELLGGILIILGVFTRIVAAFVAIDMLFAALFAHVSSGIFVTN
                     NGWELTGAIGAGALLLIAVGAGAWSIDGVLAKRKA"
     CDS             complement(584437..585999)
                     /codon_start=1
                     /locus_tag="cgR_0525"
                     /product="hypothetical protein"
                     /protein_id="BAF53493.1"
                     /transl_table=11
                     /translation="MITATALHGCSLIDGEWVAGKNGEITGFDPRTNASLNPSYSLAN
                     RAQLRAATTSAKRAFESYRLTTPEVRADFLDSIADNIDDLTEEIVQRASLETGLGTTR
                     LTGEVARTSNQLRLFAETVRSGQFHRVRIERGPRIDLRQRQVPLGPVAVFGASNFPLA
                     FSTAGGDTASALAAGCPVVFKAHNAHPGTAELVGQAVRGAVEKHEFDAGVFNLVYGRG
                     VEIGQELAADPNITAIGFTGSRQGGLALSQTAFSRPVPVPVFAEMSATNPVFVFPGAL
                     ADLDASSSLAEAFTASVTGSSGQLCTKPGLVFIPRGVAGDAFVELVAAKFKETTGQTM
                     LTQGIAQAWQRGVDNLAAQPSVKILAQGTPGDGENAPGPVVFESDVQALLNNAVLQEE
                     IFGAASLVVRYDSPDQLHQVANSLEGQLTATIHASQDDFQEVSEIIPLLEDLAGRVLY
                     GGWPTGVEVGHTVIHGGPYPATSNAQSTSVGTLAIERFMRPVSYQTFPAELLPDPVSE
                     VNKWAVPREIDR"
     CDS             complement(585996..586946)
                     /codon_start=1
                     /locus_tag="cgR_0526"
                     /product="hypothetical protein"
                     /protein_id="BAF53494.1"
                     /transl_table=11
                     /translation="MARFSPQDLADHLKDGLLSFPATAFQDDLEVDEVAYVEHIEWQS
                     SYPVAGLFAAGGTGEGFSLTVEENHRVTQLAVQASSPEVPVLGSATGSTKSAIANAQG
                     AEAAGAEGVLLLPPYLTECDAEGLYNHAAAVCESTSLGVIVYNRANAIYSPEVIARLS
                     ERYPNFIGFKDGTGNIEHLAKITTLCGDRLFYLGGLPTAETFALPLLQMGMSTYSSAM
                     FNFIPDFALSFYADVRAQDSAAVKQKLSDFVLPYLDIRDRAQGYGVSIVKGGLKAVGR
                     NAGGVRPPLRNLSEQDIADLSDLLATSGAGSYRLPVEVKA"
     CDS             complement(587040..587921)
                     /codon_start=1
                     /locus_tag="cgR_0527"
                     /product="hypothetical protein"
                     /protein_id="BAF53495.1"
                     /transl_table=11
                     /translation="MFTLEQLRCFVAVANHLHFGKAAAELSMTQPPLSRQIQKLEKIV
                     GATLLDRDNRKVELTTAGLAFLKDARLILNSTEKAAERARLASSGMWGQLNIGYTAAA
                     GFSILGPTLNQLHEKMPGVSVDLFEMVSTEQVDALESGLLDLGIGRLSSPVEGLQTRR
                     LQADSLVLAAPKGHPLLDQNRPLLRKHLTGVPFLQHSPTKAKYLYDIVVRNFTINDAQ
                     VQHTLSQITTMVSLVASGLGVALVPESAKKLNYSGVEYRHFYDLPVGLAELQAIYSTS
                     NDNPALRRFIKNIDDTF"
     CDS             complement(587937..588254)
                     /codon_start=1
                     /locus_tag="cgR_0528"
                     /product="hypothetical protein"
                     /protein_id="BAF53496.1"
                     /transl_table=11
                     /translation="MSHNDSPNFARRALNWLRQGYPTGVPRHDTFALFYVLERELTEA
                     DLNELVELLIAEGENNGLHDKPITREKIGELITHVHSQPPEDEDIDRIQKKLQAEGFP
                     TRN"
     CDS             complement(588401..589153)
                     /codon_start=1
                     /locus_tag="cgR_0529"
                     /product="hypothetical protein"
                     /protein_id="BAF53497.1"
                     /transl_table=11
                     /translation="MTKLFDSHFHIIDPNHPLTENNGYLPELFTVDDYITRVEGLNVA
                     GGAVVSGSFQPFDQGYLKDALAALGPGYVGVTQIPAGTSDQEILDLDKSGVKAVRFNL
                     KRGGSAGLDDLETLARRVYDLAGWHTELYVDARELDELESTLTSLPAVSIDHLGMHRD
                     GLPALLRLVENGIKVKATGFGRVELDPAEVIKAIMAADPTALMIGTDLPSTRAKRPFE
                     DADLDLIAETVGEDHVDNVFWNNAAAFYLGDQ"
     CDS             complement(589157..589576)
                     /codon_start=1
                     /locus_tag="cgR_0530"
                     /product="hypothetical protein"
                     /protein_id="BAF53498.1"
                     /transl_table=11
                     /translation="MKDTLTTGLTHQMTYAVPANRTVPNLLPEAAEFETMPDVLATGY
                     MVGIIEWACMELLRSHLDDGEISLGTHVNFSHSAPTVPGSTVTIDVEVAEINRRAVTF
                     NITAADEFATISTGTHQRGVVNRDRFVSRLPEAPKEN"
     CDS             complement(589573..589698)
                     /codon_start=1
                     /locus_tag="cgR_6024"
                     /product="hypothetical protein"
                     /protein_id="BAQ21086.1"
                     /transl_table=11
                     /translation="MLIHCANVRAITTGEITGIVDAKQAATKIFNIRRGTLGETS"
     CDS             589741..590274
                     /codon_start=1
                     /locus_tag="cgR_0531"
                     /product="hypothetical protein"
                     /protein_id="BAF53499.1"
                     /transl_table=11
                     /translation="MSDKLYERLANPGFVFGRLPRGLGDREFHRSVGKRASSETWLWV
                     SFDEPIKQRENATVGVGRPVVQVCGDAAFSGVTTALKNCGGQAGFGAELGVQRRFGHS
                     GFSHDPADSDRADPFCIEQSSGFGEEFLPACRVHANNLTYRSVKRLAFEGNLYGKASG
                     RIKTMAKTRPLWKRPGL"
     CDS             complement(589864..590148)
                     /codon_start=1
                     /locus_tag="cgR_6025"
                     /product="TetR family transcriptional regulator"
                     /protein_id="BAQ21087.1"
                     /transl_table=11
                     /translation="MYSTSGEKFLTEATRLLYAEGISAIGVGRVVAESGVSKSTLYAQ
                     FGTKAGLSSTVLQRRSDTRKRGITAYLDNRPPDTDSGVLALFDRFIKGYP"
     CDS             complement(590301..590564)
                     /codon_start=1
                     /locus_tag="cgR_0532"
                     /product="hypothetical protein"
                     /protein_id="BAF53500.1"
                     /transl_table=11
                     /translation="MNFATIFGSIFEVTLVGILLGAGLPALFALGIRFAHGPSSEGSN
                     AFGKIASTICFAIIAVAIIAGILWVTKATIYQYSGFDVFGTEG"
     CDS             complement(590564..591829)
                     /codon_start=1
                     /locus_tag="cgR_0533"
                     /product="hypothetical protein"
                     /protein_id="BAF53501.1"
                     /transl_table=11
                     /translation="MTELIILLIVIVTALAFDFTNGFHDTGNAMATSIATGALKPKVA
                     VALSAALNLVGAFLSVEVATTVAKGVVDLDQFDLSNAWDSHQLLLVVFAGLIGAIVWN
                     LLTWLLGIPSSSSHALFGGLIGAAIASLGFGGVVWEGVLSKMIIPALAAPVVAGLVAA
                     IGTFAVYSITKAVGDNEKNRYFRWGQIGSASLVSLAHGTNDAQKTMGVIFLSLVATGH
                     LGTDADIPFWVKATCALAIAIGTYLGGWRVIRTLGKGLVEIDSPQGMAAETSSAAIIL
                     TSSHFGMALSTTHVATGSIMGTGLGRKGAKVRWSVAGRMAMAWIITLPASAIVGVFCW
                     WIAHGIGLISSDLLGVLVAFAILVSLSGYIYARSRRVPVDPSNVNADWNEESNSVEPA
                     APSTPAAPKATEAAEAPAVQDLNENEVTK"
     CDS             592977..593129
                     /codon_start=1
                     /locus_tag="cgR_0534"
                     /product="hypothetical protein"
                     /protein_id="BAF53502.1"
                     /transl_table=11
                     /translation="MPRKYSVELKEKAVHQIIEMVRLESCSLHRAYTEVGELWSISSH
                     VAGLVP"
     CDS             593327..593443
                     /codon_start=1
                     /locus_tag="cgR_6026"
                     /product="hypothetical protein"
                     /protein_id="BAQ21088.1"
                     /transl_table=11
                     /translation="MRWVHWWNTKRLHEALDYAILQVVETKCYLTQPINTGA"
     CDS             594029..594808
                     /codon_start=1
                     /locus_tag="cgR_0535"
                     /product="hypothetical protein"
                     /protein_id="BAF53503.1"
                     /transl_table=11
                     /translation="MQRVYKNVIKASVYEGNGQWGRIDDFHPEQVLFDAGEAWPKSKT
                     DQLLNDTDVVPVLEDTPTPTPKTTDLGQRVGYVRVSSTDQNLARQREAIGAVDREFVD
                     ELSARSRAQRPSLEECIAYLRNHDELVVASIDRLARSLVDLRSIIDQITAKGASVSFI
                     KEGLVFSATDQDPRATLMLGILGSFAEFERSIIRERQAEGIALAKKAGKYSGRKKALS
                     PAQIKQARDRIDAGESKTAIAQDLGVGRATLYRYLMTDNKR"
     CDS             complement(595033..597774)
                     /codon_start=1
                     /locus_tag="cgR_0536"
                     /product="hypothetical protein"
                     /protein_id="BAF53504.1"
                     /transl_table=11
                     /translation="MKGNVKDIYTIFDGTDKELIIPVYQRNYDWGEKQCERLYNDLVD
                     VIRKDRPKHFFGAVVGKPETGFTWVVIDGQQRLTTTSLLMLALSNSLARGILTSKDPE
                     LADKIRRNYLEGADSSVTKETKLKLKPVKHDLEAYRKLLADEEPIEKSTVTANYRYFM
                     DRIAQGELTGDELWDALCRLEAMILDLEAHDDPQRIFESLNSTGKELKESDKIRNLVL
                     MGLPSKTQEHLYEYFWNRLERNVHFDTDAFVRLYLVSTTRKTPRFDAVYEAFREYLET
                     SGISVQDVLELMRNYSEYFRDLNSASTGIARADTRLRRFNLLRHEVTMPALMPLLGDY
                     RSGDITADDFADTIELVDAYIFRRLVVGVPSNALNKIFATLYSDARRLRTEGTKITDI
                     IAYLLLRRAGTSGRFPTDEEFQEAFSTRNFFNFTAANRRYLFECLENTWSKDNRAIAT
                     AIERGDLSVEHVMPQTLTKDWREELGSQAEEVHQTWLHRIGNLTITGYNSEYSNASFT
                     TKKTTKDGFDSSPYRLNEYIKQAVTWAEDDIRHRNKTLTQIALRYWPMIDTDFEPVRE
                     PLPTLPMGDDTSFTNRIIVSYEFDGTTTTVKSFKDMIIFVIRQLLAEHREMMYEYATG
                     NGLGFTLGKTGSSRYQEELAPELWVTVSNPTNDKMNILRALFNHLDIDTDDLVFTLRP
                     HQGEAPEAADQNPYAELIKFAPQFESLEGTDATENDIAELRAEFGKVFNDFEIEDWQK
                     VTNGRGYVQLAEAPAVAELSVEEVLATIMMIKVIESMAPGIFLRTVTEGALARWLNRI
                     AELTEPKKTAGGRNTAAMWEKLHQLVDAIPRGKWVSYGDLAKAIKSGAQPVGNYLAAN
                     PVEKAYRVLRADGTVSEGFSWLDENDKRSPRELLEHEGIRFDDVGRAASVQRWEIPE"
     CDS             complement(598201..598653)
                     /codon_start=1
                     /locus_tag="cgR_0537"
                     /product="hypothetical protein"
                     /protein_id="BAF53505.1"
                     /transl_table=11
                     /translation="MRPTSGSATGGATSDLAITAGGQTLDFYLSPKRNVAAAKRFLAK
                     TLRSNTITGSPRVINTDKAPSLTRAIAELKSEGICPPTVEHRQVKYLNNILEGDHGRL
                     KRILGPKVAFKNLDICISDVERDGGDALDSRKGQGTMFALTGNRTRTR"
     CDS             complement(598610..598732)
                     /codon_start=1
                     /locus_tag="cgR_6027"
                     /product="hypothetical protein"
                     /protein_id="BAQ21089.1"
                     /transl_table=11
                     /translation="MPDRQVPDRQVPDRQVPDRQASSWRVDETYIRVGDRWCYL"
     CDS             complement(598865..599161)
                     /codon_start=1
                     /locus_tag="cgR_0538"
                     /product="hypothetical protein"
                     /protein_id="BAF53506.1"
                     /transl_table=11
                     /translation="MTLGSARERLLDAARKRFYADGVHATGIDTITSEAGVAKKSLYN
                     NFSSKAEIVSTYIDSRHEEWLDLYRQHTAKASTARDRVIAVLLQSWGSRKIDVK"
     CDS             599297..599968
                     /codon_start=1
                     /locus_tag="cgR_0539"
                     /product="hypothetical protein"
                     /protein_id="BAF53507.1"
                     /transl_table=11
                     /translation="MALSFNVYLSGEIHTDWREEIQRGAEAAGLDVVFTAPVTDHPAS
                     DAAGDHLGEAPAGFWRDHQSSKVNSIRTRSLIEKADMVVVRFGDQYKQWNAAFDAGYC
                     AALDKPYATLHGEDIVHPLKEVDAAAQAGCTTTDQVVEILRYMLEAEEALLSCASPLS
                     RQAQRHGEPTLSPRPEFHRTAVGFRNCIDDRQPQALACPRGPLRPCEGLHPRADLRRV
                     QLRPT"
     CDS             complement(599771..600805)
                     /codon_start=1
                     /locus_tag="cgR_0540"
                     /product="hypothetical protein"
                     /protein_id="BAF53508.1"
                     /transl_table=11
                     /translation="MKLSLRARITVVFLGTVLGVGLALIGLVYAYLKLTPVPFMAQIP
                     TPDEGLVIDGAVPIADEVLRRVLVASLTVLALLTAVAGVIGWFVAGLVIKPLRDFADD
                     AATVTRGDLSARISHQGPDDEVGELADALNAMLDELADGLERQRRFASNASHELKTPI
                     ATIQTMADVALASGDEQILRETLGRVREVNARAADTVAALLQLANVDVRDRQEVDLAA
                     LCRDIGCGQGVPVTAEALTVAASPTLVRQAVENMVCNGLTHGEDPSVTVAQAGRNAEI
                     TVESGGPQLDAAEVRTWVEPFARAQRTAGAGQGLGLAIVDAIAKAHGGSVELRPRAQG
                     GLAVTLRLPA"
     CDS             complement(600802..601476)
                     /codon_start=1
                     /locus_tag="cgR_0541"
                     /product="hypothetical protein"
                     /protein_id="BAF53509.1"
                     /transl_table=11
                     /translation="MTIRVLVVDDESYLADAICTALNSAHMQATTVYDGATARSSIDD
                     IRPDVVVLDRDLPGIHGDDICRWVVDTHPATRVIMLTASGALDDRLAGFDLGADDYLP
                     KPFEVSELIARVNALAKRNLPVRGEVYRCGDVRLDTFRREVTRGGVAVPLSPKEFAVL
                     EVLMEAAGGVFSAEDLLAEAWDENADPFTNSPRVTVSHLRKKLGEPRIVHTVAGAGYY
                     VAEVPR"
     CDS             601553..602440
                     /codon_start=1
                     /locus_tag="cgR_0542"
                     /product="hypothetical protein"
                     /protein_id="BAF53510.1"
                     /transl_table=11
                     /translation="MQNRNVGIDVARAVALVGMMVAHLTYLDGVAVQVFYGFPAALFA
                     FVSGVSMGYMRARPAQLIVRGLCLIALHFALAPFTGQVFVVLGTIGLCMALLAWAPRW
                     SSPVLLWLACVLAFGSAVLASTATVLIPAFWPYSPLMWGALMIAGMLFRWHMLSPKLL
                     WLGLVVGLGLFAVDLALRWYTMLPEFFDVGGHTGGLGDITGSIGASVGICSLCCLLQR
                     WIGWLAPLGRMPLTIYCIHVLTADRLAPEWFGFWVSFGGAILISYAWLAVCDRGPLET
                     LLRRITAVFGKDKNEEVRS"
     CDS             602421..603302
                     /codon_start=1
                     /locus_tag="cgR_0543"
                     /product="hypothetical protein"
                     /protein_id="BAF53511.1"
                     /transl_table=11
                     /translation="MKKFAASVAAGVVAAGALAIAPAGAMESKTFAGDTEEAKPVVSV
                     RVDDSDPEEGVCTGTAIDRHWVITARHCIDAAAKPGGSVRIGQGDEQRVYKVDRHEVA
                     PRGDIALLHTEQEINLETFAEIADEVPTGDVNIYGWSSDGSGGSTKLPSAKAKVRGDS
                     PLALYEAPKALDVALKDGDRIQPGDSGGAIFADGKVAGIMSAGLFEDPENPTEEEMTS
                     NAAVSVAPVAEQADWIRGTIGGDAKDGDKKEDTSEPAAAASSEDSGNTARNVGIGAGV
                     VVLAAAGAWLLLRRRGA"
     CDS             603605..603769
                     /codon_start=1
                     /locus_tag="cgR_6028"
                     /product="hypothetical protein"
                     /protein_id="BAQ21090.1"
                     /transl_table=11
                     /translation="MPVDHTTILTAGYRNTPLSWTSTLGGTGQVPDWQASSWRVDETY
                     IRVGDRWCYL"
     CDS             603726..604178
                     /codon_start=1
                     /locus_tag="cgR_0544"
                     /product="hypothetical protein"
                     /protein_id="BAF53512.1"
                     /transl_table=11
                     /translation="MRPTSGSATGGATSDLAITAGGQTLDFYLSPKRNVAAAKRFLAK
                     TLRSNTITGSPRVINTDKAPSLTRAIAELKSEGICPQTVEHWQVKYLNNVIEGDHGRL
                     KRILGLKGAFKNLDICISDVERDGGDALDSRKGQGTMFALTGNRTRTR"
     CDS             complement(604418..605335)
                     /codon_start=1
                     /locus_tag="cgR_0545"
                     /product="hypothetical protein"
                     /protein_id="BAF53513.1"
                     /transl_table=11
                     /translation="MSKKSQEPRNYRTGRASATAGAGIFSTINKADRVAFYDRSIVLS
                     RIFANDPNSWVLKGGTALIWRDTTARSTRDIDLFNSAAEDINEALHALRNSLETISTA
                     PSDVHLVIDSAKIDVSAQGNRQQAALQVRLQSASGMPLSNTPVKIDLVVGCHVTGEVD
                     AHPTDGLEKVLQSHVPHIRLYPIVDHLADKVAATMQSYPSSDGDSPSSRVHDLIDIAH
                     IAVTEEINGTQLLVAIESERIQRGLPPYEQGFQCPPHWAELYRKRKGSKGSAPQSFDE
                     AVDIAKRLIDSAIFGKSLGMTWKDGSWHA"
     CDS             complement(605301..606275)
                     /codon_start=1
                     /locus_tag="cgR_0546"
                     /product="hypothetical protein"
                     /protein_id="BAF53514.1"
                     /transl_table=11
                     /translation="MRIEEIATLASDQNGLFTTAQAARLEVDRVTLHRAARNGVVRSI
                     RHGVYIFESAPFSPDEELRAAWLSLDPSRTVAERLQTPEQIVICTTSAAQQYGIGDFD
                     TPQHEFYSAQRKQTRADDIRLRIRTLDNEDIEIRDGLPLTTPTRIILDLLEERHDLVH
                     ISRLIADAARKGLKVEWSRLATHAHKFAGDYQLTDDGLLQALAESSESTSDTAMAALS
                     MLESSSHLNDLFNKDLANLVGGFSKHLTIQMPEIPDLAAQLSRVQLPDIADQIPDLGF
                     LPNVHSQIHDYLHHDNAVNFTKDSHTSTNKKEMRNTSNEQEKPRTTQL"
     CDS             606626..607357
                     /codon_start=1
                     /locus_tag="cgR_0547"
                     /product="hypothetical protein"
                     /protein_id="BAF53515.1"
                     /transl_table=11
                     /translation="MAPLLATPEQVTRISELLAVKAHSDNGKVITVGTTRFRASRSTL
                     PALSMTVAQRLINALQSAEVKPDVPAGMFTAISGNWFMRIKKSDYVEGEPAVIMRRDG
                     SHVNVLMHGIVEDLDDEYYAIEFSDQDKEKRTQAAPLDSNYASYTFLRNAPDGSRVWG
                     LKVPSQVYVHHGFVDVRKANGALKSEPMGHIVTDASTHVICEIEQQSLSSCTVCGERR
                     GRLLFDGVKCLKCGFDLIAYNNEKR"
     CDS             complement(607997..608449)
                     /codon_start=1
                     /locus_tag="cgR_0548"
                     /product="hypothetical protein"
                     /protein_id="BAF53516.1"
                     /transl_table=11
                     /translation="MRPTSGSATGGATSDLAITAGGQTLDFYLSPKRNVAAAKRFLAK
                     TLRSNTITGSPRVINTDKAPSLTRAIAELKSEGICPQTVEHWQVKYLNNVIEGDHGRL
                     KRILGPKVAFKNLDICISDVERDGGDALDSRKGQGTMFALTGNRTRTR"
     CDS             complement(608406..608570)
                     /codon_start=1
                     /locus_tag="cgR_6029"
                     /product="hypothetical protein"
                     /protein_id="BAQ21091.1"
                     /transl_table=11
                     /translation="MPVDHTTILTAGYRNTPLSWTSTLGGTGQVPDWQASSWRVDETY
                     IRVGDRWCYL"
     CDS             608666..609190
                     /codon_start=1
                     /locus_tag="cgR_0549"
                     /product="hypothetical protein"
                     /protein_id="BAF53517.1"
                     /transl_table=11
                     /translation="MTTGEGTYGCDYFTSLFLLPQLCNNTVSRSDPLDVLFVARTFPV
                     LSYPVENQLADKVCAMYEVHGSRASTRYRDLYDIGLIALELEVDTEKLRTALQNQQHI
                     RAITLPSRMVLPGEEWLIGYEKFISTLQQPRAELHGVDNALVVAGALLDPILTDDGQT
                     LAPSGDTPTCTGPS"
     CDS             609477..611009
                     /codon_start=1
                     /locus_tag="cgR_0550"
                     /product="hypothetical protein"
                     /protein_id="BAF53518.1"
                     /transl_table=11
                     /translation="MATAQSERIIAPEDRDTYVSEFQYDVNNPPVVDGVGGLTEAEIA
                     EIQDKIQQAEASGPPQDEIIPGQMWSDKVGIPEGYDKTEADRSEVAIATEQSQPQART
                     FMATAERCKSFWLIPFKVCGEILDRYEALGGETSWLLLPIEHQSINPDGQGHRQRFVG
                     GVIYQHPDTGAHAVSPMTMALWQRHGWEAGWLGYPLGGEVPVEGSTTIDGEISGWVQQ
                     FQGGRVYRTPILEGFQIASINGVILDKWLELGGPSGYLGFPIADEAGVTDGMGRFSIF
                     QRGEIYWAPGLGAHAVSGTILDDWKSAEGPAGDFGYPIAPMEWVDEFTYIQSFEGGEI
                     QGEVSQGFAPRGLTSQYIQADSQEEADAYFDAIEDEWIAESLGSPGISLMQKGAPVTY
                     GPCILKPNNIHIRTKSGESDFGIVGFKPSTTCTKPVSSIQHTTNLRYKYYQWWLKAAS
                     ATAYSDPGLTTTLVQKNIEHHCRGHVDTWFWGTAAGVINYGGKEYYARVYPDIARFSC
                     RV"
     CDS             611195..611470
                     /codon_start=1
                     /locus_tag="cgR_0551"
                     /product="hypothetical protein"
                     /protein_id="BAF53519.1"
                     /transl_table=11
                     /translation="MDCGKNSSWRPVHGEPVIVAFSPGYSMEEGACPGGEEPVDVRSF
                     LDRDTAVNYLRWFDRNLSPEFWEHEFWEVELGWEASGLKELMKSWQE"
     CDS             612069..612779
                     /codon_start=1
                     /locus_tag="cgR_0552"
                     /product="hypothetical protein"
                     /protein_id="BAF53520.1"
                     /transl_table=11
                     /translation="MGIFSGRQFPREIILWAVRWYCRYGVSYRDLEEMMTERGVPVDH
                     TTIYRWVQKYAPELDKKTRWYRQVPDWQARSWRVDETYIRVGGKWCYLYRAITAGGQT
                     LDFYLSPKRNVAAAKRFLAKTLRSNKSAGYPRVISTDKAPSLARAISELKAEGVCPST
                     VEHRRVKYLNNVIEGDHGRLKRILGPKGAFKNRTSAYRTLKGMEAMHSLRKGQGTMFA
                     YGHPNPDAVIVSRVFETA"
     CDS             complement(613201..613287)
                     /codon_start=1
                     /locus_tag="cgR_0553"
                     /product="hypothetical protein"
                     /protein_id="BAF53521.1"
                     /transl_table=11
                     /translation="MAEELNENYPGGRERAEEELKAWIMQST"
     CDS             613806..613955
                     /codon_start=1
                     /locus_tag="cgR_0554"
                     /product="hypothetical protein"
                     /protein_id="BAF53522.1"
                     /transl_table=11
                     /translation="MLGMTFFLDFIVAPLVQVVTIVLGGWLLDPTGVRTSWKDFLGGG
                     SPELT"
     CDS             614499..614759
                     /codon_start=1
                     /locus_tag="cgR_0555"
                     /product="hypothetical protein"
                     /protein_id="BAF53523.1"
                     /transl_table=11
                     /translation="MTFTTKYQNWPEASVVDLSDIALEGDALDAASVLTPVVGFLRLL
                     EGLDLDASRDWRATADELENVINDLRDLAADMLARQQQEELR"
     CDS             614759..615160
                     /codon_start=1
                     /locus_tag="cgR_0556"
                     /product="hypothetical protein"
                     /protein_id="BAF53524.1"
                     /transl_table=11
                     /translation="MEDRISCAYCGGLIPPRPDPRGRRAKYCSNACRAAASRERTSKR
                     HADELEAARSQMSLAVLPPAQMSSMIVTELEAVERIIRDRGEVPEAMTAIVNAAFRVA
                     VAAQDATPPPPPALNRQQRRASKKSPSGRKR"
     CDS             615313..616023
                     /codon_start=1
                     /locus_tag="cgR_0557"
                     /product="hypothetical protein"
                     /protein_id="BAF53525.1"
                     /transl_table=11
                     /translation="MGIFSGRQFPREIILWAVRWYCRYGVSYRDLEEMMTERGVPVDH
                     TTIYRWVQKYAPELDKKTRWYRQVPDWQARSWRVDETYIRVGGKWCYLYRAITAGGQT
                     LDFYLSPKRNVAAAKRFLAKTLRSNKSAGYPRVISTDKAPSLARAISELKAEGVCPST
                     VEHRRVKYLNNVIEGDHGRLKRILGPKGAFKNRTSAYRTLKGMEAMHSLRKGQGTMFA
                     YGHPNPDAVIVSRVFETA"
     CDS             616140..616487
                     /codon_start=1
                     /locus_tag="cgR_6030"
                     /product="hypothetical protein"
                     /protein_id="BAQ21092.1"
                     /transl_table=11
                     /translation="MESQQSENIVDEELLYPALPGDIEIPQTVSANSLVKVVEIGNWE
                     PTQNPNSIIVPGAMRSDRESIPGGFTKEEADRAEIEEAKLANTPFLRVQSDTACKVYW
                     PSPFQVCGEIRKL"
     CDS             616707..617657
                     /codon_start=1
                     /locus_tag="cgR_6031"
                     /product="hypothetical protein"
                     /protein_id="BAQ21093.1"
                     /transl_table=11
                     /translation="MGDQWFKQSYQGGHIITRNSVPAVQAGIYGQIYEKWVELGSQNS
                     ALGFPISSEFVASDGVGRYNIFERGVMYWHPEYGAHAVTGDLLLQWAYSGGIEGVLGY
                     PAGDPELQDDGWYRQAFADGFLHGKQLSTFFPAWDEFAWDDSAGGEPGVLMSRQAANY
                     DKGPAGGNKYTDQVVLETEDMCGNEIILRRGWYNSDASRKDKPWGYDKIRHKHGVFSL
                     WSVSTVFENSCINRIEGTQQVYEEEVYQVKCDRLFLNCEQTGQSFVYRGIYERNIYKP
                     GATEPLGLRTFFPVHNEGTHGSSDVTPTWFSTDIPTLDLW"
     CDS             617657..618115
                     /codon_start=1
                     /locus_tag="cgR_6032"
                     /product="hypothetical protein"
                     /protein_id="BAQ21094.1"
                     /transl_table=11
                     /translation="MTYKADYDLDLEKVVFRMSQLFEDLIPSENAFDYYDKSTWPTLT
                     MAATWVQDDCLLIVFRVEESRGETFVGYFSRISPRYNPDNIEFGAVELMYADSIAGDW
                     FIEKVDLKAPQKIHWRNTHHSLNTPADIEELLDYANEIPMWLSPDLEKWM"
     CDS             618115..618168
                     /codon_start=1
                     /locus_tag="cgR_0558"
                     /product="hypothetical protein"
                     /protein_id="BAF53526.1"
                     /transl_table=11
                     /translation="MHNKTMVIQLYLAELGM"
     CDS             618743..619351
                     /codon_start=1
                     /locus_tag="cgR_0559"
                     /product="hypothetical protein"
                     /protein_id="BAF53527.1"
                     /transl_table=11
                     /translation="MGHEFGYARVSTNDQDARLQHDALTKAGCYRIFTDTASGSLESR
                     PELDKLLDQLRPGDTLVVWRLDRLGRSIRHLIDQLATLQERGVEFRSLQENIDTSSSG
                     GRLVFHIFASLAEFERDLIRERTNAGLEAARARGRTGGRPPSLSGDKLRTARKLYEQK
                     DMTVAQIGEVLGVSRTTVYRALRRDTGALPTRKQASPGPLPG"
     CDS             619441..619875
                     /codon_start=1
                     /locus_tag="cgR_0560"
                     /product="hypothetical protein"
                     /protein_id="BAF53528.1"
                     /transl_table=11
                     /translation="MFVFTDPPRLTLLFVSEKETRRECCVGLLRGTARIKKLLKPPGK
                     LVTHYLEWEEIRSKEPGLEDAAQGTLVHLVLHSALPDPGLISFVFPGQDLILATLDEE
                     IARLVLEDERSRISPEFVQLWSVPVGWEVPGLEDFLDRARGG"
     CDS             620168..621187
                     /codon_start=1
                     /locus_tag="cgR_0561"
                     /product="hypothetical protein"
                     /protein_id="BAF53529.1"
                     /transl_table=11
                     /translation="MTRYGTLLGLHGKPKDRVIIMRKGSKTTRVKFPHKDRPGFNLEE
                     VKVDASTVLDDGGELWEKYQRTPNSATFVSFSGEPQGHLHVQRVYKNVIKASVYEGNG
                     QWGRIDDFHPEQVLFDAGEAWPKSKTDQLLNDTDVVPVLEDTPTPTPKTTDLGQRVGY
                     VRVSSTDQNLARQREAIGAVDREFVDELSARSRAQRPSLEECIAYLRHHDELVVASID
                     RLARSLVDLRSIIDQITAKGASVSFIKEGLVFSATDQDPRATLMLGILGSFAEFERSI
                     IRERQAEGIALAKKAGKFTGRKKALSPEQVAQARRRVEAGETKTAIAQDLSVSRATLY
                     RALAE"
     CDS             complement(621400..621852)
                     /codon_start=1
                     /locus_tag="cgR_0562"
                     /product="hypothetical protein"
                     /protein_id="BAF53530.1"
                     /transl_table=11
                     /translation="MDETYIRVGGTWCYLYRAITAGGQTLEFYLSPKRNVAAAKRFLA
                     KTLRSNTTAGSPRVINTDKAPALAKAISELKAEGICPQTVEHRQVKYLNNVIEGDHGR
                     LKRILGPKGAFKNRISAYRTLKGMEAMHSLRKGQGTMFDLTGTRTQTR"
     CDS             complement(621845..621982)
                     /codon_start=1
                     /locus_tag="cgR_0563"
                     /product="hypothetical protein"
                     /protein_id="BAF53531.1"
                     /transl_table=11
                     /translation="MTERGVPVDHTTIYRWVQKYAPELDKQTRWYRQVPDWQAKFLAG
                     G"
     CDS             622029..622187
                     /codon_start=1
                     /locus_tag="cgR_6033"
                     /product="hypothetical protein"
                     /protein_id="BAQ21095.1"
                     /transl_table=11
                     /translation="MHRPQDDVTGEMPTGEDAHGSDYFTPVFLLPQLCNNTLLGARAF
                     RHWNLTAT"
     CDS             complement(622195..623559)
                     /codon_start=1
                     /locus_tag="cgR_0564"
                     /product="hypothetical protein"
                     /protein_id="BAF53532.1"
                     /transl_table=11
                     /translation="MRTENRRQCHNGVVKKNDHGTTGTSESFRIRGSIPDIPRETRWD
                     RLWRPFWAIPAASVVAALVFGFLLPTWERGLSDAALKFVFEGGPDAAREVLGTIAAST
                     ISVTGLIFSITLVVLQLVSSQFSPRMLNGFLRNRIVQATLAMFLGTFVFSLTVIRYVW
                     SEDEDITGFVPRASVSVAFLLVLGCLGLFLAFIRLITFSMRVANAISEIGEETMALAA
                     RIYPVQSDDAGPVQGPGWSPRPGDPREEIRVGSHGSLVWIDYRKLVSWSTEHQAVITV
                     DRPVGDFLVEGQPLLRVWWDGELSDRDRRVLHSAIEVRTERELHQDVAFGLRQLVDIA
                     DRALSPGINDPATAAQCVQEIHRIFRYLVTVIEPSPYIADDDGRVRVVHQPQRIADML
                     YEVIREIHLYGADSAMIPRLLRTMVEDLVTAAADHSLPAVERARGILDDETDEDRDSD
                     TANV"
     CDS             623775..623936
                     /codon_start=1
                     /locus_tag="cgR_0565"
                     /product="hypothetical protein"
                     /protein_id="BAF53533.1"
                     /transl_table=11
                     /translation="MPVDHPTIYRWVQKYAPELDKQTRRYRQVPDWQASSWRVDETYI
                     RVGGKRCYL"
     CDS             complement(624564..625523)
                     /codon_start=1
                     /locus_tag="cgR_0566"
                     /product="hypothetical protein"
                     /protein_id="BAF53534.1"
                     /transl_table=11
                     /translation="MSNYSTENPFDPTQWATVPGFEEFTDITYHRHVGTTRADGIVRI
                     AFDRPEVRNAFRPHTVDELYQALDHARRTPDVGTILLTGNGPSEKDGGWAFCSGGDQR
                     IRGRSGYQYATEHAHDDATADVSTVDTARTKVEGGRLHILEVQRLIRTMPKVVIAVVN
                     GWAAGGGHSLHVVCDLTIASRQEARFKQTDADVGSFDAGYGSAYLAKMVGQKNAREIF
                     FLGRTYDAERMQQMGAVNIVADHGDLEKEAIQAAREINTKSPTAQRMLKFAFNLTDDG
                     LMGQQVFAGEATRLAYMTDEAVEGKEAFLEKREPNWNEFPYYY"
     CDS             complement(625535..625846)
                     /codon_start=1
                     /locus_tag="cgR_0567"
                     /product="hypothetical protein"
                     /protein_id="BAF53535.1"
                     /transl_table=11
                     /translation="MCAILRQDGAMNSLFDVSPHWSSANAKLTAHFNTGKFSTGMKFV
                     NLIADSAEEANHHPDILLTYGFVEITLTSHDVGEITDRDVALAKVIDAHAKTLNISAE
                     A"
     CDS             625845..626450
                     /codon_start=1
                     /locus_tag="cgR_0568"
                     /product="hypothetical protein"
                     /protein_id="BAF53536.1"
                     /transl_table=11
                     /translation="MRLLLTSFGHDHIRDFVRGTVAYIPDATRLFADSPEAAPFMETE
                     RNMLREHGLSIRELPISTSTPEEVDQVLGEVDGVYVAGGETFDLMWLLRSTGNDEVLI
                     KHVRAGLPYIGTSAGAVIAGPSIEPISLLDSPDVAPNLSDYSGLGLCEHVVVPHAGGT
                     IPQFPIDVFAETVRTYGAEFPLVLLKDGQALLIDDHGVHLI"
     CDS             626462..627478
                     /codon_start=1
                     /locus_tag="cgR_0569"
                     /product="hypothetical protein"
                     /protein_id="BAF53537.1"
                     /transl_table=11
                     /translation="MSTPTVDEILERAHVVSLPMRVKFRGVTTREALLIEGPAGWGEF
                     APFLEYDPQESASWLKSGIEAAWEGFPAPLRDRVEVNATIPAVPVDQVAEVLDRFPGC
                     RTIKVKVAEPGQTLTDDIARVAAVREARPGAIIRVDANCGWSVEQAVEAAQALAPLDY
                     LEQPCATVEELAEVRMTVQRRGLFVRVAADESIRKSDDPYRVADLRAADVAVVKVAPL
                     GGVKRVLEVAQHLRARTMDITVASALDTVVGMNAGLAAVAALPKLDDDDLIDVPPAAA
                     GLATSQLFLEDVATPHAITDGFMETRVIAPEMDRLETLAASKDRRDWWFARVRESYPY
                     LETI"
     CDS             627489..629120
                     /codon_start=1
                     /locus_tag="cgR_0570"
                     /product="hypothetical protein"
                     /protein_id="BAF53538.1"
                     /transl_table=11
                     /translation="MSSTPAQDLARAVIDSLAPHVTDVVLCPGSRNSPLSLELLARQD
                     LRVHVRIDERSASFLALSLARTQARPVAVVMTSGTAVANCLPAVAEAAHAHIPLIVLS
                     ADRPAHLVGTGASQTINQTGIFGDLAPTVGITELDQVAQIAESLAQRASQIPRHFNLA
                     LDVPLVAPELPELHGEAVGASWTHRWINHGEVTVDLGEHTLVIAGDEAWEVEGLEDVP
                     TIAEPTAPKPYNPVHPLAAEILLKEQVSAEGYVVNTRPDHVIVVGHPTLHRGVLKLMS
                     DPEIKLTVLSRTDIITDPGRHADQVGSTVKVTGTQEKQWLKICSAASELSADGVRDVL
                     DNQEFGFTGLHVAAAVADTLGTGDTLFATASNPIRDLSLVGMPFDGVDTFSPRGVAGI
                     DGSVAQAIGTALAVQSRHPDEIRAPRTVALLGDLSFLHDIGGLLIGPDEPRPENLTIV
                     VANDNGGGIFELLETGADGLRPNFERAFGTPHDASIADLCAGYGIEHQAVDNLQDLII
                     ALVDTTEVSGFTVIEASTVRDTRRAQQQALMTKVR"
     CDS             629121..629564
                     /codon_start=1
                     /locus_tag="cgR_0571"
                     /product="hypothetical protein"
                     /protein_id="BAF53539.1"
                     /transl_table=11
                     /translation="MEWYQVRRRTRQLLIVIYIAAMLGAASMVIGPFLNDRTIEGNSG
                     RALAQVTNVGSYRTTVDFQDENGIYHSPATGLLYPTGLGEGQRVWVNYAKSDPDLVKV
                     EGRKWTLSIIPALSVAAVATTIWSVLWLGVGRFGRRSDDANETTV"
     CDS             629670..630911
                     /codon_start=1
                     /locus_tag="cgR_0572"
                     /product="hypothetical protein"
                     /protein_id="BAF53540.1"
                     /transl_table=11
                     /translation="MEIIRPMRVAIVAESFLPNVNGVTNSVLRVLEHLKANGHDALVI
                     APGARDFEEEIGHYLGFEIVRVPTVRVPLIDSLPIGVPLPSVTSVLREYNPDIIHLAS
                     PFVLGGAAAFAARQLRIPAIAIYQTDVAGFSQRYHLAPLATASWEWIKTVHNMCQRTL
                     APSSMSIDELRDHGINDIFHWARGVDSKRFHPGKRSAALRKSWDPSGAKKIVGFVGRL
                     ASEKGVERLAGLSGRSDIQLVIVGDGPEAKYLQEMMPDAIFTGALGGEELATTYASLD
                     LFVHPGEFETFCQAIQEAQASGVPTIGPRAGGPIDLINEGVNGLLLDVVDFKETLPAA
                     AEWILDDSRHSEMCAAAWEGVKDKTWEALCTQLLQHYADVIALSQRIPLTFFGPSAEV
                     AKLPLWVARALGVRTRISIEA"
     CDS             631041..632402
                     /codon_start=1
                     /locus_tag="cgR_0573"
                     /product="hypothetical protein"
                     /protein_id="BAF53541.1"
                     /transl_table=11
                     /translation="MSNRHLQLIAIGGAIGTGLFMGSGKTISVAGPSVILVYAIIGFM
                     LFFVMRAMGELLLANLNYKSLRDAVSDILGPGAGFVTGWTYWFCWIATGMADIVAITG
                     YAQYWWPEIPLWLPGVLTIALLFALNLAAVRLFGEMEFWFAIIKIVAIVSLIVVGLFM
                     VVTAFESPNGTTAQFNNLIEHGGFFPNGITGFLAGFQIAIFAFVGIELAGTAAAETEN
                     PTKTLPRAINSIPIRIVVFYVLALAVIMMVTPWDQVSADNSPFVQMFALAGIPAAAGI
                     INFVVITSAASSANSGIFSTSRMLYGLSLEGAAPKRWSRLSKNLVPARGLTFSVICLI
                     PAVGLLYAGGTVIEAFTLITTVSSVLFMVVWSYILVAYIVYRRNSPELHKKSIFKMPG
                     GVVMAVVVLVFFAVMLVVLSLEPDTRAALIATPVWFIILGIGWLSVGGAKGAKRRSQI
                     ASH"
     CDS             632427..633119
                     /codon_start=1
                     /locus_tag="cgR_0574"
                     /product="hypothetical protein"
                     /protein_id="BAF53542.1"
                     /transl_table=11
                     /translation="MAKADLDKDPFDVASMFDDVGKNYDLTNTVLSFGQDRVWRKRTR
                     QRLDLKPGEKVLDLAAGTAVSTVELAKSGAFCVACDFSQGMLAAGKDRDVSKVVGDGM
                     QLPFADNSFDAVTISYGLRNIHDFRAGLKEMARVTKPGGRLTVAEFSTPVIPVFGTVY
                     KEYLMRLLPQVARAVSSNPEAYIYLADSIRAWPSQAELAREINQNGWSDCGWQNLTFG
                     IVALHSAIKPEN"
     CDS             complement(633103..634557)
                     /codon_start=1
                     /locus_tag="cgR_0575"
                     /product="hypothetical protein"
                     /protein_id="BAF53543.1"
                     /transl_table=11
                     /translation="MGTGWNGSAATHSSLPLVIECGFILSVNPVKWTKSFLFNRSRRK
                     ALEAPWVSLLALRTETMGFVSTTFDVLIIGAGPSGASAAVHAARAGLQTLLIDASSFP
                     RDKTCGDGLTPRAIHQLELLGVADQVTGDYFNKGLKLHGFGGSVEAPWPETYFTNKGS
                     AMSRMEFDDLLFRLAKSHEEVTTWENASAQDPILRGNFLEGVVINHAGQEKTVKAKHV
                     IIADGVRSPFGKKLGRQWHRDEVYGIAARAYCETPLSDEPWIHSHVELRDEDGVVQPG
                     YGWIFPLGNGTVNLGCGALSTDKRPAKINTKKLLSFYAGQRRKAWQLGPEHDVASALL
                     PMGGAVSNVAGANWMLIGDSAACVNPLNGEGIDYGLETAAMAVDTLVENPKRDLTLVW
                     PHRLRDAYGETFMLARTAARLLTYPQFLPMAGPLAFRGPLQKAIMPAAARLMGNLITE
                     EDKDLLARGWQAAGSAISWARKGSPLWDSTSSLV"
     CDS             complement(634442..634594)
                     /codon_start=1
                     /locus_tag="cgR_6034"
                     /product="hypothetical protein"
                     /protein_id="BAQ21096.1"
                     /transl_table=11
                     /translation="MLLWWIHLLFRARGNGLERFGRYSFIATFGDRVWIHSFGESSEM
                     DKKLFV"
     CDS             634522..635574
                     /codon_start=1
                     /locus_tag="cgR_0576"
                     /product="hypothetical protein"
                     /protein_id="BAF53544.1"
                     /transl_table=11
                     /translation="MSSGRTVPTRSHGLGKEGVSTTGASQVEFGDPELTARINDAMVQ
                     VEELLHTELSSGEDFLVDIVMHLTRAGGKRFRPMFALLASEFGEKPLSENVIKAAVVV
                     EITHLATLYHDDVMDEASMRRGVPSANARWDNSVAILAGDILLAHASGLMSQLGTDTV
                     AHFAETFGELVTGQMRETVGPRDTDPIEHYTNVIREKTGVLIASAGYLGAMHAGAAPE
                     HIDALKNFGAAVGMIFQIVDDIIDIFSETHESGKTPGTDLREGVFTLPVLYALREDTP
                     VGAELRDILNGPLEDDETVNHVLELLSQSGGRQAALDEVYRYMDIANAELDRLPDSTV
                     KEALRNLATFTVKRVG"
     CDS             637257..637592
                     /codon_start=1
                     /locus_tag="cgR_0577"
                     /product="hypothetical protein"
                     /protein_id="BAF53545.1"
                     /transl_table=11
                     /translation="MSDEQNSGVGGTSRPTGKRQLSGASTTSTSSYEAKQVSAQKKSS
                     DSDSKPGGGVVSFLPEVVGEVRKVIWPTARQMVTYTLVVLGFLIVLTALVSGVDFLAG
                     LGVEKILTP"
     CDS             637821..638777
                     /codon_start=1
                     /locus_tag="cgR_0578"
                     /product="hypothetical protein"
                     /protein_id="BAF53546.1"
                     /transl_table=11
                     /translation="MSDENINKFEQDEDLNFGASFSDEFADDDFDAEADVEADAAAEA
                     SALEAEQDLEEETLDAPEEAAEEAPAAAESEAPVEEDEEADSLAQAAAALGDTDEQDA
                     DAEYKARLRKFTRELKKQPGVWYIIQCYSGYENKVKANLDMRAQTLEVEDDIFEVVVP
                     IEQVTEIRDGKRKLVKRKLLPGYVLVRMDMNDRVWSVVRDTPGVTSFVGNEGNATPVK
                     HRDVAKFLMPQEQAVVTGEAAAAADEGEQVVAMPTDTKKPQVAVDFTVGEAVTILTGA
                     FASVSATISSIDPELQKLEVLVSIFGRETPVDLSFDQVEKVS"
     CDS             639045..639479
                     /codon_start=1
                     /locus_tag="cgR_0579"
                     /product="hypothetical protein"
                     /protein_id="BAF53547.1"
                     /transl_table=11
                     /translation="MAPKKKKVTGLIKLQIQAGQANPAPPVGPALGAHGVNIMEFCKA
                     YNAATENQRGNVVPVEITVYEDRSFDFKLKTPPAAKLLLKAAGLQKGSGVPHTQKVGK
                     VSMAQVREIAETKKEDLNARDIDAAAKIIAGTARSMGITVEG"
     CDS             639606..640316
                     /codon_start=1
                     /locus_tag="cgR_0580"
                     /product="hypothetical protein"
                     /protein_id="BAF53548.1"
                     /transl_table=11
                     /translation="MSKNSKAYREAAEKIDAGRIYSPLEAANLVKETSSKNYDASIDV
                     AIRLGVDPRKADQLVRGTVSLPNGTGKTVRVAVFAQGEKATEAEAAGADFVGTDELVE
                     KIQGGWTDFDVAIATPDQMAKIGRIARVLGPRGLMPNPKTGTVTNDVAKAIEEVKGGK
                     ISFRVDKASNLHAAIGKASFDAKKLAENYGALLDEIIRIKPSSAKGIYVKRVTLSSTT
                     GPGVEVDTHVTKNYAEEA"
     CDS             complement(640366..641880)
                     /codon_start=1
                     /locus_tag="cgR_0581"
                     /product="hypothetical protein"
                     /protein_id="BAF53549.1"
                     /transl_table=11
                     /translation="METPTQDMDVRWLYTQSQLKLREILPTNKTFDVIQISELVDPTD
                     FISPNSVVLSVGIAFAETPDGLRDWAHRLADAGVIAIGFGSGLTFPQVPQALIDASLH
                     LGLGLFEVPREIPFISITSSVRDEQTRRAGRLQQELLLEQERLNSIAISGGIEALCRA
                     AADYLGGAVTIVDSDGRVACSITTDDLDALPQAVSRLNGSSQALTDATNFGFIHRMTR
                     YGDRHHVLSVLMPTRPSEQHRALIRHCAGLADILLQRPEAMRDREIEVRSLAMSLLLG
                     RSDDLATIHRVFADITDASGNIRPILITGNTPQSVRKALSSVATALYKQERALAHLRL
                     AESTELLFLRGSRSVHNIVQLFGTAASGVRLCIGLPTRVENIDKKLIRELTATAKTLQ
                     LGTHAEPRDGTLLWLQNPELRKILKIRSRDTYDRLLDHDRTNNTELAPTLVSFTQHGG
                     HIGDTAKELGIHRHTVRTRMIRIEEICEIDLNDPLTRAELLLVIATKEGDVEKH"
     CDS             642021..643367
                     /codon_start=1
                     /locus_tag="cgR_0582"
                     /product="hypothetical protein"
                     /protein_id="BAF53550.1"
                     /transl_table=11
                     /translation="MEDLSYRIPQSRTVAEQVPGPKSKALDERRQAAVARALAPGLPG
                     YVVDADGGILADADGNRFIDLASGIAVTTVGGSNAAVAKAVGAAAARFTHTCFMVSPY
                     ETYVAMAERLNALTPGDHDKKSALFNSGAEAVENAVKVARAYTGKGAVVVFDNAYHGR
                     TNLTMAMTAKNRPYKSGFGPLAADVYRAPMSYPLRDGLSGPEAAERAISVIESQVGAE
                     NLACVVIEPIQGEGGFIVPAPGFLAAISTWCRENDVVFIADEIQSGFLRTGDWFASDA
                     EGVIPDVITTAKGIAGGMPLSAVTGRAEIMDAPGPGALGGTYGGNPVACAAALAAIEV
                     MEQADLKTRAQEIEAIIRDEFAQLSAFPEVAEIRGRGAMMAIELIDATGRPNAALTAA
                     VAARAKAEGVLLLTCGTDGNVIRLLPPLVIAEDTLRDGLQVLVAALERETAHQKVG"
     CDS             643369..644730
                     /codon_start=1
                     /locus_tag="cgR_0583"
                     /product="hypothetical protein"
                     /protein_id="BAF53551.1"
                     /transl_table=11
                     /translation="MSLTFPVINPSDGSTITELENHDSTQWMSALSDAVAAGPSWAAK
                     TPRERSVVLTAIFEALTERAQELAEIIHLEAGKSVAEALGEVAYGAEYFRWFAEEAVR
                     LPGRYGQSPSGIGHIAVTRAPVGPVLAITPWNFPIAMATRKIAPALAAGCPVLVKPAS
                     ETPLTMVKVGEIIASVFDTFNIPQGLVSIITTTRDAELSAELMADPRLAKVTFTGSTN
                     VGRILVRQSADRLLRTSMELGGNAAFVIDEAADLDEAVSGAIAAKLRNAGQVCIAANR
                     FLVHESRAAEFTSKLATAMQNTPIGPVISARQRDRIAALVDEAITDGARLIIGGEVPD
                     GSGFFYPATILADVPAQSRILHEEIFGPVATIVSFTDLADGVARANSTEFGLAAYGFS
                     NNVKATQYMAEHLEAGMVGINRGAISDPAAPFGGIGQSGFGREGGTEGIEEYLSVRYL
                     ALP"
     CDS             644769..646016
                     /codon_start=1
                     /locus_tag="cgR_0584"
                     /product="hypothetical protein"
                     /protein_id="BAF53552.1"
                     /transl_table=11
                     /translation="MTTESIVGHNAAGTAPQNVSSAKKKYLSVAQGVALIYGTNIGAG
                     VLSLPYAARNGGFLALVVALLIAGTLTTISMLYIAEVSLRTKKPLQLSGLAEKYLGQW
                     GRWLVFIAIVVNSVGALIAYASGSGILIGNLTGLPPIVGTLGFFVLGTLIMWKGLHTA
                     SFVEALITTGMATIIIVLCGWTVLGPGISADNLIVFHPFFIVPIMNLAVFTFLAQYVV
                     PEIARGVNPATPKAVPRAIIIGMVATGVTLAAVPFAALGLLGTGVSEVVTISWGEALA
                     PVAYYMANAFALLAMFTSFIAIGFTAMRNVLDIGHWPEHGWQRSVAVGLTVLPPLAIS
                     LAGLGGFVAALSYAGGFAGAIMSIIPVLLLRNSRKRGDQEPVWKATWQAHPIFQILLI
                     VVYSLAFVYSVLAIVGLMPAGWA"
     CDS             646142..648094
                     /codon_start=1
                     /locus_tag="cgR_0585"
                     /product="hypothetical protein"
                     /protein_id="BAF53553.1"
                     /transl_table=11
                     /translation="MLVSDIFMGDNGVMNKKLNTPNPWMLFIRSFDGIITVAALVAIA
                     IHLILWLALDLDGLAKNWPLIAIVILGGIPLMWDVLKSAIKTRGGADTLAAVSIITSV
                     LLGEWLVAAIIVLMLSGGEALEEAASRRASGTLDALARRAPSTAHRLLGATILDGTEE
                     IAVEEITVGDLVAVLPHELCPVDGEIVAGHGTMDESYLTGEPYVVSKSKGSQAMSGAV
                     NGDTPLTIVATKLAHDSRYAQIVGVLHEAENNRPEMRRMADRLGAWYTVIALALGGLG
                     WIISGDPVRFLAVVVVATPCPLLIAVPVAIIGAISLAARRGIIVKNPGMLENASEVKT
                     VMFDKTGTLTYGRPVITDIHTAPGVEEDTVLALAASVERYSRHPLADAIREGAKAREL
                     HLPDVVEVSERPGQGLTGTVGEHLVRITNRRSTLEIDPDSKNYIPVTSSGMESVVLVD
                     DKYAALIRLRDEPRASASEFIAHLPKKHKVDKLMIISGDRASEVRYLADKVGIDEVHA
                     EASPEDKLNIVNRHNEHGATMFLGDGINDAPAMAVATVGVAMGADSDVTSEAADAVIL
                     DSSLERLDDLLHISARMRRIALQSAGGGMALSVVGMILAVFGFLTPLMGAIFQEVIDV
                     LAILNSARVAVPRGAISDFDTQEKVS"
     CDS             648113..649528
                     /codon_start=1
                     /locus_tag="cgR_0586"
                     /product="hypothetical protein"
                     /protein_id="BAF53554.1"
                     /transl_table=11
                     /translation="MTFRGGNTGAKHAVVVGSGPNGLTTAAVLAKAGWQVDVYESAPT
                     PGGAARSESVLGEGTISDLGAAGHPFGVASPAFHYLGLEDHGLEWAYSPFAMAHPLDH
                     GRAGLLETSLPETAKKLGPDARRWKNLHQGLTKNIDKHLANLLGPVLKWPAHPIRMAK
                     FGPFALLPAKRLASAAFETEEARSLFIGSAMHSVTPPHKPMTASLGLLFGALGMSRGW
                     PVAVGGSGRIVDALVNVINHHGGTIHCDSQIDSLSQFRDTDAIILNQTPSQVLKLKGT
                     DLNAGLPQRMSTWKHGPSSYKVDYLLDGPIPWSNPQVGEATTVHVGGSSEEIAFAEAE
                     VAAGRMPERPFIILCQQQVADPSRAREGRHVVWAYAHVPRGFVDKRAALLITAQIERF
                     APGFRDRIVHSVDTNAEDLEAWNPNLVGGDITAGSALLRRMPTKIGEKTYMASASNAP
                     GGGVHGMPGWWAAQAVLADHR"
     CDS             649538..650143
                     /codon_start=1
                     /locus_tag="cgR_0587"
                     /product="hypothetical protein"
                     /protein_id="BAF53555.1"
                     /transl_table=11
                     /translation="MEPTVKASARHTIHVTADTWRIRLSASAHSHPNDAYARRATAIS
                     AIGSVLIDVPLQGERISESPAYDGQINADWNAEVTGTDVNIARDIISRLAAVPDVQVD
                     GPWWSLSDSLAAEAAVEALQGAADTARNTAAAIAESLGGQLGALLYATTDTHSSTPIP
                     ARAEMMAAKASIPPRTLDLELAPSDIEVTKEIAVTFEFLAG"
     CDS             650442..650957
                     /codon_start=1
                     /locus_tag="cgR_0588"
                     /product="hypothetical protein"
                     /protein_id="BAF53556.1"
                     /transl_table=11
                     /translation="MANPRNEAALAELKARFAETDTVVLTEYRGLTVAQTTELRKALG
                     FDVQYSVAKNTLVKIAANEAGIEGLDDLLTGPTAVAFIKGEAVDTAKVLKKFGEENKA
                     FVVKGGYMDGNALTAEQVNAIAELDNRETTLAKLAGAMKGSLAKAAGLFNAPASQVAR
                     LAVALQDKKDA"
     CDS             651035..651421
                     /codon_start=1
                     /locus_tag="cgR_0589"
                     /product="hypothetical protein"
                     /protein_id="BAF53557.1"
                     /transl_table=11
                     /translation="MAKLTKDELIEAFKEMTLIELSEFVKEFEEVFDVTAAAPVAVAA
                     AGAAGGEAAAAEEKDEFDVVLEDAGAKKIGVIKAVRELVSGLGLKEAKELVEGAPKAI
                     LEGANKDDAEAAKAKLEEAGAKVTLK"
     CDS             651928..652935
                     /codon_start=1
                     /locus_tag="cgR_0590"
                     /product="hypothetical protein"
                     /protein_id="BAF53558.1"
                     /transl_table=11
                     /translation="MPGGCSGNIVRMLPKSRIFSALLLGIGVALVVWGLVAPRFVHAD
                     GRLPLDLEATTYVLHDSDAQTTINSDPLAGVVTTPVTRQLHFEVMDPASADDATIRIG
                     DSMLRGNPDTQGFEQERLLSATVSSFRIDRTSGEVLSDIALTNQLASPTVQYSVDGIW
                     LKFPTDAQETTYNVVDPVLRSALPADFVESTEIDGREVLHYRQVIDNANVAEYFADAN
                     NTTTLTKEDGGTTTGYFYHNVTRDFWVDQRTGLVVDLAENIDDFYGDRSGQKYEQKLL
                     FDASLDDAAVSKLVAQAESIPDGDVSKIANTVGIVIGAVLALVGLAGCFGAFGKKRRE
                     A"
     CDS             653338..656835
                     /codon_start=1
                     /locus_tag="cgR_0591"
                     /product="hypothetical protein"
                     /protein_id="BAF53559.1"
                     /transl_table=11
                     /translation="MLEGPILAVSRQTKSVVDIPGAPQRYSFAKVSAPIEVPGLLDLQ
                     LDSYSWLIGTPEWRARQKEEFGEGARVTSGLENILEELSPIQDYSGNMSLSLSEPRFE
                     DVKNTIDEAKEKDINYAAPLYVTAEFVNNTTGEIKSQTVFIGDFPMMTDKGTFIINGT
                     ERVVVSQLVRSPGVYFDQTIDKSTERPLHAVKVIPSRGAWLEFDVDKRDSVGVRIDRK
                     RRQPVTVLLKALGWTTEQITERFGFSEIMMSTLESDGVANTDEALLEIYRKQRPGEQP
                     TRDLAQSLLDNSFFRAKRYDLARVGRYKINRKLGLGGDHDGLMTLTEEDIATTIEYLV
                     RLHAGERVMTSPNGEEIPVETDDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERM
                     TTQDAESITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGG
                     LSRERAGIEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYARVNPFGFIETPYRRII
                     DGKLTDQIDYLTADEEDRFVVAQANTHYDEEGNITDETVTVRLKDGDIAMVGRNAVDY
                     MDVSPRQMVSVGTAMIPFLEHDDANRALMGANMQKQAVPLIRAEAPFVGTGMEQRAAY
                     DAGDLVITPVAGVVENVSADFITIMADDGKRETYLLRKFQRTNQGTSYNQKPLVNLGE
                     RVEAGQVIADGPGTFNGEMSLGRNLLVAFMPWEGHNYEDAIILNQNIVEQDILTSIHI
                     EEHEIDARDTKLGAEEITRDIPNVSEEVLKDLDDRGIVRIGADVRDGDILVGKVTPKG
                     ETELTPEERLLRAIFGEKAREVRDTSMKVPHGETGKVIGVRHFSREDDDDLAPGVNEM
                     IRIYVAQKRKIQDGDKLAGRHGNKGVVGKILPQEDMPFLPDGTPVDIILNTHGVPRRM
                     NIGQVLETHLGWLASAGWSVDPEDPENAELVKTLPADLLEVPAGSLTATPVFDGASNE
                     ELSGLLANSRPNRDGDVMVNADGKATLIDGRSGEPYPYPVSIGYMYMLKLHHLVDEKI
                     HARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGR
                     VKVYEAIVKGENIPDPGIPESFKVLLKELQSLCLNVEVLSADGTPMELAGDDDDFDQA
                     GASLGINLSRDERSDADTA"
     CDS             656919..660920
                     /codon_start=1
                     /locus_tag="cgR_0592"
                     /product="hypothetical protein"
                     /protein_id="BAF53560.1"
                     /transl_table=11
                     /translation="MLDVNVFDELRIGLATADDIRRWSKGEVKKPETINYRTLKPEKD
                     GLFCERIFGPTRDWECACGKYKRVRYKGIICERCGVEVTKSKVRRERMGHIELAAPVT
                     HIWYFKGVPSRLGYLLDLAPKDLDLIIYFGANIITSVDEEARHSDQTTLEAEMLLEKK
                     DVEADAESDIAERAEKLEEDLAELEAAGAKADARRKVQAAADKEMQHIRERAQREIDR
                     LDEVWQTFIKLAPKQMIRDEKLYDELIDRYEDYFTGGMGAESIEALIQNFDLDAEAEE
                     LRDIINNGKGQKKMRALKRLKVVAAFQRSGNDPAGMVLNAIPVIPPELRPMVQLDGGR
                     FATSDLNDLYRRVINRNNRLKRMIELGAPEIIVNNEKRMLQESVDALFDNGRRGRPVT
                     GPGNRPLKSLSDLLKGKQGRFRQNLLGKRVDYSGRSVIIVGPQLRLHECGLPKLMALE
                     LFKPFVMKRLVENEYAQNIKSAKRMVERQRPEVWDVLEEAISEHPVMLNRAPTLHRLG
                     IQAFEPVLVEGKAIQLHPLACEAFNADFDGDQMAVHLPLSAEAQAEARVLMLASNNIL
                     SPASGKPLAMPRLDMVTGLYYLTLEKSSEEFGGQGAYQPADENGPEKGVYSSLAEAIM
                     AYDRGVLGLQAPVRIRLNHLRPPAEVEAEQFPDGWNQGETWLAHTTLGRVMFNEILPW
                     NYPYLEGIMVRKGGGSDKIMLGDVVNDLAAKYPMITVAQTMDKMKDAGFYWSTRSGVT
                     IAMSDVLVLPNKEEMLDRYEESARQIEVKYNRGKLTGRERYDRLVELWKDATDEVGQA
                     VEDLYPDDNPIPMIVKSGAAGNMRQIWTLAGMKGMVVNSKGDYITRPIKTSFREGLTV
                     LEYFNNSHGSRKGLADTALRTADSGYLTRRLVDVAQDVIVRVEDCGTRQGVRVPVAAE
                     VLDATGAVTGYTRHDLIETSVSGRVLAGDATNAAGEVVLAAGTDLTELNIDLLVEAGI
                     KDVKVRSVLTCQTPTGVCAKCYGKSMASGQQVDIGEAVGIVAAQSIGEPGTQLTMRTF
                     HQGGVGGDITGGLPRVQELFEARVPKNCAPIASVEGVIHLEDEGNFYTLTIVPDDGSD
                     NVVYEKLSKRQGLASTRVAMESNAGAFIERTLTEGDRVTVGQRLLRGAADPHDVLEIL
                     GRRGVEQHLIDEVQAVYRAQGVAIHDKHIEIIIRQMLRRGTVIESGSTEFLPGSLVDL
                     SEAKLANSEAIGAGGQPAELRSEIMGITKASLATESWLSAASFQETTRVLTDAAINKR
                     SDKLIGLKENVIIGKLIPAGTGISRYRNISIKPTEAARNAAYSIPTYGESIYGDDGFG
                     EFTGASVPLDEAF"
     CDS             661098..661280
                     /codon_start=1
                     /locus_tag="cgR_5007"
                     /product="hypothetical protein"
                     /protein_id="BAF53561.1"
                     /transl_table=11
                     /translation="MWKLSIGVIVGGILFALGLWGTHSENTVIFIAGWVGTFASFAVW
                     FWVIWWAAVGNTKSPL"
     CDS             661292..662074
                     /codon_start=1
                     /locus_tag="cgR_0593"
                     /product="hypothetical protein"
                     /protein_id="BAF53562.1"
                     /transl_table=11
                     /translation="MDELLKQEVKDFLTTRRARITPAAAGIETQPWSDRRVPGLRREE
                     VADLAGISLEYYIRFERGNLKGASPEILQSLAKALQLSPIEREHLHNLAYRADHPRNL
                     PSAETPTAPLQDIVDAVTDKPAWIRNEQMDILATNRLCAELYAPILKDLPDRPNTARH
                     CFIGATAEQFWMDRDQFSAEFAAKLRLEYARRPSAPGLKELIDELHQKSSVFRENWAS
                     ADVLSFGSGIKRFRHPTLGERVYEYETFNLNSAPGYVLSIYF"
     CDS             complement(662103..663023)
                     /codon_start=1
                     /locus_tag="cgR_0594"
                     /product="hypothetical protein"
                     /protein_id="BAF53563.1"
                     /transl_table=11
                     /translation="MSRHAKKGGSFWGPTKRVTDNLIKCKHAPPRPGKPGAIPRLSAR
                     CRQFPTTRVGLSRSHYQLAAENTKSLVRMVPMTVPQGNEPAKKLATDLNRNQVVDELS
                     AAVSRGQLTLEEFEDRSSKAWNARHLDTLVELISDVNDNPYTLLGQQFPGASYAPAAY
                     ETTPPAMPNVSDPVNIVRNRITGNPNGSKMSVSFMGGTVRKGGWHVPNVHTSFAMMGG
                     NQIDLRDAFLESDRIQINAYTFMGGIEIIVPEGVFVICDGIGIFGGFEQSVDKAGALN
                     PARLPNNAPTVHVKGLAFMGGVSVVTKKNI"
     CDS             663122..663490
                     /codon_start=1
                     /locus_tag="cgR_0595"
                     /product="hypothetical protein"
                     /protein_id="BAF53564.1"
                     /transl_table=11
                     /translation="MPTIQQLVRKGRHDKSAKVATAALKGSPQRRGVCTRVYTTTPKK
                     PNSALRKVARVRLTSGIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGAL
                     DTQGVKDRKQARSRYGAKRG"
     CDS             663497..663964
                     /codon_start=1
                     /locus_tag="cgR_0596"
                     /product="hypothetical protein"
                     /protein_id="BAF53565.1"
                     /transl_table=11
                     /translation="MRKSAAPKRPVVQDPVYKSELVTQLVNKILIGGKKSTAERIVYG
                     ALEICREKTGTDPVGTLEKALGNVRPDLEVRSRRVGGATYQVPVDVRPERANTLALRW
                     LVTFTRQRRENTMIERLANELLDAANGLGASVKRREDTHKMAEANRAFAHYRW"
     CDS             664312..666441
                     /codon_start=1
                     /locus_tag="cgR_0597"
                     /product="hypothetical protein"
                     /protein_id="BAF53566.1"
                     /transl_table=11
                     /translation="MAQEVLKDLNKVRNIGIMAHIDAGKTTTTERILFYTGINRKVGE
                     THDGGATTDWMEQEKERGITITSAAVTCFWDNNQVNIIDTPGHVDFTVEVERSLRVLD
                     GAVAVFDGKEGVEPQSEQVWRQATKYDVPRICFVNKMDKLGADFYFTVGTIEDRLGAK
                     PLVMQLPIGAEDNFDGVIDLLEMKALTWRGVTPIGTEATVEEIPAELADRAAEYREKL
                     LETVAESDEELMEKYFGGEELSIAEIKAAIRKMVVNSEIYPVYCGTAYKNKGVQPLLD
                     AVVDFLPSPLDLGETKGTDVKDPEKVLTRKPSDEEPLSALAFKIAAHPFFGKLTFVRL
                     YSGKVEPGEQVLNSTKNKKERIGKLFQMHANKENPVEVAHAGNIYAFIGLKDTTTGDT
                     LCDANAPIILESMDFPDPVIKVAIEPKTKSDQEKLGVAIQKLAEEDPTFTVELDDESG
                     QTVIGGMGELHLDVLVDRMKREFKVEANIGDPQVAYRETIRKPVESLSYTHKKQTGGS
                     GQFAKVIITIEPYAPAPEELEEGESAIYKFENAVTGGRVPREYIPSVDAGIQDAMQYG
                     FLAGYPLVNVKATLEDGAYHDVDSSEMAFKLAGSQAFKEAVAKAKPVLLEPIMSVEIT
                     TPEEYMGEVIGDVNARRGQIASMDDRAGAKIVKAKVPLSQMFGYVGDLRSKTQGRANY
                     SMIFDSYAEVPANVAADVIAERNGTAS"
     CDS             666804..667994
                     /codon_start=1
                     /locus_tag="cgR_0598"
                     /product="hypothetical protein"
                     /protein_id="BAF53567.1"
                     /transl_table=11
                     /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPELN
                     EAFAFDSIDKAPEEKERGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMD
                     GAILVVAATDGPMPQTREHVLLARQVGVPYILVALNKCDMVEDEEIIELVEMEVRELL
                     AEQDYDEEAPIVHISALKALEGDEKWGKQILELMQACDDNIPDPVRETDKPFLMPIED
                     IFTITGRGTVVTGRVERGTLNVNDDVDIIGIKEKSTSTTVTGIEMFRKLLDSAEAGDN
                     CGLLLRGIKREDVERGQVIVKPGAYTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFY
                     FRTTDVTGVVKLPEGTEMVMPGDNVDMSVTLIQPVAMDEGLRFAIREGSRTVGAGRVT
                     KIIK"
     CDS             668467..669198
                     /codon_start=1
                     /locus_tag="cgR_0599"
                     /product="hypothetical protein"
                     /protein_id="BAF53568.1"
                     /transl_table=11
                     /translation="MKDPSRIPPVVAQLQKVWEAQPDLALPTLLGILGNRGIGWGSTD
                     EDLVEALNTMYTENPGEIRGGSRIADPQREVPGRFLVETESPAYRITVDPFRVSVRRI
                     AKGPHRPLQPGVWEFQEIRRCRSGEPLLITDVEGIDHRLGVVVRITLLNDSPAPKTKS
                     LDKVRRREVGDKVFYLHFESGDTALLNHGLEIYQASRRTLEQHSVKWDQLITATPGQL
                     LKLKETGSGKILELGVLEKIIPLEG"
     CDS             complement(669203..669997)
                     /codon_start=1
                     /locus_tag="cgR_0600"
                     /product="hypothetical protein"
                     /protein_id="BAF53569.1"
                     /transl_table=11
                     /translation="MNNRLTMEDVTMAYDNRVIAEHLNVTIPDNTFTAIIGPNGCGKS
                     TLLRGFSRVLNPQHGKVLLDGRQLDSFKPKEIARELGLLPQTSIAPEGIRVYDLIARG
                     RAPYQSLIQQWRASDEDAVAQALASTNLTELAARLVDELSGGQRQRVWVAMLLAQQTP
                     IMLLDEPTTFLDIAHQYELLELLRAFNEAGKTVVTVLHDLNQAARYADHLIVMKDGHV
                     HATGTPEEVLTAEMVQGVFGLPCIISPDPVTGTPTVVPLSRSHAEA"
     CDS             complement(670016..671188)
                     /codon_start=1
                     /locus_tag="cgR_0601"
                     /product="hypothetical protein"
                     /protein_id="BAF53570.1"
                     /transl_table=11
                     /translation="MVFNIKSRTDAPEVPAVASEPVESTRPVSEASTSPALNPGYHAV
                     SVQRRRFSFLIPARLVVVSLILFAIALCSATWAITMGDYPLSLGQVINALAGTGEKFQ
                     LLVVREWRLPVAIAAVVFGALLGIGGAIFQSITRNPLGSPDVIGFDAGSYTAVVLVIL
                     VLGNTHYWSIAFAAIVGGIVTAFAVYVLAWRKGVQGFRLIIVGIGVSAMLSSVNAYLI
                     TRADVEDAMVVGFWSAGSINRVTWQSLLPSLVIAAVIIVAAIVLARSLRFMEMGDDVA
                     TTLGVKTNSTRLALIVVGVATSALVTAAAGPISFIALVAPQLARRLTKTPGVSLVAAA
                     AMGSALLSCAHLLSLIISSFYRTIPVGLLTVSIGGCYMIWLLLRETRRQYRTGTIR"
     CDS             complement(671178..672224)
                     /codon_start=1
                     /locus_tag="cgR_0602"
                     /product="hypothetical protein"
                     /protein_id="BAF53571.1"
                     /transl_table=11
                     /translation="MTAVAVEKQKETSISKNLGRRRALGILGIIVALGALIVLSIAVG
                     ANPLSFSSVWQGFTAHDSSEASIIVWSMRIPRTLVGIVTGAAFGVAGALIQALTRNPL
                     ADPGILGVNAGAGFAVTVGVGFFGLSSVTGYIWFAFLGAAAATLLVYFIGASTSGSVN
                     PVALVLAGVALAAVLGGVTSFLTLIDPETFESIRNWNLGSVARTDLSDTMTVLPFLAV
                     GLAIALLLSGALNSIALGDDLAASLGTKVMRTRVLGIISVTLLAGGATALTGGIGFVG
                     LMVPHVVRWVVGPDQRWIITFSALCAPVLVLGADILGRIIARPGEIEVGIVTAVIGAP
                     VLIALVRRRKASGL"
     CDS             complement(672610..673602)
                     /codon_start=1
                     /locus_tag="cgR_0603"
                     /product="hypothetical protein"
                     /protein_id="BAF53572.1"
                     /transl_table=11
                     /translation="MSIRPDNPQIKTSNIRTIGFLIYDGVSPLDFTGPAEAFSRSNGY
                     ELIYLSPSGGNIHTASGITIADTLPATSINPATLDTLIITGSDSLPQTPLKTSLIDAA
                     RHLVCGPRRVATVCTGAFILAELGLLNGREATTHWKNARDLARRYPQIRVRPDIIHVH
                     DGRFVTSAGITAGIDLALSLIEEDQGAHIARDTARDMVVYMHRPGGQSQFATTTEAPS
                     VSHPSLQKAIDHVFEYPAASHSAASLADYVSVSQRHLTRIFQSELGLSPAQWLEQFRL
                     NTAQQLILNGESISTTAGLSGFGSEDSLRRAFSKWLHITPSEYRARFRSTFPAH"
     CDS             673713..675188
                     /codon_start=1
                     /locus_tag="cgR_0604"
                     /product="hypothetical protein"
                     /protein_id="BAF53573.1"
                     /transl_table=11
                     /translation="MSAEEAAQFINNGATVGMSGFTGAAYPKALPTAIANRAKQEHAA
                     GREYGIRMLTGASTAPDCDGVLAEADALSFRMPYQSDPAMRGKINAGQLNYQDIHLSH
                     SGLQVEQGFFGAIDIAIVEVARITKEGHLIPSSGVGNNVEYLDAAQHIILEVNSWQSL
                     DLEGMADIYRVPHLPHRTPIPIEKVGDRVGTTFIDIDIAKVIAVVETDAPDRNSPFKP
                     FDEVSKQIAGNYLDFLDGEVAGGRLAYDHYIMQSGVGNVPNAVMAGLLDSKFENIQAY
                     TEVVQDGMLDLIDAGKMAVASATSFALSPEYAEKMNREAEKYRKYLVLRPLQISNSPE
                     VIRRMGLISSNGMIEADIYGNINSTHVAGTRVMNGIGGSGDFTRNAFASTFISPSAAK
                     GDAISAIVPFASHIDHTEHDAMVVITEYGYADLRGLSPKQRVPKMIAIAHPDYRPLLE
                     EYFDRALTSADSYQHTPHDLRTAFDFHNRLNSQGTMKIEKA"
     CDS             675761..676066
                     /codon_start=1
                     /locus_tag="cgR_0605"
                     /product="hypothetical protein"
                     /protein_id="BAF53574.1"
                     /transl_table=11
                     /translation="MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPT
                     EKNVYAVIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ"
     CDS             complement(676060..676533)
                     /codon_start=1
                     /locus_tag="cgR_0606"
                     /product="hypothetical protein"
                     /protein_id="BAF53575.1"
                     /transl_table=11
                     /translation="MCSLVTVAGTLASEAMALHSAGVALTLGGTGDVNELDVVEDFNG
                     NVLSNLVTGDIVHTNLGDVAAGGNACFLEVTSQWLVHLAWVDFAVGDLDGVVAIGLNG
                     ANLGNYAWTRFNDGNRNNAVLLVEDLSHAELGAQNALDLVFTHYLFSAAKNSVDH"
     CDS             676099..676755
                     /codon_start=1
                     /locus_tag="cgR_0607"
                     /product="hypothetical protein"
                     /protein_id="BAF53576.1"
                     /transl_table=11
                     /translation="MSENEIKGILGTKLGMTQIFDEENRVIPVTVVEAGPCVVSQIRT
                     VETDGYNAIQIAYGEIDPRKVNQPLTGHFKKAGVTPRRHVTEIRMDDVSGYEVGQDVT
                     VEIFNDIKFVDVTGTTKGKGYAGAMKRHGFAGQGAGHGNQAAHRRVGGIGAAATPGRI
                     FKGKRMAGRMGNDRVTTQNLKVQKIDADANIILIKGAIPGNRGGIVTVKTAVKGGAHA
                     "
     CDS             676752..677408
                     /codon_start=1
                     /locus_tag="cgR_0608"
                     /product="hypothetical protein"
                     /protein_id="BAF53577.1"
                     /transl_table=11
                     /translation="MTNLKLDVQTADGNINGSVELPAEIFDREVSVALLHQVVNAQLA
                     AARQGTHSTKTRGEVRGGGRKPFRQKGTGRARQGSIRAPHFTGGGISHGPKPRDYSQR
                     TPKKMIKAALYGALSDRARNARIHVVSELVPGQTPSTKSAKAFIERLTERKSVLLVVS
                     REDINAQKSANNLPGVHILAADQLNTYDVLKSDDVVFSVEALHTFINRASGAAQEEQN
                     "
     CDS             complement(677405..677734)
                     /codon_start=1
                     /locus_tag="cgR_0609"
                     /product="hypothetical protein"
                     /protein_id="BAF53578.1"
                     /transl_table=11
                     /translation="MSFSIDVLSDGAVEDVDGVAAFAKSHISALGSLASTEAGAGALA
                     LTCTVNGVHRCNLDAEDLFDGNLDLSLVSVSGDEERVNVLLHEAVGLLRNDRCDDDVA
                     WVGDSSH"
     CDS             677408..677713
                     /codon_start=1
                     /locus_tag="cgR_0610"
                     /product="hypothetical protein"
                     /protein_id="BAF53579.1"
                     /transl_table=11
                     /translation="MATIANPRDIIIAPVVSEKSYGLMEQNVYTFFVSTDANKTQIKI
                     AIEEIFGVKVASVNTVNRAGKRKRSRTGFGTRKATKRAYVTLREGSDSIDIFNGSVA"
     CDS             677738..678580
                     /codon_start=1
                     /locus_tag="cgR_0611"
                     /product="hypothetical protein"
                     /protein_id="BAF53580.1"
                     /transl_table=11
                     /translation="MAIRKYKPTTPGRRASSVSMFTEITRSTPEKSLLRPLSKTGGRN
                     SHGHITTRHRGGGHKRRYRVIDFRRNDKDGVLAKVAHIEYDPNRTANIALLHYFDGEK
                     RYILAPKGLTQGTVIESGAAADIKVGNNLPLRNIPTGTTIHNVELKPGAGAKLARSAG
                     ASIQLLGKEGSYAVLRMPSSEIRRVDIRCRATVGEVGNAEQINIRWGKAGRMRWKGWR
                     PTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGQKEGRTRKPKRYSDDMIVRRRRANK
                     NKKR"
     CDS             complement(678558..678845)
                     /codon_start=1
                     /locus_tag="cgR_5008"
                     /product="hypothetical protein"
                     /protein_id="BAF53581.1"
                     /transl_table=11
                     /translation="MTLEGLGRGEFAQLVANHGIVHENWHMLASIMDSKGVTDEIREN
                     GGTAGPGLDDLLGSLFVLSIYLVEEVLIDERTLFKAAWHSSLPPLSASCSC"
     CDS             678597..678875
                     /codon_start=1
                     /locus_tag="cgR_0612"
                     /product="hypothetical protein"
                     /protein_id="BAF53582.1"
                     /transl_table=11
                     /translation="MPRSLKKGPFVDEHLLNKVDAQNEKGTKQVIKTWSRRSTILPDF
                     IGHTFAVHDGRKHVPVFVDDAMVGHKLGEFAPTKTFKGHVKDDKKGRR"
     CDS             678879..679241
                     /codon_start=1
                     /locus_tag="cgR_0613"
                     /product="hypothetical protein"
                     /protein_id="BAF53583.1"
                     /transl_table=11
                     /translation="MSDNITSASATARFVRVSPMKARRVIDLVRGKTVVEALSILKYA
                     PQAASEPVAKVVASAAANAENNFGLDPRTLVISEAYANEGPTMKRFQPRAQGRAFQIR
                     KRSSHITVVVESQKEGAN"
     CDS             679241..679987
                     /codon_start=1
                     /locus_tag="cgR_0614"
                     /product="hypothetical protein"
                     /protein_id="BAF53584.1"
                     /transl_table=11
                     /translation="MGQKIHPHGLRLGITSDWKSHWYADKSYADYVAEDIKIREFLSK
                     GLDRAGIADVVIERTRDRVRVDIHTARPGIVIGRRGAEADRIRRELEKLTGKQVALNI
                     LEVKNVDANAKLVAQSIAEQLTNRVAFRRAMRKAIQSAMRQPQVKGIKVVCSGRLGGA
                     EMSRTERYHEGRVPLHTLRAEIDYGTYEAHTTFGRIGVKVWIYKGDVVGGRRESEINA
                     PAERRGRGDRNARPRRGGQRRQRAEQKQEG"
     CDS             679990..680406
                     /codon_start=1
                     /locus_tag="cgR_0615"
                     /product="hypothetical protein"
                     /protein_id="BAF53585.1"
                     /transl_table=11
                     /translation="MLIPKRVKYRRQHRPTRSGISKGGNRVTFGEYGIQALEPAYITN
                     RQIESARIAINRHVKRGGKVWINIFPDRPLTQKPLGVRMGSGKGPVEKWVANIKPGRI
                     LFEMSYPDEATALEALRRAGQKLPCKVRIVKREDQL"
     CDS             680406..680636
                     /codon_start=1
                     /locus_tag="cgR_0616"
                     /product="hypothetical protein"
                     /protein_id="BAF53586.1"
                     /transl_table=11
                     /translation="MAIGTPAHEFRELNEEELVTRLNEAKEELFNLRFQLATGQLTNN
                     RRLRTVKRDIARIYTVIRERELGLSVVPGAEA"
     CDS             complement(680633..680929)
                     /codon_start=1
                     /locus_tag="cgR_5009"
                     /product="hypothetical protein"
                     /protein_id="BAF53587.1"
                     /transl_table=11
                     /translation="MTPKLLSLFDDLDQTVVLVLGQWAGLFNANQVTDSGDLLLIMSL
                     DLLRGAKDLAVESVLLAVFDLDNDGLLHLVRNHVASADLAGALFLVVHVCLTHD"
     CDS             680639..680917
                     /codon_start=1
                     /locus_tag="cgR_0617"
                     /product="hypothetical protein"
                     /protein_id="BAF53588.1"
                     /transl_table=11
                     /translation="MSEANVNNQEKSTRKVRTGYVVSDKMQKTIVVEVEDRKQHALYG
                     KILRSAKKVKAHDEEQIAGIGDLVRIEETRPLSKDKNYRLIEIVEKAK"
     CDS             complement(681038..681358)
                     /codon_start=1
                     /locus_tag="cgR_0618"
                     /product="hypothetical protein"
                     /protein_id="BAF53589.1"
                     /transl_table=11
                     /translation="MIRWWLNLHAPSIRNIRMAHENQKTVSIFAWLSVLVVAILGYVL
                     WLVPISWYGIREWIYPIIAVPLIGYALFTAFKSKSWVLGICAILALLSPIIWLTAGFF
                     IFGF"
     CDS             complement(681375..682079)
                     /codon_start=1
                     /locus_tag="cgR_0619"
                     /product="hypothetical protein"
                     /protein_id="BAF53590.1"
                     /transl_table=11
                     /translation="MSLLKSLSLGSSAVLLTALLGGCVSLDERSTDTSMNTSTENVTT
                     VTATVTSTPMAEPGTAVPTSTSAPTTAPVQCNLDPRTSDFGPYLAQSRTPVGELAGSA
                     DSVVQVPDWFYHFQMGDNGYDSCSKLSYVVLNGSNGDAERSAGTGAAIADVVVLFIDG
                     HMVARPAPFEMKTVESVTRVSDSEIQVVYGHAGRSTAEGVTDYFTFNFFVDNGVLSGR
                     GDLPEHIDTHMRLYLL"
     CDS             682407..682775
                     /codon_start=1
                     /locus_tag="cgR_0620"
                     /product="hypothetical protein"
                     /protein_id="BAF53591.1"
                     /transl_table=11
                     /translation="MIQQESRLKVADNTGAREILCIRVLGGSTRRFAGIGDVIVATVK
                     EATPGGNVKSGEIVKAVIVRTKKETRRADGSYISFDENAAVIIKNDNEPRGTRIFGPV
                     ARELREKKFMKIVSLAPEVI"
     CDS             682778..683092
                     /codon_start=1
                     /locus_tag="cgR_0621"
                     /product="hypothetical protein"
                     /protein_id="BAF53592.1"
                     /transl_table=11
                     /translation="MKVHKGDMVLVISGPDKGAKGQVIAAFPKTEKVLVEGVNRIKKH
                     VANSAPERGAESGGIVTQEAPIHVSNVMVIDSDGNPTRVGYRFDENGKKVRVSRRNGK
                     DI"
     CDS             683092..683667
                     /codon_start=1
                     /locus_tag="cgR_0622"
                     /product="hypothetical protein"
                     /protein_id="BAF53593.1"
                     /transl_table=11
                     /translation="MTENYIPRLKTRYQDEIRTKLQGEFEFENVMQIPGVTKIVVNMG
                     VGDAARDSKLINGAIEDLTAITGQKPQLRRAKKSIANFKLREGMPIGAKVTLRGDRMW
                     EFLDRLLTVALPRIRDFRGLSDQQFDGHGNYTFGLTEQTMFYEIDVDKIDRPRGMDIT
                     VVTTAVTDDEGRSLLRELGFPFKGEDGNRQQ"
     CDS             683714..684748
                     /codon_start=1
                     /locus_tag="cgR_0623"
                     /product="hypothetical protein"
                     /protein_id="BAF53594.1"
                     /transl_table=11
                     /translation="MSTQWVTFRGKLSNQNKGTFINVQRKLLAIVGAFMAGALALGTP
                     TAQAQSIGSSASQKTEVLRGLTSSAGIPDATAPEGGAKVVVFGDSHASGTNAPFDVDE
                     RGCLKGNQSWPDQLQAQQGLQQGELIDLSCNGASINSTGFHFSDEVRHAEALGAIGPN
                     TENIFIQFGKNDQWGHSPINLRYSVINCLFDAANGCGEKAVAAGTMQDPSSVTGENYA
                     QRMKPVIDYLKYYAPNAQITLLGYQEYTPRSGSEICVRVGGTELRKPDATNLVSYMNN
                     LESAIFEASEILDVQHANLREVTAGHSSCSAEPWVNGVLDMRVNAVGGTWHPSPKGDE
                     VTAGLLGTLM"
     CDS             complement(684753..685562)
                     /codon_start=1
                     /locus_tag="cgR_0624"
                     /product="hypothetical protein"
                     /protein_id="BAF53595.1"
                     /transl_table=11
                     /translation="MTLSLPPIGFGTVHLDGAPGVEAIATAIDAGYRLIDTAYNYENE
                     GTVGKAFRESGVPREELIVTSKLPGRFHARELGRVRIEESLYRLNLDYIDLLLIHWPN
                     PSKDLYVEAWETLIEVRDAGLVKHIGVSNFLPNHIDRLRRETGELPAVNQIELHPYFP
                     QVEQVDFHDELGIITEAWSPLSNGRGLVEEPLLKEIGERYGVGGGEIALAWHHARGIV
                     PIPRSTNPARQRSNLEAVKISLIDEDVQAITALARKNGRIKDQDPAVYEEF"
     CDS             complement(685584..686078)
                     /codon_start=1
                     /locus_tag="cgR_0625"
                     /product="hypothetical protein"
                     /protein_id="BAF53596.1"
                     /transl_table=11
                     /translation="MPEQAEQPNQAREELERIFPQWFVSAAENRDMSVGQAMKFSPKR
                     WLFPDFSFSYDDQDFVMPLIINFDSLINDLLAHQPGAFKCPGVTLSFPNNWEDLSHKQ
                     IQDCLWNALEEWFYFLEIYTWSAVDQRKYEHGQVPGDLRIGCLFEFFSSSRPNLQFLS
                     EPLP"
     CDS             complement(686078..687019)
                     /codon_start=1
                     /locus_tag="cgR_0626"
                     /product="hypothetical protein"
                     /protein_id="BAF53597.1"
                     /transl_table=11
                     /translation="MGRITQNLQVPRVVSTDEQVFVNTRPDTVAVEEPLEIRVNGTAL
                     TTTMRTPGHDIELVHGLLLAEGLITDASEVFTARYCAGAVGPDNQNTYNVLELDVIPK
                     DNPARDPAQNLAQNLAQNLAQNLEGSQHEAPHIPTFQPVRELNLVAAQRNVLTTSACG
                     VCGTTSIEQLMNKKGWPITPITPDPRMIVSLPDKLKSKQKIFDKTGGVHAAGLATLDG
                     EMLIVREDVGRHNAADKVIGNMLMAGKLPLENTILVMSSRASFELVQKAAMAGISGVI
                     AVGAATSLAIEAAQDAGIFLSGFVRGNKFNHYAGELG"
     CDS             complement(687022..687360)
                     /codon_start=1
                     /locus_tag="cgR_0627"
                     /product="hypothetical protein"
                     /protein_id="BAF53598.1"
                     /transl_table=11
                     /translation="MQPSSETSFTVDTTPRKNNEAEKMQKMYQWLDTVCTELDIDPDI
                     LAEVVPHLLNLTRDVAHGPSRPAAPMTSFLLGLAAGRSGTSTDDWAESTLVNALHLQE
                     IIAKNYPEAK"
     CDS             complement(687443..689731)
                     /codon_start=1
                     /locus_tag="cgR_0628"
                     /product="hypothetical protein"
                     /protein_id="BAF53599.1"
                     /transl_table=11
                     /translation="MTTPPTEISNVNPTANEFDDPDVGRRITSAAGVPGVLHALQHAI
                     PNRALLPLLTMNKPGGIDCPGCAWPEPSTANLGVVEFCENGAKAVAEETTPDRAGREF
                     WAEHSIYDLREKTDHWLGKRGRITEPMFYDRSSGDDHYRPISWDRAFEIIASKLREIE
                     PDEAVFYTSGRAPNEPAYMLQLLARRLGTNNLPDCGNMCHESTGTALGETLGLGKGSV
                     VMEDFYNTDLLISVGQNPGTNHPRALTAFKELKENGGKILALNPMPETGLMKFREPQS
                     VKGALSISDKLADEYLQIRLDGDRAFFQALNKELIRRGALDHAFLDKFCSGVDETIEH
                     LKSLDDEVLLKGCGLTAAEINKAADMVEKSDTVVVSWTLGVTQHKNAVYTIREMVNFL
                     LLTGNIGKPGAGTAPLRGHSNVQGDRTMGIWEKMPESFLAALENEFGFDVPRKHGFDT
                     VDSLRAMREGKTKFFLSLGGNLVRVSSDTSVVEKGMESNELTVHLSTKPNGSQAWPGE
                     QSLILPVIARTDKDVQKSGVQRVTVEDSAGAVHASTGKRTANKDLNLKSECDIIGTIG
                     KQTFGDAFWQPMIDNYDVVRDHIEATIPGFHDFNRRIDNPGGFLLPNGPRERIFNTSN
                     GKAQLTVNETNVIELPKDYLLMNTVRSHDQYNSTIYGLDDRYRGVRNGRRVVFVNPQD
                     CKQRGLKDGDIVDIVSVFDDGERRAPNFRVVEYDTARDCVTTYFPEANVLVPLDSVAE
                     RSNTPVSKSVVVRLEATGRTAS"
     CDS             690039..690773
                     /codon_start=1
                     /locus_tag="cgR_0629"
                     /product="hypothetical protein"
                     /protein_id="BAF53600.1"
                     /transl_table=11
                     /translation="MHLQILRTKCSKTTFAHRRSNAHYSVYRIENERFKALTITFSRV
                     ALTTLAVTATTLSLSTAANAQSSLLDETLDARQCVDADNVWVYVEYGEDSEKEPEGGC
                     ATDLTNGLTALKSAGFDVVTSDSSFGKMINSINGVAPDWEETGTYWSYFIGDVDEDYN
                     VEYSFSNYGAEGTIPEPGSVEAWVVGDGSPLEATTLPETPAATGSSEDGGWIAVIAGL
                     LALIGGGVAALYQGLITIPGLVLPKF"
     CDS             complement(690872..691678)
                     /codon_start=1
                     /locus_tag="cgR_0630"
                     /product="hypothetical protein"
                     /protein_id="BAF53601.1"
                     /transl_table=11
                     /translation="MINAIALKPKTFLTLSFLAVLSIVIFFWPLIVNPESFLSDKAQA
                     PLYIAIVIPLVLAAVIAEISENGFDVKAVAMLGVLTAMVAVVRPFGAGAAGFEAVFFV
                     LILGGRAFGPGFGFILGNTGLFASALLTAGIGPWLPYQMLAAAWVSFGAGLLPQVRGK
                     KEMLIIVLYAIVSSLGYGTMMNMSFWPYAIGVTSGLSFTPGAPVLENLHTFVLFCLTT
                     SMGWDLGRAFFTSVLLLLTAKPVLGALRRASRRAAFGVERDFGEAGVPRV"
     CDS             complement(691675..693384)
                     /codon_start=1
                     /locus_tag="cgR_0631"
                     /product="hypothetical protein"
                     /protein_id="BAF53602.1"
                     /transl_table=11
                     /translation="MSAPFSARTAWSTDPVLELESVAASYYDDERTLAAPQISDVNLT
                     LFEGEILLVVGRTGSGKSTLLNAMSGAMPHATGGRLDGRVRVVGRDTRDFPPRMLSDV
                     VGVVGQDPAASFITNTVEEELAYSMEQLGLPPAVMRKRVEETLDLLGIAELRYVPLAE
                     LSGGEQQRVAIGAVLTTRPALIILDEPTSALDPNGAEDVLATVTKLAHDLAMTVVLAE
                     HRIERVLQYVDRVAHVGADGHVTVGTPEEIMADADVAPPIVELGRWAGWAPLPLSIRD
                     ARAHSADMRKRLYQRGLVVNKLHNHAVQPLLIAEDIVVEFPEIRAVDGVNLNLNAGEI
                     TVLMGRNGCGKSSLLWALQGSGTRNQGSVQVLDEATGFSWTDPKTLKPAKRRNLVSMV
                     PQTPTDILYESTVHAELARSDKDAAAPAGTTREILDSLVPNIPDHLHPRDLSEGQKLS
                     LALSIQLAAKPRVVFFDEPTRGLDYDGKKSLARSFQQLADDGHAILVVTHDVEFSALC
                     ADRVLFMASGKIISDGTAVEILPASPAYAPQVAKITAGIQEESHWLTVSAVKAALGHG
                     EIS"
     CDS             complement(693384..694532)
                     /codon_start=1
                     /locus_tag="cgR_0632"
                     /product="hypothetical protein"
                     /protein_id="BAF53603.1"
                     /transl_table=11
                     /translation="MKWIKRYVLSRRMVHPWAWWVWALGIAGCASMTNNPYILALTFA
                     TLCFVVFNRRGSSPWSRAFPIYLMIAGWLVVYRLVMHIVVGAKIGTIELFRIPPVQLP
                     EWAAGIHVFGTVYLEGLIIATTQGLTLGTMIVAVGAANSLADPKKLLKSLPGALGELG
                     TAVVIGISIAPQMAESAFRINRARTLRGDDARGVRGFARILMPVFQDTLDRSLALANS
                     MDARGYGRQAHVSKFQQRVTSIFGALGILGVTVGLFVVLDASSPMFVAVPVFITGVGF
                     LIISLVVASHRKTSTTFDQLPWGAAEWLVCITGVIPLLMAALTRYIDPGSMITTWVPL
                     HMPDTVPLLVVAGLVVATMPGFLTPRLPKNKVRVKRRKAINSPERAEV"
     CDS             complement(694539..695612)
                     /codon_start=1
                     /locus_tag="cgR_0633"
                     /product="hypothetical protein"
                     /protein_id="BAF53604.1"
                     /transl_table=11
                     /translation="MSRTSTFHLSLKAFAAAVALWIVLAISPWVPSAHALTTPCEDDQ
                     VTVMVEGNTIGCADAGGNGYQTLLDAGFDVETTVQFPEFLCRINDFPGPDVDDCMTAS
                     PAEAYWSYWHAPLGGDEWEYSNLGAFLYYPKPGTVQAWYWGDTDRPGAIPVSKSQAEL
                     GLDSADPDYKIDFDPNDFITTTPTSESPIADLGNDDEPTETTQAPIAGDGAGSARGQA
                     AGPTAEVNPENPNEVLVYQDSEGNSITKGQYENLVAAAAAKTTAAVQAPAGAGEANSQ
                     PQATAVAEAPEVDPMTTQVLMAPAGQDGDVMAEGSTQQMYATGTVDSSAQGWIIGLTL
                     AVISLVSASAVAAWAIRRSEVQG"
     CDS             complement(695633..696796)
                     /codon_start=1
                     /locus_tag="cgR_0634"
                     /product="hypothetical protein"
                     /protein_id="BAF53605.1"
                     /transl_table=11
                     /translation="MAHLRGKRTIRWSAATVALATGVSLLAPQVVAAQDASSDIQLAT
                     QFIEKEFATNGLIPGPVGTPDIGLNQDLLLSLKALDPDSPKIDAAYAAIAPELEGYVS
                     VSDHIFSDRLAKTVAFQDALGIRNADFIAQLVSAVQENGQIKNLDNGEATTAINNFSQ
                     AWGVLALHRVGETEAAERATDFLETQVCSDGGVQLASAIEPTCKTTDSDVTAMAAQAL
                     TLANGAQDPTTQATLDYLVTTMDETGGVKNTWTGVNSNSTGLVGSAFALAGEEENYLK
                     AREYLASVQFGEDSDPSIQGGFAFTVKAKETDTAISDQIRRATSQAALGFAGGNYANA
                     ELITIANPVDPTPPADSEGSTGGFGGAGIIIAILAILAAIAGVMGPMMANLQF"
     CDS             complement(697117..697587)
                     /codon_start=1
                     /locus_tag="cgR_0635"
                     /product="hypothetical protein"
                     /protein_id="BAF53606.1"
                     /transl_table=11
                     /translation="MEEFGTDPIHGSGYFENYLPIDFSEAGFHHYLKERTDAADPSVP
                     PPEGFVHCSYFWIVDDDDVLVGFLALRHELNQHLLEVAGHIGYGVRPSARRKGAATAA
                     LKLGIHEAQALGIDKVLLCVAGDNEASRNVIEKCGGVYESTIRGMRRYWIATDS"
     CDS             697998..698396
                     /codon_start=1
                     /locus_tag="cgR_0636"
                     /product="hypothetical protein"
                     /protein_id="BAF53607.1"
                     /transl_table=11
                     /translation="MTMTDPIADMLSRVRNASNAHHDTVSMPSSKIKANIAEILKQEG
                     YIANYTVEDAKVGKTLSLELKYSNTRERSIAGLRRVSKPGLRVYAKSTNLPQVLGGLG
                     VAIISTSQGLLTDRQATEKGVGGEVLAYVW"
     CDS             698416..698952
                     /codon_start=1
                     /locus_tag="cgR_0637"
                     /product="hypothetical protein"
                     /protein_id="BAF53608.1"
                     /transl_table=11
                     /translation="MSRIGKEPITIPSGVETKIDGQLVEVKGPKGTLNVNVPEPISVA
                     VEDGKIVVTRPDDHRTNRSLHGLSRSLVNNLVVGVTEGYTIKMEIFGVGYRVALKGKD
                     LEFSLGYSHPVLIEASEGITFAVDGNTKLSVSGIDKQKVGQVAAVIRRLRKDDPYKGK
                     GIRYEGEQIRRKVGKTGK"
     CDS             698956..699360
                     /codon_start=1
                     /locus_tag="cgR_0638"
                     /product="hypothetical protein"
                     /protein_id="BAF53609.1"
                     /transl_table=11
                     /translation="MSNTENKQKRVSVGKDIATRRRVARARRHFRIRKNLRGTPEAPR
                     LVVHRSSRHMHVQIIDDVAGHTLAAASSIEAEVRATEGDKKAKGAKVGQLIAERAKAA
                     GIEQVVFDRAGYKYHGRVAALADAAREGGLKF"
     CDS             699401..700036
                     /codon_start=1
                     /locus_tag="cgR_0639"
                     /product="hypothetical protein"
                     /protein_id="BAF53610.1"
                     /transl_table=11
                     /translation="MPGRERRDGGRSADDNKQNDRNERRGGGRRDDRRNQQQDERSQY
                     IERVVTINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIQKGAEEARK
                     NFFRVPMVNGTITHPVQGEKAAGIVMLKPAAPGTGVIAGGAARPVLECAGIQDILSKS
                     LGSDNAINVVHATVDGLKQLVRPEEVAARRGKTIEEVAPARILRARAGQEA"
     CDS             complement(699524..700255)
                     /codon_start=1
                     /locus_tag="cgR_0640"
                     /product="hypothetical protein"
                     /protein_id="BAF53611.1"
                     /transl_table=11
                     /translation="MELNWFAHCYLLPRHFFDDDQVANCQDHATYLWGIGTDHGVADS
                     LQTEGTKIVAMLGLGAHSAFDLSNLQRHFLRLLTCACTQNTCWCDLFDGLATAGCNLF
                     RADQLLQAVHSCVDDVDSVVRAKGLGQDVLDTCALKNWTCCATGYNTGTWSSWLQHND
                     AGCLFALNWVGDGAVDHWDAEEVLTSLFCTLLDCGRDFLGLAVTDTDHSLAVANDDKC
                     GEAEATTTLDDLGHTVDGDYTLDVL"
     CDS             700040..700225
                     /codon_start=1
                     /locus_tag="cgR_0641"
                     /product="hypothetical protein"
                     /protein_id="BAF53612.1"
                     /transl_table=11
                     /translation="MALKITQIKGTVGTKPKHRDNLRSLGLKRIRHTVIRPDTPEVRG
                     MILAVRHLIVVEEVAGE"
     CDS             700232..700678
                     /codon_start=1
                     /locus_tag="cgR_0642"
                     /product="hypothetical protein"
                     /protein_id="BAF53613.1"
                     /transl_table=11
                     /translation="MSEPIKLHDLRPAAGSNKAKTRVGRGEASKGKTAGRGTKGTKAR
                     KQVSAAFEGGQMPLQMRLPKLKGFKNPNKVDYQVVNIADLAEKFPQGGDVSIADIVAA
                     GLVRKNELVKVLGNGDISVKLNVTANKFSGSAKEKIEAAGGSATVA"
     CDS             complement(701193..702545)
                     /codon_start=1
                     /locus_tag="cgR_0643"
                     /product="hypothetical protein"
                     /protein_id="BAF53614.1"
                     /transl_table=11
                     /translation="MTNDMLATGHREIHIETKKSSDSLSNEHKRVLGGAMVGTTIEWF
                     DFFIYAQAAGLIFATQYFNPATNQSPSLAQIIAWASLGISFLFRPVGAIIAGHLGDKL
                     GRKPVLVLTLLGMGGATFAMGLLPNYAAIGIAAPILLVLLRILQGLSAGGEWGGAALI
                     AVEHAPTNKRGYFGAFPQVGVPAGMALATIFMLIVTTALSPEQFETWGWRIPFLSSLL
                     LIGIGFWIRSLVEESPVFAEMNDLKKTASAPLSTLFKQHSKLVILCALIFAGCNAAGY
                     LAIAFFASYGTSVLKMDRPVVLALTLLTALAWIVATLVAGKVSDVIGRKQTFVIGYAA
                     MIIWAIPTWLLIDTGNVLLFGIGVIVLGLFLGITYGPQPSLYAEMFPASVRLSGLSIG
                     YALGSIIGGAFAPMIAELILDTTGNSINIGIYIAIISAISLIAVLMVPKGIQGKSLHD
                     "
     CDS             complement(702672..703988)
                     /codon_start=1
                     /locus_tag="cgR_0644"
                     /product="hypothetical protein"
                     /protein_id="BAF53615.1"
                     /transl_table=11
                     /translation="MTSVYNISSTHNGPTTGIEFASRDEITALQTERAKNTLRHSYYN
                     VKHYRQAFDEIGVHPDDFRELSDLAKFPMTDKSTLRANYPFGMFAVQQHQIARLHASS
                     GTTGLPTVVAYTHKDIETWADLMARSLRAGGIRPGDRVQVTFGYGLFTGGLGAHYGVE
                     KLGATAIPTSGGQTERQIQIMNDFKPDAILGTPSYMLNVLDRIRKEGQDPRETSLRVG
                     VFGSEPWSEGMRHELEAGFGIDATDIYGLSEVMGPGVAQECIETKDGLTIWEDHFYPE
                     ILHPETLEPVPDGEFGELVITPLTKEAFPVVRYRTHDITRLLPGTARSMRRLDRISAR
                     NDDMIILRGVNCFPSQFEELIVEDPHLRPRYQCVLTKKGRMDHLTIVVEHAQNRTADE
                     IQQAGLNLRKQIKDRIGITVDVDVRDEVNSGEGKAKRIVDLRNEEA"
     CDS             complement(704306..704935)
                     /codon_start=1
                     /locus_tag="cgR_0645"
                     /product="hypothetical protein"
                     /protein_id="BAF53616.1"
                     /transl_table=11
                     /translation="MTPTSISQALPATGRGRPGYSRAQVISEAVNEFNAHGYEATSMG
                     TLAKRLGITKSAIYHHVTSKEEILQEATDLALTSLEEISTEAWEQTGGPKAQLVFLIK
                     GSIAVLCEHKAQVTLLLRLRGNSEAELEAMKRRRELTRAMIDLVVHAQEAGEIRPDLD
                     AGVVGRLIFGTVNSLTDWYEAGGKLTPEEIADTTAELVLSGLKTATPST"
     CDS             705096..705533
                     /codon_start=1
                     /locus_tag="cgR_0646"
                     /product="hypothetical protein"
                     /protein_id="BAF53617.1"
                     /transl_table=11
                     /translation="MSETAVDISQIESDLEFTRAMYENDGSLKAMGISITKLETGHVE
                     GEFIVRPEMCNGHNSIQGGFLFTFADALFAGACNSTRGAVTVASQVQIHFIAPAFAGE
                     TLRGVAIERQSWGRNGLSDVTVFRGDKVIAEFRGMSRTVGKRA"
     CDS             705713..706687
                     /codon_start=1
                     /locus_tag="cgR_0647"
                     /product="hypothetical protein"
                     /protein_id="BAF53618.1"
                     /transl_table=11
                     /translation="MTTAVAPDTNADTAGQQRFDEIIAADSRIEPTDWMPAAYRKTLT
                     RQISQHAHSEIIGMQPEANWISRAPSLKRKAILMAKVQDEAGHGLYLYSAAETLGTSR
                     DELVNQLLEGKAKYSSIFNYPARTWADIGAIGWLVDGAAICNQVPLCRASYAPYARAM
                     VRICKEESFHQRQGWEILYELSHGTPEQKQMAQEAINRLYRPALQMFGPPDADSAHSG
                     QSMKWNIKRFSNDELRQRFVDMIVPQVEALGLTFEDPDLKWNEERGHYDFGELDWDEF
                     FNAINGNGPLNSQRLKRRREAFDDGAWVREAAAAYDRKHNRVDTALVV"
     CDS             706709..706996
                     /codon_start=1
                     /locus_tag="cgR_0648"
                     /product="hypothetical protein"
                     /protein_id="BAF53619.1"
                     /transl_table=11
                     /translation="MSDSTWPQFEVFVRSNRGLSHVHAGSLHAPDETMALRNARDLYT
                     RRNEGTSVWVVPSQAITASDPDSKGGFFESASGKAYRHATYFEKSEGVPHL"
     CDS             706993..707826
                     /codon_start=1
                     /locus_tag="cgR_0649"
                     /product="hypothetical protein"
                     /protein_id="BAF53620.1"
                     /transl_table=11
                     /translation="MSFATNDSATRQTQGDAMTPEDVVASGQVASDAVANYALMLADD
                     SLMLAQRLGWWISRGPEMEEDIALGNIGLDLLGHARFFYSYAGTAWGKTEDDLAYFRT
                     EEEFRSAAIMEQENGDFAQTIARHLIVSYYLIGLYSKLESSADQMLASIAAKAVKELE
                     YHVDHANQWVLRLGDGTEESHRRMQDGLNYMWPYVNEIFEDLPLHTELAAQGIAVLPS
                     ELRADFDTRVEAVIEAATLKVPAVPQAVSGHRTGRFSEYRGFILAEMQSLARQHPGAT
                     W"
     CDS             707877..708413
                     /codon_start=1
                     /locus_tag="cgR_0650"
                     /product="hypothetical protein"
                     /protein_id="BAF53621.1"
                     /transl_table=11
                     /translation="MSITTTNHPLRPQDTELARLWDIAAQVPDPEIPVISIADLGILR
                     GVAFEGNTVVVTITPTYSGCPAMGTITADVVDALKREGFENTRVDLVLHPAWSTDWMT
                     EHGKEKLREYGIAPPQGMSRRTSGPILLNLAPPTPVTCPHCHSTNTKLISQFGSTSCK
                     SLHTCKDCFEPFDYFKVH"
     CDS             708413..709567
                     /codon_start=1
                     /locus_tag="cgR_0651"
                     /product="hypothetical protein"
                     /protein_id="BAF53622.1"
                     /transl_table=11
                     /translation="MTSVIKKKAKFNTLSVSGVKKLTDDSVEVSFDVPEELQDDYDYI
                     PGQYVALRATVDGEELRRSYSICDIPNKGTIRVGIKKDLGGKFSTWANEELQLGDVID
                     VMNPQGAFTSKIHVTSLNDAQNLVDSELGQVENPNFVAIAAGSGITPIMSIAQAVLKS
                     LPKATFQLVYSNKGGADVMFADKIGDLKDKYPARFAVHHVLTREQRVNPLFSGRIDDE
                     KMELLLDQVLRPDLVDEWFLCGPFELVQMCRDSLKERDIDEKRIRFELFSTGDPKSAP
                     GGNAGRPVIADPKGKNISIQFQLDGLSGTIESPVSAKETVLNAALRARPDVPFACAGG
                     VCGTCRAKVVEGDYEMDENYALEPDEVAAGYVLTCQTRPTGDCITVDYDA"
     CDS             709580..710365
                     /codon_start=1
                     /locus_tag="cgR_0652"
                     /product="hypothetical protein"
                     /protein_id="BAF53623.1"
                     /transl_table=11
                     /translation="MIDLNIHRIDEHASYAEVVLNDPSTLNAIAEQDLLDISAAYTEA
                     EKAGVRALLLRGEGKGFCSGRNIKGVVPAEDDAADYLANKVTPVLKQMSAFPAPTFAA
                     VHGACLGVGLGLAIASDIVYVAEKSKFGSPFANLGATLDSGGHALFVERLGAHRTMDL
                     IVTGELISGAEAVNSGLFSRLVPTEELLDFTRDKVIRAAQGATQAFVTSKALVQDIRD
                     NCTGLWDSVAVENEEQGRLCSSTDYAEGFAAFNEKRTPVFFGR"
     CDS             710443..711648
                     /codon_start=1
                     /locus_tag="cgR_0653"
                     /product="hypothetical protein"
                     /protein_id="BAF53624.1"
                     /transl_table=11
                     /translation="MSDRTAYLVSGKRTPVGRYGGALSSVRPDDLAALTITAVIEESG
                     IDPSVVDEVILGNANGAGEENRNVARLAWLLAGYPDTVPGITVNRLCASGMSAIALAT
                     AMVESGQADVVVAGGVESMSRAPWVQEKPRSAFAKPGEIFDTSIGWRFVNPIFQEQEK
                     TTFSMPETAEEVARVKGVSREEADVFAATSQARALAAISAGHFDSEIVPVEITDRKGN
                     VTVVSQDEGPREGTTTQVLAKLRPVVRGGEVVTAGNSSSLNDGASAIIVASAEAVEKY
                     GLTARAKVVGASNAGLAPEIMGMGPVPATKKLLKRTGWSVEDLDAVELNEAFATQSLA
                     CMRELELDPEKVNAWGGAIALGHPLGSSGSRITITLLNRLEKEGGSKGIATMCIGVGQ
                     GSAIAIERV"
     CDS             711655..712404
                     /codon_start=1
                     /locus_tag="cgR_0654"
                     /product="hypothetical protein"
                     /protein_id="BAF53625.1"
                     /transl_table=11
                     /translation="MSFDFDALTITESDDLLIIELSRPEVRNAIDQTMVNELHEVCAY
                     LEENPKTAIIIGSDGIFASGADIGQLRERRREDALRGINNSIFHRIAQLPMPVIAAVD
                     GFALGGGLELALAADFRVATQNAKFGQPEASLGIMAAAGGTWRLKAAVGEPLAKDILL
                     AGRIIDGEEAKTYQLVSNLAPAEDLLDEAKKLAQRIGKLDPLAVRITKSVMALPESAH
                     PQADNLAQAILFESEAKFDRMQAFLDRKKSK"
     CDS             712430..713281
                     /codon_start=1
                     /locus_tag="cgR_0655"
                     /product="hypothetical protein"
                     /protein_id="BAF53626.1"
                     /transl_table=11
                     /translation="MSSEITVPNKVGVLGGGRMGGGIAHSFLAAGAEVVVVDINDAAV
                     EAAKERITKDIEGSIKRGAAGTVEEWSSRLSFSVDHSAFAGLELVVEAVPESFELKTN
                     AFAQISAHAPEAVIATNTSSLSVSDLAATVNNQVIGLHFFNPVPASNLVEIVVATQTP
                     QDLVEVARGWVEALGKTPIVVKDSPGFASSRLGVVIALEAIRMVEEGVASPKDIDNAM
                     VLGYKFPIGPLELTDIVGLDVRLGIAEYLESTLGANFTPPQLMRDMVARGELGRKSGK
                     GFYDYSA"
     CDS             complement(713278..713679)
                     /codon_start=1
                     /locus_tag="cgR_0656"
                     /product="hypothetical protein"
                     /protein_id="BAF53627.1"
                     /transl_table=11
                     /translation="MEQELWTIQLGELDKKMGVEVLEQSANKVVARMPIDGNRQSLGL
                     LHGGAMVSLAEAVGSWAAVIHASSMGKVAVGVDINATHHASGLKGYVTATATAIRLGR
                     TLTSHEVVLHDDAGKRLCTARITNAIVDKRA"
     CDS             713795..715891
                     /codon_start=1
                     /locus_tag="cgR_0657"
                     /product="hypothetical protein"
                     /protein_id="BAF53628.1"
                     /transl_table=11
                     /translation="MSNHVDIVPSYLQGQWVRPENPSRIVDVADASTGETVARVSSEG
                     LDIQGALDYARTEGQKNLKALTFHERALKIKELALYLNEHKDVLYQLAMCSGANKRDN
                     FVDIDGGISTMFTFSSKGRRELPNTNVIVDGPPEVFAKDSSFQGQHIYTTLTGVAVQI
                     NAFNFPVWGMLEKFAPSFIAGMPTIVKPATPTGYITAEAVRLMVESGILPEGSLQLIS
                     GSVGDLLDHLDYNDHVAFTGSAKTADTLRNLPKVRENGVRFSAEADSLNAAILGPDAS
                     VDTPEFEAYTKMLFAEMTSKSGQKCTAIRRAIVPSGLIEDVAQALKQRLDDKVTVGDP
                     RDASATMGPLVSVEQAEDVEGAVEKLIAAGGQVVTGGTVEGAFFAPTILTFADAYAER
                     IHDTEAFGPVVSLIGYGDIDEAIELAALGKGSLVASVATHDPATTARVAAGIAAHHGR
                     LHFIDREDAKTSTGHGSPLPHLIHGGPGRAGGGEELGGVRGIKHYMQRTAIQGSPNHL
                     TAITGEWHTGATTNRVTRAEVEAGTAEHPFRKDLATLKIGDQFASELREVTMGEIQAF
                     AEETGDTFYAHVNEEAAMRNPFFPRRVAHGYLLVSWAAGLFVEPAPGPVLANYGLENL
                     RFIQPVTYGDSIRVELTAKRITPRVTDEYGEVAWDTVLYNQDDEIVAAYDVLTLVEKV
                     NTTYANDQKAEELAGV"
     CDS             complement(715975..716340)
                     /codon_start=1
                     /locus_tag="cgR_0658"
                     /product="hypothetical protein"
                     /protein_id="BAF53629.1"
                     /transl_table=11
                     /translation="MQHPPVPGKSILAFYVVVLVALCLWFKIGSIPDIAVIGYILALS
                     FTSAIITAALTQKSPQWVLLTVGLVGLIIVGICIFLWITVPEGILNIAVLLVASGAVI
                     AEISLLISRMRPRRRQATH"
     CDS             complement(716511..718004)
                     /codon_start=1
                     /locus_tag="cgR_0659"
                     /product="hypothetical protein"
                     /protein_id="BAF53630.1"
                     /transl_table=11
                     /translation="MSAVARRASLQLPYTHVDDFYINGSWVKAEGTKRNPVIDPAVGQ
                     EWGSVPEATESELDTAVGAARTALKSWGALTGEERAGYLLKIATEIESRSESLALTNT
                     RENGSPISETRGAASNAAGIFRYFATLAPWLDGEDIRPFPAGGAESIVDKDPIGVCAL
                     IAPWNFPINLVVIKLAPALLAGCTVIIKPASPTPLSIRFIIEAIEAAGVPAGVVNLLT
                     GSGSFGDALVRNPGVDKVAFTGSTPVGKKIAAACGELLRPVTLELGGKSSAIILPDAD
                     MSVLSARLIRSCMRNTGQTCYISTRIIAPSSRYEEVVQTVASTIAAGTQGDPYDEETV
                     FGPVASASQYSTVMSYIDSAREEGARVVAGGTRSIGLSEGLESGEFIQPTVFADVTPD
                     MRISREEIFGPVISILKYDDTNGVSEAIALANNTEFGLGGLVFGADEEQALKVARQVD
                     SGSVGINFFGSNHSAPFGGRHESGMGVEYGIEGLSAYLTYKSIHRTI"
     CDS             complement(718001..718738)
                     /codon_start=1
                     /locus_tag="cgR_0660"
                     /product="hypothetical protein"
                     /protein_id="BAF53631.1"
                     /transl_table=11
                     /translation="MTRSNLPAWEQADPSVHASDPRAITFAEDFRIRPIPAVGPIDTT
                     AICATPSGGFEQLWKAIEPETRTRANDIHLPIVAAYAERLCDAYPLADRELVLVAAIL
                     HDTGWAHVDESRIISEGFSGNWRKAAIRFEHETEGCAVARRVLPSLGYTADFAEHVCD
                     IIDGHDTRQVAYSLEDALVRDCDRLWRFDRAGIMASSSWFGMPVSDYIDRLHREILPE
                     LITEAAHQMATADLNRARALLRTDAIR"
     CDS             complement(718735..720003)
                     /codon_start=1
                     /locus_tag="cgR_0661"
                     /product="hypothetical protein"
                     /protein_id="BAF53632.1"
                     /transl_table=11
                     /translation="MNTSAETGILIIGANQSGVQLAISLRATGFTESITLLGEEDHRP
                     YQRPALSKEFLQDKIDKERLIFRSNEYWEENNIRLVKGVRIERIEKNDDGSGVAYGAG
                     QEFAFRRLALAVGARPRHLDLPGATFEGVTYLRNADDALALKAMIGSVTDAVVVGGGF
                     IGLEAACSLHDLGKNVTVLEYGPRLIGRAVGEETAAFFLEQHRSRGVNIVLDARMKQF
                     VGKDGKLSGVELEDGTVIPAQLVIVGIGVIPNTELATDLGLDINNGIVVDKHAVASDG
                     TTIAIGDVANIPNPIPGSPADERIRLESVNNAIEHAKIAAYSLVGQPEAYAGIPWFWS
                     NQGDLKLQIAGLTVGYDSTVIRQDPEKKKFSVLYYRGDNIIAADCVNAPLDFMAVRSA
                     LSKNQNIPADLAADISQPLKKLAVDLEVTR"
     CDS             complement(720013..720333)
                     /codon_start=1
                     /locus_tag="cgR_0662"
                     /product="hypothetical protein"
                     /protein_id="BAF53633.1"
                     /transl_table=11
                     /translation="MSTIHFIDHAGETRTIEATVGDSVMETAVRNGVPGIVAECGGSL
                     SCATCHVFVDPAQYDALPPMEEMEDEMLWGAAVDREDCSRLSCQIKVTEGMDLSVTTP
                     ETQV"
     CDS             complement(720360..721106)
                     /codon_start=1
                     /locus_tag="cgR_0663"
                     /product="hypothetical protein"
                     /protein_id="BAF53634.1"
                     /transl_table=11
                     /translation="MPSPRTVLITGAAGGLGRAFAEGFAAQGDRIAVADINLDGAQET
                     VDKLKALGADAAAFEVDVTSLESTEALAAGVTEFGGGRIDALINNAAVYATVTRSPFE
                     DIDPAEWDLVMGVNLKGPWLVTRSVSPFLSDNARVVNLSSATVFSGSAHWAHYVASKG
                     GVIALTRVLAKELGGRGITVNAVAPGFTLTEASLGLMDNAETYGVERGSIKRASQPKD
                     IVGTTMFLASPEAEYITGQTLIVDGGRQFI"
     CDS             complement(721099..723000)
                     /codon_start=1
                     /locus_tag="cgR_0664"
                     /product="hypothetical protein"
                     /protein_id="BAF53635.1"
                     /transl_table=11
                     /translation="MANKSFPKPSDLPVPRGAEGWEDLYPYYLVFQDKLMDEENEKFW
                     FCDSQHWPTVFKPFETIGGEFAVKCLGQYNARHLMIPNANGIEFRVHLGYLYMSPIPV
                     PEDQIAERVPMFQERITHYFQNWEPMLANWKERVLGTINELESLEFKPLPDYVPIYDI
                     VSGKAKDGTEVLMENFDRLIQLAYQNWQYHFEFLNLGYIAYLDFFNFCKEVFPDIPDQ
                     SISMMVQGVDMELFRPDDELKILAQLAVDLGLQTHFANPDDPQATLAAIAKAEGGATW
                     IARWEEAQDPWFNFTVGNGFYGHDKYWIEHLELPLGYIADYIRRLDEGQTISRPKDEL
                     IAEKDRVVEEYRDLLDGEQLAQFDAKCGLAATAYPYVENHNFYIEHWTMSVFWRKVRE
                     LSRTLQGYGFWENEEDLLYLNRTEVRDVLFDLATAWGVGAPGGPIGTIIWPEEIERRK
                     AIVTALKTARPAPALNTPPESITEPFTRMLWGITTEQVQSWLGNDEDTEEGTLKGMAA
                     SPGVVEGYARVILSADDLSEIQQDEILVAPVTAPSWGPIFGKIKATVTDIGGMMSHAA
                     IVCREYGLPAVTGTGAASTTIKTGDYLKVDGTKGKVVIVDPDAPRIEGPGAHSHAHEV
                     AAHGVDTHA"
     CDS             complement(723047..724141)
                     /codon_start=1
                     /locus_tag="cgR_0665"
                     /product="hypothetical protein"
                     /protein_id="BAF53636.1"
                     /transl_table=11
                     /translation="MTNSLNIPFVQRFDEGLDPVLEVLGGKGASLVTMTDAGMPVPPG
                     FVVTTASFDEFIREAGVAEHIDKFLNDLDAEDVKEVDRVSAIIRDELCSLEVPENARF
                     AVHQAYRDLMERCGGDVPVAVRSSATAEDLPDASFAGQQDTYLWQVGLSAVTEHIRKC
                     WASLFTSRAIIYRLKNNIPNEGLSMAVVVQKMVNSRVAGVAITMNPSNGDRSKITIDS
                     SWGVGEMVVSGEVTPDNILLDKITLQVVSEHIGSKHAELIPDATSGSLVEKPVDEERA
                     NRRSLTDEEMFAVAQMAKRAEKHYKCPQDIEWALDADLPDGENLLLLQSRPETIHSNG
                     VKKETPTPQAAKTIGTFDFSSITVAMTGTK"
     CDS             complement(724166..725461)
                     /codon_start=1
                     /locus_tag="cgR_0666"
                     /product="hypothetical protein"
                     /protein_id="BAF53637.1"
                     /transl_table=11
                     /translation="MTSQTSQTSQQSSSTGGCPFGHTSESTSHHGYQPFDMHNPFPAY
                     KELRQEEPVMFDERIGYWVVTKYDDIKATFDDWETFSSENAQAPVRKRGPQATQIMTD
                     GGFTAYSGLSARIPPEHTRIRAIAQKAFTPRRYKALEPDIRAMVIDRVEKMLANDQHV
                     GDMVSDLAYDIPTITILTLIGADISMVDTYKRWSDSRAAMTWGDLSDEEQIPHAHNLV
                     EYWQECQRMVAEAHENGGDNLTADLVRAQQEGQEITDHEIASLLYSLLFAGHETTTTL
                     ISNCFRVLLDHPEQWQAILENPKLIPAAVDEVLRYSGSIVGWRRKALKDTEIGGVAIK
                     EGDGVLLLMGSANRDEARFENGEEFDISRANAREHLSFGFGIHYCLGNMLAKLQAKIC
                     LEEVTRLVPSLHLVADEAIGFRENLSFRVPTSVPVTWNA"
     CDS             complement(725646..726452)
                     /codon_start=1
                     /locus_tag="cgR_0667"
                     /product="hypothetical protein"
                     /protein_id="BAF53638.1"
                     /transl_table=11
                     /translation="MAGGNREPGRTVTSKVIAVLGAFEHTMRPLGVTEIAELADLPPS
                     TTHRLVSELTEGGLLSRKSDGRYQLGLRIWELAQNTGRQLRDTARPFIQELYSLTSET
                     AQLVVRDKDEALLIDRAYGTKKIPRSARVGGRLPLNSTAVGKILLAFDEPWVKQSYLK
                     LPLNASTPKTIVNPEVLAAQLKQIHSQGFAITHDEQRIGGASVAVPVWHTGKLGAALG
                     LVVPTAQAANLERYLPILQATSQRITKATALIPLDTLLASHKNAGRKGDI"
     CDS             726828..728150
                     /codon_start=1
                     /locus_tag="cgR_0668"
                     /product="hypothetical protein"
                     /protein_id="BAF53639.1"
                     /transl_table=11
                     /translation="MSAIIQAFKDADLRKKIFFTIAMIVLYRIGAQIPSPGVDYATIS
                     GRLRDLTQDQSSVYSLINLFSGGALLQLSIFAIGIMPYITASIIVQLLTVVIPHFEEL
                     KKEGQSGQAKMMQYTRYLTVALALLQSSGIVALADREQLLGAGIRVLSADRNFFDLIV
                     LVITMTAGAVLVMWMGELITEKGVGNGMSLLIFAGIATRLPTDGMNILGNSGGVVFAV
                     VLASVLILVIGVVFVEQGQRRIPVQYAKRMVGRRQYGGSSTYLPLKVNQAGVIPVIFA
                     SSLIYMPVLITQIVNSGSLEVSDNWWQRNIIAHLQTPSSWQYIVLYFALTIFFSYFYV
                     SVQYDPAEQAENMKKYGGFIPGIRPGRPTAEYLGFVMNRLLFVGSLYLAVIAVLPNIM
                     LDLGVDAGSAGATPFGGTAILILVSVALTTVKQIESQLLQSNYEGLLK"
     CDS             complement(728129..728611)
                     /codon_start=1
                     /locus_tag="cgR_0669"
                     /product="hypothetical protein"
                     /protein_id="BAF53640.1"
                     /transl_table=11
                     /translation="MIDQRSSLIAVDTETGADGLFVVISATAGQHALHDDVFRNLVVN
                     NTIEGLASFGKQVSQDVSLLNGAWETIQKEAFCSIGLSKAGSNHTCSHVGWNQLASVD
                     VLLGLDTQRGTLANVGAEKIASRNVRNAKLLRENCSLGALTSTGRSEEYESHYFRSPS
                     "
     CDS             728150..728695
                     /codon_start=1
                     /locus_tag="cgR_0670"
                     /product="hypothetical protein"
                     /protein_id="BAF53641.1"
                     /transl_table=11
                     /translation="MRLVLLGPPGAGKGTQAAILSEKLGIPHISTGDLFRANIGEGTP
                     LGIEAKQYIDAGKLVPTDVTARMVASRLAESDAAEGFLLDGFPRTVEQADILANLLSE
                     AGQTLDGVVNYQVSEDVVVERMLSRGRADDNEETIRTRLGVYRDETAPLIDHYGDKII
                     NIEAEGEVEEINARTLKALGK"
     CDS             728852..729646
                     /codon_start=1
                     /locus_tag="cgR_0671"
                     /product="hypothetical protein"
                     /protein_id="BAF53642.1"
                     /transl_table=11
                     /translation="MGFRSKKKVIAAKTAAELDAMQAAGEIVGKALQAVRAEAKAGMS
                     TWDLDQIAEQVIRDAGAVPTFLGYQGFPASVCASVNEVIVHGIPSKETILEEGDLVSI
                     DCGATFDGWVGDSAWSFGIGELDEDVQGLNLATEWVLMEGMKAMVPGNRLTDVSHALE
                     VATRKAESKFGVVLGIVDGYGGHGIGRHMHEEPYLANEGKAGKGPVIQEGSVLAIEPM
                     LTLGTEDSAVLEDDWTVVTLDGSWAAHWEHTVAATKGGPRILTPRY"
     CDS             729726..730556
                     /codon_start=1
                     /locus_tag="cgR_0672"
                     /product="hypothetical protein"
                     /protein_id="BAF53643.1"
                     /transl_table=11
                     /translation="MPPGEEAIKLFCLSNIKIIKQPYILQRMAKNSRIRYSASIKRGA
                     AAILTAAATSVALIAVPATASAQDLATGSSQIQTDAREGAWATRNTIQDQLASIGPAA
                     LPVRAAVDNAINGMFPGLVDEKVAAEQEAARAEAEREAAAAREAEAARVAAEEAARFD
                     RGSCPAIADVCVDIDGGRTWLQENGQVTYGAVPVSSGGVGQETPRGTFYINRKVKDEI
                     SYEFGNAPMPYAMYFTYNGHAFHQGNVATTSAGCVRLNTQDAIYYFNNVGIGDMVYIY
                     "
     CDS             730768..731934
                     /codon_start=1
                     /locus_tag="cgR_0673"
                     /product="hypothetical protein"
                     /protein_id="BAF53644.1"
                     /transl_table=11
                     /translation="MKIAVAGLGFVGTSNAALLSKNNEVIAMDINQTRVDALNNYVSP
                     VEDAELDRYLATKPETLRATTDTQEAYGDAEFVIVATPTDYDPETNFFDTKYVESAIS
                     EAQRVNPDASIVIKSTIPVGFTEKMRAQYPNATIFPSPEFLREGSAFYDNLHPSRIVV
                     GERSEVGQQFALLLKEGAVDEATPVLFTDATEAEAIKLFANTYLAMRVSYFNELDTYA
                     STMGLKSKQIIEGVSLDPRIGNKYNNPSFGYGGYCLPKDTKQLLANFDTVPQRMISAI
                     VESNSVRKDFIAEDILSRQPKTVGVYRLVMKTGSDNFRSSSVQGVIKRIQQAGVPVVI
                     YEPTLNSESYFDSKVVTDLDEFKRDCDLIIANRPTHELDDIADRIYTRDLFERD"
     CDS             731944..733002
                     /codon_start=1
                     /locus_tag="cgR_0674"
                     /product="hypothetical protein"
                     /protein_id="BAF53645.1"
                     /transl_table=11
                     /translation="MGIIHIGPSPQLLPVKLGPGDILEIDSDLTGVLTVIAHGDAHNR
                     VHIRPANPDTFLNLESLVLTNPRHVTLSDLNIITTDDHDGVLVWATEASADIRLERVF
                     VKGARNGIAIGTDQPAGLRDVIVDSCLIQDCLLQGILCFGPETPQYGLHNVKVTQCRV
                     ERTRGDPTLTNSHSGSGIILGSVDEGEIVDCHAEGNGAACVATEGPEGIFVYDCRRVR
                     IRNCASKSNRTGGPADGGGFGIDIRCVDCLIENCDAIDNDGAGILVWNLPGMIGGGHV
                     LRGNRLSNNCRRTTWHGEITVTPSAGKVEISENTIESKANISGILTGIGAKNIKLKAN
                     AFLKSSALEIEECHMPQH"
     CDS             733242..734675
                     /codon_start=1
                     /locus_tag="cgR_0675"
                     /product="hypothetical protein"
                     /protein_id="BAF53646.1"
                     /transl_table=11
                     /translation="MLIGNKPLVGELSLDSADAGDPSNPVHVTSERDFPGIEAEGPAG
                     ITIIDTSGVIVEDISVSVSHDHSEEATDGVLLHATEGSGMHSGITVQKVRVTGAYNGI
                     AASSAGAGDGFDDVIIKDAIVQDCIRNGIITYGPTAPDYGHKNIRVLDSVVSGTKGIS
                     DITTNSGSGIVIGSVEDAVVERNEAFNNGALSNADEGPIGIWTHDSTRVLVRDNRSHD
                     NSSQRSDGGGFGLDIATTNSTMERNYSYNNAGPGFLLIAHQGGGSSGANVVRYNASIG
                     DSWLNAYHGGISAIGGFSSSEDEPQIEDTKIHHNTVFPAPSSGAAALKLRGNLDGITV
                     HHNILDTSAGDAPSIAAIDVSADSKVNFIANQLAVNQFTRTPVFDWNGERAQTVEQAE
                     ALVQDSFDNFEYAPIYPGGFEISTVLDTIAWTQPVSVPSLVPGDSTPATKDLAGNTVE
                     EPNSYVGAINPTFSDQNARRQRTFERR"
     CDS             complement(734623..735630)
                     /codon_start=1
                     /locus_tag="cgR_0676"
                     /product="hypothetical protein"
                     /protein_id="BAF53647.1"
                     /transl_table=11
                     /translation="MDLVKGPVLVTGGTGFIGSHTVVELLNAGKQVVVIDDLSNSTID
                     VLASIEEITGSKPPLEIGDIRDRAFVDSVLAQYQPSAAIHFAAKKAVGESVEQPTMYL
                     NINIGGTATLLDALHHAGVRDIVFSSSCSVHGETTHSPLNEDSPTQPANPYAFTKLTG
                     EKMLSQLVEADESWSAISLRYFNPIGAHPSGKLGESGLGRPRNIMPWLLDVAAGRKQS
                     LEVFGDDWPTPDGTCIRDYLHVVDVARVHVRALEHFKTGQAEVFNIGTGVGTSVLELI
                     NTMEEATGREIPYEISARRSGDVSALVADAQRVATQWGWVPEFSVFQMCADAWRFDQK
                     K"
     CDS             complement(735618..737396)
                     /codon_start=1
                     /locus_tag="cgR_0677"
                     /product="hypothetical protein"
                     /protein_id="BAF53648.1"
                     /transl_table=11
                     /translation="MSNGWVSDIRSTGPILATDTPRVIRDASEELFVPAMPRSTQRWL
                     NLTVLLWVVLVICFVVWWFKPEHVGTTTGLVLNSAVASFILLLPIAFVSRIRSIRRIN
                     PDVPLPDSRVAMVTTRAPSEPFSEVQPTLEAMLNQNYKADYDVWLCDESPTEEISDWC
                     EANGVYLSTRFEDEGYHRSSWPRRTRCKEGNLAYFYDNHGYANYDIVAQFDCDHIPEP
                     DYLEAILRPFSDPNVGYVAAPSMCDLNRKDSWSARGRLYAEAMIHGPHQSAHNGGLTP
                     TCIGSHYAVRTADLAKAGGIGPELAEDFSTSYVIRLTGADGAFAVDAKAHGQGPSTFA
                     AMVTQEFQWCRSLTVLLFTLVGRTLNVYGPRLKFRFLFALLVMPAMGMMTGAGFLIAP
                     LAVVFDKQWMSMNILDFFIFTTVVSLPLVGMLLILKKAGLLRPNDIPVVNWESGLFQL
                     VRWPYVVRGFFAGLRQVIFRKEVHFKVTPKGDLGIQPISMNVMLPYHFLTAAMVVIGL
                     WGLIDHRSPGYAGLTLLGGLIYGFVCFIVPWMHFCELPSANTTFMERLRAVAFPLLAG
                     IIMFLASVFALALYAAIFFGGYQWIW"
     CDS             complement(737501..738454)
                     /codon_start=1
                     /locus_tag="cgR_0678"
                     /product="hypothetical protein"
                     /protein_id="BAF53649.1"
                     /transl_table=11
                     /translation="MRCVITGGAGFLGSHLTDLILNQGHEVIVLDDLSTGSLSNLFHQ
                     ISNPRLQIKTVDVRKKFEIDGPVDIVFNLASPASPPVYTQRRVECLLINSEAVLQVAE
                     FALEKGARLVQASTSEVYGDPLSHPQLEHHWGNVNPIGERSCYDEGKRFAEALLSAMR
                     LEQGLNAGIIRIFNTYGPRMHPFDGRVISGFVRQALANEPLTVFGDGSQTRSFCYVSD
                     LVRGLWLMGNSNQPGPINLGNPIEQTVLSMAHLIKESTNSESSITFEPLPSDDPVRRR
                     PDISKAKELLGWEPLVGIDVGLREVINWQIETQRTYAEKIS"
     CDS             739081..739299
                     /codon_start=1
                     /locus_tag="cgR_0679"
                     /product="hypothetical protein"
                     /protein_id="BAF53650.1"
                     /transl_table=11
                     /translation="MAKEGAIEVEGRIVEPLPNAMFRVELDNGHKVLAHISGKMRQHY
                     IRILPEDRVVVELSPYDLTRGRIVYRYK"
     CDS             739490..739858
                     /codon_start=1
                     /locus_tag="cgR_0680"
                     /product="hypothetical protein"
                     /protein_id="BAF53651.1"
                     /transl_table=11
                     /translation="MARLAGVDLPRNKRMEVALTYIYGIGPARSKQLLEETGISPDLR
                     TDNLTDEQIAALRDVIEGTWKVEGDLRRQVQADIRRKIEIGCYQGIRHRRGLPVRGQR
                     TKTNARTRKGPKKTIAGKKK"
     CDS             739861..740265
                     /codon_start=1
                     /locus_tag="cgR_0681"
                     /product="hypothetical protein"
                     /protein_id="BAF53652.1"
                     /transl_table=11
                     /translation="MPPKARTNARRTGRRVVKKNVANGNAYIKSTFNNTIVSITDTNG
                     AVISWASSGHVGFKGSRKSTPFAAQMAAENAARKAMDHGMKKVDVFVKGPGSGRETAI
                     RSLQAAGLEIGSISDVTPQPHNGCRPPKRRRV"
     CDS             740289..740894
                     /codon_start=1
                     /locus_tag="cgR_0682"
                     /product="hypothetical protein"
                     /protein_id="BAF53653.1"
                     /transl_table=11
                     /translation="MARYTGPATRKSRRLRVDLVGGDMAFERRPYPPGQAGRARIKES
                     EYLLQLQEKQKARFIYGVMEKQFRRYYAEANRRAGKTGENLVVLLESRLDNVVYRAGL
                     ANTRRQARQLVSHGHFTVNGKAIDVPSFRVSQYDIINVREKSQKMNWFEEAQDNLVDA
                     VVPAWLQVVPENLRILVHQLPERAQIDIPLQEQLIVEFYSK"
     CDS             741012..742028
                     /codon_start=1
                     /locus_tag="cgR_0683"
                     /product="hypothetical protein"
                     /protein_id="BAF53654.1"
                     /transl_table=11
                     /translation="MLISQRPTITEEFVDNARSRFVIEPLEPGFGYTLGNSLRRTLLS
                     SIPGAAVTSVKIDGVLHEFTTISGVKEDVSDIILNIKGLVLSSDSDEPVVMQLVKEGP
                     GVVTAGDIQPPAGVEIHNPDLHIATLNETAKIEIELIVERGRGYVPATVTATGGEIGR
                     IPVDQIYSPVLKVSYKVEATRVEQRTDFDKLVIDVETKNSITARDALASAGKTLVELF
                     GLARELNIAAEGIEIGPSPQETEYIAAYSMPIEDLDFSVRSYNCLKREDIHTVGELAE
                     RAESDLLDIRNFGQKSINEVKIKLAGLGLTLKDAPEDFDPSTLEGYDAETGGYIDVEA
                     EDSE"
     CDS             742084..742590
                     /codon_start=1
                     /