LOCUS       AP006620               87093 bp    DNA     circular BCT 25-AUG-2017
DEFINITION  Nocardia farcinica IFM 10152 plasmid pNF2 DNA, complete sequence.
ACCESSION   AP006620
VERSION     AP006620.1
DBLINK      BioProject:PRJNA13117
            BioSample:SAMD00061069
KEYWORDS    .
SOURCE      Nocardia farcinica IFM 10152
  ORGANISM  Nocardia farcinica IFM 10152
            Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae;
            Nocardia.
REFERENCE   1  (bases 1 to 87093)
  AUTHORS   Hattori,M., Ishikawa,J. and Yamashita,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-SEP-2003) to the DDBJ/EMBL/GenBank databases.
            Contact:Jun Ishikawa
            National Institute of Infectious Diseases; Toyama 1-23-1,
            Shinjuku, Tokyo 162-8640, Japan
REFERENCE   2
  AUTHORS   Ishikawa,J., Yamashita,A., Mikami,Y., Hoshino,Y., Kurita,H.,
            Hotta,K., Shiba,T. and Hattori,M.
  TITLE     The complete genomic sequence of Nocardia farcinica IFM 10152
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101, 14925-14930 (2004)
COMMENT     This work was done in collaboration with Jun Ishikawa, Yasutaka
            Hoshino, Haruyo Kurita, Kunimoto Hotta (National Institute of
            Infectious Diseases) and Yuzuru Mikami (Research Center for
            Pathogenic Fungi and Microbial Toxicoses, Chiba University), and
            supported by the Research for the Future Program of the Japan
            Society for the Promotion of Science.
            The genomic sequence assembly and annotation was carried out by
            Jun Ishikawa (jun@nih.go.jp). The complete and fully annotated
            genomic sequence is also available at http://nocardia.nih.go.jp/.
FEATURES             Location/Qualifiers
     source          1..87093
                     /db_xref="taxon:247156"
                     /mol_type="genomic DNA"
                     /organism="Nocardia farcinica IFM 10152"
                     /plasmid="pNF2"
                     /strain="IFM 10152"
     CDS             1..705
                     /codon_start=1
                     /gene="parA"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_10"
                     /old_locus_tag="pnf210"
                     /product="putative partitioning protein parA"
                     /protein_id="BAD60686.1"
                     /transl_table=11
                     /translation="MATDGVLRLLFSTLKGGPGKTTSAILTAIALSRRGLTVVVICAD
                     TRTRGATDWVQEAERVGDVVPFRLAIWHESDGPLSQYARGVERSTGADVVIIDTGGEQ
                     PENFTHGCLYADWLIAPVGPFRAELRRLVPTYQSAAAVDESGSPLEISVLLTRCPAAH
                     KGKAKEAREQLTSNLVGEDGQLDPEVPYALGLDVLNTEISRGVAYDEFYGLMPEDVGE
                     YDALANEILDRRSRTS"
     CDS             705..1625
                     /codon_start=1
                     /gene="parB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_20"
                     /old_locus_tag="pnf220"
                     /product="putative chromosome partitioning protein"
                     /protein_id="BAD60687.1"
                     /transl_table=11
                     /translation="MPAPERPKRPRSRSVASGLPSTAHSDTAARVSAILAETASATIA
                     APDLQTSAPLSAFAHRPDNPRWAREYDPQADPELEAFAATVEEYGILQAVTVCSAEAW
                     LEHHPDDAFGAEVRYVVLMGNRRLAIARYKKIGQLPFHRNDRLADPRLSRESGIIENY
                     HRKPLDPVREAGEMAAVLAHTGESRRAFADRIGISHSQVNQRLQLLDLIPEFQGLVSD
                     LALPVHKALKVAALPHLDQAALLEMGPPYDPARLTDQTQPPEPESGKTLSTTKPVRIP
                     PHSTPDDVVEQLRKQLDPQLLDEVVRLLTK"
     CDS             complement(1671..3539)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_30"
                     /old_locus_tag="pnf230"
                     /product="hypothetical protein"
                     /protein_id="BAD60688.1"
                     /transl_table=11
                     /translation="MPPAQPGDGRELVWSVLAPAIAGYPAIRVIDPATNTTVRTRSRI
                     PARPPAQPAAVPVYDRAARTDKLVLDLDAKAHGPVAVARDAARARAWLEACGARVVSD
                     RNPGNGGRHLLAFFAAGETYSRADVEPVLRRLADRLPTLDLTPMLNARTGSITPPGSA
                     TRDGHFRVLDGSLEDALAAVRQRSEPGLLERLRAFLGPGAPEAVPTPAAPLPATASAS
                     ADLWEGAGADARLRAPWQCRTPVPAAVLAFAETGALPADGRWPSRSEARAAVLAATAL
                     RGWSLTDVRAHLTAWPGMAQAYARYRDPERALSQDWDRICTRWVAPHAHLFRSSEHRE
                     PGLTPPRVSQRSNTPISATSHREWLARAYAWTFATWPGQSYRWTVLAVLDALAYAAAV
                     TREPAAGATAPVAAVGVRSLASFAGLLSVGTVADVLADLRDRPGSPVLRVRRAAGTLA
                     DAYALVTPRRGEDLDREVDPVPLERVQVRQVHDAWRVLGLHARYLYELVESGLTRTQD
                     VIAAAGLARSTAYDSLAVLAQAGLITRGRGTVTLGPTTLDDIAARHGLHHLRTETLAR
                     HRAQRAAWHAWLEMRWHLTDEPPTDPPSIPLAPWDTDDELHEAIWATQMATGPPEP"
     CDS             complement(3731..3919)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_40"
                     /old_locus_tag="pnf240"
                     /product="hypothetical protein"
                     /protein_id="BAD60689.1"
                     /transl_table=11
                     /translation="MTARRGKPQLVEIDADLLAAVKAEAKRRQMTYRAFFESALSREL
                     EVSRRIEVVEAEQLKIAG"
     CDS             complement(3953..4648)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_50"
                     /old_locus_tag="pnf250"
                     /product="hypothetical protein"
                     /protein_id="BAD60690.1"
                     /transl_table=11
                     /translation="MPTDWEWEWLVQHDDPQPLELPKAAQNDPRVRAGAARHGGPGVA
                     RTVALQRARGEYVRNLDADDVLPSTALADAIEILTQHPEIGWTTCRVLDLMPDGTLKE
                     FPGDPADGPIPIGSVAEYWRAHDWRLHVHPTTITIRRDLLLAIGGWMALPISEDTGMM
                     LTANAFAAGWFIHRVGLYYRQHPDQITKADPNASDRAERMAMIDQRLRAIEALRRNTA
                     GTQIVCSPARRVG"
     CDS             complement(4726..5604)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_60"
                     /old_locus_tag="pnf260"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD60691.1"
                     /transl_table=11
                     /translation="MFGSNKNNGGIVTAKPESGQRLAVTNQEVSVSSANPAWVDIAAG
                     LRSRVAAGEWRPGEQLPSMRRLADEYGVGSHAPVNRAIMVLVSEGILTTDPAAPRRGV
                     RVRSTQVLTRDLFGNSVLPLTFEDETGADGVEVTVTYDWVEATADLATSLQVSEGTEL
                     LARTFRYTLDGTPHQVAREYMRADLARECGLTGPDAEVPGRNTAMWLERAGIHLHREH
                     LVLLTRNPTAEERDALAVPIGVPVYEKTLTTYDESDSPLDTRRILVVADRIIYTADRV
                     HPRRTDSADPAGADQC"
     CDS             5682..5945
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_70"
                     /old_locus_tag="pnf270"
                     /product="hypothetical protein"
                     /protein_id="BAD60692.1"
                     /transl_table=11
                     /translation="MSEGVFRLSFVPERLVSAAQAVAGLQLAEIVAQWDQLLWVETPN
                     TAMVWRLMAGQAQGLDLDVLDAVIRIEQSEWPTSATEWAAWLR"
     CDS             5942..6253
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_80"
                     /old_locus_tag="pnf280"
                     /product="hypothetical protein"
                     /protein_id="BAD60693.1"
                     /transl_table=11
                     /translation="MRIPEVWTLEIWRRAASPAIPVVRVVEGHMVSEATEHHADYVGQ
                     GWWVVDFLPGRQLSEEQARAAMRIAVAPQQLEVERWAAKLGLTAAEARAFVAMPVGVA
                     R"
     CDS             6250..6513
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_90"
                     /old_locus_tag="pnf290"
                     /product="hypothetical protein"
                     /protein_id="BAD60694.1"
                     /transl_table=11
                     /translation="MTRERVVDVVVPIVPDTGGRGLGVVSAMALLVAGVVLAGLAVMV
                     IVLLSFPSREYSTVPVTRQFGPCEPFCSLRTTTAPAPVGGEQR"
     CDS             6513..6836
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_100"
                     /old_locus_tag="pnf2100"
                     /product="hypothetical protein"
                     /protein_id="BAD60695.1"
                     /transl_table=11
                     /translation="MRSYPDPAYRRDRACAGVDQDVFFPAPSGQQSRRIAPARALCAA
                     CPVLAECAGWAEPLARAGELTGCVVAGVYLPSHHNTARRLRDAAADELVVIAATGRLD
                     VEGAA"
     CDS             6836..7102
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_110"
                     /old_locus_tag="pnf2110"
                     /product="hypothetical protein"
                     /protein_id="BAD60696.1"
                     /transl_table=11
                     /translation="MAASETAGVVRVFQLHRDRDVTGYSGTGVVADGVIWPDGAVSMR
                     WRGPVRTTVEAACLADIQTIHGHDGATRVVLGAVITGGAAWTAA"
     CDS             7099..8997
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_120"
                     /old_locus_tag="pnf2120"
                     /product="hypothetical protein"
                     /protein_id="BAD60697.1"
                     /transl_table=11
                     /translation="MKAPGQNGFSEWAPVLVPGAVGGVIEAAGVSLRVGDYLYADTPQ
                     TDVPWNPLALGIHLATGQLEWTGAATGGAVTLAAGTAVTVAGSMWAWRATCRQCRKLA
                     DKRGQVSRLARGKAFGRSGIRKEAIDSQARYMARGKELADLSREAILGKARDLQVQLR
                     AGDAPGVLIGRAVADGRELYASYEDLHLDIWGPRSGKSTSRVIPAVMEAPGAVVATSN
                     KRDVVDATRGARGEQGQVWVFDPQGVASEPCTWYWDPIAWVLGEDGGAGAQERAAELA
                     GHFAAGGEADKRDAFFDPEGEDLLAGLILAAAVDKKPITQVFEWVTSAHEDAPVRILR
                     DAGFGLVAGALADQYQAPEKQRGGVFSTAKKMAACLKYARIQPWVCPPAKGDAPRKAF
                     DAAQFVRSRDTLYPLSKEGKGSAGPLVTALCAAIAAAGEAEGTRHLGGRLPVPLLIVL
                     DEAANIVRWADLPKQYSHFGSRGMVVMTILQSWAQGVRCWGHEGMTALWSAANVKVLG
                     AGLDDAAFLRDRSELIGPHYELTTSTSRSHGQNGSRSTSTSRTSEVTLHASDLAALPK
                     GRVVIFISGHRPTLGQAVPWMQRPYAAQVRAALDRAARATHPQPSEVRPHLRAVPAYP
                     DELEGKSA"
     CDS             8994..9776
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_130"
                     /old_locus_tag="pnf2130"
                     /product="hypothetical protein"
                     /protein_id="BAD60698.1"
                     /transl_table=11
                     /translation="MSDTTFEFDNTAEGDDGVTAMPALVIPQMDLGQLLDEAIRKAVS
                     GQLAAEAKKIAAGVVGELLTPEVVAGMRETAVLEAVRALDPSPEASLPGEQDPGAAED
                     DAEEDAPPPLEYRTLDAFVRDYLAMMYRREVVEPGSAKHARWCPRWWEHGEAIGRLEA
                     LWRAFEEARHGEGSEMSTWWLQHADPMMTELLSPTGPFKYCSVQQGHHERLARLPLVP
                     APEGMFEDGHAHDPAPAVLVASSLTLPAPTHPRRRTVMEFPE"
     CDS             9773..12784
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_140"
                     /old_locus_tag="pnf2140"
                     /product="hypothetical protein"
                     /protein_id="BAD60699.1"
                     /transl_table=11
                     /translation="MSAPARPQRTAAPMQGSWETITSALETAVGPGRPSGAWTKYCCP
                     VHEGDGRGHKPSLGVKYDDAGQRTVVRCFAGCDNEQVLDVLGLRVRDMFDRRVEREGS
                     GRGRRANRPRSRQLSRADRAIDAAGLPLTQPKKPDPGRQLSPWRTVATYPYLRADGTV
                     AGEVVRKEARFEHTGRDKQFHQRRWNPENGRMEAGGFDPLPYQLPQLLEAIDEGRTVY
                     IVEGEKDVAAAESAGLTATTNAGGALSWTPRHAEWLRGARTVVIVADRDPAGYRRAER
                     VMATLSGLVERVRVVQAATGKDLHDHLQCGHEIADLEPIPYLDPFVSAPPPTTAPGRP
                     ASSTETSTDVSDSAENTTPGGHSDMAEYLLAPSTDTPPPQSDEVDHAGQQMAALWRAL
                     VHQLLSHALKVAEQRRRDAEELARRTAVEKAEAEERLALERKSVETKLAALRKQGWDA
                     ASRDEIADALTQARAWAPDSEQAAATFDELRHHLQDRFGLRIDPRTDAVDIDPDAAAV
                     VTHLADFERSRAIDARLVAAQARMVEAVGALDGIDESTKQALYADIEAWRTNPSPQQL
                     DVLATKLAAAKVPERTRTQIRFTAVYLYDAGAQLTADEHAERGRQAPTTLATHILRQT
                     EAPLVDPGEEAKPRIDALLVSYQDRLRTGADTSWVIEKLGREVAVLTEEDRTAARERG
                     KQIRHNPAGKFAPLWPDHVDRDALAVTVSTYATLRPQADRAVVATGDYNTAQAAGLRQ
                     QADKHRNAIVKAIKTGKGLHDLERDQLAAVLRDIDAGRTRPPAMLFVDDRSAAQHDAD
                     RAGQIASETSRIHRRQLDEILSTARVDPVSARATRDEITRVMDAQTALAAGRQNLHDY
                     GESGVEDRLQAAMTAVGIPEPVRNQVRNHLDRAAGEAAIAGKQANRIRDRWLDRHEAV
                     TTARSPQPAGAIDYDSPQRREGLETRLRASGLSEDCIAQRMAADTGHAKPPSAAPAAG
                     MAKRRTSPGTGMQRIHHRRGKGRGPEQGLGR"
     CDS             12921..14978
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_150"
                     /old_locus_tag="pnf2150"
                     /product="hypothetical protein"
                     /protein_id="BAD60700.1"
                     /transl_table=11
                     /translation="MVGKRRGRRLIAYLFDVGRARPKRTPSPAQLAAIEKATREHQAR
                     AAARRGYTRTDLTTLTDPGPGWDETTTHQEEPTMPNTDTNTGTVPIVEGGPGAPTRLT
                     PSGRGQRLAFLRTVAAVNQAKYHREQLDQLVVEAENAGRSEDFGRRLAQQLAEAEDQL
                     AAEDPWRNPHALTHALAEALYWSPGSDLAAARVQQIGEQLAHRWGVVLDGVDPETCTV
                     GIDPAFDAAAAQLAVDRAVVRARERAVAETLSQIPMPEPSQDRVVAAVTAWYDAEGAG
                     TATPHDSDALAARLEELHGDLSALDLAQPERDQVRFTVDYLWRDVGQVDLLDTPVMVD
                     PGQEVRGRVPQLLQAFAEQRIAPAEIGAEISVMTVADQQAVREAGRAIRAGDEVDVRL
                     WPGYADRDQLREQLETYARDAVEAGREADYLAETDLAPFDAALVGINDDIEDRIERMS
                     LSHDQLLAAAEAAKGLAPAERHQIRAVLADVEAGVAEDYELPELMWVDERSKAQLDTD
                     RSHRQGAVLAQTFCREAMQAIADGKAQPSNAHTQTLEGVLSTVGDNLYSVASGSVDDA
                     HRTQFVKDRTALGRALTAAGVYAETKADIRELVDTRARQAGKLGRGAVEREQRWKTRT
                     AEILARRDDAIAQRRAANASVAPSARICTTRPDRATGQSTATALPSYTVGVQQKHSRE
                     VER"
     CDS             14975..15283
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_160"
                     /old_locus_tag="pnf2160"
                     /product="hypothetical protein"
                     /protein_id="BAD60701.1"
                     /transl_table=11
                     /translation="MTDADLVELLVIARIDTTTAVADLFSCQTYYDADTGTETGPAVE
                     AMWETLTVDPAAPVCLDSLDQALTTSGYRRTSAWRKRVTAAGATRYFAHATIAIPDLP
                     "
     CDS             15593..16186
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_170"
                     /old_locus_tag="pnf2170"
                     /product="hypothetical protein"
                     /protein_id="BAD60702.1"
                     /transl_table=11
                     /translation="MQVAGSDAAGEQLYEWNQLASGAWHETLGSFEIVLRNALDAQLI
                     SYHQRIRKGNGDWYADPKMPWGTGTRLAQSIRKARSRATLNKTIPEVHGKVIAELNFG
                     FWRYTLAGTYQSTLWAQAYRHAFPHLRPRSRTAVYDPIVELHELRNRVAHHEPIHGVD
                     HTARLNDLLQVLAWIDPAAAAWVEDTTRIPAVLGSRP"
     CDS             complement(16207..16635)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_180"
                     /old_locus_tag="pnf2180"
                     /product="hypothetical protein"
                     /protein_id="BAD60703.1"
                     /transl_table=11
                     /translation="MECFVKNCHSPAAGTKDLDPQRIGGWSSYPYEVALCEPHSAAID
                     AGVDWVCRDQEDGSSGWLVLVGDQIKSLEKYTVKSVGAITSGSVNWRSNGVLPSGMHI
                     PIEVQQVGNREPSTIGLYIDPDQARRLIDILKLHIRTQER"
     CDS             16656..17633
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_190"
                     /old_locus_tag="pnf2190"
                     /product="hypothetical protein"
                     /protein_id="BAD60704.1"
                     /transl_table=11
                     /translation="MCAGTHRHAETSKICSRCRHPGVDFRLDRCGSSSAVIGQVVGIH
                     CDTRCSVGRFAKGVGGEVAQRRPWIKRKVGQARLWVWMPYEGGSNREWILGELGRRVR
                     PEWNKQDRRWEIARRHLWVLAEAMAQRFGEVDLFMEFSETEKCDRRCQEATETDVSEC
                     VCSCFGKYHGGFGDPRADWKLVGATTLVASGPLQVKHMVIRRPLPRGPDNAFTSQPLP
                     QQPAVSTQLLHDVPEPSASGASTATGSTDVGRDGEGSERAAEPPPVQPVGRAAEAERL
                     PAGCGIAMFLTTVIVSAIFALAVHGLFWMGAALAILFAVAFGAERIGLL"
     CDS             17674..18216
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_200"
                     /old_locus_tag="pnf2200"
                     /product="hypothetical protein"
                     /protein_id="BAD60705.1"
                     /transl_table=11
                     /translation="MLRVRQTRTTCTAHYSPWWPRKNLSSISRHCMPFRNWAVLRSIS
                     GWISLATSSRIPLSARTLCSDSFTDSSTSLSNVNTLFSLCGPAVGAAPDARWICRTVN
                     QSLLGRAERTVETRGATGLLASVAAACELPAVEATGRRPPQLARRELLIGRLVGCALA
                     QSGRGGEAARRWRQPRPSWR"
     CDS             18383..19318
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_210"
                     /old_locus_tag="pnf2210"
                     /product="putative recombinase"
                     /protein_id="BAD60706.1"
                     /transl_table=11
                     /translation="MGATTADIDDETTLPLAVHIEQFLTDLANANRPANTLRAYRGDL
                     TGFAEHVDGGIDGVTVAAVRGFLSGIADLAPATRKRKRAAVAAFCRWAVRHDLLAANP
                     MDKVDTITVPKTLPRPAPAADIAKVFAAICARRPRKDVALDVLRDRVLFETAYVCGAR
                     ASEVCELYVEDFDLRLDDEHVRLHGKGGTVRTVLLDDRGYVAMLRLYLDRTGYTAGPM
                     FRASINGRGGPLSYSAAHHRWSRYCAAAGVDIDIHQLRHSHATELINAGVSIEVVRKR
                     LGHASTETTQIYALLADQVADTEIRAARRRRDRSL"
     CDS             complement(19354..24315)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_220"
                     /old_locus_tag="pnf2220"
                     /product="hypothetical protein"
                     /protein_id="BAD60707.1"
                     /transl_table=11
                     /translation="MGSVHEVIEAFRLAPSNSERGTKFEQLMVRYFELDPMLAQQYDK
                     VWRWTDWPDRAGKPDTGIDLVARERDTGALTAIQCKFYEPTHVLAKGDIDSFFTASGK
                     KPFTNRVIISTTDRWGRNAEDALQDQTIPVQRIGLAEIAESPIDWDIAWPAGELQVSL
                     SEAKRHEPRPHQAQAIDAVFNGFAAGHDRGKLIMACGTGKTFTALKIAERTAVENGGN
                     ARILFAVPSISLLSQTLREWTAQTQLDLRAFAVCSDNKVSRSAEDVSVHDVAIPVTTS
                     SAVLAAEMERRRHAAGLTVVFTTYQSLPAVAGAQAEHGVEPFDLVICDEAHRTTGVTL
                     VGDDESNFVRVHDGDYLKAQRRLYMTATPRIFDETVKDKAAEHSAELSSMDDETRYGP
                     EFHRLSFGAAVERGLLTDYKVIVLTVDEDLVAAPLQQQLAGRFSELRLDDASKIVGCW
                     NGLAKRAGKTPEGVGFPPGQPPMRRAVVFAKDIAASKQVAEVFPAVVDAYRELLADRE
                     DDGHEITATNLDLSCSVHHVDGTFNALQRNAELAWLKAPVPEGECRILTNARCLSEGV
                     DVPALDAVMFLNPRNSVVDVVQSVGRVMRKADGKDYGYIILPVAVPAGVSPAKALSDN
                     TRFKVVWQVLNALRAHDDRFNAMVNSIALNTSSDVQKTGKGSDMLMGGHIGPVTDDHE
                     TLSNSTTNHGDNAAEGSPAPDEGARMAQQMALFSLSEWQEAIVARIVDKVGTRAYWED
                     WAADVADIANTLITRIRALLAGASPEVTGEFEKFVQGLRDNLNDSITREDAISMLAQH
                     LITKPVFDALFAEHDFASHNPVSRVMQAMVDTLDGSGLEAETIKLEGFYASVRVRAAE
                     VTTADGKQKVIAELYEKFFRLGFRKQSEALGIVYTPVEVVDFILHAADQASRDAFGRG
                     LTDQDVHILDPFTGTGTFLTRLLQSGLITPKDLARKYAGELHANEIMLLAYYIAAVNI
                     ETTYHAILGKEAAAEYSPFEGIVLADTFQITENGDSLDSMIFPQNNERITRQNATPIN
                     VVIGNPPYSVGQTSANDLNANISYPTLDARIADTYAARSTGTNKNSLYDSYLRAFRWA
                     TDRIGNKGIVAFVSNGGWIDGNTADGIRLSLADEYSRIYAYNLRGNQRTAGELSRKEG
                     GKIFGSGSRNTVAIFIGIKNPAHTGPCQIYYRDIGDYLTREDKLRIIADSTLTSIDWQ
                     TITPNTHGDWANQRNDEYQAWPAIGEKNASREQVTVFSNFSRGLETTRDAWVYNYSRT
                     NLAANVQRLIGNYNDQHIPFADYCRTAGVTRPNEAAVTDYLTANPTAAQADYIKWSRS
                     LRTHLARRTQVTYRTEGHTVSLYRPFAKQHTYFDKHLNHERSQLPSMFPTPHHKNLGF
                     YQVGNGSAVPFSVLMLNMLPDLHVTGAGSGGQFFPRWTYEKVVTPEGELDFGAATSSD
                     IDDYGFRRIDNITDGILKLYRDVLGDEVSKDDIFYYVYGQLHDPTYRQTYAADLKKML
                     PHIPTPTSRERFEQLADAGRQLADLHTSYETVEPYPLDVQVKAADPDDRETWRVSKMK
                     WGKKKDPATGKNVEDRTTIVYNPKVTITGIPEDADRYVLGSRSALAWVIDRYQVKTDP
                     ASGIVNDPNDWCDEHDTPTYIVDLIKRVTTVAVETMRIVDSLR"
     CDS             complement(24400..24528)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_230"
                     /old_locus_tag="pnf2230"
                     /product="hypothetical protein"
                     /protein_id="BAD60708.1"
                     /transl_table=11
                     /translation="MVSCQTPSRWAVPLLAEDLLTSATHHLRLRTRGCAVLCRIPS"
     CDS             24638..25015
                     /codon_start=1
                     /gene="arsR"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_240"
                     /old_locus_tag="pnf2240"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD60709.1"
                     /transl_table=11
                     /translation="MSKSKLVVTPVQACSAAPLVREPLSEPHAVELASVFKALSDPVR
                     LRLLSAIASRESQEACVCDLSAGIELTQPTISHHLKVLREAGLLDSERRASWVYYRVV
                     PEALQRLSEVLLVESGTAIGAPA"
     CDS             25012..26121
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_250"
                     /old_locus_tag="pnf2250"
                     /product="putative arsenic resistance transporter"
                     /protein_id="BAD60710.1"
                     /transl_table=11
                     /translation="MSVNTTDQPAVVAKLSTLDRFLPVWIGVAMAAGLLLGRMIPGLG
                     DGLSAVEIDGISLPIAIGLLIMMYPVLAKVRYDRLDTVTGDRKLLLSSLLLNWILGPA
                     LMFALAWLLLPDLPEYRTGLIIVGLARCIAMVIIWNDLACGDREAAAVLVALNSVFQV
                     IMFAGLGWFYLSVLPGWLGLEQTTIDTSPWQIAKSVLIFLGIPLLAGYLTRRFGERAK
                     GRTWYESAFLPKIGPWALYGLLFTIVILFALQGDQITSHPLDVVRIAIPLLAYFAIMW
                     GGGYALGAVLGLGYERTTTLAFTAAGNNFELAIAVAIATYGATSGQALAGVVGPLIEV
                     PVLVGLVYVSLALRKRFPATISPAASSGTGEMAPR"
     CDS             26118..26552
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_260"
                     /old_locus_tag="pnf2260"
                     /product="putative arsenate reductase"
                     /protein_id="BAD60711.1"
                     /transl_table=11
                     /translation="MSTTPSVLFVCVKNGGKSQMAAGLMRAAAGDLVQVHSAGTKPGT
                     AINALSAESLLEVGIDISGETPKPIDPALLASVDLVVTLGREAHIGPVDGVRILNWDT
                     DEPSERGIDGIERMRLVRDDITTRVNNLLTELTTPIEQRTHP"
     CDS             26549..27208
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_270"
                     /old_locus_tag="pnf2270"
                     /product="putative arsenate reductase"
                     /protein_id="BAD60712.1"
                     /transl_table=11
                     /translation="MTDSPSHTRHDLTIDQQLALKTAATHLQREFNGTFGVETIERFL
                     HSSYDQFAGRATVVNYLPLLAERFARQRLHALARVEGKAHTGTPTVLFLCTHNAGRSQ
                     MALGFFTHLAGDRAVAWSGGSEPGDEINPAVIAAMAEVGIDITGEFPKPWTEEIIQAA
                     DVVITMGCGDACPLYPGRRYEEWDIDDPADLDLAAIRPIRDEIETRVRLLLAELDLPA
                     H"
     CDS             27224..27634
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_280"
                     /old_locus_tag="pnf2280"
                     /product="putative arsenate reductase"
                     /protein_id="BAD60713.1"
                     /transl_table=11
                     /translation="MTTKPSVLFVCVHNAGRSQMAAGFLSHLAGDAIEVRSAGSAPAD
                     QINPAAVAAMAELGIDISDQTPKILTYDAVETSDVVITMGCGDTCPTFPGVSYRDWVL
                     EDPAGKGVESVRPIRDEIKARVEALVAELLPARA"
     CDS             27725..28159
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_290"
                     /old_locus_tag="pnf2290"
                     /product="hypothetical protein"
                     /protein_id="BAD60714.1"
                     /transl_table=11
                     /translation="MTTQRNRHHSTARILVTYVAVATALTAALSELRDDAWPPHAKLH
                     AAQYILVTVGLSVIAMVLLWQRGSGARTPVITACSILATPWLGLLAAPLFPGTSLHKP
                     RPDNPLLLGLHPQLLLATVMLALLLAAVALTTRASTTGTAAR"
     CDS             complement(28133..28582)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_300"
                     /old_locus_tag="pnf2300"
                     /product="putative multimer resolution protein"
                     /protein_id="BAD60715.1"
                     /transl_table=11
                     /translation="MPNPKPDAYQAATPYPPDFRRMLRLPLLPRMLAGRKSGPVFLTD
                     RKARPSVAVNDVDPSTGRARLSYRRAAELFESHTLAFDDGPYTLHQLRHSRLTHAAED
                     GASTPVLMKLSGHTSVRSLVKYARVSDEGLRRFQADSDPSARRRSGR"
     CDS             28652..31669
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_310"
                     /old_locus_tag="pnf2310"
                     /product="putative transposase"
                     /protein_id="BAD60716.1"
                     /transl_table=11
                     /translation="MATRMFADEELERLRGFPEISREELFRYFTLTSADLAFVDPGRG
                     RGPAERLGLAIALCTLPWLGFVPDRLVTAPPVAVARIAEQLRVDPVVIGAYGRRAKTR
                     TEHVRLAARYLGWRAAGALEFKELDEFLLARAMEHDSPTLLFRLGCEYLISAKVIRPG
                     PVTVVERVAHARHQAQTETYDRLAHEFTAARCAELDGLLVTDASLGISRLRWLSTGPV
                     EASAAAVRAEVDKLGFLRGLGADRLDMSVLPAERRRFLATMGRRLSPQALERRDPQRR
                     YPILLTVLAQSGTDVLDEVVALFDQAISAKFGAAERKMQQQLAERGKTGEDRQALLDD
                     LLEIVTDPTVADEEIGALIRGEKIGWERLRAAIAQAEPRLPRDHGHLAALDSSYNYLR
                     QFTPAVLEAVRFAGGTAATELLIAVNMLRELNATGRRKVFDDAPTGFVPMKWRGYLDE
                     AARKSGSATAYRHYWELCVLLGLRDGLRSGDVFVPGSRRYADPAAYLLTTGQWEPQRG
                     EFCRLVGRSADPGVALAAVVAELHDAVGELEAVLAGGDGPVRVDEGGDLVISPLSAED
                     VPAEAIALKAELTEMLPFAPIVSLLIELDKRTGYLDCFTHAGGQATRTPELKRNLIAV
                     LLAHSTNLGLTRMAEACGITYDILAWTDEWYVREETLRAANLTLIDYHQRLPLTAVFG
                     AGTLSSSDGQRFPTRGKSTTARPLSRYFASEGLSTYTHVTDQHATYGTKVIVATKREA
                     HYVLDEILGNAADLPITEHATDTHGVTLVNFGLFDLLGMQLSPRIRDLGRITLYRPGP
                     RAQAEARFPHAGPLMTRKANLGLIAEHWDDLLRLAGSLKFGHATASLLVGKLSASGRQ
                     NTLAAALKEYGALRRTIYAARYLSDPDYRRKISRQLNKGESLHALRRDLLYAHEGMIR
                     ARHLEDQTEQAWCLTLATNAVIAWTTEYYGLAVDQMRRAGQRIDDEVLAHLSPAHSAN
                     INFFGAIEVDIDAELAQLGPTGYRPLRVRDTLF"
     CDS             complement(31689..32336)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_320"
                     /old_locus_tag="pnf2320"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD60717.1"
                     /transl_table=11
                     /translation="MTDPHPADDEQADPRLARSRNRLLDAATHLLSTGGVEAVTVEAV
                     TRVSKVARATLYRHFGSTTHLLAATFERLLPHVDAPTGTTPVREQLLTLLTTQADLIE
                     QAPVQMTTLAWLAMGSIDDNHTDPAALTSLRARVIEQYRRPFDQILTSPDARATLGEL
                     DTTFAIIELLGPIVFARLTGLRTIDHDDCARLVDNFLTAHSTATASTSPTGTGRP"
     CDS             32458..34047
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_330"
                     /old_locus_tag="pnf2330"
                     /product="putative transporter"
                     /protein_id="BAD60718.1"
                     /transl_table=11
                     /translation="MPVDTPGTDTVEIARWTRAEWWMLTVSCLAVALVVAAMAALYSA
                     LPQIAVATGATQAQLTWIVDGYTLVLACLVLPAGAVGDRYGRRVVLVAGLVVFAAASA
                     LPLLLDEPVWLIATRALAGAGAALVMPSTLSILTAGFAPVHRGRAVGIWAGVAGSGAV
                     LGILGAGVLLERWSWPSVFVGLTVAGTVLAVLACTIAESRHREHPPVDWVGAGTVAVA
                     VAAIVFAAIEVPARGWADPLVAAAAGIGVAAAVAFVVVELRSAAPLLDVRLFTRRGFG
                     AGSLSVTIQFLVTFGVFLLLVQYLQLIFGYGPLASALALAPMVVPLVAISVIAPWLSS
                     LVGLRVMTVTGLLTIAAGLVLVSRLTLAANYPDLLWPLLIMSAGLGLCTAPATYAIVA
                     DTPEAKHGVAAAVNDAAREIGAAIGIAVAGSVLAAGYTHRIQPALARLPEPARGPVAD
                     SLAAALQVADQAGPVAAPLAEFAQAAFVHGSGQAALALAALTTATAIVLAVLAPGRTP
                     RPHTRTPSPAPHSPPGERRPS"
     CDS             34044..34211
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_340"
                     /old_locus_tag="pnf2340"
                     /product="hypothetical protein"
                     /protein_id="BAD60719.1"
                     /transl_table=11
                     /translation="MMGYRTSIVGTDGSGPARTAPVGCHHRRSPLLARLLSTPPIELD
                     GKAHCDILITA"
     CDS             34233..34760
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_350"
                     /old_locus_tag="pnf2350"
                     /product="hypothetical protein"
                     /protein_id="BAD60720.1"
                     /transl_table=11
                     /translation="MTENTPSTDTPEPRQVPDWIPAFPVLAPDSVDLPPHHDHCLGCG
                     PANPHGHRLRARRDAHGVYAHHRFDSRHVGAPAIAHGGAVATVLDELFGLLLYTVGEP
                     AVTRHLAIDYLAPILLDTPYTLRAHIHSRDGRKLHLKATIENDRAHVVTTATALFLIV
                     DVNHFLTPQHTPTHR"
     CDS             34849..35517
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_360"
                     /old_locus_tag="pnf2360"
                     /product="putative resolvase"
                     /protein_id="BAD60721.1"
                     /transl_table=11
                     /translation="MFRKLCRSTPAIWNTFGMGEPFRIGYCRCSTDEQDVEIQTEQLL
                     ALGVPRERIFIDKGFSGTTRKNRAGLDNALAAATSAAAAIDERQVVLTTTKFDRFARN
                     MAEAGQTLTELRERDVLFGLGSSIYDWADPFGKLFLQTLAMVAEFEANLNHLRTREGM
                     AKARAKGRLKGKQPKLPLTARKTIHRRYHDPADDASLADLAEEYSVGRSTIHRIVSNA
                     PPRA"
     CDS             35662..36186
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_370"
                     /old_locus_tag="pnf2370"
                     /product="hypothetical protein"
                     /protein_id="BAD60722.1"
                     /transl_table=11
                     /translation="MARQTIVSTQQAERIIDQTQRHIRPIFGKCYGYPGVRCWGEDGM
                     KALWSAANVKVIGGGLDDEAFLRARSELIGPHYEQSVSVSKAQGGHRSHSVSRTTEIT
                     LHPSDLAAMPRGRCVVFTSGNRATLAQTVPWMDRPYAAQIAAALDELANATEPVRPRL
                     QVVPPLSDQKGKTA"
     CDS             36183..36959
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_380"
                     /old_locus_tag="pnf2380"
                     /product="hypothetical protein"
                     /protein_id="BAD60723.1"
                     /transl_table=11
                     /translation="MTSTDIPTSSSDIDIDLTTLDTDTDTGAGAGAGVGGVVELTEAL
                     TGAVRKAIASQVAEAAQLIAKGALDEVLTEEVAEEMRVAAVRDALAAVDPQQGEDPVE
                     KLKYRNLELFVSEFLARVYRREVTREGSQKKARWCPVWWDHGEAVARLAALWRSFERM
                     RQGDGVEMSVWWLHHADPMMDRLLDPENGPFRYCSVADGHVRRLTKLPVVEIPDALKF
                     ADGYIEDQQPDTTTAALPVTSLYLPPATGQARRVVIREFP"
     CDS             36959..39805
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_390"
                     /old_locus_tag="pnf2390"
                     /product="hypothetical protein"
                     /protein_id="BAD60724.1"
                     /transl_table=11
                     /translation="MAVPAHEAGRGSWVRVTTALEQVVGPGRPSGSWTKYCCPVHEGD
                     GRHHRPSLSVKYFGDAGRTKVRCQAGCEDELVLDAVGLRVADLYDTPLRRGERGARSG
                     PARRPAKRAESRSDRALRAAGIPAHKPKRDLGAQVSPWRSTATYTYVRADGTVAGEVI
                     RREADFEGGRDKSFSQRSWNSRHGGWERTGFDKIPFQLPQVREAIAAGRTIYLVEGEK
                     DALNAAAAGLVATTNAGGASGWSPEHAEWLRGARTVVIVADRDAPGFHRADRVMATLS
                     GLVGRVRVVQAATGKDLTDHLEAGHRIADLVPIPYLDPYTRALTAVPTPPATTTAAVA
                     GPAPPPSAVSPAPEFPAETPSPQGHPMPESLLTPAAETTPHSDEVDHMHSQWSVFMKL
                     LMQQMLLMATKAVHQRAAAAAEAARKSEQAARDAEERAAAEMAAVEVRLRKLRQKGYD
                     TASRTEIADAVRDAATWGDQSEVAGNELGHLALHVSRRWGVELDLDTGQASIAPGTDA
                     QRLAEIEQDRAAAARARKAQDRMVEMVAREDDLDESAKVGIYAAIESWRADPSAEKLD
                     ALTRQLKDRKVPQQTRTRLRFVAAYLGTPAAIGDEENADIKTVSAAEELSRHATPLVD
                     PGEEAKPRIDKLLETYQEQLKVGADTSEVREELAREVAVLTVEDQEAARARGKAIRAN
                     PAGAYPRMWPDHVDRDELDEHIRVYALLAPKAEQAAGKAGDLDDVTATQLAKQAASHK
                     TAIRKALTDGKGLHDLERDQIKAVLRDVEAGKPTVPEQLFADDRSAAIVDIQRTQRIA
                     YNTHRTQRRDLDEILDTGAVPEPVRQQVREHLDNTTGAVEMAHRGVADAAFKWARRRE
                     AVIVSRTAAVIEADGGYDSPQRAQAMQEQLRAGGLDDDQIAERMAAESSFATPPSAAA
                     KPPKLNPRTTSPGAGMQRINHRNKNNGPEQGNGR"
     CDS             39827..41950
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_400"
                     /old_locus_tag="pnf2400"
                     /product="hypothetical protein"
                     /protein_id="BAD60725.1"
                     /transl_table=11
                     /translation="MTTPDQQPATYPWRAAPSHLKTRRQLRDAGLSPGGQDVAALMVR
                     QRRGRRLVAHLFDIALARPKRVPSPGQLAAIEKATRTHQLRAAERRGYTATDLHTPTD
                     LGLTWSETPTLQEETTMSTNGSTTGQVRPQGLGQRRAWLHALVATNQARDRRTRLDTD
                     LDHAARAGGEVEAGYLAGLRRDLDAAETRLSAVRGIGDPYTDTALLADALYWSPGSDT
                     AARLAEQITSGLAAEWGVHVDPESWQVSIDPGFDAATAQTTAETSAMRAREAAIVDVV
                     SGLALPDHTAAAVDQAVQAWAEATPAGSNDLATRREQLRGELAGVRCADTDRALIEFT
                     VDYLTDHTAGVDLLDTPVLVDPGQEVRGRIPRLLERFTEGRIAPAQVAEEIAVMTDAD
                     QQAVREVGAATVHELEQIGFQVWPGWADRDQVFEQLHEYATEAREHHSDIDYLATQDL
                     TDDERENLGVSDDIGARIERMTAARTELLDTATTSKGLTAAERHHLTAVIRDIDTGTI
                     NSESELPELMWVDERSKAAVDEKRSYEPGRRLSKAVTQEVTRLLSDAGVDLSHRDHGK
                     LASSVSAIGSTLDSVAYGGSLLGLDSDREEFLTRRTRLGQHLRDTRIGPEAMTTIREV
                     VDGHARDAGQAGQAAIERRGRWKDRITAIAAARDDAIAQRQAATAGHSTRPRACTTSP
                     AITTQATGPTRPPRIRHLHGEEIGR"
     CDS             42038..42226
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_410"
                     /old_locus_tag="pnf2410"
                     /product="hypothetical protein"
                     /protein_id="BAD60726.1"
                     /transl_table=11
                     /translation="MPPSLAALDWARGANPDFADDDSGFFAAADWMREAASAVILPPS
                     LSDFDTILSFLGSPTLPV"
     CDS             42361..43140
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_420"
                     /old_locus_tag="pnf2420"
                     /product="hypothetical protein"
                     /protein_id="BAD60727.1"
                     /transl_table=11
                     /translation="MGTGRERVGAVWCESDYRLLFEALALGMTDEEIAAHIDREVGGV
                     RSRALLLVDNATSKKGALPMLRRLAEAPDFDWDTWVREVHTRENLPYWDTAADEALIG
                     HWAAEPPPRIQQLCEQFGVGQDVIARRAIILGLAQTRAEVVDRFGAAPGSGLAVNAVL
                     AKDKLAAAVAVLVVTDTTGEVLYLSLHPTTDEATTSLQDLTTTPLAAIQGRWTIGTRV
                     VGEGSVRPTDTGTWPATTEYIPAPQERPSRWRRLLRPVRQG"
     CDS             complement(43236..43796)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_430"
                     /old_locus_tag="pnf2430"
                     /product="hypothetical protein"
                     /protein_id="BAD60728.1"
                     /transl_table=11
                     /translation="MVPKFIAEANNCLDEQDVATAVLAVLVIVTAGCGSSDTTSTSSA
                     TSAPVAAPSAGLESGPTSPLGGTLKIWGGANLSDKTQLAEYTVSNPRTLDGRWTVDVV
                     IACRQGNGYVPGTFEVLTTAGRRLEQFNPYSASGGQLSLAGALIAGERREGYISFEVP
                     ADDQVAKVVLYHGTLNPPAAFWTVGS"
     CDS             complement(43910..44254)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_440"
                     /old_locus_tag="pnf2440"
                     /product="hypothetical protein"
                     /protein_id="BAD60729.1"
                     /transl_table=11
                     /translation="MRQRGRARATLYDFEVTTRLWAGAGISDCTEAGVDCMPGFGMFL
                     VELVALGLFLIVWFVSVPIATVSILSVANTAGRRVAWLAVVWLVPVVGALAWYFRARS
                     RVACDVDDGRPV"
     CDS             45007..47655
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_450"
                     /old_locus_tag="pnf2450"
                     /product="hypothetical protein"
                     /protein_id="BAD60730.1"
                     /transl_table=11
                     /translation="MPAPDGRKPSGTVVGGVHAEGARSVAVSGDARLVQTGDNATARI
                     VELPAEAYRPISEVDAPPGIDNLPIRPANFVGRTTELDKLDTMLASAGQVVVQAVHGL
                     GGIGKTTLVAHWAATRTHGCSPILWLTADTPAEITQGLAGFAAALQPALSTVLEVEQL
                     AERGLQWLATHTGWLLVLDNVEDVTDINPVLARAGTGGRIVVTSRRATGWPTGTAVIR
                     LDVLDPTESLELLTGLLTASGPRDEDGAVELCAELGHLPLAIEQAGAYLAQNPFLTPR
                     AYLQTLDTYPAETLGHGGVDTDAERTIAQIWRVTLDRITTIQPMAAELLRVLAWYAPD
                     AIPLSMCQSITDPPTLNTALGVLTAYNMITPDLTTNTVSIHRLVQAVACTPDPTDPHR
                     DPTAIEQARDQAADVLLACLPDHQDPGTWLTWRALLTHVDTFTGKVQSTSVTDAKAQI
                     LTRAGQFVLDQGMHTSALIYYRQALTEYERVLGAEHPHTLASRGNLAGAYQSVGRLDE
                     AIPLYEQARTGQERILGPDHPETMAARNNLAYAYQSVGRLDEAIPLYEQVLTDSERIL
                     GTEHPDTLKSRSNLAYAYQSVGRLDEAIPLYEQVLTDSERILGTEHPDTLKSRSNLAY
                     AYRSVGRLDEAIPLYEQVLTDSERILGTEHPNTLTFRSNLAFAYESTGRLEAAIPLLE
                     QTLADRERILGDEHPHTLISRGNLAGAYQSAGRLDEAIPLYQQTLTDRERILGVKHPD
                     TLISRNNLAYIYKSAGRLDEAIPLYQQTLTDRERILGDEHPHTLISRNNLAGAYQSAG
                     RLDEAIPLYQQTLTDRERILGVKHPDTLISYNNLAGAYQLLGRLDEAIPLYERTLTIS
                     KELLGAEHPTTRLIRGNLAAAREATH"
     CDS             47853..48404
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_460"
                     /old_locus_tag="pnf2460"
                     /product="putative resolvase"
                     /protein_id="BAD60731.1"
                     /transl_table=11
                     /translation="MRVGYIRVSTVDQNTDRQLDGIDVERVFTDKVTGKNAKRPALQE
                     MLAFVRDGDTVLVHSMDRLARNLDDLRRLVRQLTGKGVRVEFVKEALTFTGEDSPMAT
                     LMLSVMGAFAEFERALILERQREGIATAKARGAYKGRKPALTADQVTALRERAAAGEP
                     KSALAREFGVSRETVYAYLRATA"
     CDS             complement(48559..49002)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_470"
                     /old_locus_tag="pnf2470"
                     /product="hypothetical protein"
                     /protein_id="BAD60732.1"
                     /transl_table=11
                     /translation="MRWRDLPGAAQRPYVVGEVIVVKRVGAVDEIEELFETQVVEILW
                     SEVGVLVTKLEDTPHLELLVVLFSHPAALVLTTAFLPALRVGSPRSEYSSALRTCVCA
                     VAVERQRQQHTNGMAADCGQPVPTLDEVERWRASPEGVDAAGLLE"
     CDS             49041..49550
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_480"
                     /old_locus_tag="pnf2480"
                     /product="putative acetyltransferase"
                     /protein_id="BAD60733.1"
                     /transl_table=11
                     /translation="MVHLRYFTDCDEAIRARVLEWVRTDEFISRIGMPDHELKHVPGA
                     ETRTGRVHNWVIFVDEQPVGLISAQIQDQPRSHSPLNRELDDPADYPLLGTVTYIDRQ
                     HRSRGYASAAKHAISEHVAAAGVQTFGCIVAGDNPQSLRSISRAGYERVHTEKVDGKP
                     DKLYFRRRR"
     CDS             49934..50272
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_490"
                     /old_locus_tag="pnf2490"
                     /product="hypothetical protein"
                     /protein_id="BAD60734.1"
                     /transl_table=11
                     /translation="MHTLTRDLQLVRNLRRRYQLRQVGRVRLGEVGLLIDHFNRHRRQ
                     AGDRPNKRSSESGRLHRILCFDIDAQHDRNTGEPSRRGIDIRELFFPHRELFSVDLSR
                     AIAQGHYPDH"
     CDS             complement(50275..50532)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_495"
                     /old_locus_tag="pnf2495"
                     /product="hypothetical protein"
                     /protein_id="BAD60735.1"
                     /transl_table=11
                     /translation="MNSDISDLAAWARSQGWRVVDTTRGYTQFFDPDGEYIAQYPATP
                     SNPRRRMADLKVKLKAAGLQVPPPSKKEQRAVRRKASTEGA"
     CDS             complement(50734..51765)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_500"
                     /old_locus_tag="pnf2500"
                     /product="hypothetical protein"
                     /protein_id="BAD60736.1"
                     /transl_table=11
                     /translation="MTDAQRRELAEIAARAFRATAPHWPTIDLMGSLQSSLPTDIPWP
                     RLEPIRLDPGLFQHMEAAIDVTHSLRSAVFDGILAGVHLPRLDIPTFDVARPMPQLPA
                     VDVQRMLRHHIPAPGDLIPPGVQELIDSLFARYPANWPMGEEALDLDLAQQIVENEGI
                     PIVYIPRADIVSELAQAPDRAGRDAILVARTSEILDDCAAAVDSQLDPLVAEQRPLLL
                     KAIAALADGHHEAAQALGVSVCNTQIEAHIDNKSGKAKHQCRVTNLEVAFQEDRLRYV
                     LGVAPVVNLLTDWNPKSGKPRPVPLSRHVVAHQAHPDHFTPENAVLAVMVATSLMLAL
                     DERYSWPTD"
     CDS             52171..52512
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_510"
                     /old_locus_tag="pnf2510"
                     /product="hypothetical protein"
                     /protein_id="BAD60737.1"
                     /transl_table=11
                     /translation="MATPARCRASIWWSRFCSAVETRPYPINRRKKHGSPGAGRGKAN
                     AERLGREKFARRRTAAGPPRRRSLNPFLRRPTTRTRRHLVGITPLGNHHTGIVGPEHS
                     PPLAWSRSARS"
     CDS             complement(53022..53444)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_520"
                     /old_locus_tag="pnf2520"
                     /product="hypothetical protein"
                     /protein_id="BAD60738.1"
                     /transl_table=11
                     /translation="MTSAIRKASITVVSTAAILLSGTTAAIAAPTTPTAPAVSQVVGE
                     PLGATQEAAAETVAAPALANLRPEVTPVKRNWAADTAMFAGCLGGFGFVAAPIVAGFM
                     FGGPGGAVAAAKAWIPRLGPVGGGILKWCMASVLGIRM"
     CDS             53653..53982
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_530"
                     /old_locus_tag="pnf2530"
                     /product="hypothetical protein"
                     /protein_id="BAD60739.1"
                     /transl_table=11
                     /translation="MIAATRRRDDAMRGEGKSKPAGKTKTLQVRVDEETARHFAAIAR
                     ARRMTESQLLRATISEMLRSSESNVDVLKAELRAEFEAAEAALDELSSESRQAAVAAG
                     SRQRSTR"
     CDS             complement(54035..55297)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_540"
                     /old_locus_tag="pnf2540"
                     /product="hypothetical protein"
                     /protein_id="BAD60740.1"
                     /transl_table=11
                     /translation="MTRHYYGAVVEMNTAKLKTLALKVLEIVSLPDTVTHESIDVAVL
                     STAMETARLNAGMEKESGGNLPDWPLLLGGHVAFMMLRRGNEIVLDPALELRDPRLVA
                     LGLTYIEGAALILATLVVETAAGPNSATMEPTTHPAATRDFHCLAEVIPHDDYSAQTA
                     VPALVDVLRRFTIPEASVPDPFSLQSILPPGRIKNKVALLERRINGLSLPTRLAFTAG
                     LAIAGIVAGYLAGSSHGPTENPDIVTATEIALPPGFPETYVGPAVPNVVARVLVHESE
                     QQPHPRMQSVAGDLPDDAFVTGVDHRLRAEIHLGWRDPALGTDQNIELALGLDAGLTI
                     TPGTTMLVNDANAAPGIGALQLATTYTPVAMDEEGEIVYQFELAVSSDPALFFCGYNL
                     RPINVLVRDGNSPVLVTAMPVYVLKSCP"
     CDS             55394..55753
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_550"
                     /old_locus_tag="pnf2550"
                     /product="hypothetical protein"
                     /protein_id="BAD60741.1"
                     /transl_table=11
                     /translation="MSESRPRTKILTVLGTVAAAALCTAFLGCPTAAAADVPLDLHAQ
                     CATQYPETPHAYAGHPILIAPGNAYSWRCEQPSKLPGGGLLSSLFLDTDAFCVNNRLG
                     HALALDTDNPHSWVCRQ"
     CDS             complement(56558..56848)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_560"
                     /old_locus_tag="pnf2560"
                     /product="hypothetical protein"
                     /protein_id="BAD60742.1"
                     /transl_table=11
                     /translation="MPGRVRPALLSCGFMSNERVYLTPEAAASLPHTLPLQWDSNRPT
                     ICHVDVDAAVPQDNGWLRIVLSQNEGNQFVLSLPPTAVAAVVWVQGAMFPTF"
     CDS             57571..58266
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_570"
                     /old_locus_tag="pnf2570"
                     /product="putative transposase"
                     /protein_id="BAD60743.1"
                     /transl_table=11
                     /translation="MKCFSFEKDAPGSGGRITLYRAAPRAQVESAFPHAGPLLTRRCN
                     LDLIAEHYDDLLRLAGSLKFGHATASLLVGKLSASGRQNALAAALKEYGALRRTIYAA
                     RYLSDPGYRRKISRQLNKGESLHALRRDLLYAHEGTVRARHLEGQTEQAWCLTLATNA
                     VIAWTTEYYGLAAEQMRRAGRRIDDEVLTHISPAHSENINFFGAIEVDIDAELAQLGP
                     TGYRPLRVRDTLF"
     CDS             58358..58759
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_580"
                     /old_locus_tag="pnf2580"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD60744.1"
                     /transl_table=11
                     /translation="MRTGELAARAGINAQTLRYYERRGLLARPARSPAGYRSYPDEAV
                     AVVRFVKRSQELGFTLDEVAELLRLADGGPDDCDTARALAESRVAELERRIADLQRMR
                     GSLAELIATCELPRNRRSCPILTSLHEGDHP"
     CDS             58756..59757
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_590"
                     /old_locus_tag="pnf2590"
                     /product="putative alkylmercury lyase"
                     /protein_id="BAD60745.1"
                     /transl_table=11
                     /translation="MKLEILQVPDCPNVAVLEQRIRQATAGQPVQLEITRRVIDDPGR
                     AATAGMTGSPTLLVDGCDPFATPGQVPSLSCRLYPSDTGRLDGAPSVAALRAALRLVP
                     DGTAALGDDTASSCCTPPAAESPATVLRAWRAAAQPADPTEKAVHQAILRAFATDGQA
                     PTGDDLTEMAAGPDVPVEQLLRRLHDADIVRLDATGSIAAAYPFSATPTPHRVRIAGG
                     ATVSAMCAVDALGMAAMLDTPVTITSADPVTADPITVTVDGGHVTADPATTVVFVGAQ
                     AGPGPSADTCCHYLNFFTDRASAQGWADTHPGIGGVIVELPDAHHLGTTIFGHLLHS"
     CDS             59804..60841
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_600"
                     /old_locus_tag="pnf2600"
                     /product="putative recombinase"
                     /protein_id="BAD60746.1"
                     /transl_table=11
                     /translation="MKPGLRRLRSGGARSGPVICGKQAREVTMLSSGITVRAAGDGFL
                     DSIRSPNTRRSYAIAVDKTTARLGEARPLANVADDEIGETLETLWGEAAVNTWNARRA
                     AVASWLAWCREHGHLAPAVPAWVKRSTPPDSATPVRSRTAIDRLITRRDIDLREKTLW
                     RMLYETCARTEELLQVNIEDLDLAGRCCPVKSKGAKPRTRRRGATHHEYAHELVYWDA
                     GTARLLPRLTKGRTRGPLFVTHRRPGPGKAAADRDICPDTGLARLSYGQARAVLDAAT
                     ATNGPGTGWDLHELRHSGLTHLGEAGASLLELMAKSRHRKPDNLRRYFKPSPAAMRGI
                     TSLLGPDRSHR"
     CDS             60940..61173
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_610"
                     /old_locus_tag="pnf2610"
                     /product="putative transposase"
                     /protein_id="BAD60747.1"
                     /transl_table=11
                     /translation="MAAVGSSADNALAESFNATIKREVLQDAACWPDEATCRREVFRW
                     LVRYNTRRRHSWCGYLSPSTYEARRAATLPTAA"
     CDS             complement(61580..61978)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_620"
                     /old_locus_tag="pnf2620"
                     /product="hypothetical protein"
                     /protein_id="BAD60748.1"
                     /transl_table=11
                     /translation="MKKLSTISDTECRVLLRSVPVARIAYLEDGVPAIRPINFTVAGD
                     RIVVWTVPGAHGSAVTGQTVAVQVDRIDPDSHSGWTVLITGPATAISDIDELVAAADI
                     PRRPWVTTPHDQVIGIDIERISGLRLPPAP"
     CDS             complement(62045..62464)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_630"
                     /old_locus_tag="pnf2630"
                     /product="hypothetical protein"
                     /protein_id="BAD60749.1"
                     /transl_table=11
                     /translation="MTDTGTDLGLSTTVTASFDDAVDAAKRALAEQGFGVLTEIDMQA
                     TLKAKLGHDMEDYRILGACNPPLAHRAVEIDRQIGLLLPCNVVVRRSPDNDTDIIIEA
                     MNPQLMVQLTNQPALAPIAADATTRLRAAIDSLHRSH"
     CDS             complement(62513..62758)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_640"
                     /old_locus_tag="pnf2640"
                     /product="hypothetical protein"
                     /protein_id="BAD60750.1"
                     /transl_table=11
                     /translation="MTLPTRPRTWTIDRVVPLLAGTLILLSAALAATLSPWWLILTAL
                     VGANLLLYSALGWCPASLLMARLGLPAGTATCTVART"
     CDS             complement(62812..63081)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_650"
                     /old_locus_tag="pnf2650"
                     /product="hypothetical protein"
                     /protein_id="BAD60751.1"
                     /transl_table=11
                     /translation="MVGDENSIAPVLNRLRRAHGQLAGVIAMIEQGRDCKDVVTQLAA
                     VSRALDRAGFKIVATGLRECLAGQPGEGADPMTVEELEKLFLTLA"
     CDS             complement(63156..65315)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_660"
                     /old_locus_tag="pnf2660"
                     /product="putative membrane protein"
                     /protein_id="BAD60752.1"
                     /transl_table=11
                     /translation="MVETRLAGTAAGGQHPDSSPGLLGRWGAFMAGRTRAVIGIWLLV
                     LVALGAAAPSVFTSLAGAGWQANGSESVRARELAQQHFGGNSSAAVQVVIHSDTATIG
                     DPAMARVVEQVTAVFAGDERIGQVIAPQPGFTISPDGHTGIVIAGANASTDDMVKAVD
                     EHKAALTALSEDGIEVYPTGASALWSDFNAANHDAMIQAEMLSWPVTLAIMVLAFGSL
                     VAAGLPLLLTLAGLVASAGGLVLLNQITPISVWAMNFAMMFALALGIDYALFLVARFR
                     DALARTGDPRAAVAETMDTAGKAVLLSGLTVLVSLSAVLIVPAPAVRTMAVGIMLAVV
                     FVLAATLTLLPAVLGALGTKVNAAALPYARRQQHRSPVFARWGQILHKHPWPFAAVAL
                     AILIGLAAPVFGLKTAMPSIAVVPTDAPVRQGYELIAEQMGPGAPGMLSIITPTADAA
                     ATATIARASDGIVMLTPPQPAADGADLVMMQAMPAVDPSAPQMAEILDQLRADLPADA
                     VVGGAAAENLDLQQALDDYLPIVVGIILVLGFVLLLIALQAPLIAALGTLVSLLSTAA
                     AFGVAKLIFQDGHGAELLGFTPQGFLDGWGPVFFFAMIFAIAMDYTVFLLATAKEHYE
                     RTGDPHAAHVDGLAHSGRVIFAAAAVMVAVFFTFALADPLPPKEMGIILGVAVLLDAI
                     LVRLVLLPVMLRLTGHAAWWSPAWLTRVLPTISFAHH"
     CDS             65425..65652
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_670"
                     /old_locus_tag="pnf2670"
                     /product="hypothetical protein"
                     /protein_id="BAD60753.1"
                     /transl_table=11
                     /translation="MGIVEFMRGTAGRAARIIAGIALILIGLAAIGGPVGILVAVIGV
                     IPIAAGAFNFCLLGPVLGLDLHGQPRRQAGH"
     CDS             65751..66371
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_680"
                     /old_locus_tag="pnf2680"
                     /product="hypothetical protein"
                     /protein_id="BAD60754.1"
                     /transl_table=11
                     /translation="MADIELFVDPVCPFSWVSSQWLLTAAEDSAHTVRLRQMSLAVLN
                     DGHDVAADHKPMIDRSRRLGRVFAAATRTGGAEAFARLYDVIGTRLHIQGDDLGPQEV
                     AKSLTEAGLDPGLAEHLDSTSLDDDITGTHEVSQAALGGRGGSPIVVVDGRGFNGPVL
                     TEQPRPDRGRDLLDALVTAATTPGFAALQRPYQGPPKIDAATEETH"
     CDS             66371..66532
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_683"
                     /old_locus_tag="pnf2683"
                     /product="hypothetical protein"
                     /protein_id="BAD60755.1"
                     /transl_table=11
                     /translation="MCSPTRCRTCGKTTWSGCGAHIEAVRARVAPDDWCPGHPTQQAG
                     QPWWRLRRN"
     CDS             66773..66964
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_687"
                     /old_locus_tag="pnf2687"
                     /product="hypothetical protein"
                     /protein_id="BAD60756.1"
                     /transl_table=11
                     /translation="MACRVPSLLLATAVYAAGGPGWVAAAIMGVTLPLSWMAVLIAND
                     RPPREKRRPSLLRRRRRRR"
     CDS             complement(67269..67841)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_690"
                     /old_locus_tag="pnf2690"
                     /product="hypothetical protein"
                     /protein_id="BAD60757.1"
                     /transl_table=11
                     /translation="MRSWAIELFVSKEDLSMSGFKINRRGIQQMSREIQREFAKNPVR
                     VPIEMEAGGVYPPAANITNYNGPIVTVHGSHAQLAWNNGTVHQGQAHSDQIAPGYEEL
                     AATLAELLATLPRFPLADDETTEVREHTETILAEVVNEEPDPGIVKRGLTMIKGLLSP
                     IAAGVTAAATDESAQAAREVIQRLGEAVPF"
     CDS             68554..68919
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_700"
                     /old_locus_tag="pnf2700"
                     /product="hypothetical protein"
                     /protein_id="BAD60758.1"
                     /transl_table=11
                     /translation="MLLGVGAQQHNHVVRSWKPETIICQYCSMEVVWLPTIYGGNKLF
                     DAKMYPTSESARGNRFAAKRNGSVVDLDDIHSNRWPAECLHLHRYSCSEYNADMEARI
                     WTTKQSPGRDGRRIAEPPF"
     CDS             complement(69007..69249)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_710"
                     /old_locus_tag="pnf2710"
                     /product="hypothetical protein"
                     /protein_id="BAD60759.1"
                     /transl_table=11
                     /translation="MPYSDWGCEVARKKLTIEFDKPLPSELYANIISATWMNMRAIAD
                     AANFEFTIHHDGESSLSVELNNHWDRFATEAWWDTE"
     CDS             complement(69349..69990)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_720"
                     /old_locus_tag="pnf2720"
                     /product="hypothetical protein"
                     /protein_id="BAD60760.1"
                     /transl_table=11
                     /translation="MPRPSRILAHDQPAPSTETSSADHQFAGMPRHLEEPWMNHKHGD
                     ETLDRIVHPVEVTAANAMRAEGQLIDAVRTARAQGASWQAIAAAAGVSPLEAERRWAT
                     RTHTPLAELGAAVIEPWKTRLANYDHAQVERPENPRALVADLLLATTHARQLLDEITA
                     VTDRLADTQDTVVATAADTASTALAAGADTADQQARHLRTALTQLGTIDKHDR"
     CDS             complement(70026..70451)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_730"
                     /old_locus_tag="pnf2730"
                     /product="hypothetical protein"
                     /protein_id="BAD60761.1"
                     /transl_table=11
                     /translation="MTGAAVFAAVLGTYLVAHQVGDYWVQTDHQAQTKGRPGWSGRWA
                     CTKHVATYTLTLALCLATVDWWLGMPVQPAWAAAGLTVSAVTHYWADRRATLAWLADL
                     LGSGGFYRAGTGLATGAAHLDQSWHWLWLGIAALITTGP"
     CDS             complement(70448..71305)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_740"
                     /old_locus_tag="pnf2740"
                     /product="hypothetical protein"
                     /protein_id="BAD60762.1"
                     /transl_table=11
                     /translation="MSATGIEWTETTWNPVTGCDRISAGCDHCYALAMAKRLKAMGSA
                     KYQRDGDPRTSGPGFGVSVHPDALDIPRRWRAPRMVFVNSMSDLFHARVPDAFVHAVV
                     EVMRQTPQHTYQVLTKRPSRARRLTERGLVLPDNVWIGTSVEHGAVTHRITDLLAIDA
                     AVRFLSCEPLLGPIDLDPWLFPDRCPDGCSCRWPDDGDHNECACGGACADWAPRPAID
                     WVIVGGESGPAARPIDPEWVRDLRDQCVTAGTAFFFKQWGGRTPKAAGRELDGVIWSQ
                     FPTAARRTA"
     CDS             complement(71302..72927)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_750"
                     /old_locus_tag="pnf2750"
                     /product="putative DNA methyltransferase"
                     /protein_id="BAD60763.1"
                     /transl_table=11
                     /translation="MMGVRMSLRSTVYFAGWGGDSLGWEEVPGIELRLAANHNPVCVE
                     VHTLNFPDAEHLPPGDVEAIDLATLPYTELFWASPACPAWTDAKGRKRYFDKSNQYTL
                     LSDDELGTVIEDPAEARSRGLVEQIPRYLRAMAGRGTPVLAGVMENVIQCRRWDQWDR
                     WLRAIESIGPGYETRVIALNSMHAVPRRCLPAPQSRDRLYVAYWLKSLGRRPDWDKWL
                     RPKAWCPTCDRVVDAVQSWKQPGIDMGRYGARHGQYVYRCPAKSCRFQIVEPFTVPAA
                     AAIDWSLDPGEKIGERARPLAAATMERIRIGLAKFAGESFLTPAGGTWRADPTALSAP
                     MPARTTRESDGLVVPPLIVQTSKRADLTARSTGQPLPTQTTRRELAVAIPPFITSLRG
                     GGSRKTARHVGEPLGTFSARGFHHGLVQPPGSTAVVEQLAGTREQLLVPYYRTGLARP
                     LTEPMGTLTTRDRHGLLGIDPDRILAECTFRMLEPDEIRAGMAFPPTYIPIGDKRTQA
                     AGYGNAVTPPVPEVIGCALVEAITGEPIERTAA"
     CDS             73008..73223
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_760"
                     /old_locus_tag="pnf2760"
                     /product="hypothetical protein"
                     /protein_id="BAD60764.1"
                     /transl_table=11
                     /translation="MMAGMSDETDHAAAIRAARAAYDQARSELFATIRAALDDGVGPS
                     AIARYSDFTREYIARIRDGKGPKDIRG"
     CDS             complement(73335..73985)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_770"
                     /old_locus_tag="pnf2770"
                     /product="hypothetical protein"
                     /protein_id="BAD60765.1"
                     /transl_table=11
                     /translation="MGAPVPPPSAGSPGPASLPPVDAVEVTALAALYQADRADQSQHN
                     TSALTLIAGAVAYLGLVVTAWKDVKAAAMWPVLLPVPLWMVAAFHVLIMGAVLTRNQS
                     IRILEVRLHSATKLPMLGVASHELGGARARQVMDLDRQPILLKVQTLVTYMGIGCVLF
                     GFTAYAVWNTWHHHGWDAQVRIAAGAYSTASALVLAAWIRILLYLEEPLPAWAQLP"
     CDS             complement(74159..74971)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_780"
                     /old_locus_tag="pnf2780"
                     /product="hypothetical protein"
                     /protein_id="BAD60766.1"
                     /transl_table=11
                     /translation="MPETPRRRRRSGELWTDECNAELVELLRAGLPVEAIAEQAGRSV
                     SALATQCRKMLPPDFDTRPTAVEALRGVLADPDYDWRSPLRELARRARTVYWDAGMVD
                     RLRQGWERATPLDDLCEEFEASEIDVARQLLRLGAAESMFDVAERLGCDPHGTLAGRL
                     RIAADRCAAAVWILIVDGALTGAKTQFGSAGPGLRHVSVHHDYDTADLRLAEVLLDHV
                     VAGGRIQDVTTTIVERTIGDGAIGFNRFLTGSEALPTPAVAVVDLDDSTPTM"
     CDS             complement(75260..75673)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_790"
                     /old_locus_tag="pnf2790"
                     /product="hypothetical protein"
                     /protein_id="BAD60767.1"
                     /transl_table=11
                     /translation="MNRCGRGGRRHGCGSCWPCTGSCTCAAESGACAHAKRYAHTPTP
                     GREGEHAMTYYPPPRYRCLNLRCPETYHPLPTCPYTPLTTVVPPRTRPLTPRERDAVD
                     HIYRLGQAGELRILPTHWKWWVTAAVAFVLLLILF"
     CDS             complement(75764..76096)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_800"
                     /old_locus_tag="pnf2800"
                     /product="hypothetical protein"
                     /protein_id="BAD60768.1"
                     /transl_table=11
                     /translation="MHRPRSAPRVSACRVTLSGEGTLRGEERMAATEGPTVRLVAHCR
                     RCHGWLLSPESVAQGIGPTCAIRERAEQRAAEAAAATSTLTLFELPAGNSDGDGPHDL
                     LELLGLAS"
     CDS             complement(76111..76500)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_810"
                     /old_locus_tag="pnf2810"
                     /product="hypothetical protein"
                     /protein_id="BAD60769.1"
                     /transl_table=11
                     /translation="MSEDVEGSDRADWPGWAEVLEGVRRSRGRVEQAKGALMLVYGLD
                     STAAEQLLRRHSRDRGLPTAVLADQFLHTVAALGGAAGPEHARFDHLLLTAHQRLPAD
                     TDCPDVLEQALAPHADWTPPSCDRPTS"
     CDS             76757..77326
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_820"
                     /old_locus_tag="pnf2820"
                     /product="hypothetical protein"
                     /protein_id="BAD60770.1"
                     /transl_table=11
                     /translation="MTRPEAPELCPRCGEPIVQLPLGRRRKWCSDYCRRRADEEGLKV
                     HEVVRERERVVYRPERVSREQQIARLLDDPEATEQLLRALAYRWRHTAPDPAARQQIA
                     PTLLELWQAFHARIDPHTAQHPPAKIPTVAAEQRAAVERVLSSPRSTASVINRVTDRL
                     DAGELRSGRDEAILNAIAYLTTRRRFPRR"
     CDS             77532..78608
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_830"
                     /old_locus_tag="pnf2830"
                     /product="putative recombinase"
                     /protein_id="BAD60771.1"
                     /transl_table=11
                     /translation="MALAVVRSLRETRSLVTDEELADFELDVLSEFVLARASSGVGDS
                     TIRGDTTHLGQVRQWFGRPLWEMEPQDADRYFGTVLRRVSSSTRAARARTVVSYFEFL
                     EIRYKVVLHEMTGRVVECPIDEVNRPRMSVDTMVRIPPTEAELEQLFTGWREDLVTCR
                     KFAPSARNYMVARLAADVGLRVNEACMLDLDDIRWELGRFGKLNVRHGKGAFRSGPRQ
                     RLVPLINGADTALTWFVEDVWAQFDADETLPRAPLFPSERRRAGSSGTRVTRDVIRRA
                     LGGAVDRHLPTWSGRLTPHVLRHYCASQLYRTGVDILAIQELLGHSWITTTMRYVHPY
                     GTRVEDAVTAGHKRAAARWEGLIR"
     CDS             78605..78940
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_840"
                     /old_locus_tag="pnf2840"
                     /product="hypothetical protein"
                     /protein_id="BAD60772.1"
                     /transl_table=11
                     /translation="MKWNLRLVAANRGIWKSSELRRMLAARGLEISTGKMSGMWSSTP
                     AVLRPEELDVLCAVLNCGIAELITAEPDTVAAPTDAGEHVRAVGDQGPESVRRIVPKP
                     RTGRSLPPR"
     CDS             78937..80559
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_850"
                     /old_locus_tag="pnf2850"
                     /product="hypothetical protein"
                     /protein_id="BAD60773.1"
                     /transl_table=11
                     /translation="MTATSCRECGGRIEASTCPRGGRPRQYCLTCRPSKTAERRAEGA
                     KDYRDGSCVGCGTQLERAARTIGRPRIYCDACRGRRARTPSRSRRRNDAGPAQDNRSE
                     AYRDRRCTRCDAPIEVDGQRKGRPRIYCDGCFGRRVHEQRRHRTRPRSLDGLRFAEVF
                     GTITGRVEHEVLERLFDTARVGRWSVATVQRRSEELRRVLATAGDEPISLSQVRAELG
                     NVWQSRIAARVLDQCGLLIDDTESPTRQWIDRRTAELPPGFRDDVRAWLVVLHEGGQR
                     ARPRAEATLHAYYSRVLPPLTEWGSTRSHLREVTQADVSVALNRLNGHKRVGTFVALR
                     SLFRFAKRHRLIFLDPTRRLRAGAAPSRVLLPMTTGQVDAVTATAVTPLQRVVVALVA
                     VYAVRAHALRQLVLDDLDLARRRIRIGGSVHQLTEFTHDVLTDWLTYRQQRWPGTPNP
                     HVLVSSDSVLGNSPVEDYYLTWHLSLLGIQLEHIRGDRILEEALSTDTDPLHLTIMFG
                     LSEKSAADYARLARGITERPIEAVSHYPADWD"
     CDS             complement(80866..81024)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_860"
                     /old_locus_tag="pnf2860"
                     /product="hypothetical protein"
                     /protein_id="BAD60774.1"
                     /transl_table=11
                     /translation="MGKGVANGPRTQGRGGPSSGPRKRRNHLGCRLATPSLRNLLAPA
                     LRNSLPTP"
     CDS             complement(81040..82905)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_870"
                     /old_locus_tag="pnf2870"
                     /product="hypothetical protein"
                     /protein_id="BAD60775.1"
                     /transl_table=11
                     /translation="MIPNSTKGSDIKRLLWYLAGPGRYNEHVGQRVLAGDAVTMAVFA
                     GRINQARAWELGKLLDSPRQVLLRGDPVSVTSYQKARALMAEGMSRKAAFEAATSDEN
                     TWHCSLALHPDEGALSDEKWQAIATDFMREMGFVDAGDAVPDVRWAAVHHGPNRNGCD
                     HIHIAMSVVRADGSLVDMMYDRPRSQRAAGRVERKHGLRVLASRETGETEAATTPAER
                     AYMQRVGAHETDREALRRRVRAAAAATGSEAEWLRELRTQQIVVRPRFAKDSTEEVVG
                     YSVRMPAQRNVETGVWETPRGYSGLQLGKDLTLPALRSWAGWETSETAQQEAAAEWRR
                     LLAASDRRGARAGAHRPLDPAAQTEALAAVSRWCQRIQAIPAEDHAAVRRAASATAGL
                     FAAASVSTEPAPGPMDRLSRQLARIGDTDPARRLPRRERADTASVRAAARLLWSTTSR
                     QASQIALIEAMMDCFLAVAEARRAVGQAQAAEAMYSQARQALTEVHMRAAGINPDRPY
                     ESTPGSPAWVAAYRAHAHVTGEDPAITTNTILNQKALHATNTNRRVQKPMTPSRPRPW
                     LPIEDERAARDRQAAEAATLQRLATPRRTSTRSTKAPITPPRPARGNNRDTGFER"
     CDS             complement(82913..83506)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_880"
                     /old_locus_tag="pnf2880"
                     /product="hypothetical protein"
                     /protein_id="BAD60776.1"
                     /transl_table=11
                     /translation="MHQWCTPPGCRVVAALAVGRLRMAGESRNQRAGVRRTRQANVAG
                     GRSHRCVVKLSDSEYADLTVRAEAAGMTVPRLLVETTLGKATPEVGRAAAALRALEEG
                     EQDRRALNNLNQLVRYSHQNRELAEGLPLAVAAVVRAALQMDALARWVMGETPSVSPS
                     VIGEDQLAAAQEWVERVDNLGVLGIDEDIDDVDGGGV"
     CDS             complement(83798..85564)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_890"
                     /old_locus_tag="pnf2890"
                     /product="hypothetical protein"
                     /protein_id="BAD60777.1"
                     /transl_table=11
                     /translation="MTPDHTPAEAVARKAKDQRSAKIERSVTLFTAGIASVVAAQGMY
                     VMFSESLHMHPALQALCFAFIELMVVASAMRARRSQIDTGSAGVDGIAMWVLTILSGV
                     LAASHATNDVGLLVLRLAAPLVAAWGWERSMALERRQLTGRAGGMNWRWTPQRLLVKW
                     GIADPTDRTVAEVAVERRLADLALAADAVRIARINGGGRAERKAMQRLHRAIDKATAD
                     GIALGKESVRAQLAEHLEGRFSAYTLPNYRPVTDWADHTARAPRPTLDTIESDPAVRA
                     EIAALEREVERELTARATAPLARGDEDHAPVHAAESAIDRAREAVAGGPRADRSLARG
                     EDESRASDPVDRASIAREPIARSRADIGDGRAGEDAVSIAGEVSTARADASVERAESG
                     SEAESIAREVEVVDRAPIAQTGPELDTDRDSRADHTPEEQLSNARPGSEERASVARAT
                     EGVDRDRRAVVSIARDPKPVSPIAREDADRARPSRAGRARSTVIEGALARATEPAPRA
                     RLGGHGPFDRALSRAEATVIARAVVDRKLSRKSVEELTAIYEAASAGATPNAIGATMG
                     LPHSTVGRALEAATKVSGPRLV"
     CDS             complement(85561..86799)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF2_900"
                     /old_locus_tag="pnf2900"
                     /product="hypothetical protein"
                     /protein_id="BAD60778.1"
                     /transl_table=11
                     /translation="MTNPEQGPAVGADDGADRRVCQFPVAYDPGSGEFAVAGHPLPPA
                     PPGRGRKAEYCGEFHVDPDGVRRRHDRAAAFQRKRELQLEAAGGATARPDRPVPRPVT
                     SARASLAELLAQWEMVTTAHRAQQAEIVDRVAEIVATAGDPDAAVAEVARIRAEAQAE
                     IDAARAAAAEAENEALSARRELARAIEDKTLAEGAAEDAIADRDARAAEAAAEVDQAR
                     AEAATVIEQARADVAAAHAELEHALTDARSRIAAAEQAAAERVHAIRTETATEIEQIQ
                     AAANEQIRAAETRVRAASKAQRDAEAERAGAEQAAADARTEAQQLRRDLEVARAELTE
                     LTQAARAEREQLRSELASARAEARADREQMRTDHAAELARTQEAANAQVAALRQALDT
                     AHSTISRLEDEMARRKGEQK"
BASE COUNT        13872 a        30167 c        29417 g        13637 t
ORIGIN      
        1 atggcaactg atggtgttct gcgtctgttg ttctcgacgc tcaagggcgg gccagggaag
       61 acgaccagcg caatcctgac cgcgatcgcg ctcagccgtc gtggcctgac cgtggtggtc
      121 atctgcgccg acacccgcac tcggggtgcc acggactggg tgcaggaggc cgagcgggtc
      181 ggtgatgtgg tcccgttccg gttggcgatc tggcacgaga gcgacgggcc gctgtcgcaa
      241 tacgcgcgcg gagttgagcg ttcgaccggc gcggatgtgg tgatcatcga caccggcggt
      301 gagcagccgg agaacttcac gcacggctgc ctgtacgcgg actggctgat cgccccggtg
      361 ggcccgttcc gcgccgagct tcggcgcctg gtgccgacgt atcagagtgc cgccgcagtc
      421 gacgagagcg ggtcacccct ggagatcagc gtgctgctca cccgctgccc ggctgcacac
      481 aagggcaagg cgaaggaggc gcgtgaacag ctcacctcga acctggtggg cgaagacgga
      541 cagctcgacc ccgaggtccc ctacgcgttg gggctggacg tgctcaacac cgagatctcc
      601 cgcggcgtcg cctacgacga gttctacggg ctgatgcctg aggacgtggg ggagtacgac
      661 gcgctggcga acgagatcct cgaccgtcgc agcaggacca gctgatgccg gccccggaac
      721 gtcccaagcg tccgcggtcc cgctcggtcg ccagcgggct gccgtccacc gcccacagcg
      781 acaccgccgc ccgggtctcc gcgattctgg cggagaccgc cagcgcgacc atcgcagcac
      841 ccgatctgca gacctcggcg ccgctgtcgg cgttcgcgca ccggcccgac aacccgaggt
      901 gggcgcgcga gtacgacccg caggcagacc ctgaactcga agcgttcgcc gcgaccgtcg
      961 aggagtacgg gatcctccag gcggtgaccg tctgctccgc ggaggcatgg ctggaacacc
     1021 accccgacga cgcattcggc gccgaggtcc gctacgtcgt gctcatgggc aaccgccggt
     1081 tggccatcgc ccgttacaag aagatcgggc agctgccctt ccaccgcaac gaccgcctcg
     1141 ccgacccgcg gctttcccgt gagagcggga tcatcgagaa ctaccaccgc aagccgttgg
     1201 acccagtgcg tgaggccggc gagatggccg cggtgctcgc ccacaccggc gagagccgcc
     1261 gcgccttcgc cgaccgcata ggcatctccc acagccaggt caaccagcgc ctgcagctgc
     1321 tcgacctcat ccccgaattc cagggcctcg tctccgatct cgccctgccc gtgcacaagg
     1381 ccctcaaggt ggccgcactc ccccatctcg accaggccgc cctgctcgag atgggaccgc
     1441 cctacgatcc ggcccgactt acggatcaga cacaaccgcc ggagccagag agtggaaaga
     1501 ctctttccac caccaaaccc gtccggatcc cgccgcacag cacccccgac gacgtcgtcg
     1561 agcagctgcg caagcagctc gacccgcagc tgctcgacga ggtcgtccgc ctgctcacca
     1621 agtaacactc ggagctcgcg ccgcaggcga gaccgctgag taggggccca ctacggttct
     1681 ggcggtccgg tggccatctg ggtggcccag attgcttcgt gtagttcgtc gtcggtgtcc
     1741 cagggggcga gcgggatcga gggtgggtcg gtgggtggtt cgtcggtgag gtgccagcgc
     1801 atttcgagcc aggcatgcca ggcagcgcgt tgggcacggt ggcgggcaag ggtttcggtg
     1861 cggaggtggt gcaggccgtg gcgggcggcg atgtcgtcga gcgtggtcgg accgagggtg
     1921 acggtgccgc ggccgcgggt gatgagcccg gcctgggcca ggacggcgag gctgtcgtag
     1981 gcggtcgagc gagcgagccc ggccgcggcg atcacgtcct gggtgcgggt cagaccggat
     2041 tcgacgagtt cgtagaggta gcgggcgtgc aggcccagca cgcgccaggc gtcgtgtacc
     2101 tgccgcacct gcacgcgctc gagcgggacc gggtcgacct cgcggtcgag atcctcgccc
     2161 cgccgggggg tgaccagggc gtaggcgtcg gccagcgtgc ccgcggcgcg gcgcacccgc
     2221 aacaccgggc taccgggccg gtcccgcagg tcagcgagta cgtcagccac cgtcccgacc
     2281 gagagcagcc cagcgaacga cgcgaggctg cgaacaccca ccgcggcgac gggagcggtg
     2341 gcgccggcgg cgggctcgcg ggtgacggcg gcggcgtagg ccagggcgtc gaggactgcc
     2401 agcacggtcc accggtagga ctggccgggc caggtcgcga acgtccaggc gtaggcacga
     2461 gcgagccatt cacggtgcga ggtcgcagag atcggggtat tcgagcgttg ggagaccctg
     2521 gggggtgtga gccctggttc cctgtgttcg gaggaccgga ataggtgggc gtggggtgcg
     2581 acccaccggg tgcagatgcg gtcccagtcc tggctcagcg cccgctcggg gtcgcggtag
     2641 cgcgcatacg cctgggccat gcccggccac gcggtcaggt gggcgcggac gtcggtgagc
     2701 gaccagccgc gcagcgcggt ggccgccagc acggcggcac gggcttccga ccgcgatggc
     2761 caccggccat cggcgggcag ggcaccggtc tcggcgaagg cgaggaccgc ggccgggacc
     2821 ggcgtgcggc actgccaggg cgcgcgcagg cgggcatcag cccctgcgcc ctcccacaga
     2881 tccgccgacg ccgaggcggt cgcgggcagg ggagccgccg gggtcggcac cgcttccggc
     2941 gcgccggggc cgaggaaggc ccgcaggcgt tcgagcaggc cgggctcgga ccgctgccgc
     3001 accgcggcca gtgcgtcctc cagcgagccg tccaggaccc ggaaatgccc atcgcgggtc
     3061 gccgacccgg gtggggtgat cgagcccgtg cgagcgttga gcatcggcgt caggtccagc
     3121 gtcggcaacc gatccgccag gcgccgcagc acgggctcga cgtcggcccg gctataggtc
     3181 tcacccgcag cgaagaacgc gaggaggtgg cggccgccat tgccggggtt gcggtcggag
     3241 accacccggg caccgcacgc ttccagccag gcacgggccc gggcggcatc gcgggcgacc
     3301 gccaccggac catgtgcctt ggcgtccagg tccagcacca gcttgtcggt gcgcgccgcc
     3361 cggtcataga cgggcaccgc cgcaggctgt gccggcggcc gcgccggaat ccgggaccgc
     3421 gtccgcaccg tggtgttggt ggccgggtcg atcacccgga tcgcgggata ccccgcgatc
     3481 gctggagcca gcaccgacca caccagctca cggccatcac ccggctgagc tggcggcatg
     3541 gagttgtctg ggggaggtag ctcgtcggcc gctgtcagca aatcgtgacc agcgacatcg
     3601 cgcccgggtc tttggtgctg accacctcgt gagctaccct tagacccgct tagcacaagc
     3661 gttggtcctt aagggccttg aagcgcctcc ggttgccgcc gggggcgttt cgtcatttac
     3721 atggacattt ctaaccagcg atcttgagct gctcggcttc gacgacctcg atcctccggg
     3781 agacctccaa ctcgcggctc aaggcggact cgaagaacgc ccggtaggtc atctgtcgcc
     3841 gcttcgcctc agccttgaca gccgccagca ggtcggcgtc gatctcgacc agttgcggtt
     3901 ttccacgtcg tgctgtcatg cgggctatat aacgcctagt ttcgggctcg acctagccga
     3961 cacgccgcgc cggtgagcac acaatctgtg tccctgcggt gttcctgcgt agcgcttcga
     4021 ttgctcggag ccgttggtcg atcatggcca tccgctcggc acggtcgctg gcattggggt
     4081 ctgccttggt gatctggtcc ggatgctgtc ggtagtagag cccgacgcgg tggatgaacc
     4141 agccagcagc gaatgcgttg gcggtcagca tcattccggt gtcctcggag atgggcagcg
     4201 ccatccatcc tccgatcgcg agcagcaggt cgcgccggat ggtgatcgtg gtcgggtgga
     4261 cgtggaggcg ccagtcgtgg gcgcgccagt actcagcgac ggacccgatc ggaatcgggc
     4321 catcggcagg gtcaccggga aactccttga gggtgccgtc gggcatcagg tcaaggaccc
     4381 ggcatgtggt ccaaccgatc tcgggatgct gggtcagtat ctcgatcgcg tcggcgagcg
     4441 cggtggaggg gagtacgtca tcggcgtcga gattgcggac gtattcaccg cgtgcgcgtt
     4501 ggagcgctac tgtccgtgcg actccagggc ctccatggcg ggcggcgccg gcgcggactc
     4561 gggggtcgtt ctgagctgcc ttgggcagct ccaacggctg cgggtcatcg tgctggacta
     4621 gccattccca ttcccagtct gttggcatct cctggtgtgc caaagactcg tacgcggcag
     4681 tgaggtagtc gagccgtccg tggtgcacgg gggtgacgac ggagatcagc actggtcggc
     4741 tcctgcgggg tcggcgctgt cggtgcggcg ggggtgcacg cgatctgcgg tgtagatgat
     4801 gcggtcggcg acgacgagta tgcgccgggt gtcgagtggc gagtcggatt cgtcgtacgt
     4861 cgtgagcgtt ttctcgtaga ccggcacgcc gataggtacg gccagggcgt cgcgttcctc
     4921 ggctgtgggg ttgcgggtga gtaggaccag gtgctctcgg tgtaggtgaa tgcctgcccg
     4981 ctccagccac attgccgtgt tacgacctgg aacttctgcg tcaggtccgg tcaaaccgca
     5041 ctcgcgagcc aggtccgccc gcatgtactc gcgcgccacc tggtggggcg tgccgtccag
     5101 ggtgtagcga aacgtcctcg cgagcagctc agtgccttcg gagacctgca gcgaggtagc
     5161 cagatcggct gtcgcttcga cccagtcgta ggtgacagtg acctcgactc catcagcgcc
     5221 cgtttcatcc tcgaacgtca gtggcagcac tgagtttccg aacagatcgc gggtgagcac
     5281 ctgcgtcgag cgcacccgga cgccccggcg tggcgccgca gggtcggtgg tgagaatgcc
     5341 ttcgctgaca agcaccatga tcgcccgatt caccggcgca tggctgccca cgccgtactc
     5401 gtctgccaag cggcgcatcg aggggagttg ctcaccgggt ctccattcgc cagcggctac
     5461 ccgacttctc aggcctgcgg cgatgtcgac ccacgccggg ttcgcggaag acacggaaac
     5521 ctcctggttt gttactgcca aacgttgacc tgactcaggt ttggcagtaa caatacctcc
     5581 attgtttttg ttactgccaa acattggagg gagttgcagt gacgatccgt cgagatggtg
     5641 agtggctgac aacgacgcag tcggcgcacg tcgcctatga ggtgtccgag ggggtgttcc
     5701 ggctcagctt cgttccggaa cgcctggtca gcgccgcgca ggccgtggcc ggcctgcagc
     5761 tggccgagat cgtggcccag tgggaccagc tgctgtgggt ggagacgccg aacaccgcga
     5821 tggtgtggcg gttgatggct ggtcaggcgc agggcctgga cttggacgtg ctggatgcgg
     5881 tgatccggat cgagcagagc gagtggccga cctcggctac cgagtgggcg gcgtggttgc
     5941 gatgaggatc cccgaggtct ggacgcttga gatttggcgt cgcgcagctt ctccggcgat
     6001 tccggtggtg cgggtggtcg aggggcacat ggtgtcggag gcgaccgagc accacgccga
     6061 ttacgtgggg cagggctggt gggtggtcga tttcctgccg ggtcgtcagc tgagtgagga
     6121 gcaggcgcgg gcggcgatgc ggatcgcggt cgctccacag cagctggaag tcgagcggtg
     6181 ggccgccaag ctcgggctga ccgcggcgga ggcccgcgcg ttcgtggcca tgccggtggg
     6241 ggtggcgcga tgacccgcga gcgtgtggtg gatgtggtcg tgccgatcgt gcccgacacc
     6301 ggcgggcgcg ggctcggtgt ggtgtcggcg atggcgctgc tggtcgctgg tgtggtgctg
     6361 gccggtctgg ccgtgatggt catcgtgctg ctgtcgttcc cgtcgcggga gtactcgacc
     6421 gtgccggtca ccaggcagtt cggtccgtgt gagccgttct gctcgctgcg caccaccacc
     6481 gccccggcac cggtgggggg tgagcagcgg tgatgcgcag ctaccccgat cccgcctacc
     6541 gccgcgaccg cgcctgcgcg ggcgtggatc aggacgtgtt cttcccggcc ccgtcgggcc
     6601 agcagtcgcg gcggatcgcg ccggcgcggg cgctgtgcgc ggcgtgcccg gtgctggccg
     6661 agtgcgccgg gtgggcagag ccgctggccc gtgccggtga gttgaccggc tgcgtcgtcg
     6721 ccggggtgta cctgcccagc caccacaaca ccgcccggcg cctgcgcgac gcggccgccg
     6781 acgagctggt cgtcatcgcc gctaccggcc gtctcgatgt cgagggggcc gcctgatggc
     6841 cgcctccgaa accgccggtg tggtgcgggt tttccagctg caccgggatc gggatgtgac
     6901 cggctactcg ggcacggggg tcgtcgcgga cggcgtgatc tggcccgacg gggcggtgtc
     6961 gatgcgttgg cgcggcccgg tccgcaccac ggtcgaggcc gcgtgcctgg ccgacattca
     7021 gaccatccac ggccacgacg gcgccacccg cgtcgtgctc ggggccgtca tcacgggagg
     7081 tgcggcatgg accgcagcgt gaaagcccca ggacagaacg gattttcgga gtgggcgccg
     7141 gtgctggtgc ctggcgcggt cggcggcgtg atcgaggcgg cgggggtgtc gttgcgggtg
     7201 ggggactacc tctacgccga caccccgcag acggacgtgc cgtggaaccc gctcgcgctc
     7261 gggatccacc tggccaccgg gcagctggag tggaccggcg cggccaccgg cggcgcggtc
     7321 accctcgcgg ccgggaccgc ggtcacggtg gccgggagca tgtgggcgtg gcgggcgacc
     7381 tgccgccagt gccgcaagct cgccgacaag cgcggccagg tctcgcgcct ggcgcggggc
     7441 aaggcgttcg ggcgcagcgg catccgcaag gaggcgatcg attctcaggc ccgctacatg
     7501 gcgcggggca aggagctggc tgatctgagc cgggaggcga tcctgggcaa ggcccgggat
     7561 ctgcaggtgc agctgcgcgc cggtgacgcc ccgggtgtgc tgatcgggcg tgcggtcgcc
     7621 gacggccgcg agctgtatgc ctcgtatgag gatctgcacc tggacatctg gggtccacgc
     7681 tcgggcaagt ccacctcgcg ggtgatcccg gcggtgatgg aggcccccgg cgcggtggtc
     7741 gccacgtcga acaagcgcga tgtcgtggat gccacccgcg gcgctcgggg tgagcagggc
     7801 caggtgtggg tgttcgaccc gcagggcgtg gcgagcgagc cgtgcacctg gtactgggat
     7861 ccgatcgcgt gggtgctggg ggaggacggc ggcgccggtg cccaagagcg tgccgccgag
     7921 ctggccgggc atttcgccgc aggcggtgag gccgacaagc gggatgcgtt cttcgacccc
     7981 gagggcgaag acctgctcgc gggcctgatc ctggctgccg cggtggacaa gaagccgatc
     8041 acgcaggtgt tcgagtgggt cacctccgct catgaggacg ccccggtccg gattctgcgc
     8101 gatgccgggt tcgggttggt cgccggagcg ctggccgacc agtaccaggc cccggagaag
     8161 cagcgcggtg gcgtgttctc gacggcgaag aagatggcgg cctgcctgaa gtacgcgcgg
     8221 atccagccgt gggtgtgccc gccggccaag ggggacgccc cgcgcaaggc gttcgacgcc
     8281 gcgcagttcg tgcgcagccg cgacaccctc tacccgctga gcaaggaggg caagggcagc
     8341 gcgggcccgc tggtgaccgc cctgtgcgcg gccatcgccg ccgctggcga ggccgagggc
     8401 acccggcacc tgggcgggcg gttgccggtg ccgctgctga tcgtgctcga cgaggccgcc
     8461 aacatcgtgc gctgggccga tctgcccaag cagtactccc acttcgggtc ccgtgggatg
     8521 gtcgtgatga ccatcctgca gtcgtgggcc cagggggtgc gctgctgggg gcatgagggc
     8581 atgaccgcgc tgtggtcggc cgccaacgtc aaggttctcg gcgcgggcct ggacgatgcg
     8641 gcgtttctgc gggaccgctc ggagctgatc ggcccgcact acgagttgac cacctccacc
     8701 agccgcagcc acggccagaa cgggtcgcgg tccacctcga cctcgcgcac cagcgaagtc
     8761 accctgcacg ccagcgatct ggcggcgctg cccaagggcc gggtcgtcat cttcatctcc
     8821 gggcatcgcc cgacgttggg ccaggcggtg ccgtggatgc agcgccccta cgccgcgcag
     8881 gtccgcgccg cgctcgaccg ggccgcccga gccacccacc cacagcccag cgaggtccgc
     8941 ccgcacctgc gggcggtgcc cgcctacccc gacgagttgg aaggcaaatc cgcatgagcg
     9001 acaccacgtt cgagttcgac aacactgccg aaggcgacga cggcgtgacc gcgatgcccg
     9061 cgctggtgat cccgcagatg gacctgggcc agctgctcga cgaggcgatc cgcaaggccg
     9121 tgagtggtca gctcgcggcc gaggcgaaga agatcgccgc tggtgtggtc ggtgagctgc
     9181 tgaccccgga ggtcgtggcc gggatgcgcg agaccgcggt cctggaggcc gtgcgagccc
     9241 tggatcccag ccccgaagct tcgcttcccg gcgagcagga tccgggcgcg gcagaggacg
     9301 acgcggagga agacgcgcct ccgccgctgg agtaccgcac gctggatgcc tttgtccgcg
     9361 actacctggc gatgatgtac cggcgcgagg tcgtcgagcc cggctcggcc aagcacgccc
     9421 gctggtgccc gcgctggtgg gagcacggcg aggcgatcgg ccgcctggag gcgctgtggc
     9481 gggcgttcga ggaagcccgc cacggtgagg gctcggagat gagcacctgg tggctccagc
     9541 acgccgaccc catgatgacc gagctgctgt ccccgaccgg cccgttcaag tactgctcgg
     9601 tgcagcaggg acaccacgaa cggctggccc ggctaccgct ggtgcccgca ccagagggga
     9661 tgttcgagga cgggcacgcc cacgacccgg caccggcggt gctggtggca tcgtcgttga
     9721 ccctccccgc gccgacgcac ccgcgccgac gcacggtcat ggagttcccc gaatgagcgc
     9781 cccagcccgg ccgcagcgca ccgccgcgcc catgcagggc tcgtgggaga cgatcaccag
     9841 tgcgctcgag accgcggtcg ggcccggccg cccgtcgggg gcgtggacga agtactgctg
     9901 cccggtccac gagggcgacg gccgcgggca caagccctcg ctgggcgtga agtacgacga
     9961 cgcgggccag cgcacggtgg tgcgttgctt cgccggatgc gacaacgaac aggtcctcga
    10021 cgtgctcggg ctgcgggttc gggacatgtt cgaccggcgt gtcgagcgtg agggcagtgg
    10081 gcggggccgc cgcgcgaacc ggccccgctc ccggcagctc tcgcgtgccg accgggcgat
    10141 cgacgccgcg ggcctgccgc tgacccagcc gaaaaaacct gacccgggcc gtcagctttc
    10201 gccgtggcgc acggtggcga cctacccgta cctgcgcgcc gatggcaccg tcgccgggga
    10261 ggtcgtccgc aaagaggcgc ggttcgagca caccggtcgt gacaagcagt tccatcagcg
    10321 ccgctggaac cccgagaacg gccggatgga ggccggtggg ttcgacccgc tgccgtatca
    10381 gctgccgcag ctgctggagg cgatcgacga gggccgcacc gtctacatcg tcgagggcga
    10441 aaaggacgtc gcggccgccg aatccgcggg tctgaccgcc accaccaacg ccggcggcgc
    10501 gctgtcgtgg accccgcgcc acgccgagtg gttgcgcggt gcccgcacgg tggtgatcgt
    10561 cgccgaccgc gacccggccg ggtaccggcg cgctgaacgc gtgatggcca ccctgtccgg
    10621 gctggtcgag cgggtgcggg tggtgcaggc cgccaccggc aaggacctgc acgaccacct
    10681 gcagtgcggt cacgagatcg ccgacctcga gccgatcccg tacctggacc ctttcgtctc
    10741 cgccccgccg ccgaccaccg cgccggggcg gcctgcttca tcgaccgaga cctccaccga
    10801 cgtctcggat tctgctgaaa acaccactcc gggaggacat tccgacatgg ccgaatactt
    10861 gctcgcccct tcgaccgaca cacctccgcc gcagtcggac gaggtcgacc acgccggcca
    10921 gcagatggcc gcgttgtggc gggcgctggt gcaccaactg ctgtcgcacg cgttgaaagt
    10981 ggccgaacag cgacgccgtg acgccgagga actggcgcgc cgcaccgccg tggagaaggc
    11041 cgaagccgag gaacggttgg ccctggaacg taagagcgtc gagaccaagc tcgcggccct
    11101 gcgcaaacag ggctgggacg ccgccagccg ggacgagatc gccgacgcac tgacccaggc
    11161 gcgagcgtgg gcgccggatt ccgagcaggc cgccgccacc ttcgacgaac tgcgtcacca
    11221 cctgcaggac cggttcgggc tgcggatcga cccgcgcacc gacgccgtcg acatcgaccc
    11281 cgacgccgcc gcggtggtga cccacctggc cgacttcgag cgcagccgcg cgatcgatgc
    11341 ccgcctggtc gccgcccagg cccggatggt ggaggcggtg ggtgcgctcg acgggatcga
    11401 cgagtccacc aagcaggccc tctacgccga catcgaggcg tggcggacca accccagccc
    11461 gcagcagctc gacgtcctgg ccacgaagct ggccgcagcg aaagtgcccg aacgaacccg
    11521 gacccagatc cggttcaccg cggtctacct ctacgacgcc ggcgcccagc tgaccgccga
    11581 cgagcacgcc gaacgcggcc gccaggcgcc gaccaccctg gccacccaca tcctgcgcca
    11641 gaccgaggct ccgctggtcg accccggcga ggaggccaag ccgcgcatcg acgccctgct
    11701 ggtgtcctac caggaccggt tgcgcaccgg cgccgacacc agctgggtca tcgagaagtt
    11761 gggccgtgag gtcgcggtgc tgaccgagga ggaccgcacc gccgcacgcg agcgaggcaa
    11821 gcagatccgc cacaatcccg ccgggaagtt cgcgccgctg tggcctgatc acgtcgaccg
    11881 cgacgccttg gcggtgacgg tgtcgaccta cgccacgctg cgcccgcagg ccgaccgcgc
    11941 ggtcgtggcc accggcgact acaacaccgc ccaggccgcg ggcctgcgtc agcaggccga
    12001 caagcaccgc aacgccatcg tcaaggccat caaaaccggc aaaggcctgc acgacctgga
    12061 acgcgaccag ctcgccgcgg tgctgcgcga catcgacgcc ggacgcaccc gcccgccagc
    12121 gatgctgttc gtcgacgacc gcagcgccgc tcagcacgac gccgaccgcg ccgggcagat
    12181 cgcctcggaa acctcgcgga tccaccgccg ccagctcgat gagatcctgt ccaccgcgcg
    12241 ggtggacccg gtctcggcgc gggccacccg cgacgagatc acccgcgtca tggacgccca
    12301 gaccgcgctc gcggccgggc ggcagaacct gcacgactac ggcgagtccg gtgtcgagga
    12361 ccggctgcaa gccgccatga ccgccgtcgg tatccccgaa ccggtacgca accaggtccg
    12421 caaccacctc gaccgcgccg ccggtgaggc cgcgatcgcg ggcaagcagg ccaaccggat
    12481 ccgcgaccgc tggctcgacc gccacgaggc cgtcaccacc gcacgatccc cgcagcccgc
    12541 cggcgcaatc gactacgaca gcccgcagcg gcgagagggc ctggaaacca ggctgcgggc
    12601 ctcgggcctg tccgaggact gcatcgccca gcgcatggcc gccgacaccg ggcacgccaa
    12661 gccgccctcg gccgcacccg ccgccgggat ggccaagcgc cgcaccagcc ccggcaccgg
    12721 catgcagcgc atccaccacc gccgcggcaa gggccgaggg cccgagcagg gcctgggccg
    12781 gtgagggtct gttcgccgtg accgtgcacg accggcagcc cgacaccttc ccgtggcggg
    12841 ctgccccagc tcatttgaag acccgtcgcc agctgcgtgc ggccggcctt tcgcctggcg
    12901 ggcaggacgt cgccgcggtg atggtcggca agcgccgcgg ccgccgcctg atcgcctacc
    12961 tgttcgacgt ggggcgggcg cggccgaagc ggacgccctc acccgcccag ctggccgcga
    13021 tcgagaaggc gacccgcgag caccaggccc gcgccgccgc ccgccgcggc tacacccgca
    13081 ccgatctgac caccctcacc gatcccggcc cgggctggga cgaaaccacc acccaccagg
    13141 aggaacccac catgcccaac accgacacca acaccggcac cgtgcccatc gtcgagggcg
    13201 ggcccggcgc gccgacgcgg ctcaccccga gcgggcgcgg gcagcggctg gccttcctgc
    13261 gcaccgtcgc cgcggtcaac caggccaaat accaccgcga gcagctggat cagctggtcg
    13321 tcgaggccga aaacgctgga cggagcgagg atttcggtcg ccggttggcg cagcagctgg
    13381 ccgaggccga ggatcagctc gccgccgagg acccgtggcg caacccgcac gcgctcaccc
    13441 acgccctcgc cgaggccctg tactggtcgc cgggttcgga cctcgccgcc gcgcgggtgc
    13501 agcagatcgg tgagcagctc gcgcaccgtt ggggtgtggt cctggacggg gtcgatcccg
    13561 agacctgcac cgtcggtatc gatcccgcct tcgatgccgc cgcggctcag ctcgccgtcg
    13621 accgtgcggt ggtgcgggcc cgtgagcgcg ccgtcgccga gacgctgtcg cagatcccga
    13681 tgcccgagcc cagccaggac cgggtggtgg ccgcggtcac cgcctggtac gacgccgagg
    13741 gcgccggtac ggccaccccg cacgacagcg acgccctggc cgcgcgcctc gaggagctgc
    13801 acggcgacct gtccgcgctc gacctcgccc agcccgaacg cgaccaagtg aggttcacgg
    13861 tcgactacct gtggcgtgac gtgggccagg tcgacctgct cgacaccccc gtgatggtcg
    13921 accccggcca ggaagtgcgc gggcgggtgc cgcagctgct ccaagccttc gccgagcagc
    13981 ggatcgcccc ggccgagatc ggcgccgaga tctcggtgat gaccgtggcg gatcagcagg
    14041 ccgtgcgcga ggccggccgc gccatccgcg ccggagacga ggtcgatgtg cggctgtggc
    14101 ccggctacgc cgaccgggac cagctgcgcg agcagctcga aacctacgcc cgcgacgccg
    14161 tcgaggccgg tcgagaggcc gactacctcg ccgagaccga cctggccccc ttcgacgccg
    14221 ccctggtcgg catcaacgac gacatcgagg accgcatcga gcggatgtcg ctgagccacg
    14281 accagctgct ggccgccgcc gaggccgcca agggcctggc cccggccgag cggcaccaga
    14341 tccgggcagt cctcgccgat gtcgaagccg gggtcgccga ggactacgaa ctacccgaac
    14401 tgatgtgggt cgacgagcgc agcaaagccc agctcgacac cgaccgcagc caccggcagg
    14461 gcgccgtgct ggcccagacg ttctgccgcg aggcgatgca ggccatcgcc gacggcaaag
    14521 cccagcccag caacgcccac acccagaccc tcgagggcgt gctgtccacg gtgggcgaca
    14581 acctctactc ggtcgcctcc ggcagcgtcg acgacgccca ccgaacccaa ttcgtcaagg
    14641 accgcaccgc actcgggcgg gccctgaccg ccgccggggt ctacgccgag accaaggccg
    14701 acatccgcga actggtcgat acccgtgctc gccaggctgg gaaactcggg cgcggcgccg
    14761 tcgaacgtga gcagcggtgg aagacccgca ccgccgagat cctcgcccgc cgcgacgacg
    14821 ccatcgccca acgccgcgcc gccaacgcca gcgtcgcgcc cagcgcccgg atctgcacca
    14881 cccgacccga ccgtgccacc gggcagagca ccgccaccgc cctgccctcc tacaccgtcg
    14941 gggttcagca gaagcacagc cgcgaggtgg agcggtgacc gacgccgacc tcgtcgagct
    15001 gctggtcatc gcccgcatcg acaccacgac cgcggtcgct gacctgttca gctgccagac
    15061 ctactacgac gccgacaccg ggaccgaaac cggacccgcc gtagaggcga tgtgggagac
    15121 gctgaccgtc gaccccgccg ccccggtctg cctggactcg ctcgaccagg cactcaccac
    15181 ctccggctac cggcgcacca gcgcctggcg caaacgcgtc accgccgccg gcgccacccg
    15241 ctacttcgcc cacgccacca tcgcgatccc cgacctgccc taaacccgca ggcgcgagtc
    15301 agccccccag agcgcgaacc tggggggctg actggtgtca acggatggct gacgactatc
    15361 cgcccgagca acagcacggg tttctcctgg gcagggagcg ttggggtgcc cccaacacgt
    15421 gccggaatga aaggaacccc ggtgatgtgc ctgaccgccg aggcggccgg tagggatcgt
    15481 tccggggttt tctgcgccca gtataacctc agcgaccgtg acgacaattc ccgcccgatg
    15541 gtcagctgcg gatctgcggc gattcttgtc tgctggccgg ttcgaccgct acgtgcaggt
    15601 cgccggctcg gatgcggcgg gcgagcagct atatgagtgg aaccaactcg cctctggagc
    15661 ctggcacgaa acgctcggct cgttcgagat cgtgctgcgc aacgccctcg acgcccagct
    15721 gatcagctac caccagcgca tccgtaaggg caacggtgat tggtacgccg acccgaagat
    15781 gccttggggc acaggcacca ggctggcaca gtccatccgc aaggcacgca gccgtgcaac
    15841 cctgaacaag accatccccg aggtccacgg aaaagtcatc gcagaactca acttcggatt
    15901 ctggcggtac accctcgccg gcacctacca gagcactctg tgggcccagg cctaccggca
    15961 cgccttccca cacctgcgcc cgcggagccg gaccgctgtc tacgatccaa tcgtcgagct
    16021 acacgagttg cgcaacagag tcgcacacca cgaaccaatc cacggcgtcg atcacaccgc
    16081 acggctcaac gacttgctgc aagtcctcgc ctggatcgac ccagccgctg cggcctgggt
    16141 cgaagacacc acgcggatcc cggcagtgct cggcagccgt ccctgaacct cgatcacacg
    16201 acgtcgctac ctctcctgag tcctgatgtg caacttcagg atgtcaatga gcctcctcgc
    16261 ttgatccgga tcgatgtaga gcccgatcgt ggacggctcg cggtttccga cctgctgcac
    16321 ctcgataggg atgtgcatgc ccgagggcag gactccgttg gagcgccagt tcaccgaacc
    16381 gctggtgatg gcgcccaccg acttcaccgt gtacttttcc aggctcttga tctggtcgcc
    16441 caccaacacg agccaccccg agctgccgtc ctcctggtca cggcagaccc agtcgacgcc
    16501 tgcgtcgatc gcggctgagt gaggctcgca gagggcaact tcataggggt agctcgacca
    16561 gccaccgatc ctttgcggat cgaggtcctt ggttcccgcc gccgggctgt ggcagttctt
    16621 cacgaaacac tccattcgag gattgtcggc cctgcatgtg tgcgggaacg caccgccacg
    16681 ccgaaacctc gaaaatctgt tcgagatgcc gccaccccgg cgtcgatttc cgactcgacc
    16741 gctgcggctc ctcgtccgcc gtaatcgggc aggttgtcgg tatccactgc gacactcggt
    16801 gttccgtcgg tcggttcgca aaaggggtag ggggcgaagt ggcacagcgc aggccgtgga
    16861 tcaagcgaaa agtcggccaa gcgaggttgt gggtttggat gccgtacgag ggcggctcga
    16921 accgggagtg gatcctgggg gaactcggtc ggcgggtgcg gccagagtgg aacaagcagg
    16981 atcggcggtg ggaaatcgcc cgtcgtcacc tgtgggtgct cgccgaggcg atggctcaac
    17041 ggttcggtga ggtcgacctg ttcatggagt tctccgagac cgagaagtgc gaccggcgct
    17101 gccaagaagc caccgagacc gatgtcagcg agtgcgtctg ctcatgtttc ggcaagtacc
    17161 acggcggatt tggtgacccg cgtgctgatt ggaaactcgt tggcgccacc accctggtcg
    17221 cgtcgggtcc tttgcaggtg aagcacatgg tgatccgccg cccactgccc cggggtccag
    17281 acaatgcctt cacctcccag ccgcttcctc agcagccagc agtatcgacg cagctactcc
    17341 atgatgtgcc tgagccttcg gcctcgggag catccactgc tactgggtcc accgatgtcg
    17401 gccgagacgg cgaaggctcc gagcgtgcgg ccgagccgcc accggttcaa ccggtgggtc
    17461 gggcggctga agcggagagg cttccggcgg ggtgtgggat cgcgatgttc ctcaccaccg
    17521 taatcgtgtc ggctatcttc gccctggccg tccacgggct gttctggatg ggggccgctc
    17581 tcgcgatact cttcgccgtc gcgttcggcg ccgagcgaat cggcctgctc tagcgccggg
    17641 cctgccttcg aggaccgagc tacccggtgg tgcatgctcc gagttaggca gacacgcacc
    17701 acctgtacag cccactactc gccgtggtgg ccccgcaaga acctcagctc gatctcacgg
    17761 cactgtatgc ccttccggaa ctgggcagtc ctccggtcga tctccggctg gatctccctg
    17821 gcgacctcct cgaggatccc gctgtcggcg aggaccttgt gcagcgactc cttcaccgat
    17881 tccagcacca gtttgtcgaa tgtgaacacg ttgttctcct tgtgcggtcc agcggttggg
    17941 gccgcgcccg acgcacggtg gatctgccgg accgtgaatc agagcctgct cgggcgcgcg
    18001 gagcgcacgg tagagaccag gggcgcaacc gggctgctgg cctcggtcgc cgcagcgtgc
    18061 gagctgcccg cggtcgaggc caccgggcgg cggccgcctc agctcgcccg tagggaactg
    18121 ctaatcggca ggttagtggg ttgcgctctg gcccagagtg gccgtggcgg tgaggctgcc
    18181 cgacgatggc ggcaaccgcg cccgagctgg cggtagctgg aggctagcag ctcgtcgacg
    18241 caaccgtgtc tccgactttg cctgataact gacgttatcg ggcaagatag gctcggaacg
    18301 gctccggcga gctggcacaa cacctcccgg cgcgagacgt tcgattcctg gttatcgggc
    18361 aacctcggcg aaggggagcg agatgggcgc gacgacggcc gacatcgacg acgagacgac
    18421 actgcccttg gcggtgcaca tcgagcagtt cctcaccgac ctcgccaacg ccaaccggcc
    18481 cgccaacacc ctgcgcgcct accgcggcga cctcaccggc ttcgccgaac acgtcgacgg
    18541 cgggatcgac ggggtgaccg tggcggcggt gcgcgggttc ctgtcgggga tcgcggatct
    18601 ggcgccggcc acccgcaagc gcaagcgggc cgcggtcgcc gcgttctgcc ggtgggccgt
    18661 tcgccacgac ctgctggccg cgaatccgat ggacaaggtc gacaccatca ccgtccccaa
    18721 gaccctgccc cgcccggcgc ccgcggccga catcgccaag gtgttcgccg cgatctgcgc
    18781 tcgccggccc cgcaaagatg tcgccctcga cgtgctgcgg gaccgggtgc tgttcgagac
    18841 cgcctacgtc tgcggcgccc gggccagtga ggtctgcgag ctctacgtcg aggacttcga
    18901 cctgcgcctg gacgatgaac acgtccgctt gcacggcaag ggcggcaccg tacgcaccgt
    18961 cctgctcgac gaccgcggct acgttgccat gctgcggctc tacctcgacc gcaccggcta
    19021 caccgccgga cccatgttcc gcgccagcat caacggccgc ggcggaccgc tctcctactc
    19081 cgccgcccac caccggtgga gccgctactg cgccgcggcc ggggtggaca tcgacatcca
    19141 ccagctccgg cattcccacg ccaccgaact catcaacgcc ggcgtctcca tcgaagtcgt
    19201 ccgcaaacgc ctcgggcacg cctccaccga aaccacccag atctacgccc tgctcgccga
    19261 ccaagtcgcc gacacagaaa tccgggcagc acggcggcgg cgggatcgca gcctctgagc
    19321 tgacaccccc ttacgggcag gtaccggcgt cgttcagcga agcgagtcca cgattctcat
    19381 cgtctcgacg gcgaccgtgg tcacccgttt gatcaggtcg acgatgtaag tgggggtgtc
    19441 gtgttcgtca caccagtcgt tggggtcgtt cacgattccc gacgctgggt cggtcttgac
    19501 ctggtaacgg tcgatgaccc acgccaacgc cgaccgggat ccgagtacgt agcggtcggc
    19561 gtcctccggg atcccggtga tggtgacctt cgggttgtag acgatggtgg tgcggtcctc
    19621 gacgttcttg ccggtcgcgg ggtccttctt cttgccccac ttcatcttcg acacccgcca
    19681 ggtctcccga tcgtccgggt cggcggcttt gacctggaca tccagtggat acggctccac
    19741 ggtctcgtag ctggtgtgca ggtccgccag ctggcggccg gcatcggcga gttgctcgaa
    19801 ccgctcccgt gaggtcgggg tggggatgtg cggcagcatc ttcttcaggt ctgcggcgta
    19861 ggtctgccgg taggtcggat cgtggagctg gccgtagacg tagtagaaga tgtcatcctt
    19921 gctgacctcg tcgccgagca catcgcgata cagcttgagg atcccgtcgg tgatgttgtc
    19981 gattctgcgg aagccgtagt catcgatatc gctgctcgtc gcggcaccga agtcgagctc
    20041 cccctcgggg gtgacgacct tctcgtaggt ccaacggggg aagaactgac caccgcttcc
    20101 cgctcctgtg acatggagat caggaagcat gttgagcatg agcaccgaga acggcacagc
    20161 ggagccattc cccacctggt aaaagccaag atttttgtga tgcggggtcg ggaacatcga
    20221 cgggagctgc gaccgctcat ggttgaggtg cttgtcgaag taggtgtgct gtttagcgaa
    20281 aggccggtag aggctgacgg tatggccttc ggtccggtat gtgacctgcg tgcgacgggc
    20341 aaggtgggtg cggagactgc gcgaccactt gatgtagtca gcctgcgctg cagttgggtt
    20401 ggcggtcagg tagtccgtga cggcggcttc gttcggccgg gtgacccctg cggtacggca
    20461 gtagtcagcg aacgggatgt gctggtcgtt gtagttgccg atgagccgct gcacgttcgc
    20521 ggccagattg gtacgcgagt agttgtacac ccacgcatcc ctggtcgtct caagcccgcg
    20581 ggagaagttg gagaagacgg tgacctgttc ccgggaggcg tttttctccc cgatggctgg
    20641 ccaggcctgg tattcgtcgt tgcgttggtt ggcccagtcg ccgtgggtgt tgggggtgat
    20701 ggtctgccag tcgatgctgg tgagggtgct atcggcgatg atgcggagtt tgtcttcgcg
    20761 ggtgaggtag tcgccgatgt cgcggtagta gatctggcag gggccggtgt gggcggggtt
    20821 cttgatgccg atgaagatgg caacggtgtt gcggctgccg gagccgaaga tcttgccgcc
    20881 ctctttacgg gacagttcgc ctgcggtgcg ttggttgccg cggaggttgt aggcgtagat
    20941 gcgggagtat tcgtcggcga gggacaggcg gatgccgtcg gcggtgttgc cgtcgatcca
    21001 gccgccgttg gagacgaagg cgacgatgcc tttgttgccg atgcggtcgg tggcccagcg
    21061 gaaggcccgc aggtaggagt cgtagaggct gttcttgttc gttccggtgg agcgtgcggc
    21121 gtaggtgtcg gcgatccggg cgtcgagggt ggggtaggag atgttggcgt tgaggtcgtt
    21181 ggcggaggtt tgcccgaccg agtagggcgg gttgccgatg acgacgttga tcggggtggc
    21241 gttctggcgg gtgatgcgtt cgttgttctg ggggaagatc atcgagtcga ggctgtcgcc
    21301 gttctcggtg atctggaagg tgtcggcgag cacgatgccc tcgaacgggc tgtactcggc
    21361 ggccgcttct ttgccgagga tcgcgtggta ggtggtttcg atgttcaccg cggcgatgta
    21421 atacgcgagg agcatgatct cgttggcgtg cagctcaccg gcgtatttgc gggccagatc
    21481 cttcggggtg atgagtccgg attgcagtag ccgggtcagg aaggtgccgg tgccggtgaa
    21541 ggggtcgagg atgtggacgt cttgatcggt caggccgcga ccgaacgcgt cgcgggaggc
    21601 ttggtcggcg gcgtggagga tgaagtcgac gacttcgacg ggggtgtaga cgatgccgag
    21661 ggcttcggat tgtttgcgga agcccagccg gaagaacttc tcgtagagct cggcgatgac
    21721 cttctgtttg ccgtcggcgg tggtgacctc ggcggcgcgg acccgcaccg aggcgtagaa
    21781 cccttcgagc ttgatggttt cggcttccag gccggagccg tcgagggtgt cgaccatggc
    21841 ctgcatgacg cgggagaccg ggttgtggga ggcgaagtcg tgctcggcga acagcgcgtc
    21901 gaagacgggt ttggtgatca gatgctgggc cagcatgctg atcgcgtcct cgcgggtgat
    21961 ggagtcgttg aggttgtcgc gcaggccttg gacgaacttc tcgaactcgc cggtcacctc
    22021 gggggaggcg ccggcgagca gggcgcggat gcgggtgatg agggtgttgg cgatgtcggc
    22081 gacgtcggcg gcccagtctt cccagtaggc gcgggtgccg accttgtcga cgatgcgcgc
    22141 cacgatcgct tcctgccatt ccgacaggga gaacaacgcc atctgctgcg ccatccgagc
    22201 accctcatcc ggcgccggac tcccctccgc tgcgttgtcg ccgtggttgg tggtgctgtt
    22261 ggagagggtt tcgtggtcgt cggtgacggg cccgatgtgc ccgcccatca gcatgtcgct
    22321 gcctttgccg gttttctgga cgtcgctgct ggtgttgagg gcgatggagt tgaccatcgc
    22381 gttgaaccgg tcgtcgtggg cgcgcagggc gttgaggacc tgccagacca ccttgaagcg
    22441 ggtgttgtcc gacaaggcct tcgcgggtga gacgccggcg ggcacggcga cgggcaggat
    22501 gatgtagccg tagtccttgc cgtcggcctt acgcatcacc cgcccgaccg actgcacgac
    22561 gtcgacgacg gagttgcggg ggttgaggaa catcaccgca tccagcgccg gcacatccac
    22621 gccctcggac aggcaacggg cattggtgag gatccggcac tcaccctccg gcaccggcgc
    22681 cttcaaccag gccagctcgg cgttgcgctg cagcgcattg aacgtgccgt ccacgtggtg
    22741 gaccgagcag gacaggtcca ggttcgtcgc ggtgatctcg tggccgtcgt cctcgcggtc
    22801 ggcgagcagc tcccggtagg catccaccac cgcgggaaac acttcggcga cctgtttgga
    22861 ggcggcgatg tccttggcga acaccacggc ccgccgcatc ggcggctgcc ccggcgggaa
    22921 ccccaccccc tcgggggttt tcccggcacg tttggccagc ccgttccagc agcccacgat
    22981 cttcgacgca tcatccagcc gcagctcgct gaaccgcccg gccaactgct gctgcaaggg
    23041 cgcggcgacg aggtcttcgt cgacggtcag cacgatcacc ttgtaatcgg tgagcaaacc
    23101 ccgctcgacc gcggcaccga aggacaggcg gtggaactcg ggcccgtagc gggtttcgtc
    23161 gtccatcgac gacagctcgg cggagtgttc ggcggccttg tccttgacgg tctcgtcgaa
    23221 gatccgcggc gtggccgtca tatacagccg ccgctgcgcc ttcagatagt cgccgtcgtg
    23281 cacgcgcacg aagttcgact cgtcatcgcc gaccagggtg acaccggtgg tgcggtgcgc
    23341 ctcatcgcag atcaccagat cgaacggctc caccccatgc tcagcctgcg cgccggccac
    23401 ggcgggcagg gactggtagg tggtgaacac caccgtcaac cccgccgcat ggcggcggcg
    23461 ctccatctcc gcagccagca ccgccgagct cgtggtcacc gggatcgcga cgtcgtggac
    23521 cgagacgtcc tcggccgagc gggagacctt attgtccgag cacaccgcga acgcccgcag
    23581 atccagctgc gtctgggccg tccactcccg caacgtttgc gacagcagcg agatcgacgg
    23641 caccgcgaac agaatccgcg cgttgccgcc gttctcgacg gcggtgcgtt cggcgatctt
    23701 caacgccgtg aacgtcttgc ccgtcccgca cgccatgatc agcttgcccc ggtcgtggcc
    23761 ggcggcgaaa ccgttgaaga cggcgtcgat ggcctgggcc tgatgcggtc ggggctcgtg
    23821 gcgcttggcc tccgacaggc tgacctgcag ctcaccagcc ggccaggcga tgtcccagtc
    23881 gatcggggac tccgcgatct cggccagccc gatccgctgc accgggatcg tctgatcctg
    23941 cagggcgtcc tcggcgttgc ggccccaccg gtcggtggtg gagatgatca cccggttggt
    24001 gaacggcttc ttccccgaag cggtgaagaa cgagtcgata tcgcccttgg ccagcacatg
    24061 agtgggctcg taaaacttgc actggatcgc cgtcaacgcc ccggtatcac gctcccgggc
    24121 gaccagatcg atcccggtat ccggtttacc tgcccggtcg ggccagtcgg tccaccgcca
    24181 caccttgtcg tactgctggg ccagcatcgg atccaactcg aagtagcgga ccatcaactg
    24241 ctcgaacttg gtgccccgct ccgagttcga cggcgccagc cggaacgcct cgatgacctc
    24301 gtgaacagaa cccataaccc actcacacct tccccacgcc aacaaccgac ccggtcatct
    24361 tgcccaggcc cgcgcccaca gccagagcgg cataggcggt caggacggta tacggcacag
    24421 taccgcgcaa cctcgggtcc gaagccgcaa gtggtgggtc gccgacgtca gcaggtcctc
    24481 cgccagcaac ggcaccgccc agcgcgacgg cgtctggcac gacaccatcc tgctcgaacg
    24541 ccgctccccg gtccggtaac cgcagccctg gcggacgggc cggtgttcac cggctgttcg
    24601 tttgcctccc ggtatcgata tcggtcaata ttggcgtatg tcgaagtcga agttggtggt
    24661 gacgcctgtg caggcgtgct cggccgcgcc cctggtgcgc gagccgctgt ccgaacccca
    24721 cgccgtcgag ctggccagcg tgttcaaagc actctcggac ccggttcggc tgcgactgct
    24781 cagcgccatc gcctcgcgcg agagccagga agcctgcgtg tgcgacctgt ccgcgggcat
    24841 cgagttgacc cagccgacca tctcccatca cctcaaggtg ctgcgcgaag ccgggctgct
    24901 cgacagcgaa cgccgcgcct cttgggtgta ctaccgcgtc gtccccgaag cgctgcaacg
    24961 actctcggaa gtcctgctcg tggagagcgg caccgcgatc ggagcccccg catgagcgtg
    25021 aacaccaccg accaacccgc cgtggtcgcc aaactgtcca ccctcgaccg gttcctgccc
    25081 gtctggatcg gcgtggccat ggccgccggc ctgctgctcg gacgcatgat ccccggcctg
    25141 ggcgacgggc tgtcggcggt ggagatcgac ggcatcagcc tgccgatcgc gatcgggctg
    25201 ctgatcatga tgtacccggt gctggccaag gtccgctacg accgcctcga caccgtcacc
    25261 ggcgaccgca aactcctgct cagctccctg ctgctgaact ggatcctcgg cccggctctg
    25321 atgttcgccc tggcctggct gctgctgccg gacctgcccg agtaccgcac cgggctgatc
    25381 atcgtcggcc ttgcccgctg catcgccatg gtcatcatct ggaacgacct cgcctgcggc
    25441 gaccgcgaag ccgccgccgt gctggtcgcg ctgaactcgg ttttccaggt gatcatgttc
    25501 gccggactcg gctggttcta cctctcggtc ctgcccggct ggctcggcct ggaacaaacc
    25561 acgatcgaca cctcgccgtg gcagatcgcg aaatcggtgc tgatcttcct cggcatcccg
    25621 ctgctggccg ggtacctcac ccgccgcttc ggtgaacgcg ccaagggccg tacctggtac
    25681 gaatcggcct tcctgcccaa gatcgggccc tgggccctgt acgggctgct gttcaccatc
    25741 gtgatcctgt tcgccctgca aggcgaccag atcacctccc atcctctcga tgtcgtgcgg
    25801 atcgcgatcc ccctgttggc ctacttcgcc atcatgtggg gcggcggcta cgccctcggc
    25861 gcggtcctgg gtctgggcta cgagcgcacc accaccctgg cgttcaccgc cgcgggcaac
    25921 aacttcgagc tcgccatcgc cgtcgccatc gccacctacg gcgccacctc cggccaggcc
    25981 ctcgccgggg tcgtcggccc gctcatcgag gtccccgtcc tggtcggact ggtctacgtc
    26041 tcgctcgcgc tgcgcaaacg cttccccgcc accatctccc cggcggcgtc gtcgggcacc
    26101 ggggagatgg cgccgcgatg agcacgaccc cgtcggtgct gttcgtgtgc gtgaagaacg
    26161 gcggcaaatc ccagatggcg gccgggctga tgcgcgccgc cgccggtgac ctcgtgcagg
    26221 tccattccgc cggaacgaaa cccggcaccg cgatcaacgc cctgtcggcc gaatcgctgc
    26281 tcgaagtcgg tatcgacatc agcggcgaga ccccgaaacc gatcgacccg gccctgctgg
    26341 cctcggtcga cctggtcgtc accctcggcc gcgaagccca catcggcccg gtcgacgggg
    26401 tgcggatcct caactgggac accgacgaac cctccgaacg cggcatcgac ggcatcgaac
    26461 gcatgcgcct ggtccgcgac gacatcacca cccgcgtcaa caacctgctc accgaactca
    26521 ccacccccat cgagcaacgg acacacccat gaccgacagc ccctcccaca cccgccacga
    26581 cctgaccatc gaccagcaac tcgcgctgaa aaccgcggcc acccacttgc aacgtgagtt
    26641 caacggaacc ttcggcgtcg agaccatcga gcggttcctg cactcctcct acgaccagtt
    26701 cgccggacgc gcgaccgtgg tcaactacct gccgctgctg gccgaacgct tcgcccgcca
    26761 acgcctgcac gccctggccc gcgtcgaggg caaagcccac accggcacac ccacggtgtt
    26821 gttcctgtgc acccacaacg ccggacgctc ccagatggcc ctcgggttct tcacccacct
    26881 tgccggggac cgcgcggtgg cgtggtccgg cggcagcgaa cccggcgacg agatcaatcc
    26941 cgccgtgatc gccgcgatgg ccgaggtcgg catcgacatc accggcgagt tccccaaacc
    27001 gtggaccgag gagatcatcc aggccgccga cgtcgtcatc acgatgggct gcggtgatgc
    27061 ctgcccgctc tacccggggc gccggtatga ggaatgggac atcgacgacc ccgccgacct
    27121 cgacctcgcc gccatccggc ccattcgcga cgagatcgaa acccgcgtcc gtctcctgct
    27181 cgccgaactc gacctccccg cccactgaaa ggcccacccg cacatgacca ccaagcccag
    27241 cgtgttgttc gtctgcgtcc acaacgccgg acgctcccag atggccgccg gattcctgtc
    27301 ccacctcgcc ggcgacgcca tcgaggtccg ctccgccggc agcgcacccg ccgatcagat
    27361 caacccggcc gcggtcgcgg caatggccga actcggcatc gacatctccg accagacccc
    27421 gaagatcctc acctacgacg ccgtggaaac ctccgacgtc gtgatcacca tgggctgcgg
    27481 ggacacctgc ccgaccttcc ccggcgtcag ctaccgcgac tgggtgctcg aagaccccgc
    27541 aggcaaggga gtcgaatccg tccggccgat ccgcgacgaa atcaaggctc gcgtggaagc
    27601 cctcgtcgcc gaactcctgc ccgcgcgcgc ctgaggcccg ccccgcccgg aggccgcggc
    27661 cacacacggc tgccggcctc cgggcgggag tccgatccac tacagggctg taggaactcg
    27721 tgagatgacc actcagcgca accgtcacca cagcactgca cgcattctcg tcacctacgt
    27781 cgccgtagcc acagcgctca ccgcagcact gtccgagctg cgcgacgacg catggccccc
    27841 acacgcgaaa ctccatgccg cccaatacat cctcgtcacg gtcgggctca gtgtgatcgc
    27901 gatggtcctg ctgtggcagc gcggaagcgg ggcacgaaca cccgtgatca cggcctgctc
    27961 gatcctggcc acgccatggc tgggcctgct ggctgcacca ctgtttcccg gcacctcctt
    28021 gcacaaaccc cgaccggaca accccctgct cctcggccta cacccgcagc tactcctggc
    28081 cactgtcatg ctggcgctgc tgctcgccgc cgtcgcgctc accacccgag catcaacgac
    28141 cggaacggcg gcgcgctgac gggtcgctgt cggcttggaa ccggcgaagc ccctcgtcgg
    28201 agacccgcgc gtacttcacc aggctgcgca ccgaggtatg cccggacagt ttcatcagca
    28261 ccggcgtcga ggcaccgtcc tccgcggcgt gggtcagccg ggaatggcgc agctggtgca
    28321 gcgtgtaggg gccgtcgtcg aaggcgaggg tgtgcgactc gaacagctcg gccgcccgcc
    28381 gatacgacag ccgcgcccgc cccgtactcg ggtcgacatc gttgaccgct accgagggcc
    28441 gggccttgcg gtcggtcagg aacaccggcc cggacttgcg cccggccagc atcctgggca
    28501 gtaggggtag ccgtagcatc cgccgaaaat caggcggata tggcgtagcc gcctggtagg
    28561 catcgggttt cgggttcggc atgcgctgtc ggctggttgg tgcttggctg ccggtgatgg
    28621 tgttggtcgg cgctggtgga ggctggggtt cgtggcgacg cggatgttcg cggacgagga
    28681 attggaacgt ctgcggggat tcccggagat cagccgcgag gagctgtttc gatacttcac
    28741 gctcacgtcg gcggatctgg cgttcgtgga tccgggccgc ggccggggac cggccgaacg
    28801 gctgggcttg gcgatcgcgt tgtgtacgct gccgtggctg ggattcgtgc cggatcggct
    28861 ggtcacggcc ccaccggtgg cggttgctcg tatcgccgag cagttgcggg tggatccggt
    28921 ggtgatcggt gcctatggca ggcgagccaa gacccgcacc gagcatgtgc gcctggccgc
    28981 gcggtacctg ggatggcgtg cggccggtgc gctggagttc aaggagctcg atgagttcct
    29041 gctggcgcgg gcgatggagc acgattcgcc gactctgttg ttccggctgg ggtgtgagta
    29101 tctgatctcg gcgaaggtga tccggccggg ccctgtcacc gtggtggagc gggtcgccca
    29161 cgcccggcac caggcccaga ccgaaaccta tgatcggctc gctcacgagt tcactgcggc
    29221 gcggtgtgcg gagttggacg gcttgctggt gaccgacgcg tcgctgggga tttcgcggtt
    29281 gcggtggctg tcgacggggc cggtggaggc gtcggcggct gcggtccgcg ctgaggtcga
    29341 caagctgggg tttctgcggg gtttgggtgc tgatcggctg gatatgtcgg tgctgcccgc
    29401 cgagcggcgc cggttcttgg ccacgatggg ccggcgtctg agtccgcaag ccctggagcg
    29461 tcgggatccg cagcgccggt atccgatcct gctcacggtg ctggcccagt cgggcaccga
    29521 tgtgctcgat gaggtcgtgg cgttgttcga tcaggcgatc tcggcgaagt tcggtgccgc
    29581 cgaacggaag atgcagcagc agctggccga gcgcggcaag accggcgagg accgccaggc
    29641 gctgctggac gatctcctgg aaatcgtcac cgacccgacg gtggctgatg aggagatcgg
    29701 cgcgctgatc cgcggcgaga agatcgggtg ggagcgcctg cgcgcggcga tcgcccaggc
    29761 cgaacccagg ttgccgcgtg atcacgggca tctggcagcg ctggattcct cctacaacta
    29821 tctgcgccag ttcacccccg cagtgctcga ggcggtgcgc ttcgccggcg gcaccgccgc
    29881 taccgagctg ctgatcgcgg tgaacatgct gcgggagctg aacgcgaccg ggcggcgcaa
    29941 ggtcttcgac gacgccccga ccgggttcgt gccgatgaaa tggcgcggct acctcgacga
    30001 ggccgcccga aaatcgggca gcgccaccgc gtatcggcac tactgggagt tgtgcgtgct
    30061 gctgggtttg cgtgacgggc tgcgcagtgg ggatgtgttc gtgcccggct cgcgccgcta
    30121 cgccgacccg gccgcctacc tgctcaccac tgggcagtgg gaaccgcaac gcggagagtt
    30181 ctgccgcctg gtcgggcgat ccgccgatcc cggcgtcgcg ctggcggccg tggtcgccga
    30241 actgcacgat gcggtcggtg agctggaggc ggtgctggcc ggcggggacg gcccggtcag
    30301 ggtggacgag ggcggggatc tggtgatctc gccgctaagc gcggaagatg ttcccgccga
    30361 ggcgatcgcg ctcaaggccg agctgaccga gatgctgccg ttcgcgccga tcgtttcctt
    30421 gttgatcgag ttggacaagc gcaccggcta cctggactgc ttcacccacg ccggcggcca
    30481 ggccacccgc acaccagagc tcaaacgcaa tctgatcgcg gtactgctgg cgcactcgac
    30541 gaacctgggg ttgacccgga tggccgaggc gtgcgggatc acctacgaca tcctggcctg
    30601 gaccgatgag tggtatgtgc gcgaggagac cctgcgcgcg gccaacctca cgctgatcga
    30661 ctaccatcag cggctgccgc tgaccgcggt gttcggtgcc ggaacgctgt cgtcgagcga
    30721 cgggcagcgg ttcccgacgc gcgggaaatc aaccacggcc aggccgttga gccggtattt
    30781 cgccagcgag ggcctgtcga cctacaccca tgtcaccgat cagcatgcca cctacggcac
    30841 caaggtgatc gtggcgacca aacgcgaagc ccattacgtg ctcgatgaga tcctgggcaa
    30901 cgccgcggat ctgccgatca ccgagcacgc caccgacacc cacggggtca ccctggtcaa
    30961 cttcgggttg ttcgacctgc tcgggatgca gctctcgcca cggatccggg atctgggccg
    31021 gatcaccctg taccggccgg gcccgcgcgc gcaggccgag gcccggttcc cgcacgcggg
    31081 cccgctgatg acccgcaagg ccaacctggg tttgatcgcc gagcactggg acgatctgct
    31141 gcggttggcc ggatcgctga agttcgggca cgccaccgcg tcgctgctgg tcggcaagct
    31201 gtcggcgtcg gggcggcaga acactctggc cgcggcgctc aaggagtacg gagcgctgcg
    31261 gcgcaccatc tacgccgcga ggtacctctc cgatccggac tatcggcgca agatctcgcg
    31321 gcagctcaac aagggcgagt cgctgcacgc gctgcgccgc gacctgctct atgcccacga
    31381 ggggatgatt cgggcgcgcc atctcgagga ccagaccgag caagcctggt gcctgacctt
    31441 ggcgaccaac gctgtgatcg cctggaccac agagtattac gggctcgctg tcgatcagat
    31501 gcgccgcgcc gggcagcgta tcgatgacga ggtcctggcc catctttccc cagcgcacag
    31561 tgccaacatc aacttcttcg gcgcgatcga ggtcgacatc gacgccgagc tggcccagct
    31621 gggcccgacc gggtaccggc cgctgcgggt gcgtgacacc ttgttctgac tgcgcggccg
    31681 atctgtggtt acggtctgcc ggtgccggtc gggctggttg atgcggtggc tgttgagtga
    31741 gcggtgagga agttgtcgac gagccgggcg cagtcgtcgt ggtcgatggt gcgtagtccg
    31801 gtgaggcggg cgaacacgat cgggccgagg agttcgatga tggcgaaggt ggtgtcgagt
    31861 tcgccgagtg tggcgcgggc gtcggggctg gtgaggatct ggtcgaacgg tcggcggtat
    31921 tgctcgatga cgcgggcgcg tagtgaggtg agcgcggccg ggtcggtgtg gttgtcgtcg
    31981 atggatccca tggccagcca ggccagggtg gtcatctgta ccggggcctg ttcgatgagg
    32041 tcggcttggg tggtgagcag cgtgaggagc tgctcgcgta ccggggtggt gccggtgggg
    32101 gcgtcgacgt gggggagcag ccgttcgaag gtcgccgcga gcagatgggt ggtgctgccg
    32161 aagtgccggt agagggtggc gcgcgcgact ttcgatacgc gggtgaccgc ttcgacggtg
    32221 accgcctcga caccgccggt ggacagcaga tgggtggccg cgtcgagcaa ccggttgcgt
    32281 gagcgtgcca gccgcggatc ggcctgctcg tcgtccgcgg ggtgcgggtc ggtcatggac
    32341 gcgtgttcct ccggttcgtg ccgtgcggct gtgggtgtga gtggactcta tcccacaccc
    32401 cgacccctat gatacgaatg gtctcgcaca gagactatcg gtctctaaag tcgggaggtg
    32461 ccggtggaca cgcctgggac ggacactgtc gagatcgccc ggtggacccg ggccgagtgg
    32521 tggatgctga cggtgtcgtg cctggcggtg gcgctggtgg tcgcggcgat ggcggcgttg
    32581 tattcggcgt tgccgcagat cgcggtcgcg accggggcca cccaagctca gctgacctgg
    32641 atcgtcgacg gctacacact ggtgctggcg tgtctggtgc tgcccgccgg cgccgtcggt
    32701 gaccgttacg ggcgccgtgt ggtgctggtg gcggggttgg tggtgttcgc cgccgcctcg
    32761 gcgctgccgc tgctgctgga cgagccggtg tggctgatcg cgacgcgcgc gctggccggg
    32821 gcgggcgcgg cgctggtgat gccctcgacg ctgtcgatcc tgaccgcggg gttcgcccct
    32881 gttcatcgcg gccgggcggt cgggatatgg gccggggtcg ccggatccgg ggcggtgctg
    32941 gggatcctcg gtgccggggt gctgctcgaa cgatggtcgt ggccctcggt gttcgtcggg
    33001 ttgaccgtgg ccgggacggt gctggcggtg ctggcgtgca ccatcgccga atcccgccac
    33061 cgtgagcatc cgccggtgga ctgggtcggc gcgggcacgg tggcggtcgc ggtcgccgcg
    33121 atcgtgttcg ccgcgatcga ggtccccgca cgcggctggg ccgacccgct cgtcgccgcc
    33181 gcggccggga tcggtgtggc cgcggcggtg gcgttcgtgg tcgtcgaact gcgcagcgcg
    33241 gcgccgctgc tggacgtgcg gttgttcacc cgccgcggtt tcggtgccgg gtcgctgtcg
    33301 gtgaccatcc agttcctggt caccttcgga gtgttcctgc tgctggtgca gtacctgcag
    33361 ctgatcttcg gttacgggcc gctggcctcg gcgctggcac tggcgccgat ggtggtgccg
    33421 ctggtcgcga tctcggtgat cgcgccgtgg ctgtcgagcc tggtcggatt acgggtgatg
    33481 accgtgaccg gcctgctcac catcgccgcc gggctggtgc tggtgagccg gttgaccctc
    33541 gccgcaaact atcccgacct gctgtggccg ctgctgatca tgagcgcggg cctgggattg
    33601 tgcaccgccc cggcaaccta tgccatcgtc gccgacaccc cagaggccaa acacggggtc
    33661 gccgccgcgg tcaacgacgc cgcccgcgag atcggcgccg cgatcgggat cgccgtggcc
    33721 ggcagcgtcc tcgccgccgg ctacacccac cgcatccagc ccgccttggc ccggctaccc
    33781 gagcccgccc gcggcccggt cgccgattcc ctggccgccg ccctgcaagt cgccgaccag
    33841 gccggaccgg tggccgcgcc gctggccgag ttcgcccaag ccgcgttcgt gcacggcagc
    33901 ggccaggccg cgctcgcact ggccgccctc accaccgcca cagcgatcgt gctggccgtc
    33961 ctggcccccg gccgcacacc gcgcccgcac accaggacgc cctcaccggc accgcactcc
    34021 cctcctggtg aaagacgccc gtcatgatgg gctaccgcac gagcatcgtc ggcaccgacg
    34081 gatccggccc tgcccgtact gcgccagttg gctgtcacca ccgccggtca ccgctgctgg
    34141 cccggctgct gtccacccca ccgatcgagc tcgacggcaa agcccactgc gacatcctca
    34201 tcaccgccta aacacactca cagaaagcgc ccatgaccga gaacacaccc agcactgaca
    34261 cacccgagcc ccggcaggtc ccggactgga tccccgcctt ccccgtgctc gcacccgact
    34321 ccgtcgacct gccgccccac cacgaccact gcctgggctg cggaccggcc aatccccacg
    34381 gccaccggct acgcgcccga cgcgacgcac acggcgtcta cgcccaccac cgcttcgact
    34441 cccgccacgt cggcgcccca gcgatcgccc acggcggcgc ggtcgccacc gtcctcgacg
    34501 aactgttcgg actcctgctc tacaccgtcg gggaacccgc cgtcacccgc cacctcgcca
    34561 tcgactacct cgccccgatc ctgctcgaca ccccctacac cctccgcgcc cacatccact
    34621 cccgcgacgg ccgcaaactc cacctgaaag ccaccatcga aaacgaccgc gcccacgtgg
    34681 tcaccaccgc caccgccctg ttcctcatcg tcgacgtcaa ccacttcctc accccacaac
    34741 acacccccac acaccgataa cacccccctg acctgttccg taacccgatc cgtaaccgga
    34801 acaccacgca gaacgaacat cggcccagca caccggtgtt ccgtagaggt gttccgcaaa
    34861 ctgtgccggt caacccccgc catctggaac actttcggca tgggtgagcc gttccgcatc
    34921 ggatactgcc gctgctccac cgacgaacaa gacgtcgaga tccaaaccga acaactactg
    34981 gcgctcggag tgccgcgcga gcggatcttc atcgacaaag ggttctccgg gaccacccgc
    35041 aagaaccggg ccggcctgga caacgcactc gccgccgcca cctccgccgc agcggccatc
    35101 gacgagcgac aggtagtgct gaccacgacg aagttcgacc gattcgcacg caacatggcc
    35161 gaagcaggcc agaccctgac cgaactgcgc gagcgcgatg tgctgttcgg actcgggagc
    35221 tcgatctacg actgggcaga cccgttcggc aagctgttcc tgcaaaccct cgccatggtc
    35281 gccgaattcg aagccaacct caaccaccta cgcacccgcg agggcatggc caaagcccgc
    35341 gcaaaaggca gactcaaagg caaacagccg aaactacctc tcacggcacg gaaaacaatc
    35401 caccgccgct accacgaccc cgccgacgac gcgagcctcg ctgacctcgc cgaggaatac
    35461 agcgtcggcc gctccaccat ccaccgcatc gtcagcaatg ctccaccacg agcctgagaa
    35521 ttcaccagcc tgtcgtaaag accccgctac ttcgcacttc ctgacaaccc ttgggttgcg
    35581 ggcccttacg tcccacacga gtcctgaccc gaatcggatc gtcggcgagc tgggcggata
    35641 cgccgcgccc accaggagcc ggtggcgaga cagacgatcg tttcaaccca acaggccgag
    35701 cggatcatcg accagacaca acgccatatc cgcccgattt tcggcaaatg ctacggctac
    35761 cccggtgtgc gctgctgggg cgaggacggc atgaaggcgc tgtggtcggc ggcgaatgtg
    35821 aaggtcatcg gcggcggcct ggacgacgaa gcgttccttc gcgcccgctc ggagttgatc
    35881 ggcccgcact acgagcagtc ggtctcggtc agcaaagccc agggcgggca ccgctcgcac
    35941 tcggtgtcgc ggaccaccga aatcaccctg cacccgagtg atctggcggc gatgccgcgc
    36001 gggcggtgcg tggtgttcac ctccggcaac cgggccacgc tcgcccagac cgtgccctgg
    36061 atggaccgcc cctacgccgc ccaaatcgcc gccgctctcg acgaactcgc caacgccacc
    36121 gagcccgtgc ggccgcggtt gcaggtggtg ccgccactgt ccgaccagaa aggcaaaacc
    36181 gcatgaccag caccgatatc ccgaccagca gcagcgacat cgacatcgac ctcaccaccc
    36241 tcgacaccga caccgacacc ggggcagggg ccggggcggg ggtcggtggg gtggtggagc
    36301 tgaccgaggc gttgaccggt gcggtccgca aagcgatcgc ttcccaggtc gccgaggccg
    36361 cccagctcat cgccaagggc gcactcgatg aggtcctcac cgaggaggtc gccgaggaga
    36421 tgcgggtcgc ggcggtgcgt gacgcgctgg ccgcggtcga cccccagcag ggtgaggacc
    36481 cggtcgagaa gctgaagtac cgcaacctgg agctgttcgt ctccgagttc ctcgcccgcg
    36541 tctaccgccg cgaggtcacc cgggagggga gccagaagaa ggctcgctgg tgcccggtgt
    36601 ggtgggacca cggtgaggcc gtggcccggt tggcggcgtt gtggcggtcc ttcgagcgga
    36661 tgcgccaggg cgacggggtg gagatgtcgg tgtggtggct gcaccacgcc gacccgatga
    36721 tggaccgcct gctcgatccc gagaacgggc cgttccgcta ctgctcggtc gccgatgggc
    36781 atgtgcggcg cctgaccaag ctgccggtcg tggagatccc cgacgcgctg aagttcgccg
    36841 acggctacat cgaggaccag cagcccgaca ccaccacggc ggcgctgccg gtgacgagtc
    36901 tctacctgcc gcccgccacc gggcaggccc gccgggtggt catccgggag tttccctgat
    36961 ggccgtccca gcacatgagg cgggtcgggg gtcgtgggtg cgggtcacca ccgcgctgga
    37021 gcaggtggtg ggcccgggcc gtccgtcagg gtcgtggacg aagtactgct gcccggtgca
    37081 cgagggtgat ggtcgtcatc atcggccgtc gttgtcggtg aagtatttcg gcgacgccgg
    37141 ccgcacgaag gtccgctgcc aggccgggtg tgaggacgaa ctggttctcg acgcggtcgg
    37201 gctgcgggtg gccgacctct acgacacccc gttgcggcgc ggtgagcgtg gggcgcggtc
    37261 cggtccggcc cggcgcccag ccaagcgggc ggaatcccga tccgatcgtg ccctgcgcgc
    37321 ggcgggcatc ccggcgcaca aacccaaacg tgacctcggc gcgcaggttt cgccgtggag
    37381 gtcgaccgcc acctacacct acgtccgcgc tgacggcacc gtcgccggtg aggtcatccg
    37441 ccgcgaggcc gatttcgagg gtgggcggga caagtcgttc tcccaacgct cctggaactc
    37501 ccggcacggt ggttgggagc gcaccggttt cgacaagatc ccgttccagc tgccgcaggt
    37561 tcgtgaagcg atcgccgccg ggcgcaccat ctacctcgtc gagggggaga aggacgccct
    37621 caacgccgcc gcagcggggt tggtggccac caccaacgcc ggcggcgcct cggggtggtc
    37681 gcccgagcat gccgagtggc tgcgtggggc gcgcaccgtg gttatcgtcg ccgaccgcga
    37741 cgcgccgggc tttcaccgcg ccgaccgggt catggccacc ctgtccgggc tggtgggacg
    37801 ggtgcgggtg gtgcaggccg ccaccggcaa ggacctcacc gaccatctcg aggccgggca
    37861 tcggatcgct gatttggtgc cgatcccgta cctggacccc tacacccgcg ccctgaccgc
    37921 cgtgcccacc ccgccggcca ccacgaccgc ggcggtggcc ggaccggccc caccgccctc
    37981 tgcggtgtcg cccgcgcccg agttccccgc cgaaacgccc tctccccaag gacatccgat
    38041 gcctgaatcc ttgctcactc ccgccgccga gacgacaccg cattccgacg aggtcgacca
    38101 catgcacagt cagtggtcgg tgttcatgaa gttgctgatg cagcagatgc tgctgatggc
    38161 gaccaaagcc gtccaccagc gcgcggccgc cgccgccgag gcggcccgca agtccgaaca
    38221 agccgcccgc gacgccgagg aacgcgccgc cgcggagatg gccgctgtcg aagtccggct
    38281 gcgcaaactg cgccagaagg gctacgacac cgcctcacgc accgagatcg ccgacgcggt
    38341 gcgcgacgcc gcgacgtggg gcgatcagag cgaggtcgcc ggaaacgaac tcggccacct
    38401 ggccctgcac gtctcgcgcc gttggggtgt ggagctcgac ctcgacactg ggcaggccag
    38461 tatcgccccc ggcaccgatg cccagcggtt ggccgagatc gagcaggacc gcgccgctgc
    38521 cgcccgcgcc cgcaaagccc aagaccggat ggtcgagatg gtcgcgcgtg aagacgatct
    38581 cgacgagtcg gcgaaggtgg gaatctacgc cgcgatcgag tcctggcgcg ccgatcccag
    38641 cgccgagaag ctcgacgcgc tgacccgcca gctcaaagac cgcaaggtcc cccagcagac
    38701 ccgcacccgg ttgcggttcg tcgccgccta cctcggcacc cccgccgcga tcggtgatga
    38761 ggaaaacgcc gacatcaaga cggtgtcggc ggctgaggag ttgagtcgtc acgccacacc
    38821 gttggtggat ccaggggagg aggccaagcc gcgcatcgac aaactgctcg agacctatca
    38881 ggagcagctg aaggtggggg cggacaccag cgaggtgcgt gaggaactcg cgcgtgaggt
    38941 cgcggtcctg accgtggagg accaggaagc cgcccgcgcc cgcgggaagg cgatccgcgc
    39001 caaccccgcc ggggcctatc cgcggatgtg gcccgatcac gtcgaccgcg acgaactcga
    39061 cgaacacatc cgcgtctacg cgctcctcgc gccgaaagcc gaacaagccg ccggtaaggc
    39121 cggagacctc gacgatgtca ccgccaccca gctggccaag caggccgcca gccacaagac
    39181 cgcgatccgc aaagccctca ccgacggcaa aggcctccac gatctggagc gcgatcagat
    39241 caaggccgtg ctgcgggatg tggaggcagg caaacccacc gtgccggagc agttgttcgc
    39301 cgacgaccgc tccgcggcga tcgtcgacat ccaacgcacc cagcgcatcg cctacaacac
    39361 ccaccggacc cagcgccgcg acctggacga gatcctcgat accggggcgg tacccgaacc
    39421 ggtgcgccag caggtccgtg agcacctcga caacaccacc ggtgcggtcg agatggccca
    39481 ccgtggggtc gctgacgccg ccttcaagtg ggcacgacgc cgggaagcgg tcatcgtctc
    39541 ccgcaccgcc gccgtcatcg aagccgatgg cggctacgac agcccgcaac gagcccaagc
    39601 gatgcaggag cagctgcgcg ccggcgggct cgacgacgac cagatcgccg aacgcatggc
    39661 cgccgaatcc tccttcgcca ccccgccctc ggccgcggcg aagccgccca agctcaaccc
    39721 gcgcaccacc agccccggcg ccggaatgca gcggatcaac caccgcaaca agaacaacgg
    39781 ccccgaacag ggcaacggcc gctgaggccc gagctgcacg aagccgatga ccacgcctga
    39841 ccagcagccc gccacctacc cgtggcgggc tgccccgtcc cacctgaaaa cccgccgcca
    39901 actccgcgac gccggcctgt cacccggcgg ccaggacgtc gccgcgctca tggtccgcca
    39961 gcgccgcggc cgccgcctgg tggcccacct gttcgacatc gccctcgccc gcccgaaacg
    40021 agtgccctca ccagggcaac tggcggcgat cgagaaagcc acccgcaccc accagctccg
    40081 cgccgccgaa cgccgcggct acaccgccac cgaccttcac acccccaccg acctcggact
    40141 gacctggtcc gaaaccccca ccctccagga ggaaaccact atgtccacca acggatccac
    40201 caccgggcag gtccggccgc aggggctcgg tcagcgcagg gcgtggctgc acgccctggt
    40261 cgcgaccaac caagcccgcg accgccgtac ccgcctcgac accgacctcg accatgccgc
    40321 ccgcgccggt ggtgaggtcg aggccgggta cctggccgga ctgcgccgtg acctcgacgc
    40381 ggccgaaaca cgactgtcgg cggtccgggg gatcggtgac ccctacaccg acaccgcgct
    40441 gctggccgat gccctgtact ggtcgccggg ctcggacacc gccgcccggc tcgccgaaca
    40501 gatcaccagc gggctggccg ccgagtgggg tgtgcacgtc gatcccgaat cctggcaggt
    40561 gagtatcgat cccggcttcg acgcggccac cgcccagacc accgccgaaa ccagcgcgat
    40621 gcgggcacgg gaagccgcga tcgtcgacgt cgtctcgggg ctggcgctgc ccgaccacac
    40681 cgctgccgcg gtcgaccagg cggtccaggc gtgggctgag gcgaccccgg cgggcagcaa
    40741 cgacttggcc acgcggcggg agcagctgcg cggggagctg gctggcgtgc ggtgcgccga
    40801 caccgaccgg gcactgatcg agttcaccgt cgactacctg accgaccaca ccgccggggt
    40861 cgacctgctc gacaccccgg tgctcgtcga ccccggacag gaagtccggg gccggatacc
    40921 gcgactgctg gaacggttca ccgagggccg tatcgccccc gcgcaggtcg cggaagagat
    40981 tgcggtgatg accgacgccg atcagcaggc cgtgcgggag gtcggcgccg cgaccgtgca
    41041 cgagctcgaa cagatcgggt tccaggtgtg gccgggctgg gccgaccgcg accaggtctt
    41101 cgagcagctg cacgagtacg cgaccgaagc ccgcgagcat cacagcgaca tcgactacct
    41161 cgccacccaa gacctcaccg acgacgaacg cgaaaacctc ggggtcagcg acgacatcgg
    41221 tgcccgcatc gaacgcatga ccgccgcccg caccgaactg ctcgacaccg ccaccaccag
    41281 caaaggattg accgcggccg aacgccacca cctcaccgcc gtcatccgcg acatcgacac
    41341 cggcaccatc aacagcgaat ccgaactgcc ggagctgatg tgggtcgacg aacgcagcaa
    41401 agccgctgtc gatgagaaac gcagctatga acctggtcgc cgcctgtcca aggcggtcac
    41461 ccaggaagtg acccgactgc tcagcgacgc gggtgtcgac ctgagccacc gtgatcacgg
    41521 caaactcgca tcctcggtgt cggcgatcgg cagcaccctg gacagcgtgg cttatggcgg
    41581 gtcgctgctg ggtttggact ccgaccgcga ggaattcctc acccgacgca cccgcctcgg
    41641 acaacacctg cgcgacaccc ggatcggccc tgaggccatg accaccatcc gtgaggtcgt
    41701 cgacggtcac gcccgcgacg ccggccaggc cgggcaggcc gcgatcgaac gccgcgggcg
    41761 gtggaaggac cggatcaccg cgatcgccgc cgcccgcgac gacgccatcg cccaacggca
    41821 agccgccacc gccggccact ccaccaggcc ccgcgcctgc accaccagcc cggccatcac
    41881 cacacaggcc accggcccga cccgcccacc gcgcatccgg cacctgcacg gtgaagagat
    41941 cggacggtga tcgaaagcag gtagtccgcc acccgtgaca tagatcagcc cagggcgcga
    42001 acccctgggc tgatctacgt tccgggtcgg ctacttcttg ccgccgtcct tggctgcgct
    42061 ggactgggcg cggggcgcga acccggactt cgccgacgac gattccgggt tcttcgcggc
    42121 cgccgattgg atgcgggagg ccgcctcagc ggtcatcttg ccgccgtcct tgtctgactt
    42181 cgacacgatc ctctccttcc tcggttcccc tacccttccg gtgtagcacc tcggcgcggg
    42241 tctcgacagc ctgctcgaaa ccggaatcaa cacaggtcag aggcaggttc gaggcagggc
    42301 ggagccggtc cggcagcgat cgccggcgga gatgtcgttg cctgcgtgca tcattcagtc
    42361 atggggacag ggcgggagcg tgtcggcgcg gtgtggtgcg agagcgatta ccggttgttg
    42421 ttcgaggcgc tcgcgctcgg catgaccgat gaggagatcg ccgcacacat cgaccgtgaa
    42481 gtcggcgggg tacgtagtcg ggcactgctg ctggtggaca acgccaccag caagaagggt
    42541 gccctgccga tgctgcggcg gctggccgaa gcacccgact tcgactggga cacctgggta
    42601 cgtgaagtcc acacccgcga gaacctgccc tactgggaca ctgccgccga cgaggccctg
    42661 atcggccact gggccgccga accgcccccg cgtatccagc agctgtgcga gcagttcggt
    42721 gtcggtcagg acgtcatcgc ccgccgggcg atcatcctcg ggctggcgca gacccgcgcc
    42781 gaggtcgtcg accggttcgg cgccgcaccc ggcagcggcc tggccgtcaa cgctgtcctg
    42841 gccaaggaca aactcgcggc agcggtcgcc gtcctggtcg tcaccgacac caccggtgag
    42901 gtcctgtacc tatcgctgca cccgaccacc gacgaggcca ccaccagcct gcaagacctc
    42961 accacgaccc cgctggccgc gatccaggga cgctggacga tcggcacccg ggtcgtcggc
    43021 gaaggatcag tccgccccac cgacaccggc acgtggccgg ccaccaccga gtacatcccc
    43081 gcaccgcagg aaaggccgtc gcggtggcgg cgcctgctgc ggccggtccg gcagggctga
    43141 gcgaacggtc cgacaccgta agcaagaccc accagccctg cccaggccga gaccggatcc
    43201 atcaccctgc agagcagtgc atacggcggg cccggctagc tgccaacagt ccagaacgcc
    43261 gcgggcgggt tcaaggtgcc gtgatagagg acaaccttgg cgacctgatc gtcggctggg
    43321 acctcgaagg aaatgtagcc ctcacgtcgt tcaccggcga tcaaggctcc ggcgaggctg
    43381 agctgcccgc cgctcgcaga gtaggggttg aactgctcga ggcggcgtcc agccgtggtc
    43441 aacacctcga acgtgcccgg tacatagcca tttccctgcc tgcatgcgat gacgacatcc
    43501 accgtccagc gcccatcgag cgtccgagga ttggacacgg tgtactcggc caactgcgtc
    43561 ttgtcggaca gattcgcccc accccatatc ttcagcgtcc cgcccaaagg actcgtcgga
    43621 ccggactcca aaccggcgct cggcgccgct accggcgcgc tcgtcgcgga ggacgtactg
    43681 gtcgtgtcag aggatccgca gccagctgtc acgatcacca gcacggcaag taccgctgta
    43741 gcgacatcct gctcatccag acaattattc gcctcagcta taaattttgg aaccatcgat
    43801 cgtgggccga cccgaacgcc gaacagagcc cgacctgggt cgcagccgcg ttcgggtctc
    43861 ccgcgcgctt ctctaccgct acctcaccga gaccaataca gcctgacctt cagaccggtc
    43921 gtccgtcgtc gacgtcgcac gccacgcgag aacgggcacg gaagtaccag gccaaggcac
    43981 cgaccaccgg caccaaccac accaccgcca accacgcgac gcgacgtcca gcagtattcg
    44041 ccacggacaa gatcgagaca gtcgctatcg ggaccgagac gaaccagacg atcaggaaca
    44101 accccagcgc aacaagttcc accagaaaca tgccgaaacc gggcatgcag tccacccccg
    44161 cctcagtgca gtcgcttatc cctgctccag cccacagcct ggtcgtcact tcgaaatcgt
    44221 agagtgtggc ccgcgccctc ccgcgctggc gcatcgctgt ggatttggag tacaccccag
    44281 ctcgacaccg gtggcgggtt tgctgcgggc cgacaacaga gccaggcgtt ccccaacggc
    44341 caaggcgaca agaattcgac ggcgacgggg ccccgctcct ggccgccggt aaggcgccca
    44401 aaccggaggt agccggtcgg acatgcctca ggtcgacatc gtcgaggggt tttgcgccgg
    44461 gtcgtggtgt cggtctcccg tatgacgttg ttgtgcggcg tttctcggtt aggttgtggg
    44521 tgttctggct ggtggtcggc cgggtgtcat gtggggagac ggttatgagt tcgggatcgg
    44581 ggtcgttatg gccggtggcg gtgccgatcg cggtatcggt ggtggtgaac gtcgtggtgg
    44641 cgatagtggt gaacctcgcc accgggggcg ggccctggtg gatgtgggtg ctgatcgcgg
    44701 tgttgaccgt ggtcgggatc gcgaccgcga tctggcagta ccggaagcag cagtcgtcca
    44761 cgcccctggc cgagccagca cgttcagtcg aagcatcggg tgctcgcagt gtggcggtgg
    44821 gcggtaacgc gggttggatc agcaccggcg acaactcgac cgcaccccag acagttccga
    44881 caccaccacc atccacggct tcgcctgcac cgggatcggt gacagccagc ggggagcgtt
    44941 cggcggcggt cgggggagac gccggcggcg tcaccaccgg cgaccaatag tgaccgggcc
    45001 tcgaatatgc ctgcccccga cggtcggaag ccctccggga ctgtggtcgg tggcgtgcac
    45061 gcggaaggtg cgcgctcggt cgcagtcagc ggagacgctc gcctggttca gaccggagac
    45121 aacgccactg cccggatagt tgagctcccg gcggaggcgt accgccccat ctccgaggtc
    45181 gacgccccac ctggcatcga caacctgccc atccggccag cgaacttcgt cggccgcacc
    45241 accgaactgg acaagctcga caccatgctc gcgagtgcgg ggcaggtggt ggtgcaggcc
    45301 gtgcacgggc tcggtgggat cggcaaaacc accctggtcg cacactgggc cgccacccgc
    45361 acccacggtt gctccccgat cctttggctc accgccgaca cccctgccga gatcacccaa
    45421 ggtctcgcgg gtttcgcggc cgcactgcag ccagccttat ccacggtgct ggaggtcgaa
    45481 caactcgccg agcgagggct gcagtggctg gccacccaca ccggatggct actcgtcctc
    45541 gacaacgtcg aggacgtcac cgacatcaac cccgtcctgg cccgcgccgg gacaggtggg
    45601 cggatcgtgg tcaccagccg ccgcgcgacc ggctggccga cgggcaccgc agtcatccgt
    45661 ttggacgtgc tcgaccccac cgagtccctg gaactactca ccggtctgct caccgccagc
    45721 ggtcctcgcg acgaggacgg ggctgtcgag ttgtgcgccg agctggggca tctgccgctg
    45781 gcgatcgaac aagccggcgc ctatttggcg cagaacccgt tcctcacccc acgggcctac
    45841 ctgcagacgc tcgacaccta ccccgccgaa acactcgggc acggcggcgt ggacaccgat
    45901 gccgaacgca ccatcgccca gatctggcgg gtcaccctcg accgcatcac caccatccag
    45961 ccgatggcgg cagaactgct gcgtgtcctg gcctggtatg cccccgacgc catcccgctt
    46021 tccatgtgcc agagcatcac ggacccaccc acactcaata ccgccctcgg ggtcctcacc
    46081 gcctacaaca tgatcacccc cgacctgacc accaacactg tgtcaatcca ccgcctcgta
    46141 caggctgtag cgtgcacgcc tgatcccacc gaccctcacc gtgacccgac cgcgattgaa
    46201 caagcccgag accaagccgc agacgtcttg cttgcctgcc tccctgatca tcaagatccg
    46261 ggcacctggc tgacgtggcg ggctctattg acccacgtgg acaccttcac gggaaaggtc
    46321 caaagcacct ctgttaccga cgccaaggcg cagatcctca cgcgcgccgg gcaattcgtg
    46381 ctcgatcagg gtatgcacac aagcgcgcta atctactatc gccaagcttt gaccgaatac
    46441 gagcgggtgc taggtgccga gcacccccac actctggcct cccgtggcaa cctcgccggc
    46501 gcctaccagt cggtgggacg gctggacgag gcaatcccgc tctacgaaca ggcccgcacc
    46561 ggtcaggagc ggattctcgg acccgaccac cccgagacca tggccgcgcg caacaacctc
    46621 gcctacgcct accagtcggt gggacggctg gacgaggcaa tcccgctcta cgaacaggtc
    46681 ctcaccgact ccgaacgcat actgggcacc gagcaccccg acaccctgaa atcccgtagc
    46741 aacctcgcct acgcctacca gtcggtggga cgactggacg aggcaatccc gctctacgaa
    46801 caggtcctca ccgactccga acgcatactg ggcaccgagc accccgacac cctgaaatcc
    46861 cgtagcaacc tcgcctacgc ctaccgatcg gtgggacggc tggacgaggc aatcccgctc
    46921 tacgaacagg tcctcaccga ctccgaacgc atactgggca ccgagcaccc caataccttg
    46981 accttccgta gcaacctcgc tttcgcttat gagtcaacgg gacgactgga ggcggcaatc
    47041 cctctgctag agcagacact ggcggatcgg gagcgcatat tgggcgacga gcacccccac
    47101 accttgatct cccgtggcaa cctcgctggc gcctatcagt cggcgggacg gctggacgag
    47161 gcaatcccgc tctaccagca gaccctcacc gatcgggaga gaatcctggg cgtcaagcac
    47221 cccgacacct tgatctcccg caacaacctt gcctacatct acaagtcggc gggacggctg
    47281 gacgaggcaa tcccgctcta ccagcagacc ctcaccgatc gggagcgcat attgggcgac
    47341 gagcaccccc acaccttgat ctcccgcaac aaccttgccg gcgcctatca gtcggcggga
    47401 cgactggacg aggcaatccc gctctaccag cagaccctca ccgatcggga gagaatcctg
    47461 ggcgtcaagc accccgacac cttgatctcc tacaacaacc ttgccggcgc ctaccagttg
    47521 ctgggacgac tggacgaggc aatcccgctc tacgaacgaa ccctcaccat ctccaaggag
    47581 cttcttgggg cggagcaccc caccacccgt ttgattcgtg gaaatctcgc ggctgcgcgg
    47641 gaggcgactc actgacctga cgctaggcgt atcacgttcg tcgcgacgtc aatttggggt
    47701 agagcccaac tagacacccc tgaccgagac gtcttgcgtc cgaatagagt ccgaaaccga
    47761 atttcttgac actcgtccga tgagttctta gattccaacc tgacaaccag ccgcagtcgc
    47821 ggccggatcc ggacaagcag ggggagggcg cggtgcgcgt cggctacatc agggtctcga
    47881 ccgtcgacca gaacaccgac cgacaactcg acggcatcga cgtcgagcgc gtcttcaccg
    47941 acaaggtcac cggcaagaac gccaaacggc ccgccctcca ggagatgctc gccttcgtcc
    48001 gcgacggcga caccgtgctc gtgcactcca tggaccgcct cgcccgcaac ctcgacgacc
    48061 tccgacgcct cgtccgacag ctcaccggca aaggcgtacg cgtcgagttc gtcaaagagg
    48121 cactgacctt caccggcgag gactccccca tggccaccct gatgctgtcg gtcatgggcg
    48181 ccttcgccga attcgaacgc gccctgatcc tggaacgcca gcgcgaaggc atcgccacgg
    48241 cgaaggcccg cggcgcctac aagggccgaa agcccgcact caccgccgac caggtgacgg
    48301 cgctgcgcga gcgcgcggca gccggcgagc cgaaatccgc cctcgcgaga gagttcggag
    48361 tcagccgcga aaccgtctac gcctaccttc gcgccactgc ctgacaccgg cctacgtggc
    48421 acatcgacat cttcggtcgt ggtcgctatt gttccggcga atctgcggca ggaggtggtc
    48481 gtgaagtacg aagacaccgg atcggcgctg gaggagtact ccaacgagcg cgacgccgac
    48541 ggctactggg agccacaact actcgaggag cccggccgcg tccacgcctt ctggcgacgc
    48601 cctccagcgc tcgacttcat ccagagttgg gacgggttgt ccgcagtctg ccgccatccc
    48661 gttcgtgtgc tgctgccgct gccgttcgac agcaacggcg cagacgcatg tcctgagtgc
    48721 gctcgaatac tcgctgcgcg ggctgccgac cctgagggct gggaggaacg ccgtcgtgag
    48781 caccagcgcc gccggatgag agaagaggac tacgaggagc tcaaggtgcg gcgtgtcctc
    48841 caacttcgtg acgagaaccc cgacctcact ccagaggatt tcgaccacct gagtttcgaa
    48901 gagctcttcg atctcgtcca cagctccgac ccgtttgacg acgatgacct ctccgacgac
    48961 gtagggccgc tgggcggcgc ctggtagatc ccgccatcgc atggggacag ctccaccact
    49021 gttcgatacg gtgtgccgcc atggtgcatc tccgctactt caccgactgc gacgaagcga
    49081 tccgggcacg agtcctcgaa tgggtgcgca ccgacgagtt catctcccgg atcgggatgc
    49141 ccgaccacga actcaagcac gtccccggcg ccgaaacgcg cactggccgg gtccacaact
    49201 gggtcatctt cgtcgacgag caacccgtgg ggttgatatc ggcacagatc caggaccagc
    49261 cacgcagcca cagcccgctt aaccgagaac ttgatgatcc tgccgactac ccgttgctcg
    49321 ggacggtgac ctacatcgac cgacagcacc gcagccgcgg atacgcatcg gcggcgaaac
    49381 atgccatcag cgaacacgtc gccgcagccg gagttcaaac cttcggttgc attgtcgccg
    49441 gcgacaaccc gcagagcctg agatcgatca gtagagctgg atacgagcgt gtccacaccg
    49501 agaaggtcga cggaaagccg gacaagctct acttccgacg gcggcggtaa ccacattcgc
    49561 taccgccaac tccgggcctg ccgcttcgtc agtgacccct gagggccgtt gcacgggatg
    49621 tgccgtttcc tcccagctag gccttgcggg cgcgacgacg agaggtctgc cccgcctccg
    49681 agactccagc tacccaagca cccgtttttc cactcgggac acggagctgc ttgtacttag
    49741 tggaacttcc ccgcatcttc gtcggtttgg agctgcgcgg agatggagat tctggttcct
    49801 tggcgtctgc acccctacgg ccgggccgcc ggtcccacct gctcgcgaat gccttgatcg
    49861 cacgagcatc ccaaaccggc cccgtcctca gccgatacag aggctcagga aacccgacag
    49921 tgccctgaag ctggtgcaca cgctgacgcg agacctccaa ctcgtccgca acctccgccg
    49981 cagataccaa ctgcggcagg ttgggcgcgt ccgcctcggc gaagtgggtc tcctcatcga
    50041 ccacttcaac cgccacagga gacaggccgg tgacaggccg aacaagcgca gcagcgagtc
    50101 cggccgcctc caccggatcc tctgcttcga tatagacgct caacatgacc gcaacaccgg
    50161 ggagccgtcc cgccgtggca tcgacatccg cgagctcttc ttcccacatc gtgagctctt
    50221 ctcggtcgat ctcagccgag ctatagcgca aggtcactac ccagatcact gatctcacgc
    50281 tccttccgtc gatgccttgc ggcgtacagc acgctgctct ttcttgctgg ggggcggaac
    50341 ctgaaggccg gcagccttca atttcacttt caggtcagcc atccgacggc gaggattgct
    50401 cggtgtagcc ggatactgcg cgatgtactc cccgtccgga tcaaagaact gcgtatatcc
    50461 cctcgtggtg tccactaccc gccagccctg agagcgcgcc caagccgcaa ggtcgctgat
    50521 gtcactgttc aagcggtttc tgtcccctcc agactcgcct aaatattgcg atacgtcaag
    50581 ctttgaagac tatacaacgt caagatttgc atcagcaaca atcctgctga tcggtccgaa
    50641 ctctgggcca gatactcgct gacatgcccc tgctccagcg ccgcaaggga ggctctcccg
    50701 aggcgctcgg taatcggttc ggatcgctct acttcagtca gtaggccatg aatacctctc
    50761 gtcgagggcc agcatcaggc tcgtggccac catgaccgcc aggactgcgt tctccggggt
    50821 gaagtgatcg gggtgcgcct ggtgcgcgac gacgtggcgc gaaaggggca ccggcctcgg
    50881 cttgccggac ttcggattcc agtccgtcag caggttcacg accggcgcaa caccgagcac
    50941 gtaccgcaaa cgatcctcct ggaatgccac ttccaggttg gtcaccctgc actggtgctt
    51001 cgccttgccg gatttgttgt cgatgtgcgc ttcgatctgt gtgttgcaca cgcttacgcc
    51061 gagcgcttgc gccgcttcgt ggtgcccgtc ggcgagggca gcgatggcct tcaggagcag
    51121 tggccgctgc tcggcgacca gtgggtcgag ctgggagtcc accgctgctg cacagtcgtc
    51181 caagatctcg gatgttcggg ccaccaggat ggcatcgcgt ccggcacgat ccggggcttg
    51241 cgcaagttcg gagacgatat ccgcccgcgg aatgtacacg atcgggatgc cctcgttctc
    51301 gacgatctgc tgcgcgagat ccaagtccag agcctcctca cccataggcc agttggccgg
    51361 gtatcgcgcg aagagcgagt cgatgagctc ctggactccc ggcggaatga gatcgcccgg
    51421 cgccgggatg tggtggcgaa gcattcgctg cacatcgacc gccggaagct ggggcatcgg
    51481 ccgggcgaca tcgaaggtcg gaatatccag cctaggcaga tggacgccgg ccaggattcc
    51541 gtcgaagacc gccgagcgga gtgagtgggt gacatcgatg gcggcttcca tgtgctgaaa
    51601 caggccagga tccagcctta tcggctcaag tcgcggccat gggatgtccg tcggcaagct
    51661 cgactgcagg gaccccatga ggtcgatcgt cggccagtgc ggcgcggtgg cccggaaagc
    51721 gcgcgcggcg atctctgcca gttcacgcct ctgtgcatcc gtcatcttcg ggaaggtcac
    51781 ggatcgagat tacgggcggc tacaggtagc tcgcctggtc atttccggct ggctccgagg
    51841 gcggacaagc ccctaggaac ccgtacccat cccgagcagc agcccgccgg gacctgggcg
    51901 gctgccccac ctaacggtgg gcgagcggcg gagtaggaga acggccgcgg caaccaccaa
    51961 gactgacgcg gggcatcggt tcggaggttc gttcctcctt cgccgagttg cccaccaacc
    52021 aggaatcgaa cggtccgcgc cgagagtcgt tgtgccagct cgctcgaccc gttcgggccc
    52081 tatcttgccc gataaccata gttatcaggc aacagtctcc gatggcatcg cgcggcgccc
    52141 ggtgtcccaa atccgccccg cagacagccg gtggcgacgc cggcgcggtg cagggcgtcg
    52201 atctggtggt cgcggttctg ctcggcggtg gagacccgcc cgtatccgat caacaggagg
    52261 aagaagcatg ggagtccggg cgccggacgc ggaaaggcca atgccgagcg actcgggcgg
    52321 gagaagttcg cgcggaggcg caccgctgcc ggaccgccga gacgacgcag cctgaacccc
    52381 ttcctgcggc gccccaccac ccgcacgcgc cgtcacctcg tcggcatcac cccactcggc
    52441 aatcaccaca ccggcatcgt cggaccggag cacagtccgc ccctggcgtg gtcgcggtcg
    52501 gctcgcagtt agcagcgtgt ccattgttgt cagacgtaac tgctatgaca gggcagtcgg
    52561 gaacctgtgt ggagcaaagg agtagaaggt ggcggttttg ttcactcatc ggcgtatgtc
    52621 gcccgggggg accagaaacg agcacatcac ccacgtgaag tggcgccaag agcacgatgg
    52681 ggagacaggt ttcatgacca agccgcaagc ggtggagtgg ctggacgatg gcaacagagc
    52741 cttcgtacaa ggcccgcact cccgcgtgga agtcggagtg gtacgcgaag ccggaaaaga
    52801 gccgtacctg aggacccatg ccaacggtaa gtgggacgac aacctcttgt ctctcccgtt
    52861 gttctaactc acggcgatgg tgagcacggg ctcgggcacg acgtggtaac tgtcgacgac
    52921 gaagccgacc cccacctggt gagactgcat acggccagcc ttcacgacga aaaccgcccc
    52981 gcttccgaga cggaagcggg gcggttgcgt gtggggccag gctacatgcg gatccccagg
    53041 accgaggcca tgcaccactt gaggatgccg ccgccgaccg ggcccaggcg cgggatccat
    53101 gccttggcgg ccgcaaccgc gccgccgggg ccgccgaaca tgaagccggc gacgatcggg
    53161 gcggcgacga agccgaagcc gccgaggcat ccggcgaaca tggccgtgtc ggccgcccag
    53221 ttccgcttca ccggagtcac ttccggccgc aggttggcaa gcgccggggc ggcgacggtc
    53281 tccgcggccg cctcctgcgt ggcgccgagc ggttcgccga ccacctgcga caccgccgga
    53341 gcggtggggg tggtcggtgc ggcgatggcg gcggtggtgc cgctgagcag gatcgccgcc
    53401 gtgctcacga cggtgatgct ggccttacgg atggcgctgg tcattgctgg ctaccttcct
    53461 tctggcggag gtcgaggtgt ggttccgccg tcgttccggt cgccggtgcg cgaccgtgaa
    53521 ctacaacata tttgtattac aaatatacgt caagtgtgtc tatcaagatg ctttgctgtt
    53581 gatgagacaa gcggctcggg tgtacatatt caggcaggtt gtaggccata atggacgtat
    53641 gaccacttgc gagtgatcgc ggcgactcga cgaagggatg acgccatgcg cggcgaaggg
    53701 aagagcaaac cggccgggaa gaccaagacc ttgcaggtcc gcgtcgacga ggagacagcg
    53761 cggcatttcg ctgcgatcgc gcgggcgcgg cggatgaccg agtcccagct gctgcgcgcg
    53821 acgatctcgg agatgctgcg cagttcggag agcaatgtcg atgtgctcaa ggccgagctg
    53881 cgggcggagt tcgaggcggc cgaggccgcg ctcgatgaat tgagctcgga gtccaggcag
    53941 gccgccgtcg cggcggggtc ccgtcagcgg tcgactcgct aggagcctcg ccacggggga
    54001 cacggagacg atcgtgaggg cgggatactc acgatcaggg gcagctcttg agcacataga
    54061 ccggcatggc cgtcaccagg accgggctgt tgccgtcccg gaccagaacg ttgatcgggc
    54121 gcagattgta gccgcagaag aacagggcgg gatcggagct gacggcgagc tcgaactggt
    54181 agacgatctc gccttcttcg tccatcgcga cgggggtgta ggtcgtggcc agctgcaggg
    54241 cgccgatgcc gggggcggcg ttggcgtcgt tgacgagcat cgtcgtgccg ggcgtgatcg
    54301 tcagtcccgc atcgagcccc aacgccagct cgatgttctg atcggtgccc agggcgggat
    54361 cacgccagcc caagtggatc tcggctctca gccggtgatc gaccccggtc acgaacgcgt
    54421 cgtcgggaag gtctccggcg accgactgca tgcggggatg gggctgctgc tcgctttcgt
    54481 ggacgagcac acgggccacc acattcggca ccgccggccc gacataggtt tccgggaacc
    54541 ccggtgggag cgcgatctcg gtcgcggtga cgatgtccgg gttctcggtc gggccgtgcg
    54601 aacttcccgc aagatagcca gcgacaatcc ccgcgatcgc cagaccggcg gtgaaggcga
    54661 gccttgtcgg caggctcagg ccgttgatgc gccgctcgag cagggccacc ttgttcttga
    54721 tccggcccgg cggaaggatg ctctgcaggg agaacgggtc cggcacagac gcttcgggaa
    54781 tcgtgaaacg gcgcaggaca tcgaccagcg cgggcaccgc ggtctgggcg ctgtagtcgt
    54841 cgtggggaat cacttccgcc aggcagtgga agtcccgggt cgcggccggg tgagtggtcg
    54901 gctccatcgt cgccgagttc ggccccgcgg ccgtttccac gaccagggtg gccaagatca
    54961 gcgccgcgcc ctcgatgtag gtcaatccca gagcgaccaa tcggggatcc cgcagctcca
    55021 gcgccgggtc caagacgatc tcattgcctc ggcgaagcat catgaacgcc acgtgcccgc
    55081 ccagcaggag aggccaatcc ggcaggttcc cgcccgactc cttctccatc ccggcattca
    55141 agcgtgcggt ctccatcgcg gtgctcaaca ccgccacatc gatggattca tgagtcactg
    55201 tgtccgggag actcactatc tcaaggactt tcagtgccag cgtcttcagc ttggcagtgt
    55261 tcatctcgac caccgcgcca tagtagtggc gggtcacatg cctgtcggcg gtcttcgtaa
    55321 cgcccgaccc ctccccagca gatcattcat gcaataccgt aatacattca tcaatgcaac
    55381 ggagagtgca gacatgtccg agagccgtcc gagaacaaag atcctgaccg tcttaggtac
    55441 cgtcgccgcg gccgccctct gcacagcttt tctcggctgc cccaccgcgg ccgccgccga
    55501 cgtgccactg gacttgcacg cccaatgcgc aacccaatac cccgaaaccc cccacgccta
    55561 cgccggccac cccatcctga tcgcacccgg caacgcctac tcctggcgct gcgaacaacc
    55621 ctccaaactg cccggcggcg gcctgctctc cagccttttc ctcgacaccg acgccttctg
    55681 cgtcaacaac cgtctaggcc acgcgctcgc cctcgacacc gacaaccccc acagctgggt
    55741 ctgccgccaa taaccggcac accgccgcca ccatctccag cgcaggcaat cggactcctg
    55801 atccgacgcc cggaggctcc aacgcaggcc cggcccggta ttcgacgccg accgaacgca
    55861 tcccaggtct cagcctagag gcttgggact cagctcagca ggccgctcaa caggtcgatg
    55921 agacgcacaa ccgtctcgat gcgctcgatg aaggtgcctg tggtgatcac aacgcgtccc
    55981 gctcggcgca gcctctgcct ccacctgcca tgagggttcg ccgggctggc gtcagaaggc
    56041 tcgggatcac cggaaggtgc tggtgttcgg tcgttatcgg acatgagcgg gcaccgtaga
    56101 caggtggggt gcagcgaccg atccgacgag aaaagtgaca gttcgcgcag tgccgggaca
    56161 tccgggctcc tcagcagaag gatctcgccc ggccagaggc cagcagcaac agcgccacca
    56221 acaagagcct gcctaccgag ccgctacacc cctgtgcggt ccgatacagg atttatcccc
    56281 gcgctccagc gaccccgacc atccgaacta ctcgccttgt aagcgaaagg gcgtcgttgg
    56341 tccggtcgaa ccgggtgccg aaaacgtctg caacactcgt aatgaaaagg tcggcagttc
    56401 gcctctacta ccggtctcgg gccaggctcc tctgtggcag agtgcctggc cggaggccag
    56461 tgacaggtgt acgcgaacac gataaccgcc gcgtagtaat cgaagtcttt gccacctccg
    56521 acacgcggag gcgtgccccg gagcggggac ggctcggtca gaaggtcggg aacatggctc
    56581 cctgaaccca gacgaccgcg gcaaccgcgg tcggcggcag gctgaggacg aactggttgc
    56641 cctcgttctg ggacaggacg atcctgagcc agccgttgtc ctgcgggacc gcggcgtcga
    56701 catcgacgtg gcagatcgtt gggcggttgc tgtcccactg gagcgggagc gtgtgcggca
    56761 aggacgcggc ggcttcgggg gtcaggtaga cgcgttcgtt cgacatgaag ccacacgata
    56821 ggagcgcggg ccgaacacgc cccggcatcc cagggcgtgt ccatgagcag tgccgtggat
    56881 ggtcgcaagc ccggtagctg gttgaatgtc ttcgccacac ctgcctgccc ttcggccgcc
    56941 ctggctcggc gcaggtgtgg tgttcggata ccggcagcgt cgccgggcgc ggtcaagcac
    57001 ccggcccatc cggcgacgct gcaccgatcg acatttcttc cgatcggaga cagcccccac
    57061 cggctgacct cgcccagcgg gcgtggagat ccgcggtgtc ggtcaccttc cgcccgaccg
    57121 ttgtgcagct gtcgctgcgt tcaggcaggc cctgcagcac agggatcgtc ggcggcggca
    57181 ccggcctcgc gctcagggcc gcatcaggct cccccggcca gaggacatcc cgcccgctca
    57241 gtcctgagcc tcggccttca tcgcgggcga gtcaccggcc ggggaccgca caagcccgtg
    57301 ctgcctgtgc tgctgccact gcccggctcc acggtgcagg cgagtatgtc cttgtagatc
    57361 ccgggggtgc cgggatctgc ggtgatgacg tgcggggttg cagcacccgg ggcgggggtt
    57421 tgcccttcgg caccggcgga ggcggtggtc atgatggtcg ccgcagcgat ggccgcgagg
    57481 gcggcgacgg tgcgattgcg tgctgtcgga ttgttgaaca tggcaggtgc gctccgtttc
    57541 ggcgtgaaga gttccaccaa ggtagcgact atgaagtgtt tcagtttcga aaaggatgcc
    57601 cccggttctg ggggccggat caccctgtac cgggcggcgc cgcgagccca ggtcgagtcc
    57661 gcgttcccgc acgcgggccc gcttttgacc cggcggtgca atctcgatct gatcgccgag
    57721 cactacgacg acctgctccg gctggccggg tcgctgaagt tcgggcacgc caccgcgtcg
    57781 ctgctggtcg gcaagctgtc ggcgtcgggc cggcagaacg ccctcgcggc ggcgctcaag
    57841 gagtacgggg cgctgcggcg cacgatctac gccgcccggt atctgtccga cccgggctat
    57901 cgacgcaaga tctcccgcca gctcaacaag ggcgaatccc tgcacgcgct ccgccgcgac
    57961 ctgctctacg cgcatgaagg aaccgtgcgc gcgaggcacc tggagggaca gaccgaacag
    58021 gcatggtgcc tcacgttggc gaccaacgcc gtcatcgcct ggaccacaga gtattacggg
    58081 ctggcggccg aacagatgcg gcgggccggg cggcgcatcg acgacgaggt gctgacgcac
    58141 atctccccgg cccacagcga gaacatcaac ttcttcggcg ccatcgaggt cgacatcgac
    58201 gccgaactcg cccagctcgg ccccaccggg taccggccgc tgcgcgtgcg cgacaccctg
    58261 ttctgacccg ggggaaaccg agagacaccc agccgagagg atccggcggc tgcgcggcct
    58321 tgaccctgta ctcgggtaca gggttgagaa tgtgtgcatg cggaccggtg agctggcagc
    58381 cagggcgggg atcaacgcgc agaccctgcg ctattacgag cgccgtggtc tgctcgcgcg
    58441 accggcgcgg tccccggcag gctaccgcag ctaccccgac gaggcggtcg cggtggtcag
    58501 gttcgtcaaa cgatcccagg agctggggtt caccctcgac gaggtcgccg aactgctgcg
    58561 gctggccgac ggcggccccg acgactgcga caccgcccgc gcactggccg agtcgagggt
    58621 tgccgagctg gaacggcgta tcgcggacct gcagcgcatg cgcggctcgc tggcagagtt
    58681 gatcgcgacg tgcgagctgc cccgcaaccg ccggtcctgt ccgatcctga cctcgctgca
    58741 cgaaggagac cacccgtgaa actggaaatc ctccaggtcc ccgactgccc caacgtggcg
    58801 gtactcgaac agcgcatccg gcaggcgacc gccggccagc cggtgcagct cgagatcacc
    58861 cgccgtgtga ttgacgatcc cggccgggcc gccaccgcgg gtatgaccgg atcacccacc
    58921 ctgctggtcg acggctgcga cccgttcgca acgccgggcc aggtcccgag cctgtcgtgc
    58981 cgcctctacc cctccgacac cgggcggctc gacggcgcac cctcggtcgc cgcgttgcgc
    59041 gccgcgttgc ggctcgtccc ggacggcacc gcggcactcg gggacgacac cgcatcctca
    59101 tgctgcaccc cacccgccgc cgaatctccg gcaacagtgc tccgcgcctg gcgcgccgcc
    59161 gcgcaaccgg cagaccccac cgaaaaggct gtgcaccagg cgatcctgcg tgccttcgcc
    59221 accgatgggc aggcgccgac cggtgacgat ctgaccgaga tggccgccgg gcccgacgtg
    59281 ccggtcgagc agctactgcg ccgcctgcac gacgccgaca tcgtccgcct cgacgcgacc
    59341 gggagcatcg cggcggcgta tccattctcg gccacaccga cgccgcatcg agtccggatc
    59401 gctggtggag ccacggtttc ggccatgtgc gcggtcgacg cgctcggtat ggccgcgatg
    59461 ctcgacacgc cggtgacgat cacctccgcc gacccggtga ccgccgaccc gatcacggtc
    59521 accgttgacg gcgggcacgt caccgccgac ccggccacca cggtcgtctt cgtcggcgca
    59581 caggccggcc caggcccgtc cgccgacacc tgctgccact acctcaactt cttcaccgac
    59641 cgcgccagcg cccagggctg ggcagacacc caccccggca tcggcggcgt tatcgtcgaa
    59701 ctccccgacg cccaccacct cggcaccacc attttcgggc acctgctgca cagctgaccg
    59761 cacccgggcg tgccacggat aacaccctgt tatctgtggc accatgaaac ccggcctgcg
    59821 acgactccgc tccggcggtg cgcgaagcgg ccctgttatc tgtggcaagc aggccaggga
    59881 ggtcacaatg ttgtcgtccg ggatcaccgt ccgcgccgcc ggcgacggct tcctcgactc
    59941 gatccgctcc ccgaacaccc gccgctccta cgccatcgcc gtcgataaga ccaccgccag
    60001 gctcggcgag gcccggccgc tggccaatgt cgccgacgac gagatcggcg aaaccctgga
    60061 aactttgtgg ggcgaggcgg cggtcaacac ctggaacgcc cgccgcgccg cggtcgcgtc
    60121 ttggctggcg tggtgccgcg agcacggaca cctcgccccg gcggtccccg cgtgggtgaa
    60181 acgctccacc ccgccggact cggccacccc ggtgcgctcg cgcaccgcga tcgaccggct
    60241 catcacccgc cgcgacatcg acctgcggga gaagacgctg tggcggatgc tctacgaaac
    60301 ctgcgcccgc accgaggaac tgctccaggt caacatcgaa gacctcgacc tggccgggcg
    60361 gtgctgcccg gtgaagtcca agggcgccaa gccccgcacc cgccgccgcg gtgccaccca
    60421 ccacgagtac gcgcacgagc tcgtgtactg ggacgcgggc accgcccggc ttctgccacg
    60481 cctcaccaag ggccgcaccc gcggaccgct gttcgtcacc caccgccgac cgggccccgg
    60541 caaggccgcc gccgaccggg acatctgccc cgacaccggc ctggccaggt tgtcctacgg
    60601 ccaggcccgc gccgtgctgg atgccgccac agcgacgaat ggccccggca ccggctggga
    60661 cctgcacgaa ctccggcatt ctggcctgac gcatctcggc gaggccggag ccagcctgct
    60721 cgagctaatg gccaagtctc gccaccgcaa acccgacaac ctgcgccgct acttcaaacc
    60781 ctcaccggca gccatgcgcg gaatcaccag cctcctcggt cccgaccgca gccaccgata
    60841 gcggccgcca acaacggctc gtccgtctac ccgctgacca ggcgctacgc gaacttcgtt
    60901 gttttttgcg ccattactgc cggaaccccg acccagtcca tggcagccgt cggctcctcg
    60961 gccgacaacg ctctggccga gtcgttcaac gccaccatca agcgcgaggt cctccaagac
    61021 gccgcctgct ggcccgacga ggccacctgc cgccgcgagg tcttccgctg gctcgtccgc
    61081 tacaacaccc gccgccgtca ctcctggtgc ggctacctgt ccccgtccac ctacgaggcc
    61141 cgccgggccg ctacgctgcc aaccgctgcg taatcaccca ccgtgtccaa gatccggggg
    61201 tagggcccag ctgaaggttc gcggtgaccg gacaacaggc agactccttc ctcgtgggga
    61261 aggaaccatc agccccggac cggggcggtt cagacggccc ataggtcggt cgtctcggcg
    61321 gagatccatc gcctgcggac tcatcatagc gttgcggtgc ggttcgctcc ctttcccgct
    61381 gcgtccgtga cggcgcgcct gtgacatcac ctttcgtggg agatctgtcc tgcgcgaggt
    61441 tgtgcagcag cttgctcgac cttgggccaa ccatccatgg cgtgatccag gcatcggcga
    61501 gcaagagtgg accgcgcgtc ggtggccagt ctcggcgagt ccggtcgggc aaacaactcg
    61561 gtcgccgatc agcagcaggt cagggcgctg gtggtaagcg aagaccggag atgcgttcga
    61621 tgtcgatgcc gatgacctgg tcgtggggtg tggtgaccca ggggcgtcgg gggatgtcgg
    61681 cggcggcgac gagttcgtcg atgtcggaga tggctgtggc gggtccggtg atcagcacgg
    61741 tccatccgct gtgggagtcg ggatcgatgc ggtccacttg taccgccacg gtctggccgg
    61801 tgaccgcgct gccgtgggcg cctggcacgg tccacaccac gatgcggtca ccggcgacgg
    61861 tgaagttgat cggccggatc gccgggaccc cgtcctcgag gtaggcgatg cgggcgaccg
    61921 ggaccgaccg cagcaggacc cggcactcgg tgtcgctgat tgtcgacagc tttttcatcg
    61981 cttgagttcc tttcggcggg aaggttgtct gcccggatcg gtcctgttcg cggccggtgt
    62041 ccggtcagtg ggagcggtgc agggagtcga tggctgctcg cagtctggtc gtggcgtcgg
    62101 cggcgatggg tgccagcgcg ggttggttgg tgagctgcac catcagttgg gggttcatcg
    62161 cctcgatgat gatgtcggtg tcgttgtcgg gtgagcggcg cacgacgacg ttgcagggca
    62221 gcagcagtcc gatctggcgg tcgatctcga ccgcgcggtg ggccaggggc gggttgcagg
    62281 cgcccaggat gcggtagtcc tccatgtcgt ggccgagttt ggctttcagg gtggcctgca
    62341 tgtcgatctc ggtgagcacg ccgaagccct gttcggccag cgcgcgcttg gcggcgtcga
    62401 cggcgtcgtc gaagctggcg gtcacggtgg tggacagtcc caggtcggtt ccggtgtcgg
    62461 tcatgtgcgg gctcgctttc tcggttcggt gacgctgagg ggtggccggt ggtcaggtac
    62521 gcgcgaccgt gcaggtcgcg gtgccggcgg gcaggccgag gcgggccatg agcaggctgg
    62581 ccgggcacca gccgagcgcg ctgtagagca gcaggttggc accgaccagg gcggtcagta
    62641 tcagccacca cggtgagagg gtcgcggcca gggcggcgct gagcaggatc agcgttcccg
    62701 ccagcaacgg caccactcgg tcgatggtcc aggtgcgcgg tcgcgtgggc agcgtcatga
    62761 cgtgttatct ccttgtcctc ggtcccggtc caggaccgag gcgggtaggg gtcaggccag
    62821 ggtgaggaac agtttttcca gttcctcgac cgtcatcggg tcggcgcctt cgccgggttg
    62881 tccggccagg cattcgcgca gcccggtggc gacgatcttg aatccggccc ggtccagggc
    62941 gcgtgagacc gccgcgagct gggtgacgac gtctttgcag tcgcgtccct gctcgatcat
    63001 cgcgatcacg cccgcgagct gtccgtgtgc gcggcgcagc cggttcagta ccggtgcgat
    63061 gctgttctcg tcgccgacca tggtggtgtc tccgttctcg tgccgtaccc ctcccaagat
    63121 acccgatggg gtattccggg aggggttcgc gcacgtcagt ggtgagcgaa gctgatggtg
    63181 ggcagcaccc gggtcagcca cgccgggctc caccaggcag cgtgcccggt caggcgcagc
    63241 atgaccggca acagcaccag ccgcaccagg atcgcgtcga gcaggaccgc gacaccgagg
    63301 atgatgccca tctccttggg aggcagtggg tcggccaggg cgaaggtgaa gaacaccgcc
    63361 accatgaccg ccgcggcggc gaagatgacc cgccccgaat gcgcgagccc gtcgacgtgc
    63421 gcggcgtggg ggtcgccggt gcgttcgtag tgttctttgg cggtagccag cagaaacacc
    63481 gtgtagtcca tggcgatggc gaagatcatc gcgaagaaga acaccggccc ccacccgtcg
    63541 aggaacccct gtggagtgaa gccgagcagt tcggcgccgt gcccgtcctg gaagatcagt
    63601 ttggccaccc cgaacgcggc cgcggtcgag agcaggctga ccagggtgcc cagggccgcg
    63661 atgagcgggg cctgcaacgc gatcagcaac aacacgaacc cgagcaccaa gatgatgccc
    63721 accacgatcg gcagatagtc gtcgagggct tgttgcaggt cgaggttttc cgccgccgcg
    63781 cccccgacca ccgcgtcggc gggcaggtcg gcgcgcaact ggtccaggat ttcggccatc
    63841 tgcggtgcgg agggatcgac tgcgggcatg gcctgcatca tcaccagatc ggcgccgtcg
    63901 gcggcgggct ggggcggggt gagcatgacg atgccgtcgc tggcgcgcgc gatggtcgcg
    63961 gtggccgccg cgtcggcggt cggggtgatg atcgagagca tgcccggggc gcccgggccc
    64021 atctgctcgg cgatcagttc atagccttgg cgcaccggcg cgtcggtggg cacgacggcg
    64081 atcgagggca tcgcggtttt gagcccgaac accggtgcgg ccagcccgat caggatggcc
    64141 agtgccaccg cggcgaacgg ccacgggtgc ttgtgcagga tctggcccca ccgcgcgaag
    64201 accggcgagc ggtgctgctg gcggcgcgcg tagggcagcg cggcggcgtt gaccttggtg
    64261 ccgagcgcgc cgaggacggc gggcagcagg gtcagggtcg cggcgagtac gaacaccacc
    64321 gcgagcatga tcccgaccgc catggtccgc acggcgggag cgggcacgat cagcaccgcc
    64381 gacaagctca ccagcaccgt cagccctgag agcaggacgg ctttgcctgc ggtgtccatg
    64441 gtttcggcga ccgcggcgcg gggatcgccg gtgcgggcca gcgcgtcgcg gaagcgcgcg
    64501 accaggaaca gcgcgtagtc gatgcccagg gccagggcga acatcatggc gaagttcatc
    64561 gcccacaccg agatcggggt gatctggttc agcagcacca gtccacctgc ggaggccacc
    64621 aagcccgcga gggtcagcag cagcggcagc ccggccgcga ccagtgaccc gaacgccagg
    64681 accatgatcg ccagggtgac cggccacgac agcatctcgg cctggatcat cgcgtcgtgg
    64741 ttggcggcgt tgaagtcgct ccacagcgcc gaggccccgg tcggatacac ctcgatcccg
    64801 tcttcggaca gcgcggtcaa cgcggctttg tgctcgtcga cggctttgac catgtcatcg
    64861 gtggaggcat tggcgcccgc gatcacgatg ccggtgtgtc cgtcagggct gatcgtgaag
    64921 cccggttgcg gggcgatcac ctgcccgatc cgctcgtccc cggcgaagac cgccgtgacc
    64981 tgctcaacca cgcgtgccat cgccgggtcg ccgatcgtgg cggtgtcgga atggatcacc
    65041 acctgcaccg cggccgagga gttaccgccg aagtgctgct gagccagctc tctggcgcgc
    65101 accgattccg agccgttggc ctgccacccg gccccggcca gggaggtgaa cacactcggc
    65161 gcggcggcgc ccagcgcgac cagcaccagc agccatatcc cgatcactgc ccgggtgcgc
    65221 ccggccatga acgcgcccca ccggcccaga agccccggac tcgagtccgg gtgctggccg
    65281 ccagcggcgg tcccagcgag tctcgtctcg accatacagc cctccttaga tacccttggg
    65341 ggtatattca atcccgcgac gacaataccc tatggggtat cgtggtgtgc aagtccgtcc
    65401 gccgagcaga ggagtttcac cgtcatggga atcgtcgaat tcatgcgagg caccgcgggc
    65461 cgggccgccc gcatcatcgc cgggatcgcg ctgatcctga tcgggctcgc cgctatcggc
    65521 ggacccgtcg gcatcctcgt cgccgtcatc ggagtgatcc cgatcgcggc aggagcgttc
    65581 aacttctgcc tgctcggccc cgtcctcggc ctggacctgc atggtcagcc acgccgccag
    65641 gccggtcact gaactcgggc cggtcacaca accgccgagt ccgatccgtc ccgcgcatcg
    65701 ccgacaccgc accgttgtag cgatgcgcca caacacgcag gagtttgtcg atggccgata
    65761 tcgagctgtt tgtcgatccc gtctgcccgt tctcgtgggt gagttcgcag tggctgctca
    65821 ccgccgccga ggacagtgcg cacacggtgc ggctacgcca gatgagcctg gccgtgctca
    65881 acgacggcca cgacgtggcc gccgaccaca agccgatgat cgatcgctcg cgccgcctgg
    65941 ggcgggtgtt cgccgcggct acccgcaccg gcggcgccga agcgttcgca cgcctctatg
    66001 acgtcatcgg cacccgactg cacatacagg gcgatgatct cgggccgcag gaggtggcga
    66061 agtcgttgac cgaggcgggc ctggatccgg ggttggccga gcacctggac agcaccagcc
    66121 tcgacgacga catcaccgga acccacgagg tcagccaagc tgcgctcggc ggccgcggcg
    66181 gcagtccgat cgtcgtcgtc gacggacgcg ggttcaacgg tcccgtcctg accgaacaac
    66241 cccgcccgga ccgcggccga gatctgctcg acgcgctcgt caccgccgcg accacccccg
    66301 gattcgctgc cctgcagcgc ccctatcaag gcccgccgaa aatcgatgcc gccaccgagg
    66361 agacccactg atgtgctcac cgacccgatg ccgcacctgc ggcaaaacca cctggtccgg
    66421 ctgcggcgcc cacatcgagg ccgtccgtgc ccgggtcgcc cccgacgact ggtgccccgg
    66481 ccacccgacc cagcaagcag gccaaccctg gtggcgcctg cgcaggaact gaccgaccac
    66541 ctcacccctg ccggagcgga cacgctcgac agtgaccccg gtcccgcacc tcggtgtgta
    66601 tcgagctcgc gacgccgatt gcctgcggcg cagaagggta aggcttgcgc atgaaacgtt
    66661 ctgcgccggg ctttgccggc ggcggggacg agcggcaggc ggcgttgatc accgccgtgg
    66721 gcttgtccta ccccgaacag catcgccgta gggtccgcaa gtacgtggtc ctatggcgtg
    66781 tcgggtgccg tcgttgctgt tggccaccgc cgtgtacgcc gctggtggtc ccggctgggt
    66841 ggccgcggcg atcatggggg tgacactgcc gttgtcgtgg atggcggtgt tgatcgccaa
    66901 cgaccgccca ccccgcgaga aacgccgtcc ctcgctgctt cggcgccgtc ggcgccgtcg
    66961 ttgagctcgg cagtgatcgg gggtccggga acattcacga gaaaagtcac gctaaggagt
    67021 taccgcacat agtgacatac tatgtgcggc atcgcggcgg ccgagctgga gaagcggccg
    67081 agcagccagt ggtcgactcg cgaaactatg tgcggtagga ctcgcctgtc gactcacgga
    67141 gagcaatggg ggaccgctag cggaacattc cgcgcggatg ttcctcaatc cccttcgcct
    67201 acccggcgcc tgccgcgcca gcagtgtgcg cgccagagat gttcgggcgt gcggttgccc
    67261 gagcgagttc agaaggggac ggcctcgccc aggcgctgga tgacttcgcg ggcggcctgc
    67321 gcgctttcgt cggtggcggc cgcggtcacc cctgccgcga tgggggagag caggcccttg
    67381 atcatggtca agccacgttt gacgattccc ggatccggtt cctcatttac gacctcggcc
    67441 aggatcgtct cggtgtgctc gcgaacctcg gtggtctcgt cgtcggccag ggggaaccgc
    67501 ggcagtgtgg cgagcagctc ggcgagagtg gccgcgagct cttcgtaccc gggggcgatc
    67561 tgatcgctgt gggcttgtcc ctggtgcacg gttccgttgt tccaggccag ctgggcgtgc
    67621 gagccgtgga ccgtgacgat cggaccgttg tagttggtga tgttcgccgc gggcgggtag
    67681 accccgcccg cctccatctc gatcggcacg cggaccgggt tcttggcgaa ctcccgctgg
    67741 atctcgcggc tcatctgctg gatgccacgg cgattgatct tgaacccgct catggacagg
    67801 tcctccttcg acacgaatag ttcgatggcc cacgatctca tgcacgcccg acagctaccc
    67861 cgacagctac tccgccctac tcagacgggc gcgccgacgt cacgtcggtg tgggtcggta
    67921 cccagctgtc ctggcctggg cctcatcgcc atctccgggc gaggatcggt gtgacagcag
    67981 gtgccgtgat ctggaacgtc gaaaggtccc gcccggaggg cgagaccttt cgactcctgt
    68041 ttacggacgg tgcgctgctc taaccattga gctacgggcc ctcgtggtgg acccgacggg
    68101 attcgaaccc gcaaccttcg cagtgccctc gattctactg gaggggaccg acaggtctgc
    68161 ggcggtggtg cagcgtggag ccgcgcgcgc tatcgtcgat ggcagcacgc tgctggcctc
    68221 gggccgggca actcttctct aggtgatgag gagcctggga tgctcggtcg ctgcgcgaac
    68281 tgccacttcc tctcgccgga tctccccgga actgttccca gtccgcggtg cccgctctcg
    68341 accgagaggg gtcgtgcgcc cgcacgatgt gaagacgacg aaccgacagc ttcaccttgc
    68401 ccggaacctg tcgaagacac cgtcgtcccg ctgctgcggc agctgtgtcg agtcctggag
    68461 ttcgtgctcc atgtcgggtc ggttatggat tgggtcggac agttcatgga ttgggtcggc
    68521 cacgtgctgg agtcgatgcc ctagtgcgcc cttgtgctgc tcggcgtcgg tgcccagcag
    68581 cacaatcatg ttgtgcggtc ttggaaacct gaaacgatca tctgccagta ctgctcgatg
    68641 gaagtggtgt ggctgcccac tatctacggc gggaacaagc tgttcgacgc gaagatgtac
    68701 ccgacctccg agtcagctcg gggtaatcgg ttcgcagcca agcgcaacgg atcggtcgtc
    68761 gacctggacg acatccacag caatcgctgg ccggcggaat gtctccacct ccaccggtac
    68821 tcgtgttcgg agtacaacgc ggacatggag gcacggatct ggacgacgaa gcagtcgccc
    68881 ggacgggacg gacgacgcat cgccgagcct ccgttctgag cagcgccggg cagggtacga
    68941 accggccggg accccagagg gcgtgcgctc tgggggtccc gcgtcgatgg agctggtggc
    69001 gccgggttat tccgtgtccc accaggcttc cgtggcgaac cggtcccagt ggttgttcaa
    69061 ctccacgctc aatgaggact caccatcgtg gtggatggtg aactcgaagt ttgcggcatc
    69121 ggcgatcgcg cgcatgttca tccacgtcgc cgagatgatg ttcgcgtaca gctccgacgg
    69181 gagcggtttg tcgaactcga tggtcagctt cttgcgagcc acctcgcacc cccagtcgct
    69241 gtatggcacg cccgcccagt ccggctcatg ctggagcgat catagggcgg caggaccggg
    69301 tgtccgaagt gaaaagggtt ccggtggggt tcgcgggcac ctcggacgct accggtcgtg
    69361 cttgtcgatg gtgccgagct gggtgagcgc ggtgcgcagg tggcgggctt gctggtcggc
    69421 ggtgtcggca cctgcagcga gtgcggtcga tgccgtgtcg gctgcggtgg ctacgacggt
    69481 gtcctgggtg tcggcgagcc ggtcggtgac tgcggtgatc tcgtcgagca gttgtcgggc
    69541 gtgggtggtg gccaggagca ggtcggcgac gagagcgcgg gggttttcgg gtcgctcgac
    69601 ctgtgcgtgg tcgtagttgg ccaggcgggt cttccagggc tcgatgaccg cggcgccgag
    69661 ttcggcgagc ggggtgtggg tgcgggtggc ccatcgtcgt tcggcttcca gcggtgagac
    69721 gccggccgcg gcggcgatgg cctgccagct ggcgccctgg gcgcgggcgg tccgcacggc
    69781 gtcgatcagc tgtccctcgg cgcgcatcgc gttggcggcg gtgacctcga cggggtggac
    69841 gatcctgtcc agggtctcgt cgccgtgctt gtggttcatc cagggctcct cgaggtggcg
    69901 cggcattccg gcgaattggt ggtcggcaga actggtttcc gtgctgggtg ccggttggtc
    69961 gtgtgcgagt atgcgcgagg gccggggcat gtagccgatg ccccggccct cgcgggttgt
    70021 ggtggtcagg gtccggtggt gatgagggcg gcgatgccga gccagagcca gtgccaggac
    70081 tggtcgaggt gggcggcgcc ggtagcgagt ccggtgccgg cgcggtagaa gccgccggag
    70141 ccgagaaggt cggcgagcca ggccaaggtg gcgcggcggt cggcccagta gtgcgtgacc
    70201 gccgagaccg tcagtccagc cgcagcccac gccggttgga ccggcatgcc gagccaccaa
    70261 tcgacggtgg ccaggcacag ggcgagggtg agggtgtagg tggcgacgtg cttggtgcag
    70321 gcccagcgcc cgctccagcc gggtcggcct ttggtctggg cctggtggtc ggtctgcacc
    70381 cagtagtcgc cgacctggtg ggcgacgagg taggtgccga gaacggccgc gaacaccgcc
    70441 gcgccggtca tgcggtcctc ctggcggcgg tggggaactg gctccagatc acgccgtcga
    70501 gttcgcggcc ggcggccttg ggggtgcgtc cgccccactg cttgaagaag aacgccgtgc
    70561 ccgcggtgac gcactggtcg cgcaggtcgc gcacccattc cgggtcgatc ggccgcgcgg
    70621 ccgggccgga ttccccgccg acgatcaccc agtcgatcgc cgggcgcggc gcccagtccg
    70681 cacaggcgcc accgcaggcg cattcgttgt ggtcgccgtc gtcgggccac cggcacgagc
    70741 agccgtccgg gcaccggtcg gggaagagcc acgggtcgag gtcgatcggg cccagcagcg
    70801 gctcgcacga cagaaaacgc accgcggcgt cgatggcgag caggtcggtg atgcggtggg
    70861 tgaccgcacc gtgctcgacc gaggtgccga tccagacgtt gtcgggcagc accaggccgc
    70921 gttcggtcag ccgccgcgcc cgcgacgggc gcttggtcag cacctggtag gtgtgctgcg
    70981 gcgtctgccg catgacctcg acgacggcgt ggacgaaggc gtcggggaca cgggcgtgga
    71041 acaggtcgga catggagttg acgaacacca tccgcggtgc ccgccaccgc cgcgggatgt
    71101 cgagggcgtc ggggtggacg ctcacgccga acccgggccc ggaggtgcgc gggtcgccgt
    71161 cgcgctgata cttcgccgag cccatcgcct tgagccgttt ggccatcgcc agggcgtagc
    71221 agtggtcgca gcccgcgctg atccggtcac agccggtgac cgggttccag gtggtttctg
    71281 tccattcgat accggtggcg ctcatgcggc ggtcctttcg atcggttctc cggtgatggc
    71341 ttcgacgagg gcgcagccga tgacctcggg caccggtggg gtgaccgcgt tgccgtagcc
    71401 ggccgcctgg gtgcgcttgt cgccgatggg gatgtaggtg ggcgggaatg ccatcccggc
    71461 ccggatctcg tcgggttcga gcatccggaa cgtgcactcg gccaggattc tgtcggggtc
    71521 gatgccgagc aggccgtgcc ggtcgcgggt ggtcagggtg cccatcggct cggtgagcgg
    71581 gcgggcgagg ccggtgcggt agtagggcac gagcagctgc tcacgcgtgc ccgccagctg
    71641 ctcgacgacc gcggtcgatc cgggcggctg caccaggccg tggtgaaagc ccctggcgga
    71701 gaaggtgccc agcggttctc cgacgtggcg ggcggtcttc ctgctgccgc cgccgcgcag
    71761 gctggtgatg aacggcggga tggccacggc gagttcgcgg cgggtggtct gtgtcggcag
    71821 cggctggccg gtgctgcggg cggtgaggtc ggcgcgcttg ctggtctgca cgatcagcgg
    71881 cggcaccacc aggccgtcgc tctcgcgggt cgtgcgggcg ggcatcggcg ccgacagcgc
    71941 ggtggggtcg gcgcgccagg tgcccccggc cggggtcagg aacgactcac cagcgaattt
    72001 cgccagcccg atccggatcc gctccatcgt ggccgcggcc agcgggcggg cccgctcgcc
    72061 gatcttctct cccggatcca ggctccagtc gatggcggcg gcggccggga ccgtgaacgg
    72121 ctccacgatc tggaagcggc aggacttggc cgggcagcgg tagacgtact ggccgtggcg
    72181 ggcgccgtag cggcccatgt cgatgccggg ctgcttccag gactgcaccg cgtccaccac
    72241 ccgatcgcaa gtcgggcacc aggctttcgg gcgcaaccat ttgtcccagt ccgggcgtcg
    72301 ccccagggat ttgagccagt aggcgacata gagccggtcg cggctctgcg gtgcgggcag
    72361 gcaccggcgc ggcaccgcgt gcatgctgtt gagcgcgatc acccgggtct cgtagccggg
    72421 gccgatcgac tcgatcgcgc gcagccagcg gtcccactga tcccagcgac ggcactggat
    72481 gacgttctcc atcaccccgg ccagcaccgg ggtgccgcgc ccggccatcg cccgcaggta
    72541 gcgcgggatc tgctcgacca gcccgcgcga gcgggcctca gccggatcct cgatcaccgt
    72601 ccccagctcg tcgtcgctga gcagcgtgta ctgattcgac ttgtcgaagt accgtttgcg
    72661 gcccttggcg tcggtccagg ccgggcacgc cggcgacgcc cagaacaact cggtataggg
    72721 caaggtcgcc aggtcgatgg cttcgacgtc gccgggcgga agatgctcgg cgtccgggaa
    72781 gttcagtgtg tggacctcca cacacaccgg gttgtggttg gccgccagcc gcaactcgat
    72841 gccgggaacc tcctcccagc ccagcgaatc gccaccccaa ccggcgaagt agaccgtgga
    72901 tctcagagac atccgaaccc ccatcatgtg aacaaaattc gcgtactcag ttcacattga
    72961 ggctcggccg agtgtttgtc aactatgttc gcgaacagtg ttatgcgatg atggcgggca
    73021 tgagcgacga gaccgaccac gcggccgcga tccgcgccgc gcgagcggcc tacgaccagg
    73081 cccgctcgga gttgttcgcc accatccgcg ccgccctcga cgatggcgtc ggcccgtccg
    73141 cgatcgcccg atacagcgac ttcacccgcg agtacatcgc ccgcatccgc gatggcaagg
    73201 ggcccaaaga cattcggggg tagcccgcgg tgacgccagg cgccgaactc ggcctggcag
    73261 gtgagtccgg tgtcgccgaa ccaacgatct ttcgcttacg aggcgaatgg ttcggcggga
    73321 cggccttcgg cccgttaggg cagctgcgcc catgcgggca ggggttcttc caggtagagc
    73381 aggatgcgga tccaggcggc cagtaccagg gctgaggcgg tgctgtaggc gccggcggcg
    73441 atgcggacct gcgcgtccca gccgtggtgg tgccatgtgt tccagaccgc gtaggcggtg
    73501 aagccgaaca gcacgcagcc gatgcccatg taggtcacca gggtctgcac tttgagcagg
    73561 atcggttgcc ggtcgaggtc catcacctgc cgggcacggg cgccgccgag ttcgtgggag
    73621 gcgacgccga gcatcgggag tttcgtggcc gaatgcaggc gaacttccag gatgcggatg
    73681 gactggttgc gggtcaggac cgcgcccatg atcagcacgt ggaaggcagc gaccatccac
    73741 agcggcaccg gcaacaggac cggccacatc gccgcggctt tgacgtcttt ccacgcggtc
    73801 acgaccaagc ccaggtaggc gactgcaccg gcgatgaggg tcagcgccga ggtgttgtgc
    73861 tgggactgat cagcccgatc ggcctggtag agcgcagcca aagcggtcac ctcgaccgcg
    73921 tcgaccggcg gcaggctcgc cgggcccggc gagcctgcgc tcggcggcgg aacgggtgct
    73981 cccatactgt cccccgggaa gatcagggcg agctctgccc gccgtcaccg cccaggatag
    74041 aggcagcgca tccgcggccg atgtgtttca ccggacccgc ccaggcgcca cacgaagggc
    74101 cgtcacacct gcatcgtggc tcgacgcagg ggcgtccgag cgggaccgcg ttcgcggatt
    74161 acatggtggg ggtggagtcg tcgaggtcga caaccgctac cgcgggtgtg gggagggctt
    74221 cggagccggt gaggaaccgg ttgaagccga tggcgccgtc gccgatggtg cgttcgacga
    74281 tggtcgtggt cacgtcctgg atgcggccgc cggcgacgac gtggtcgagc aggacttcgg
    74341 ccaggcgcag atcggcggtg tcgtagtcgt ggtggaccga gacgtgccgc agacccggac
    74401 cggcggaacc gaactgggtc ttggcgccgg tgagcgcgcc atcgacgatc aggatccaca
    74461 ccgcggccgc gcaacggtcc gccgcgatcc gcagccgccc ggccagggtg ccgtgcgggt
    74521 cgcagccgag ccgctcggcg acgtcgaaca tgctctcggc cgctcccagc cgcagcagct
    74581 ggcgcgcgac gtcgatctcg gaggcctcga actcctcgca cagatcatcc agcggtgtcg
    74641 cccgctccca gccctgccgc agtcgatcca ccattcccgc gtcccagtag acggtgcggg
    74701 cacggcgagc cagctcgcgc agcggcgacc gccagtcgta gtccgggtcg gccagcaccc
    74761 cgcgcagggc ctcgacagcg gtgggtctgg tgtcgaagtc cggcgggagc atcttgcggc
    74821 actgcgtggc gagcgcgctc acgctccgac cggcctgctc agcgatcgcc tcgaccggca
    74881 gcccggcacg cagcaactcc accagctcgg cattgcactc gtcggtccac agttcaccgc
    74941 tgcggcggcg tcgtctcggt gtttccggca tcgacagatc cctccctgac cgaatcccct
    75001 gcgccacatc ctgttcccgg cgcacaccca tgatgacgcc gaccaccgac agaccaaccc
    75061 cgatcagatc cactcgcgca gcgcgggaat cagcgcgcga accacacaga ctcccagccg
    75121 cgaaccggtg atgcaggtca catcaaccgg tgacaccttt tgcatctggg gtgtcgttct
    75181 ggcatcgcct ggtggtgcgg acagcgctag cgcccgtggc agcagccggc cagcgcgcag
    75241 ttgctgccag gggacgcggt cagaagagga tgagcagcag gacgaaggcc acggccgcgg
    75301 tgacccacca cttccagtgc gtgggcagga tgcgtagctc gccggcctgg ccgagccggt
    75361 agatgtggtc gacggcgtcg cgttcgcgtg gggtcagcgg ccgtgttcgc ggcggtacca
    75421 cggtggtcag cggcgtgtac gggcaggtcg gcagcgggtg gtaggtctcc gggcagcgca
    75481 ggttcagaca ccggtacctc ggcggcgggt agtacgtcat cgcgtgctca ccctctctcc
    75541 ccggggtcgg ggtgtgagcg tagcgcttcg cgtgggcaca ggcgccggac tcggcggcgc
    75601 aggtacagct gcccgtgcac ggccagcacg atccgcaacc gtgccgccgc ccaccgcgcc
    75661 cgcacctgtt catcggtcat gtcgtgttcg acgcagacga tcacggcgag gttcccccgg
    75721 cgacgaggat gccctgaggg tgtccgcctg gcatgggcgg ggttcagctg gcgaggccga
    75781 gcagctcgag cagatcgtgg ggcccatcgc cgtcgctgtt gccggcgggg agctcgaaca
    75841 gagtcaacgt cgatgtggcg gccgcggctt cggctgctcg ctgctcggcg cgttcacgga
    75901 tcgcgcacgt cggcccgatc ccctgggcga ccgactccgg cgagagcagc cagccgtggc
    75961 agcggcggca gtgcgcgacc aagcgcaccg tgggtccctc ggtggcagcc atgcgttcct
    76021 ctccacggag tgtgccttcg ccgctcaggg tgacacgaca ggccgacacc ctgggcgcac
    76081 ttcgaggtcg atgcacccct gggtcatggc tcagctggtg ggccggtcgc aggaaggcgg
    76141 cgtccagtct gcgtgtggcg ccagggcctg ctccaggacg tcgggacagt cggtgtcggc
    76201 gggcaggcgc tgatgtgcgg tgagcagcag atggtcgaag cgggcgtgct ccgggccggc
    76261 ggcacccccg agcgcggcga cggtgtgcag gaactggtcg gccagcaccg cagtcggaag
    76321 accgcggtca cggctgtggc ggcgcagcag ttgctcggcc gcggtggagt cgaggccgta
    76381 gacgagcatc agcgccccct tggcctgctc gacgcgcccg cgcgatcgac gcaccccttc
    76441 cagaacctcc gcccaacccg gccagtccgc tcgatcgctg ccctcgacat cctcgctcat
    76501 ctacgccgtg tacccgcctc agcgcgcccc aacgtcaggt tcaattcgct cgcacacctc
    76561 tactactact tatctcgtaa cggtcttgca tccaagacaa cggcccgata acgggcctga
    76621 ccaccgtttt tccaccacgc gtgagcggcg ggggtattcg tccggcgcaa caggccccaa
    76681 atcccgtcac accttctgca tctccatccc ctccaggcgc gtatttcgtc cgccgaaact
    76741 cggtacggtg gggagaatga cccgtccaga ggctcccgaa ctctgcccgc gctgcggcga
    76801 gcccatcgtg cagcttccgt tgggtcgccg ccgcaagtgg tgctcggact actgccggcg
    76861 ccgcgccgac gaagagggcc tcaaggtcca tgaggtcgtg cgcgaacgcg aacgggtggt
    76921 gtaccggccg gagcgggtct cccgcgagca gcagatcgcg cgactgctcg atgatccaga
    76981 ggccaccgag cagctgctgc gcgccctggc ctaccggtgg cgtcacaccg ccccggaccc
    77041 ggccgcccgg cagcagatcg ccccgacgct gctggagttg tggcaggcat ttcacgcccg
    77101 catcgacccg cacaccgccc agcacccacc ggcgaagatc ccgaccgtcg ccgctgaaca
    77161 gcgcgcggcc gtcgaacgcg ttctgtcctc acctcgctcg acggccagcg tcatcaaccg
    77221 cgtcaccgac cggctcgacg caggagaact acgaagcggg cgcgatgaag cgatcctcaa
    77281 cgccatcgcc tacctgacca cgcgccggcg cttcccacgc cgctgacgcc cggattcagt
    77341 ccagcaacag ttagacaacc gtcttgttcg ctgccgtccg gcattactcg aatgtcggtg
    77401 tcgtgcagcg cagcagtcgt ttctacctat ccgtgcacgt cgtggtgacg aatgaagttc
    77461 tgtcactgtg gtcggcggga tcgctgccct ggtgagggaa tttcatccac gatgaacatc
    77521 gaggggttgg gttggcactg gcggtagtgc ggtcgctgcg cgagacgcgc agtttggtga
    77581 ccgacgagga gctggccgat tttgagctgg atgtgctgtc ggagttcgtg ctcgcgcggg
    77641 cctcatccgg cgttggagac agcacgatcc ggggcgacac cacgcatctc gggcaggttc
    77701 ggcagtggtt cggccggccg ttgtgggaga tggaaccgca ggacgcggat cggtacttcg
    77761 gcacggtgct gcgccgggtg tcgtcgtcga ccagggcggc ccgagcccgg accgtggtgt
    77821 cctatttcga gttcctcgag atccggtaca aggtcgtgtt gcacgagatg accggccgtg
    77881 tggtcgagtg cccgatcgac gaggtgaacc ggccccgaat gtcggtggac acgatggtgc
    77941 ggatcccacc gaccgaggcc gagctggagc agctgttcac ggggtggcgc gaggatctgg
    78001 tgacctgccg caagttcgcg ccgagcgccc gcaactacat ggtcgcccgt ctggcggccg
    78061 atgtcgggtt gcgggtcaac gaggcgtgca tgctcgacct cgacgacatt cgatgggagc
    78121 tgggcaggtt cggcaagctc aacgtccgcc acggcaaggg cgcgttccgc agtggaccac
    78181 ggcaacggct cgtcccgctg atcaacgggg cggacaccgc gctgacctgg ttcgtcgagg
    78241 acgtgtgggc ccagttcgac gctgacgaga ccttgccgcg cgcaccgttg ttcccgtccg
    78301 agcgccgccg ggcgggcagc tcgggcaccc gggttacccg ggacgtgatt cgtcgcgctc
    78361 tgggtggtgc ggttgatcgc cacctgccga cctggtccgg gcggctcacc ccgcacgtgt
    78421 tgcgccacta ctgcgccagc cagctctacc ggaccggtgt cgacatcctc gcgatccagg
    78481 aattgctcgg gcattcgtgg atcaccacga cgatgcgcta tgtccacccc tacggaaccc
    78541 gggtcgagga cgccgtcacg gccgggcaca aacgcgccgc cgcacgctgg gaaggactga
    78601 tccgatgaag tggaacctgc gcctggtcgc cgcgaaccgc ggcatctgga agtccagcga
    78661 actgcgccgg atgctcgccg cgcgtggcct cgagatcagc accggcaaga tgtcgggaat
    78721 gtggtcgagc acgccggcgg tgctgcgacc ggaggaactc gacgtgctct gcgcggtgct
    78781 caactgtggg atagccgaac tcatcaccgc cgaaccggac accgtcgcgg cgccgactga
    78841 tgccggggag catgtccggg cggtcggaga tcagggcccg gagtcggtcc ggcggatcgt
    78901 tccgaagccc aggacgggcc ggtccctccc gccccgatga ccgccaccag ttgccgggaa
    78961 tgcggcggtc ggatcgaggc gagtacgtgt ccacgtggcg gccgccctcg ccaatactgc
    79021 ctgacctgcc gaccgtcaaa gacggcagaa cgacgagccg aaggcgcgaa agactaccga
    79081 gacggttcgt gtgttgggtg cggcacgcag ctcgaacgcg ccgcccgcac gatcggacgc
    79141 ccccggatct actgcgacgc atgccgcggc cgccgggccc gcaccccatc ccggtcccgc
    79201 cgacgcaacg acgccgggcc tgcccaggac aaccgttcgg aggcatatcg ggatcgtcga
    79261 tgcactcgct gcgacgcccc gatcgaggtc gacggtcaac gaaagggccg tccccggatc
    79321 tactgcgacg gttgtttcgg ccgccgggtc cacgaacagc gccgccaccg aacgaggccg
    79381 cgctcgctcg atggtcttcg gttcgccgag gtcttcggca caatcactgg ccgcgtcgag
    79441 cacgaagttc tggagcgact gttcgacaca gcccgggtcg gccgctggag cgtcgcaacg
    79501 gtgcagcgca ggagcgagga gttgcgccgc gtcttggcca ccgccgggga cgaaccgatc
    79561 tccctcagcc aggtccgcgc cgaactcggc aacgtctggc agtcccggat cgcggctcgg
    79621 gtgctcgacc agtgcggtct gcttatcgac gacaccgagt caccgacacg gcagtggatc
    79681 gaccgccgca ccgccgagct cccgccggga ttccgtgacg atgtccgagc ctggctggtg
    79741 gtgctgcacg agggcggaca gcgagcccgg ccacgggcgg aggcgacgtt gcacgcctac
    79801 tacagtcgcg tacttccgcc gctgaccgaa tgggggagca cccgatcgca cctgcgtgag
    79861 gtcacccagg ccgacgtgtc cgtagcgctg aaccggctga acgggcacaa gcgggtcggg
    79921 acgttcgtcg cgttgcgttc actgttccgg ttcgccaaac gacaccggct gatcttcctc
    79981 gacccgaccc gtcgcctccg tgctggcgcc gcaccgtcgc gggtgctgct gccgatgacc
    80041 accggccagg tcgacgcggt caccgcaaca gccgtgacac ccctccagcg cgtcgtcgtc
    80101 gctctggtcg cggtctatgc cgttcgcgcg cacgcgttgc gacagctcgt gctcgacgat
    80161 ctcgacctag cgcgtcggcg gatccggatc ggcggctctg ttcaccagct caccgagttc
    80221 acccacgacg ttctcacgga ctggctgacc taccggcaac agcgatggcc gggcaccccg
    80281 aacccgcacg tgctggtctc ctccgattcg gttctcggca attctccggt cgaggactac
    80341 tacctgacct ggcatctgag cctgctcggc atccagcttg aacacatccg cggtgaccgg
    80401 atcctcgaag aagcgctctc gacggacacc gacccgctgc acctgacgat catgttcggg
    80461 ctctccgaga agtccgcggc cgactacgcc aggcttgccc gcggcatcac ggagcggccc
    80521 atcgaggccg tcagtcacta ccccgccgac tgggactgat ggaggcggcc cgctgccgcg
    80581 gccgcctccc tgccatcgtc tcgatgccgg ttctgccgaa accggacgcc ttctcgcacg
    80641 ccggatcgcg aaacacgttg ggttcccgct gaaacacctt cactctccgt gaacccactg
    80701 ctttcgagtg agcaagatat cccaaaaccc cggggttttg gcgtgagccc ggggacgggc
    80761 ggaagggggt cggtgactac ccgtccgcgc tgggctcgag ggcaagcgag cgaagctcgt
    80821 gcggcagcac caccgccggg accccgttcc gaccgccctg ttgattcagg gagtcggcag
    80881 cgagttccgc agcgccggtg cgagcaagtt ccgcaggctc ggcgtcgcga gtcggcagcc
    80941 gaggtggttc cgccgctttc gggggcccga ggacgggcca ccgcgcccct gcgtccttgg
    81001 cccgttcgcc acccccttgc ccatcggccc cgggcagggt cagcgctcga atccggtgtc
    81061 ccggttgttg ccgcgcgctg gtcggggcgg cgttatcggc gccttggtgc tgcgagtgga
    81121 tgtgcgacga ggcgtggcca gtcgttgcag cgtcgccgcc tcagcggctt ggcgatctcg
    81181 tgcggcgcgt tcgtcctcga tcggcagcca cgggcgcggc cgtgacgggg tcatcggctt
    81241 ctgcactcgc cggttggtgt tggtggcgtg cagcgccttc tggttgagga tcgtgttggt
    81301 ggtgattgcc gggtcttccc cggtgacgtg ggcatgggcg cggtaggccg cgacccaggc
    81361 cggcgagcct ggagtcgact cgtatggacg gtccgggttg atcccggcgg cgcgcatgtg
    81421 gacctcggtc aatgcttggc gggcctggga gtacatcgcc tctgccgcct gtgcctgccc
    81481 gaccgcgcgc cgtgcctccg ctaccgccag gaagcagtcc atcatcgcct cgatgagcgc
    81541 gatctgagag gcctgccgcg aggtcgtcga ccacagcagc cgcgccgccg cccgcaccga
    81601 ggccgtgtcg gcacgctctc ggcgcggcag ccgccgagcg gggtcggtgt caccgatccg
    81661 ggcgagctga cgcgacagcc gatccatcgg gcccggcgcg ggctcggtgg atacgctcgc
    81721 ggccgcgaac agtcctgccg tcgccgaggc ggcgcggcgc accgcggcgt ggtcctcggc
    81781 cgggatcgcc tgaatccgct ggcaccaccg ggacacggcc gcgagcgcct cggtctgggc
    81841 cgccggatcc agcggcctgt gcgcgccggc gcgggcgccg cgccggtcgc tggccgccag
    81901 cagccgccgc cactctgctg ccgcctcctg ctgcgcggtc tcggaggtct cccaccccgc
    81961 ccagctgcgc agcgcgggca gggtcagatc cttgcccagt tgcagccccg agtacccgcg
    82021 tggtgtctcc cacacgccgg tctcgacgtt gcgctgggcg ggcatgcgca ccgagtagcc
    82081 gacgacctcc tcggtggagt ccttggcgaa ccgcggccgc accacgatct gctgggtgcg
    82141 caactcccgc agccactccg cctcactgcc cgtggccgcc gccgcggccc gcactcgccg
    82201 gcgcagcgcc tcccggtcgg tctcgtgtgc gccgacgcgc tgcatgtacg cgcgttcggc
    82261 cggtgtcgtg gccgcctcgg tctcccctgt ctcccgcgac gccaacaccc gcagcccgtg
    82321 cttgcgttcg acccggcccg ccgcccgctg cgagcgcggc cggtcataca tcatgtccac
    82381 cagcgacccg tccgcacgca ccaccgacat ggcgatgtgg atgtggtcgc agccgttgcg
    82441 gttcggcccg tgatgcaccg ccgcccaccg cacatccggc accgcgtccc cggcgtcgac
    82501 gaaccccatc tcgcgcatga agtcggtcgc aatcgcctgc cacttctcat ccgagagcgc
    82561 accctcgtcc gggtgcagcg ccagcgaaca gtgccaggtg ttctcatcgc tggtggcggc
    82621 ctcgaacgcc gccttgcggc tcatgccctc cgccatcaac gcgcgagcct tctgatagct
    82681 ggtgaccgac accgggtcac cgcgcagcag aacctggcgc ggactgtcga gcagcttgcc
    82741 cagctcccac gcccgcgcct ggttgatccg gccggcgaac accgccatcg tcaccgcatc
    82801 ccccgccaac acccgctggc cgacgtgttc gttgtagcgg cccggacccg ccaggtacca
    82861 caacagccgc ttgatgtccg agcccttcgt cgagttcgga atcatcgcgg cctcacaccc
    82921 cgccgccgtc cacgtcgtcg atgtcttcgt cgatgccgag caccccgagg ttgtccaccc
    82981 gctccaccca ctcctgcgcc gcggccagct gatcctcacc gatcaccgac ggcgacaccg
    83041 acggcgtctc tcccatcacc caccgcgcca acgcatccat ctgcagcgcc gcacgcacca
    83101 ccgccgccac cgccaacggc aacccctcgg ccagctcccg gttctggtgg ctgtagcgca
    83161 ccagctggtt gaggttgttc agcgcccgac gatcctgctc cccctcctcc agcgcccgca
    83221 gcgccgcagc tgcccgcccg acctctgggg tcgccttgcc cagcgtcgtc tccaccagca
    83281 gccgcggcac cgtcatccca gccgcctctg cccgcacggt gaggtcggcg tactccgaat
    83341 ccgacagctt caccacgcac cggtgcgacc gcccgccggc cacgttcgcc tgccgcgtcc
    83401 gacgcacacc ggcacgctga ttccgcgact cccctgccat ccgcagcctc ccaacagcca
    83461 gcgcagcgac cacccgacac ccgggcgggg tgcaccattg gtgcacctaa acgttagctc
    83521 gctcccactc aatttgtccc agactaccga ccggaccgta cgaggccgtg tcgctgaacg
    83581 gtgaccacac cgggagagtg gagcgcaggt gccggacggc ctctcggcac ggatcggggc
    83641 gcggatccgg gtgacgcttc cgagttgggt ggtgggtgcc cccggtactg tcgcggcggg
    83701 gtccctggtt tgttcgcgct gccaggggct ccgcacacag aaggaccccg ccgggtaccc
    83761 gccggcgggg tccttcgcgt tcggtgctgc ccggggttca gaccaggcgg ggtccggaga
    83821 ccttcgtagc ggcttccagt gcgcggccga ccgtcgagtg cggcaggccc atcgtggcgc
    83881 cgatcgcgtt cggggtcgcc ccggccgagg ccgcttcgta gatcgcggtg agctcctcga
    83941 ccgacttgcg cgagagcttg cgatcgacga ccgcgcgcgc gatcaccgtc gcctccgcgc
    84001 gcgacaacgc gcgatcgaac gggccgtgcc caccgagtcg cgcgcgcggg gcgggttcgg
    84061 tcgcgcgcgc gagcgccccc tcgatcactg tcgatcgcgc gcggcccgcg cgcgatgggc
    84121 gcgcgcgatc ggcgtcctcg cgcgcgatcg gcgagaccgg cttcggatcg cgcgcgatcg
    84181 acaccaccgc gcgccgatcg cgatcgacgc cctcggtcgc gcgcgcgacg ctcgcgcgtt
    84241 cctcgctgcc gggtcgcgcg ttcgacagct gctcctcggg tgtgtgatcg gcgcgcgagt
    84301 cgcgatcggt gtccagctca ggaccggttt gcgcgatcgg cgcgcgatcg accacctcga
    84361 cctcgcgcgc gatcgactcc gcctcgctgc cggactccgc gcgttcgaca ctggcgtccg
    84421 cgcgcgcggt cgagacctcg cctgcgatcg acacggcgtc ctcgcccgcg cgtccgtcac
    84481 caatgtccgc gcgcgaacgc gcgatcggct cgcgcgcgat cgacgcgcga tcgaccggat
    84541 cgctcgcgcg cgactcgtcc tcaccgcgcg cgagcgatcg gtccgcgcgc ggaccgccgg
    84601 ccaccgcctc gcgcgcgcga tcgatcgcgg actcggccgc gtgcacaggc gcgtgatcct
    84661 cgtcgccgcg cgcgagcggg gctgtcgcgc gggcggtcag ttcgcgctcg acctcgcgtt
    84721 cgagagcggc gatctccgca cgcaccgcgg ggtcggattc gatcgtgtcg agcgtcggcc
    84781 gcggcgcacg ggcggtgtgg tcggcccagt cggtcaccgg ccggtagttc ggcagcgtgt
    84841 acgccgagaa acggccctcc aaatgctcgg cgagctgagc gcgcactgat tccttgccga
    84901 gagcgatgcc gtcggcggtg gccttgtcga tggcgcggtg cagacgctgc atggccttgc
    84961 gctcagcccg gccgccgccg ttgatgcggg cgatgcggac ggcgtcggcc gcgagggcca
    85021 ggtcggccag gcgccgctcc acagccacct cggcgacggt gcggtcggtc ggatcggcga
    85081 tgccccactt caccagcagc cgctgcggtg tccaccgcca gttcatgccg ccggcgcggc
    85141 cggtgagctg gcgacgctcc agcgccatcg accgctccca gccccatgcc gcgaccagcg
    85201 gggcggccag gcgcagcacg agcagcccga cgtcgttggt ggcgtgggag gcggccagga
    85261 cgccggacag gatggtcagc acccacatcg cgatgccgtc gacgccggca gatccggtgt
    85321 cgatctggga acgccgcgcc cgcatcgccg aggcgacgac catgagctcg atgaacgcga
    85381 agcacagcgc ctgcagggcc gggtgcatgt gcagcgactc ggagaacatc acgtacatgc
    85441 cctgcgcggc cacgaccgag gcgatgcccg cggtgaacag ggtgacgctg cgttcgatct
    85501 tggcgctgcg ctggtccttg gccttccgtg cgaccgcttc ggctggcgtg tggtcggggg
    85561 tcatttctgc tcacctttcc ggcgtgccat ctcgtcttcc aggcgcgaga tggtcgagtg
    85621 ggcggtgtcg agggcttggc gtagcgccgc gacttgggcg ttggccgctt cctgcgtgcg
    85681 ggccagttcg gcggcgtggt cggtgcgcat ttgctcgcgg tcggcgcgcg cctcggcgcg
    85741 cgcgctggcg agttcgctgc gcagctgctc gcgctcggcg cgagctgcct gagtcagctc
    85801 ggtcagctct gcgcgggcga cctcgaggtc gcggcgtagc tgctgggcct cggtgcgcgc
    85861 gtcggcggcg gcctgctcag ctccggcccg ctcggcttcg gcgtcgcgtt gagccttgct
    85921 ggccgcgcga acacgggttt cggcggcgcg gatctgctcg ttggccgctg cctggatctg
    85981 ctcgatctcg gtcgcggtct cggtgcggat ggcgtggacc cgctcggcgg cggcctgctc
    86041 agcggcggcg atccgcgatc gagcgtcggt gagtgcgtgc tcaagttcag cgtgcgcggc
    86101 cgcgacgtcg gcgcgtgcct gctcgatcac ggtcgcggcc tcagcacgtg cctggtccac
    86161 ctcggcggca gcttcggcag cgcgggcgtc gcgatcggcg atcgcgtcct cggccgcgcc
    86221 ttcggccaag gtcttgtcct cgatcgcacg cgccagctca cggcgagcgg acagcgcctc
    86281 gttctcggct tctgccgctg cggcgcgggc cgcgtcgatc tcggcttgtg cttcggccct
    86341 gatgcgggcg acctcggcga cagcggcgtc cggatccccg gcggtggcca cgatctcggc
    86401 caccctatcg acgatctcgg cctgctgcgc gcggtgtgca gtggtcacca tctcccactg
    86461 cgccagcagc tcggccagcg acgcccgcgc cgaggtcacc ggtcgcggca caggacgatc
    86521 cggccgtgcc gtcgcaccgc cagcggcttc gagctggagt tcccgcttgc gctggaaggc
    86581 agccgcgcga tcgtggcgac gccgcacccc gtccggatcg acgtggaact ccccgcagta
    86641 ctcggccttg cgtccccgtc caggcggcgc gggcggcaac gggtgaccgg ccaccgcgaa
    86701 ctcccccgag ccggggtcgt aggcgacggg gaattggcat acgcgccggt cggctccgtc
    86761 atctgccccg acagcggggc cctgctctgg attcgtcacc ctccaatcct accataaacg
    86821 ttttcgttta tcgttctacg attacgttct atcgttttaa cgaaaacatt tgtccggaat
    86881 gtccccactt cgtttggatg gtggacatgc ggggcgcggg tcgtgggctg gcgaggcgtc
    86941 gggcaggcgg tagggtctgg ctgaaatccg ggcgcttacc tcgctttggg cgagtgggtg
    87001 aaggcggacc ggggccgttt cagtcgccga agggtgtgcg gtggaaagac tctttccacc
    87061 gcacgcggcg agatagcgag tggagttgca gcg
//