LOCUS       AP006619              184026 bp    DNA     circular BCT 07-OCT-2016
DEFINITION  Nocardia farcinica IFM 10152 plasmid pNF1 DNA, complete sequence.
ACCESSION   AP006619
VERSION     AP006619.1
DBLINK      BioProject:PRJNA13117
            BioSample:SAMD00061069
KEYWORDS    .
SOURCE      Nocardia farcinica IFM 10152
  ORGANISM  Nocardia farcinica IFM 10152
            Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae;
            Nocardia.
REFERENCE   1  (bases 1 to 184026)
  AUTHORS   Hattori,M., Ishikawa,J. and Yamashita,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-SEP-2003) to the DDBJ/EMBL/GenBank databases.
            Contact:Masahira Hattori
            Graduate School of Frontier Sciences, University of Tokyo; 5-1-5
            Kashiwanoha, Kashiwa, Chiba 277-8561, Japan
REFERENCE   2
  AUTHORS   Ishikawa,J., Yamashita,A., Mikami,Y., Hoshino,Y., Kurita,H.,
            Hotta,K., Shiba,T. and Hattori,M.
  TITLE     The complete genomic sequence of Nocardia farcinica IFM 10152
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101, 14925-14930 (2004)
COMMENT     This work was done in collaboration with Jun Ishikawa, Yasutaka
            Hoshino, Haruyo Kurita, Kunimoto Hotta (National Institute of
            Infectious Diseases) and Yuzuru Mikami (Research Center for
            Pathogenic Fungi and Microbial Toxicoses, Chiba University), and
            supported by the Research for the Future Program of the Japan
            Society for the Promotion of Science.
            The genomic sequence assembly and annotation was carried out by
            Jun Ishikawa (jun@nih.go.jp). The complete and fully annotated
            genomic sequence is also available at http://nocardia.nih.go.jp/.
FEATURES             Location/Qualifiers
     source          1..184026
                     /db_xref="taxon:247156"
                     /mol_type="genomic DNA"
                     /organism="Nocardia farcinica IFM 10152"
                     /plasmid="pNF1"
                     /strain="IFM 10152"
     CDS             1..714
                     /codon_start=1
                     /gene="parA"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_10"
                     /old_locus_tag="pnf110"
                     /product="putative plasmid partitioning protein"
                     /protein_id="BAD60526.1"
                     /transl_table=11
                     /translation="MAYVEVVLNQKGGVGKSTVAVNLAATTADALTSSEPGTISPVAA
                     VSIDPQGSAVWWADRVEDLPFHIVQAHNDIDGLRALRNSSSIDHFYVDTPGWIGQDED
                     DQAAADPLGKGPAAEALRAVLESADHVIVPIEPEPLAFDPTARTIEKVIKPRGLDFLV
                     VVNNWDPRDGVADLEQTKDYVKANGWPLANTVIRHYKVHARAAAEGIVVTEYPRNRVS
                     MEARADFSKLALELKAGAR"
     CDS             714..1631
                     /codon_start=1
                     /gene="parB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_20"
                     /old_locus_tag="pnf120"
                     /product="putative plasmid partitioning protein"
                     /protein_id="BAD60527.1"
                     /transl_table=11
                     /translation="MAGRGGRANLADLVGSTGKNSTVDGVNARTSSPAKGPTPEVMVN
                     GAPLEIKLEDLVANPLNPRETMDVDDLASIVEIQLQPALIIGREAYLKLWPELKSELG
                     DAKYVVINGCRRLEAARKFGRTTLECVRKDEVADSRASLRAASIRENVERENLDVIEE
                     AKAVEALVSDCDGNGARAGQILGKTKMWVSQRRALLKLTPELQAKLRAGELAIREARE
                     LGRVPAEEQVARWKAQLEKKEREQAGETSGSNSSRRDVDTVKIVKTLKKWDADTAVLA
                     SALFVHLDRSGVHELIEQLNQMATSNEAE"
     CDS             complement(2029..2970)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_30"
                     /old_locus_tag="pnf130"
                     /product="putative recombinase"
                     /protein_id="BAD60528.1"
                     /transl_table=11
                     /translation="MSAALTARYRYDYARFADWCAVHGYRPIPADPSVIGEYLASAPA
                     APSTQRGRLSAINWAHRNAGFPAPGRSPHVRDLLNPVRASRTERLHELIEAVLPNLPT
                     WGWPTGLFGRRDAVILHLARSGLSFPLIAGLDRSEVVIREDRIEIGAGPLLVLRAADD
                     CPSCPVAAFRRWSAVLAVVHRPTATYLLEQHLENETLPERTSPRSTGPLLFALDRDGN
                     PALNPSPLTPGSIGVITAAHILGRAPTHRPRQRRRGNGVDFVPDLTVGSRCPSLSNDH
                     FDRGLAARRRALESMADIDALLDAAEAEVDRVLARWG"
     CDS             complement(2967..4259)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_40"
                     /old_locus_tag="pnf140"
                     /product="putative recombinase"
                     /protein_id="BAD60529.1"
                     /transl_table=11
                     /translation="MRVWMSVYTAKLLHMTSKEIEVYRPAAAPALTDAEIDHIREVLK
                     PLGMADVDSGAELTVAPLPSLSSEDVRLIGESTATARARNTIRSYATDWRRFERWCAA
                     NAARGHQALPAHPLTVALYISEAAALRDSKGRRRYAPPTLTRWVAAIGDHHRAAGYPH
                     PGSARIVAGVLTGIRRACRAKGERRPERAEPVLVDDVRELVTQARRQAESDAQRIAAH
                     RDAALLLMGFTGAFRASEMTERWLEDITPHRLDGLHVRLRISKGSQEEEVVVALPRGS
                     EPATCPPCAWRRWLDLVAAHDAGGRVAVQQVLSKTGDGCEQHVCRGRWPELTNPRNPA
                     FRAVDRHGNIASTALTAEAVGDMLRRRLMAVGYDKETAASFAGHSLRSGFVTQSYRLG
                     ASDYEIQRQTRHKSVAMLRVYAREHAPLVGNAATRLPW"
     CDS             4365..4826
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_50"
                     /old_locus_tag="pnf150"
                     /product="hypothetical protein"
                     /protein_id="BAD60530.1"
                     /transl_table=11
                     /translation="MELATHTPVPGQLALWEPEVEQPHAQPSQPHRPAGQHTCPNPEC
                     GYPATGASARGRLREDVKVVWLVPDPDQPDTPAERRYCNRCRPRPPQQIADVECAACD
                     HGGPLLVGELAKALRTRGTVPVAVRAWLLDHGWREQEGGELLCPDHPAAVR"
     CDS             4982..5818
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_60"
                     /old_locus_tag="pnf160"
                     /product="hypothetical protein"
                     /protein_id="BAD60531.1"
                     /transl_table=11
                     /translation="MMAADSPALSSVGESVNGSATTDHPIAGSRPPWSRVFFRGLAAV
                     TLVYPLVYCSSYAVVVGDTPLAVAVAFCFGVLASGVIGIGAFMVRPRSSMVTETRVVC
                     GLLGFRRPEPARWRRRPLLVWCVVVPVLLAAVHFGLDTVIGAVWHPVSDAEQLRANAE
                     RAEILTRNGALSAAVLYPFLVAAVPEEIRYRALVLLTQRAVGACTIPRWVGFLVVAAV
                     AGLSIALFAAAQAEYGPMNLVTSAIGGVIYTGLVLYTRSLWPAISCHGFYDLMAISLT
                     IL"
     CDS             complement(5995..6498)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_70"
                     /old_locus_tag="pnf170"
                     /product="hypothetical protein"
                     /protein_id="BAD60532.1"
                     /transl_table=11
                     /translation="MIPTVPTADHHAGPAANHNEGVGTLITLKEWAEQRGRSYGSIRN
                     NWTGRDDFPAPKQPRPRTGKGTPAPEYDSDELDAFAERWEAANRPAPFPMPDEPDEFR
                     TLGAIARLLGVDGKTVTQYRETFDEKVEHENRGARTVYRTRGVVEVLNERRGKGLTRP
                     HLRQSSE"
     CDS             complement(6670..7377)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_80"
                     /old_locus_tag="pnf180"
                     /product="hypothetical protein"
                     /protein_id="BAD60533.1"
                     /transl_table=11
                     /translation="MTFTMFDRSRWTPADEDRARRGVAARAAGPTGPWTGDILVHPGG
                     YRSRLWVTAYSGELFACGDDPDYGFILDPDGSIDYTGTSGMYGNKRIDRESLTGVSGA
                     EVAPFWLDRRDEEMPDDVLTFTTEVRVWQTTETVPSVYEAVAQRIYNHDSFDTVITEY
                     EARIIAEGWAGEHYCPNLAEWVNGRRTGIDRAVLIAEARKLWDDLSLHVEDWPHAGEP
                     EPSVAAAAALTAFLEGY"
     CDS             complement(7419..8489)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_90"
                     /old_locus_tag="pnf190"
                     /product="hypothetical protein"
                     /protein_id="BAD60534.1"
                     /transl_table=11
                     /translation="MKAREGARAQGPLPGLPLSSTPATTSGKDSSVDDLTTNHTEWGT
                     PAPLAPPAPTTRVAVRAVTSGIVGVACEHTEAWRFVTIPTDALGCYDAEADAITTALD
                     GRSWVGDVIALDTVTGCDGQQFTAGCSTWTVFSDEVSDDPDHALPERLRAEIGHWNCE
                     HALFGGRPAEGWTTESDPDELLALAVLERWTFETAGFRAFAERPEESPNLVRLTVFRD
                     GAEPLCEYIAFSTAEAAKEAAVALIVGAITADQATRLPTYAQRVAALPHPLPSSGVVF
                     TARIVTDDSVEPEHGPAQRADIVITADGDTDPVATYSLTSNPLDPIPDEPTDVLARHG
                     WRMAGPGHLDTDRYLIVRVERA"
     CDS             complement(8486..10171)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_100"
                     /old_locus_tag="pnf1100"
                     /product="hypothetical protein"
                     /protein_id="BAD60535.1"
                     /transl_table=11
                     /translation="MLELMDWFCGAGGSTQGASKVPGVCVTRAANHWDKAIETHATNY
                     PEADHFLGDLSTEEAKAQIVKWPVADIFWASPECPQWSSARGKKRDFHNTLQGDLLDL
                     QRDEEADRSRALMEEVPMYLRGVIERGGRVRAGVVENVVEVRQWDQWHRWIGEIRALG
                     YGVRVIALNSAHAQPVRTPAAPQSRDRLYVAYWDLKLGRTPDWNKWLRPMAYCAECGW
                     VQALQAFKRPGADMGRYRTQYFYRCPRYTCRNAVIEPPVLPAAAAIDWTLPGTRIGDR
                     DKPLAPKTMERIRVGMRRYASMVPMMVPAGGTWRDDATQVTGPMAARTTRENDGLAIP
                     QPFLALLRSDRPRTIGLHEPLATVVADGSNHGLVVPPPLMIPMEGRDGKEAQLASMPL
                     RTQTTRNETAVAFLPFVAELRGGSSDARPVTEALATVTASGNHHGLVTPPTPPTGMSP
                     ELWNSLLLPYYGNSTARPVSDPMGTLSTRDRFALVDMITERDIENTRFRMLEPHEIQD
                     AMAFRKDYIVLGNKRQQVRQLGNAVTPPAAEILISALVEAITGEELDRYAPTA"
     CDS             10400..11080
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_110"
                     /old_locus_tag="pnf1110"
                     /product="hypothetical protein"
                     /protein_id="BAD60536.1"
                     /transl_table=11
                     /translation="MCGRVSPRVRPPVNEAGRAANDVGPAASSGPRPLTAGRPAPVIR
                     LHPSVPGGRLVGTAWTNRAAAQLHRNGSTPPMTEVDRVQVVQEMWPTIGPHDADSLAA
                     AAVASREIFRMLAHATITRTDALKALPYMVDGYTVLGGLAEAASSERQGLEQLAVWAE
                     HFANDPTLRHAEHRDQQGGGIAQAQQAALETAEDLREAAGHAEALMRALQRAQAHTSP
                     LYHDDEES"
     CDS             11077..11349
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_120"
                     /old_locus_tag="pnf1120"
                     /product="hypothetical protein"
                     /protein_id="BAD60537.1"
                     /transl_table=11
                     /translation="MTSAHAAGEPTDYFAPVYAILDRWAADGAAAPDPVPVILGDGSH
                     ATMTRDWLTFPRTEGTISGKSMSLRLLEKARGTLTPSNRPTDEKDR"
     CDS             11346..11873
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_130"
                     /old_locus_tag="pnf1130"
                     /product="hypothetical protein"
                     /protein_id="BAD60538.1"
                     /transl_table=11
                     /translation="MTASYTADELRTLLETGAAAADSRYQRAAIHLLNFTELPGRTAL
                     NAYIETDTVTIDGRDVRAAWIRDWDGMGRLENLGYLSGGEERLVRRAASMAHGSPVDL
                     CATLSSLGHAHARRVLEAVAICLGADEYYDITPTPALLENQRFEEQLLAGELSRRGLG
                     PDGQPVPNPQSGETE"
     CDS             11870..12118
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_140"
                     /old_locus_tag="pnf1140"
                     /product="hypothetical protein"
                     /protein_id="BAD60539.1"
                     /transl_table=11
                     /translation="MTSLPTQEQIWTNAADAADRAALALSDVRDWLRSDWSDTKPLTD
                     EAVQARSAAYARLETLKDEIRDLEHQLRGGARSLRDRR"
     CDS             12149..12493
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_150"
                     /old_locus_tag="pnf1150"
                     /product="hypothetical protein"
                     /protein_id="BAD60540.1"
                     /transl_table=11
                     /translation="MFDETPISWEDFKARRPSDAENAARLADLVRRARTVRAHGWDDY
                     RYVWSSGEVAGVAYLLDDEDVLRDADETADSVLSRYACDLFGVTGGHDDIAAGHPGTR
                     AWFDHARQEAER"
     CDS             12490..13218
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_160"
                     /old_locus_tag="pnf1160"
                     /product="hypothetical protein"
                     /protein_id="BAD60541.1"
                     /transl_table=11
                     /translation="MSTLLADAEARVATLAQAHPEMYPQPVELRRRAHPRDPATETAI
                     ALYQWRTPVFKARRERRVVEHIVVDPDVYARLDGRGRDALLAVELTRADHVRRTLSAA
                     PLGLAATWQLDRLLRRSGTGRADTAVITGVLAAAAGAFLPLPVAPPVRLVLLAVVIAT
                     VVWAFDAAITRGLHLHADRVAARWIGADAVRYMLMTLSADEHHPEGAAAWRVRWLGYQ
                     PTLRHRLKSLNRVHAVTENLRPVE"
     CDS             13605..15275
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_170"
                     /old_locus_tag="pnf1170"
                     /product="putative integrase"
                     /protein_id="BAD60542.1"
                     /transl_table=11
                     /translation="MAGDSSVADRGVLTAEEARWQVAVQRAEVIGRLAQGDRVSVAAA
                     DEAAAELGVTQRQVYALVKRWRAGEGVASDLLPRRSSGGRGGERLSDEVEEIVRAVLR
                     ARYLTRQRRSVAVICREIDRECKVRGLRPPSRSAVQRRISRLDPVKTVTAREGQGVAR
                     SRRPAGGVAPAVTGVLERVQIDHTPADVIVVDEHHRLPIGRPYVTAAIDEATKCVPGL
                     VLTLEAPSATSVGLCLAHMAIDKRAWLERIGVQAVWPMSGKPVQLYTDNATEFKSEAL
                     RRGCGQHGIAIDYRPPGAPHYGGIVERLVGTMMRMVHELPGTTFSDTRERGDYDSDAK
                     AVLTLAELQRWMALAVACYHGEPHDGLGGRTPGGVWAEKVAAHGAPPTVTNETAFLVD
                     FLPVERRSLRRTGFVLDHVQYYSDALKPLIARREQLEKVVLRRDPRDISRIWALHPET
                     GEYLEVPYRMWSRPAISLWEQRAAVARLREQGRAEIDENALFAMVEQMRHITADATAT
                     SRRARRNTERRKATPARSRAQAIPPAPPVPTPGAAPVAVAPFEVIEQW"
     CDS             15272..16183
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_180"
                     /old_locus_tag="pnf1180"
                     /product="putative ATP-binding protein"
                     /protein_id="BAD60543.1"
                     /transl_table=11
                     /translation="MSIGEPVDLSHLHPSAQRPAMLPDAERIQYVRADRWIGYTRARE
                     ALARLEGLLSMPGKQRMPNLLLIGATNNGKSMIIEKFRRDHPPVSHEDREEIPVLTMQ
                     MPSEPSVSRFYVAVLAALGAPIRPRAPRLAELEQLVLRLLRACGVRVLVIDELHNVLA
                     GRGDTRREFLNVLRFLGNELRIPLVGVGTRDAYLAVRSDPQLENRFAPFTLPLWEPGD
                     QACALLASFAASFPLRRSSSIATEEMASYLFTRCEGTIGELTALLSDAAIAAIESGEE
                     AINQRTLLLASYAGPTERRRMFERELA"
     CDS             16180..17565
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_190"
                     /old_locus_tag="pnf1190"
                     /product="hypothetical protein"
                     /protein_id="BAD60544.1"
                     /transl_table=11
                     /translation="MSPSPPRRWPLHPPPGALESLSSWLDRLARIYEVPVRELLGPNL
                     GVLVGIRDVLDEDPPPAVFTALAERTGVPAGQVRAMTLPGWVPWLFDAYPLPERDATD
                     GFYTYVRQYSVLLAPREAPRFEVTHRRRWRGPWIPERPVRRSCPQCAAGPDPARALIW
                     QLPLTVSCLEHRCRLALDTDTLAAEIAGQPYQPVPVGEPVAALDGYTRQALINAAVRL
                     PGRTVHAGVWFRLLRCLLDELSLAGSTGTRSSERLLEQIWDATGEPIRAGLAVWQPYE
                     NLEWTTQEKLLTAAATALVLATDRRIQPRGTLAWLLTEPQPLPVYDGDPPRPPTPDPP
                     AQTRRDLMQTMNAWYARARIDADAARAMLRLLTALDTTPAHATRHRDVLISEGIPARF
                     LRDDLLRCPGRRTRDETETLLVAEGFDPGEVAYELDCCVAETIALWEVPDEGVLIGED
                     ELGQIRARLEL"
     CDS             17569..18708
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_200"
                     /old_locus_tag="pnf1200"
                     /product="hypothetical protein"
                     /protein_id="BAD60545.1"
                     /transl_table=11
                     /translation="MPRWPLHPQPGPIESLSSWVQRLATVYQLPVKVLVADLCADFSP
                     NMRAFANRLHHPPPALLDALAVRTGVPVPRLATMTLSGWVPWLFEKLWPREFEQQQLF
                     DNYVGRQSVLLLPGTIERDIVRRIKSRWDAPWLPYPRRPRACPVCATDPDSGRALVWD
                     LPLMLSCVEHRCRLERAGAVAGGDAPVVAVDETVTTMDGYTYQALTTGLVRLPGRTVH
                     AGVWFRLLRCLLEELCVSRLACSARTDAVLETIWDTIELPMRGRIAMLEPYECLDYDV
                     AETLMRAAALALALAAERSIPAVGELGSALAPVPYRPVPPGDPPVRRCAPSRLDLLNP
                     PRWWPAAPVQAGTARDWSQVARRYALKRGFPAWVFGGLTDEPGLD"
     CDS             complement(18705..20003)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_210"
                     /old_locus_tag="pnf1210"
                     /product="putative resolvase"
                     /protein_id="BAD60546.1"
                     /transl_table=11
                     /translation="MLIGYGRVSTADQNPAHQIDALRRAGVEPGDIHIDTASGAKASR
                     PKLDLVLTLARRGDTIVITRLDRLGRSMLHLVNLGADLRARGIGLKVLEQGIDTDTAE
                     GRAMFGMLSVLAEFQRELIVANTRDGLEAARARGRTGGRRPKLTVHQIEQAQRLYDEG
                     RHTVQQIADILGVKRGTLYGHLDKNSIGTRPHSGPATPLPTTSAPAAVVVDQADPAPG
                     IAPAITETATATPQTLGVPAGDPTDGRPGSPGGSSAVVTEAAPTGLVDLGGLVPEPDP
                     IRPLPAADADEHAETNSSTREFARERPNLAWRLKQTARMNLPEPPAVCPNDACGYTAH
                     ETSERGRLLEDIKVVWLEPADDGGLIEARHCHRCRPREVPIADIECAACDCGGPLLTG
                     VYATELRDTGEIPALVRRWLSVRRWRVTDAGPVCPDHPDS"
     CDS             20286..20993
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_220"
                     /old_locus_tag="pnf1220"
                     /product="hypothetical protein"
                     /protein_id="BAD60547.1"
                     /transl_table=11
                     /translation="MAVRFKLGYYSPLTDDPLNRDYVGYFPRMTEEEAWTAGRGVWKA
                     NKERLSREKFALIIGDSRVCAVAEIRGVSVYEDRVAVDGEALGEGHPVRDAWIGKPDP
                     VVNASQNPVGYCDLPEEAEFRERPCGCGCGEISTRDFLPGHDVRAFQDRVRRMFAGSA
                     LEFFRWVDRIGAEHGLPLLANPTGGTALPDEHREPPNPDPGEQSPHDPGISYAALSDS
                     GDLLSGNESRAESGEPV"
     CDS             complement(21272..22828)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_230"
                     /old_locus_tag="pnf1230"
                     /product="putative multicopper oxidase"
                     /protein_id="BAD60548.1"
                     /transl_table=11
                     /translation="MSSSQFPHSTPMTRRGFLALGAGVTAAAALTACSKNSTASRTLV
                     EPDSEAVRAAENRRRAAGAAVRQVRLRAEPATVDLGGVRVQTWAYGGTLPGQEIRITK
                     GNVLRAEFTNALSAPSTVHWHGIALRNDMDGAPEVTQPPIAPGGTFGYEFTAPDPGTY
                     FFHPHVGVQLDRGLYAPLIIEDPADGKDYDLEAVVVLDDWLDGVNGRDPDKELDQLRA
                     KGMSGMDMGGMDHGGMTMGGSSTMAMPTDPSAPLGSDTGDVRDYPYYLINGRIGADPV
                     TITARPGQRIRLRIINAASDTAFRVAVGGHQLRVTHSDAFPVQPVTTSSLLISMGERY
                     DAVVELADGVFPLVASAEGKAGQGFALIRTGGGTPPPADVRPAELSAPPLTADRLVGA
                     ESVRLPNRTPDNTLDLTLENDTAKYLWMINGKAFPDHSMLDVTEGQRVRLRLVNKTMM
                     FHPMHLHGHTFQVVSAAGTGPRKDTSIVLPMQTVEVDFDADNPGQWMVHCHNAYHGEA
                     GMMSVVSYVR"
     CDS             24477..25604
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_240"
                     /old_locus_tag="pnf1240"
                     /product="putative pyridoxal-phosphate dependent enzyme"
                     /protein_id="BAD60549.1"
                     /transl_table=11
                     /translation="MDKVVLDALADRSAALVGAPVAARYPHSLIGNTPVLWVGAPLAP
                     QGRGFWAKLEGFNPGGMKDRPALHMVRKAEQRGDLAPGARIIESTSGTLGLGLALAGI
                     ATHHPVTVVTDPGLEPIVARMLTAYGTQVDVVTEAHPTGGWQQARRDRVAELLAGEPD
                     AWCPDQYSNPDNVDSYESLALELVEQLGEVDVLVCAVGTGGHSAGVARVLRRFNPGMK
                     LIGVDTVASTIFGQPAGLRLMRGLGSSIYPINVDYDAFDEVHWVAPSEAVWACRTLAA
                     THHATGGWSVGAVGLVAGWAARTHDADTRIAAVFPDGPHRYFDTVYNDTYCEEHGLLD
                     ADPPVEPDTIAHPAERVVRSWTRCTTVVDPRQFIHDREPAS"
     CDS             25601..26965
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_250"
                     /old_locus_tag="pnf1250"
                     /product="putative transporter"
                     /protein_id="BAD60550.1"
                     /transl_table=11
                     /translation="MTVVAKFRSFDMAARLLMINQFGINLGFYMLMPYLAGYLAGPLG
                     LAAWAVGLVLGVRNFSQQGMFLIGGTLADRLGYKPLIVAGCLLRTGGFALLVFATSLP
                     GLLIASAATGFAGALFNPAVRAYLAADTGDRRVEAFAVFNIFYQAGILAGPLVGLALM
                     ALDFRVTAAAAAVVFAILTAAQLFALPTRRAETPAEHTSVLDDWRTVVANRRFVGFAV
                     AMTGSYVLSFQVYLALPLQAEFVAGAQAQALVSALFVISGVVAVAGQLRITAWFRNRW
                     GTGRSLVVGLGILAASFVPLVVVPDPDRFGVPPAAAALLVSAVLLAVGTAAVFPFEMD
                     TVVSLSGGKLVATHYGFYNTVVGVGILTGNLATGAVVGAARAAGMDWAVWAGLSMIGV
                     LAAFALHRLDRPQPVAEKGRSTRTRGRHRIPDQHTVGTAPAEQQFEYTGRGHWPTKIP
                     AARR"
     CDS             complement(27064..27708)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_260"
                     /old_locus_tag="pnf1260"
                     /product="hypothetical protein"
                     /protein_id="BAD60551.1"
                     /transl_table=11
                     /translation="MPLRSTALRRYLPGVAVLLFVLAGCGDSDEADKPTTTAGPSAPA
                     ISTTVGAATSAPAGTYNDADVTFLQSMYPHHAQAIQMADLVPSHSQNQQLLDLASAIK
                     TAQEPEMAQIRSLLEEFGKPVPSPATGPMGPMGHDMPGMMSPQQMSSLQSMSGAEFDR
                     MWLEMMINHHTGAVQMAQTELDTGANDRAKQLAAAIVPAQQREIDQMKAMLEQR"
     CDS             complement(27961..28347)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_270"
                     /old_locus_tag="pnf1270"
                     /product="hypothetical protein"
                     /protein_id="BAD60552.1"
                     /transl_table=11
                     /translation="MPPTPADLGDVDRDKLTKCIEECIACAQACTACADACLSEGMVG
                     ELTKCIRTDMDCADICNATASVLSRHTGYDANITRAILEACATACKACGDECSAHADT
                     HEHCRVCAEACRRCEQACTDLIQALG"
     CDS             complement(28776..31268)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_280"
                     /old_locus_tag="pnf1280"
                     /product="putative cation-transporting ATPase"
                     /protein_id="BAD60553.1"
                     /transl_table=11
                     /translation="MTTHSDTHLPPPKERATAVLDVRGLLFASQQNVVVARLARRPGV
                     HRVEVNPVAQTATVVYDQTQTTIAALRDWVVECGYHCAGRSVPAHLCDPLTEPDPPSG
                     DGYHEHTGHAGQLAPAEPIDDAGHAVAAPAHEGHPGGTGDLRSPHEAMGHGGHAGMSM
                     AAMVADMRNRFLVALLFSIPIVIWSPIGREVLGLDVPVPFGLREDIWALLLSLPVIFY
                     SSWIFFDGAGRALRARTLDMMVLVAVAIGSGWLYSLVITLTGGGEVFYEAATVLAAFV
                     LLGHWFEMRARGGANDAIRTLLDLAPPKALVLRDGEPVEIPTAEVAVGDLLLVRPGAK
                     IAVDGVVEDGDSEVDESMVTGESLPVHKAPGAAVVGATINSNGTLRVRATKVGADTAL
                     AQIVQLVQEAQNSKAPGQRLADKAAFWLVFVALIGGGVTLAAWLLLSDRPFSAAILFA
                     ITVVVITCPDALGLATPTAIMVGTGLGAKRGVLFKNAMALETSARIQVVVMDKTGTLT
                     KGEPEVTDVITDGIGETEVLRLIAAVERESEHPLAQAVVRYAENAGVGQVRAEKFENV
                     PGHGAIAEVEGRRVVVGNRRLAEREGIDLGALAARRDELAATGRTAVIAAVDGKAAAV
                     IGIADAPRETSPAAVAALHDLGVEVVMLTGDNEATAKRIAERLGIDTVIAEVLPGDKA
                     TKIAELQRSGRQVAMVGDGVNDAPALAQADLGIAIGAGTDVAIETADVVLMRSDPLDV
                     PTALRIGRGTLGKMRQNLAWAIGYNTIALPIAAGVFEPAFGLMLRPEIAALSMSGSSL
                     IVAVNALALKRLRLPIPKPAHTGTSEATRVIA"
     CDS             complement(31273..32025)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_290"
                     /old_locus_tag="pnf1290"
                     /product="putative membrane protein"
                     /protein_id="BAD60554.1"
                     /transl_table=11
                     /translation="MALLVSRGAAVWSLIGVLALLNVTVAFGAMFASITGVTTGVASV
                     LSNSASLLVVLPAWWLFGERPRLLGITGVAVGFGGLVIIAAPSGGGRGAGLALLAAFG
                     IAVGALLARRLSSIDLLVLGAWQFLLGGTVLAGIACVVEGPPTTIAWSSRFTLTLAVL
                     ALVATALPYLLWFGELRRASLTAVTTWTLLVPVVGVILGVVVLDEPITLAGVIGDVIV
                     VAGLAVVARAARPSRAETLSATDTVDYRPLEE"
     CDS             complement(32554..32847)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_300"
                     /old_locus_tag="pnf1300"
                     /product="hypothetical protein"
                     /protein_id="BAD60555.1"
                     /transl_table=11
                     /translation="MMFWYGDGMSGWGYGLMTVGMVLFWALVIVGVILTVRYLAQPSA
                     PVGGAPIVRPSAEQVLAERFARGEIDADEYHQRLATLRGDIGSGRGTKSGGAG"
     CDS             complement(37033..39279)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_310"
                     /old_locus_tag="pnf1310"
                     /product="putative membrane protein"
                     /protein_id="BAD60556.1"
                     /transl_table=11
                     /translation="MNQQQQSAVTERSPQQPLPPDSPGLLYRWGVLMARRRRTALAIW
                     GVLLAVCAVAYPLLENRLGAMDFGVEGSESTEVDRLVAQHFPQFGAEQAVIVLQSGAL
                     TATDSDFRAVVARTVTAAEEVQGVVDVVGPYDGLPGSQISADGHVAIALAGMDGDMAE
                     RARVARDLQDAIASTGDDSIDVGLTGYSAVQNAATELQNADLARAEAIGIPVALILLV
                     LALGALAAAAVPIGVAIAGLLTAVGVLFTLTTVTAFDSLTVAMATMVGLGVGIDYAMF
                     IVSRFREELAHHTVADHAAIAAAVGRSLATAGKTILVSGLVVMISLCALIIIQAPIFR
                     GIAIGVATAVTSMLIVAVTLLPALLAALGPAINRGALPARWRPADSTANAPGALSGRW
                     ARWAYLVMRRPVLFGTAAVAVLVIAALPVFGIRYGLDMGTTALDDTPTGRATTALTTN
                     FPAGALSPVEIIATGPGDTPLTGDPAAQVNRFLAEIADDDRIDTVLPAQLNDGRVLAL
                     ALPSVAFDSMEATDLIRDLRNTATDAAGAEIRIGGSTAEFVDLSDEMTSKLPLVVALV
                     LTASLIFLIAAFRSIALPIKAIAMNLLATGAALGITVAVFQWGLGENILDFTSPGFVQ
                     VYLPTVVFALLFGLSMDYEVFLIRRIREYWDTTGDNEHAVAAGLTHTARPITAAAAIM
                     IAIFASFLTADILELKQLGLALAVAVFLDAVLIRLVLVPALMRLLGDWNWWLPTRPSI
                     RPDTNTGI"
     CDS             39395..39784
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_320"
                     /old_locus_tag="pnf1320"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD60557.1"
                     /transl_table=11
                     /translation="MTINADGGCLVETQGLDPAVALFHSLSDATRLAIVRRLACGEAR
                     VADLMAGLELAQSTVSAHVACLRDCGLVVGRPQGRQVFYSLARPELMDLLASAETLLA
                     ATGNAVALCPNYGTDATTTETTAEVRA"
     CDS             39898..41745
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_330"
                     /old_locus_tag="pnf1330"
                     /product="putative cation-transporting ATPase"
                     /protein_id="BAD60558.1"
                     /transl_table=11
                     /translation="MLLVAALIVGWTGGPSAVELGLEIAALLVGAYTFVPSTFKRLAK
                     GKIGVGTLMTIAAIGAVILGEVGEAAMLAFLFSISEGLEEYAVARTRRGLRALLNLVP
                     DRATVLRDGTETIVSPAELRVGDRMLVRPGERVATDGVIAEGRSSLDVSAITGESVPV
                     EAGPGAEVFAGSINGNGVLTVEVTTTAEDNSLARIVRIVEAEQARKGDAQRLADKIAK
                     PLVPGIMIAAAAIAVIGAILGDPVTWIERALVVLVAASPCALAISVPVTVVAAIGAAS
                     KLGVLVKGGAALEAMGRVREVALDKTGTLTANKPAVVEISAVAGTEQATVLAVAAALE
                     SRSEHPLARAILAAVDTFTPATDVEAVTGAGLTGLVDGRPARLGRPGWIEPGDLAADV
                     ERMQHAGATAVLIELDGQVIGAIAVRDELRPEAHEVIDRLHALGIRVSMLTGDNTRTA
                     AALATEAGIEDVHADLRPEDKARIVGELRADRFTAMVGDGVNDAPALATADLGVAMGA
                     MGTDVAIETADVALMGEDLRHLPRALEHARRARRIMLQNVGLSLGLITVLIPLALFGV
                     LGLAAVVLVHELAEIVVIANGVRAGRTKPLASLPESTAKPAPVLAGASA"
     CDS             41742..42272
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_340"
                     /old_locus_tag="pnf1340"
                     /product="putative signal peptidase"
                     /protein_id="BAD60559.1"
                     /transl_table=11
                     /translation="MTATASSAPTVSRWGRRLRWAITAAVLAGLDLALKAWAQTALDG
                     APVEAGPVDLRLAFNPGAAFSIAADAPSWVMLSITTVITTGVAVGGWVLAPRASLLTR
                     VALAAILGGAAANVIDRAPDGLVTDYLHTGWWPTFNLADSFIVLGAIALIITTLIGNS
                     DEREQLSPDHHTDKRD"
     CDS             42301..43800
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_350"
                     /old_locus_tag="pnf1350"
                     /product="putative transporter"
                     /protein_id="BAD60560.1"
                     /transl_table=11
                     /translation="MAALVVALLTVGLDLMVLNVALPTLAQDLGASTTQLQWIVNAYT
                     LVFAALMLPAGGFGDRYGRKRLLLVGLVAFVAASAWAAYSGSTGSLIAARAVMGIGAA
                     IIVPLSLGILPTLFGPDQRRRAIAVWVGALGVGLPLGPIVGGWLLQHFWWGSVFLINV
                     PVGVAALVACVVLLPESADPHAPPLDWLGIITAVPGTAAVVFAVIQAPEYGWTDPIVL
                     TTLAAGVVLIVGFLVWERHTRYPLVDLGLFANPAFTWPTLAATAGTFTLVGVLFVLPQ
                     YLQILRHYDAFGTGLRLVPLVLAIIIAAAAVDKIVTRVGAKIPIVTGMLIAAAGFVLA
                     SRITADSGYGFVAVCLGVVGLGAGLALAPAVDAVMASLPEHRSAAGAGLLMAIRQVGA
                     AFSVAVLGTLLTLVYTRDLDPHLSALPEAVVGAARDNVAGAQLAATGVPGPAGADLAA
                     TSAHAYTEAMSAVFLASAAVSAVLAAAIAAKLPKQTPPPIGTSPAPGPR"
     CDS             43864..44484
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_360"
                     /old_locus_tag="pnf1360"
                     /product="putative transporter"
                     /protein_id="BAD60561.1"
                     /transl_table=11
                     /translation="MHSPRKASASMVTSILQAIGLFLVTNIDDIIVLSLFFARGAGTR
                     GTTVAIATGQYLGFGAILAASVLVSLGVTALLPEEAIAYFGLIPLLLGLLAAWRAWRN
                     SGDDDERFEGKKVAVWTVAAVTFANGGDNIGVYVPVFATVGTAAIVAYSVVFLLLVGV
                     LVITAKFLTTRKAIAEILERWEHILFPLVLVVLGIVILVSGGAFGL"
     CDS             44525..45364
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_370"
                     /old_locus_tag="pnf1370"
                     /product="putative DNA-binding protein"
                     /protein_id="BAD60562.1"
                     /transl_table=11
                     /translation="MGAQQGDLPLPALELPTAVRPRPQTGRAEVSAPEHRWSGGVSLT
                     PGLMTFTGEIGDAPAHAHAAVQVLFVARGRLTLTDATGYTTPALAAIIPPGVVHQVHT
                     EPGTSGFLAFLDPDSATAHAALAQLDGQPRQAATTWVSAATPAPSLSVGDPVTRPVRR
                     SSHPVVAQALRRATDWVGGPPSLGELAADIGISVSRLSHIFTAQVGLPYVAWRRWVRL
                     QLGFAVVRGGGSLTAAAHAAGFADSAHLTRTCRDLIGISPTEALIATGWRPPPARDRA
                     VTE"
     CDS             complement(45390..46679)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_380"
                     /old_locus_tag="pnf1380"
                     /product="hypothetical protein"
                     /protein_id="BAD60563.1"
                     /transl_table=11
                     /translation="MSAVLLDPGRGEENLSAIAAPLTGGGPRVISRAQWGADESIRCE
                     DPTYDDGLGGIVVHHTAGRNDYSKAESAAIVRGIYAYHAETLGWCDIGYHALVDKYGQ
                     IFEGHFGGLDRPVQGAHTGGFNENTAGVAFMGDHESEEPTQAAITAMGQFIGWRARVA
                     GLDPRGTTTMISEGTEFTPYGEGEQVQLPVVFSHRDVGNTTCAGDAAYALMDRIRAIA
                     AGVSSGAGPRQAPGGQDSAPAPAQPDADADADVSALAVLTGKLLDLVDRNVLARRWVD
                     AGGPQGRLGLAASEPVPTAEGGQYARFVNGYLFQAPDGQVYEVAGRIGQRFAQLGGDN
                     GVLGAPRSNEYPVPGGVRVDFGRGSLVFNEATGVVTTLGLPQPASDHPTQSAASPTPT
                     RAEAPPAPAPADAAPAPSPVPPGSVETVPGEVPVAGQ"
     CDS             complement(46772..47479)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_390"
                     /old_locus_tag="pnf1390"
                     /product="hypothetical protein"
                     /protein_id="BAD60564.1"
                     /transl_table=11
                     /translation="MVGVIGGAGSVGWFGPAIAVSTEVGVLVPNYARKRTYVLPLVAV
                     AVVTAPVTAGFLGGGGQFRFSNDSEADGVSPTATTQVGLSGAPRVVLPLRELAGMQLP
                     DLRVADLRLVPGAPPLPEGSRVGPIGFVAAAGAAPISARTPALDPGVVPEQLVDRVGA
                     QVTELTRESRFSMIGLTAPNLEGVTTMVRARQLDGSWGPWFEAGTDDSISARRPARGA
                     CRVVNRCMWVTPTRCKS"
     CDS             47643..48563
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_400"
                     /old_locus_tag="pnf1400"
                     /product="hypothetical protein"
                     /protein_id="BAD60565.1"
                     /transl_table=11
                     /translation="MTTLISPLIRYGYAPVMLLGINGTGIALAATGASKLWLIALLGL
                     AVAVSFTAERLLPYQAAWNNSHGDTGRDTAHTLVNETLILGSVAAIPVLAAVVPGDGI
                     WPGSWPFVVQVLVAILVADLGITLAHYASHKIGVLWRFHAVHHSVQRFYGLNGLMKHP
                     LHQTIEMTAGVTPLLLAGISVPVAAVLSLAVAVQLLLQHSNADYRVGPFKYVLALNEG
                     HRFHHLKWAGIGDVNFGLFTLIWDHLLGTYSYDPHRRFSSADLGMAAKPDYPVGYLAQ
                     LAEPFTRHGACEPTPEASVVLRATEQAKNA"
     CDS             48596..48955
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_410"
                     /old_locus_tag="pnf1410"
                     /product="hypothetical protein"
                     /protein_id="BAD60566.1"
                     /transl_table=11
                     /translation="MTMAKIRAAARARYHEEMQAANTTTDPARRWNHLERAHILSQPD
                     PWLHTANHIAMFALAVRQRDRREALGQIIRIIVAAPGSLAGLAPEGNTGRANVGLRQT
                     MTTPPDLAALLDPSPTR"
     CDS             49051..49728
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_420"
                     /old_locus_tag="pnf1420"
                     /product="hypothetical protein"
                     /protein_id="BAD60567.1"
                     /transl_table=11
                     /translation="MTARSVSRRTRLLTTVIAVLVIVVGAVVLAAARTDDNRPGNSVE
                     STTGEPALAVRPDSHRLSGPTDARVTLVEFLDFECEACRAMFPIMEQLRADYSDRVAF
                     VVRYFPIPSHFNSGRAARAAQAAADQGRFEQMYQRLFETQADWGEQRAPADEVFRGLA
                     AELGLDLGAYDLAYNDPATAARVRADFDEGLALGVVGTPSFFLNGEKISGGSYRDMAA
                     ALDAALD"
     CDS             complement(49747..50358)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_430"
                     /old_locus_tag="pnf1430"
                     /product="hypothetical protein"
                     /protein_id="BAD60568.1"
                     /transl_table=11
                     /translation="MTAWWALALYLLFAALGFGWRSWRQHRATGSTGFRGISGRPGSL
                     EWIAGVGFLLAIGVGVAAPLLQLADLVAPVAILTAAPIQGIGLVAALAGIAATVYAQN
                     QMGDSWRIGVDDTETTTLVRTGVFRLVRNPIFTAMLLFAAGITLLIPNPVAVAGFALL
                     LTTIELQVRIVEEPYLTRVHGPDYQAYLASTGRFAPGIGRARA"
     CDS             complement(50419..51342)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_440"
                     /old_locus_tag="pnf1440"
                     /product="putative cation transporter"
                     /protein_id="BAD60569.1"
                     /transl_table=11
                     /translation="MGAGHSHGTSNPNQGSASARYTTRLAVAIGLGLVTFITQVVVGL
                     STSSLALLSDSAHVFTDVFGVSMALVAIMIARHATRGGARSFGMYRGEVFAALFNAVL
                     LFAVAGWVLYEAIGRLSDPPEVPGLPVAIVAVVGLAMNVISMLILRQGAKDSLNVRGA
                     YLEVMADMLGSLGVLASGLITLFFGWRYADPAIGVAIGLFVLPRAFSLGRQALRILFQ
                     HAPAELDLTEIEQSLRGLDGVREVHDLHVWTLTPGMEVASAHVVIDRDADLDTVLGSA
                     QQLLAEEYHLGHATVQIETDGSTERCRNTTW"
     CDS             51565..52203
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_445"
                     /old_locus_tag="pnf1445"
                     /product="hypothetical protein"
                     /protein_id="BAD60570.1"
                     /transl_table=11
                     /translation="MRPHIRWLVVFVIVFAALAAALWPRSDSTTALPERVFGQPDAAT
                     GRIEDGPPQDQRVGAPALPPCPIPGGVSAGGGPLRGVLARCLGSAEQVDLGVALTGEP
                     TLINLWASWCAPCRSEIPVLNAYASDPDSIRVVGINVQDDPTTAAELLAELQAGYPSF
                     VDGGAVQKALPAPPVLPLSFLVQRDGTVRRITTPAVFDNPAQIDATIREMTR"
     CDS             52200..52862
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_450"
                     /old_locus_tag="pnf1450"
                     /product="putative thioredoxin"
                     /protein_id="BAD60571.1"
                     /transl_table=11
                     /translation="MTHLRTTKAARHGHRYGRARHRQLRLLAAMALVIAAVTAVISCA
                     SGSDSVATGGGTFDFVSPGGQTDIFYDPPESRGKIGVLAGPDLMAEDKTVSVSDYTGQ
                     VVVINLWGQWCGPCRAEADDLERAYAATKASGVQFVGINVRDQQRDKAQDFVIDNKVS
                     YPSIYDPPMRTLVALGGSYPTSVIPSTLILDRKQRVAAVFLRALLTSDLQPVIERLAA
                     EQ"
     CDS             52859..53668
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_460"
                     /old_locus_tag="pnf1460"
                     /product="putative membrane protein"
                     /protein_id="BAD60572.1"
                     /transl_table=11
                     /translation="MTALAQGIGTSFQDAAATGPLFLALAACMVAGLVSFASPCVVPL
                     VPGYLSYLAGVSGASATLSQADDIGPGRSSDRWRVAGAATLFVAGFTVVFVLATASVF
                     GVITALRLNADLLQRIGGVVTIVMGLAFIGLIPALQRDTRFAPVRVSSLLGAPLLGAV
                     FGLGWTPCLGPTLTGVLSVAAGTEGTTATRGVVLIVAYCLGLGMPFVVLGFGSSRALR
                     GIGWLRRNTRRIQTIGGILLILVGTALITGIWAQFVAWIRDEFVTAVVLPI"
     CDS             complement(53715..54521)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_470"
                     /old_locus_tag="pnf1470"
                     /product="putative peptidase"
                     /protein_id="BAD60573.1"
                     /transl_table=11
                     /translation="MPHHRMTSGSLSVKELLGEVTDEPRARHRMAADSTDRFKGVAGV
                     AVAAGALLGTMAQAAPATAATTDLRAGGISDADADSDAAVSAAAPASTPATAPFGLGG
                     LPDELAAPLAQAEQIIKDLQTASPSVTAPAAAPAVLPVGREISSGYGSRWGAFHYGVD
                     IADALGTPIRSAMGGTVIEAGPASGFGQWVRVQQDDGTIAVYGHINEYYVQAGDRVSA
                     GDVIAAVGNRGQSTGPHLHLEIWDQDSNKIDPVAWLEGNGVLTEQRWGID"
     CDS             complement(54602..55297)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_480"
                     /old_locus_tag="pnf1480"
                     /product="hypothetical protein"
                     /protein_id="BAD60574.1"
                     /transl_table=11
                     /translation="MTSESPTPEATPPARRRSSAIWAAALVAAVIVGLLAGFWVRGVL
                     GSDSSAPALDVVDVGFAQDMATHHNQAVEMSATALEQAEDPAVRTLAFDVLTTQQSQL
                     GMMRGWLMLWDRPLSSEQPMLWMRRGDSHTAGTDHQMPAQESMRMPGMATTEELAQLR
                     RARGAAFDTLYLQLLLRHHEGGVSMARAARDNATVPAVAALAKQIDDAQTAESQAIRA
                     MLAQRGAPTLPMN"
     CDS             complement(55294..56076)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_490"
                     /old_locus_tag="pnf1490"
                     /product="hypothetical protein"
                     /protein_id="BAD60575.1"
                     /transl_table=11
                     /translation="MNNKSGARSSKRGPRAGKKATAAAIGGKQPPWLLIGAAAAIILL
                     TVGLALYYVPKYREYSEAQRYVPGSGQSDPSEMIDGVTKQEYPAGSHVRATQRVAYDQ
                     APPFGGPHDQSWATCTGEVYTTPIRSENAVHSLEHGAIWVTYNADRLSGEDLAALRGE
                     VEGKPYMFMSPYPNLDSAVALQSWGRQLKLDSVDDPRIRRFVTALRQNPNTHPEPGAS
                     CASGGGFDPDAPPPFDPSPPGPDAVPLPPAGAGSTTPSGGRR"
     CDS             complement(56073..57158)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_500"
                     /old_locus_tag="pnf1500"
                     /product="hypothetical protein"
                     /protein_id="BAD60576.1"
                     /transl_table=11
                     /translation="MISPELLAAIPLPDTPPSIGSMLAWNPPSFPVLPALALAASILY
                     LIGLVRLRRLQRAWPWWRTACFLAGCLLLAAITGLGIEAYGYQLFSVWMFQHLTLSMT
                     IPPLLVWGCPGLMLLRATPHRGLGRLVLAVAVSGLRSRTMRWMLHPGFTIPLFLFSYY
                     GIYLTPVFDNVASTVLGHQLLELFFLLSGLLFVVPILSVGPLPIRQTNLGRFFDLFVE
                     MPLHVFFGVILMMATTPLVEFFATPPPQWGIEAMRDQYLAGALAWSYGEPVALVVVIV
                     FAIRWRRDEMRDNAVADRRSDLVGDDELAAYNAFLNDLYPRRPDRSAVSRPVASLVRE
                     HDAAPASAIISTGHVTDAGSSARRNTA"
     CDS             complement(57166..57684)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_510"
                     /old_locus_tag="pnf1510"
                     /product="putative copper resistance protein"
                     /protein_id="BAD60577.1"
                     /transl_table=11
                     /translation="MMLTALGLTLTAGSARAHSQLDSSVPAADAVVDTPLTLITLTFN
                     QQIGTAFANVGLTDAAGTSWAAQVSKVEGKTVRVAVSPTMPAQKYTVAYRVVSDDGHP
                     ITGSYEFTYASGSATTTAPSGAPSPSSVTAAGESSATALSSSLPWPLIVAVIVLIGGA
                     VVTLRAATRTKR"
     CDS             complement(57825..58766)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_520"
                     /old_locus_tag="pnf1520"
                     /product="hypothetical protein"
                     /protein_id="BAD60578.1"
                     /transl_table=11
                     /translation="MIVALGAAWAAALLSLASPAILQRITPSMTPRTAVACWLISLGS
                     AVVLAGVAVTAALWPGHAPGVGVAEAAMLCLTRVVHSVPHWLADPLTVAALAGVVGLS
                     YRVALSARRHTRAGARVRAYHRDVVSVVARRGDEDMPVMWLDHPKPMAYSVDGRPGMV
                     VATEGLARKLNDGQRQAVLAHELAHLRGGHHRLIRGCEVLAAAMPWIPLFADAPKAVA
                     ALAEFAADDCAAAATSPATIRSALCAVAATTGTEPASTLSLAGQVLQQRLQRLESSNP
                     PRRSSRWVLMGLSPIVAAVAAPAGLLTCAVVACVVMS"
     CDS             complement(58763..59125)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_530"
                     /old_locus_tag="pnf1530"
                     /product="hypothetical protein"
                     /protein_id="BAD60579.1"
                     /transl_table=11
                     /translation="MNGLGTLEARVMDVLWGTSEALTVREILERLPDPYAYTTILTVL
                     THLHEKEWVVRVMHRRAYLYRPTRSRAEATAEVVRGIIDSSNDPESVLLHLASIVTEA
                     ESEAFHRGRTRPRKRSRK"
     CDS             59605..61875
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_540"
                     /old_locus_tag="pnf1540"
                     /product="putative transporter"
                     /protein_id="BAD60580.1"
                     /transl_table=11
                     /translation="MSQAEAPESADDLHTSPSSPSRDRLRGILRHDLPSSVVVFLVAL
                     PLSLGIAIASDAPIMAGLIAAVIGGIVAGAVGGSPMLASGPAAGLTVVVAELVAKFGW
                     QVTCAITVAAGALQILFGLSRIARAALAISPVVVHAMLAGIGITIALQQVHVLLGGTS
                     RSSVWQNLSQLPAQLTRLHWGDLTIGLIVIVTLLSWKKVPGALGRIPGALVAVVAATA
                     VSLVVPLGVERIVMNGSLFDAIALPALPDGKWLAVATGVLTVALIASVESLLSAVAVD
                     KMHSGARTDLNRELIGQGTANIASGMLGGLPITGVIVRSATNVAAGAKSKASTILHGV
                     WILLFSVLLAGVVQQIPKAALAGLLIVIGIQLVKLAHIRLAHRTGDLWVYLITVAGVM
                     FLNLLEGVLIGLIVAIALFVWRAARADIHAEPVGDLDSLRWRVVIEGSCSFLSLPKLS
                     STLDSVPEGADVTIELTVDFIDHAATEVLHEWQRRHRDAGGTVLIDELGSHALSATTQ
                     GPPQRASSAQARGVEPWKAWQDTNAQAVPHFDALRPMLDGISRYHRRHAPLMRAHLSE
                     LRDRQDPTTFFLTCGDSRVVPNLITHSGPGDLFTIRNIGNLIPSDGLDTSVDAALAFA
                     VEELGVSTIVVCGHSGCGAMGALLGKPTKNSPAVRDWLAHAEPSLRAYHDNHPVAAAA
                     EAAGFDAYDQLAIVNVAVQIATATQHPSLVSAVAQGQVQIVGLFFDIATATVWHVSPT
                     TVTAHHNQLATSTVHA"
     CDS             61951..63243
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_550"
                     /old_locus_tag="pnf1550"
                     /product="putative esterase"
                     /protein_id="BAD60581.1"
                     /transl_table=11
                     /translation="MIMQWSLVTGPLPWLLSGVGALCAAWLIGARRRLSAQAVAECAG
                     LGFGAAIVIWVVVERWWRPFPDALPRSVYTWVGIAVAALALLAVRISVTPRWIRRIAA
                     VTAAVCVITACAVQINLEFGAYPTLEDLLGTGSDNRISLTAVPAAQPNPVTGWPIESV
                     WSPPPPTQVDGRVVRAVIPGTRSGFRARPAEIYLPPAYFTDPRPLLPVLVLLPGQPGS
                     PVDWLNGGRVDQTMDAFAAAHGGLAPVTVIADATGGAWRNPLCLDSRLGKVASYLAID
                     VPAWVNGRLQVDPDPRRWAIGGMSYGGTCALQIATNYPDRYPSFLDLSGDAEPSLGDR
                     RQTVQAAFGGDTAAFERVNPPTLLRTRRYPNSAGALVTGTEDDTTLSAQRSIAAAARA
                     AGMTITTRELPGGHNWSVWSAGLRIEMDWLAQRLGLTR"
     CDS             63581..64240
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_560"
                     /old_locus_tag="pnf1560"
                     /product="hypothetical protein"
                     /protein_id="BAD60582.1"
                     /transl_table=11
                     /translation="MLRTLIQYGLDGIGTDGSVSRAINRSADATQWLHPVMLAVDRFG
                     IVLAPLALFAARWSTRRTAAAAPFPAISTAVAASGLAYLLARITAASAQHHPPCAIDQ
                     TRIVLEYCTNTYSLPDATLSAAAAVAAVLAQIDRNLGIAVWASVSGFLVARVYVGHDY
                     LIDVVLALTIGTSVAVVLTSITRAAAPLVNRTMTRTRRRRCARRTATGHPRAGSDTEA
                     R"
     CDS             complement(64204..65247)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_570"
                     /old_locus_tag="pnf1570"
                     /product="putative cation transporter"
                     /protein_id="BAD60583.1"
                     /transl_table=11
                     /translation="MSTMGAEHALAEHTATTGGHAHDNNANAHHGHGHSHGVSADADR
                     RWLVLALGLIVAFMAVEVIVGVMAQSLALLSDAAHMLTDAASIVLALIAIRLAKRPAR
                     GRFTYGFKRAEILSAQANGITLLLLAAWFLYEGVQRLVNPPEVSGPLVLITALVGIVV
                     NIVAAWSISQANRTSLNVEGAFQHILNDLYAFIGTAIAGAVVWLSGFARADAIAALVV
                     AVLMAKAGWSLVRESGRIFLEAAPAHLDPDQIGSRLASVPQVSEIHDLHIWQITSGQP
                     SLSAHVLVADAADCHSVRSGIESVLHDEFGLEHTTLQVDHAADVHAGAGDGHCADPHG
                     PVHRASVSDPARG"
     CDS             66064..67206
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_580"
                     /old_locus_tag="pnf1580"
                     /product="putative pyridoxal-phosphate dependent enzyme"
                     /protein_id="BAD60584.1"
                     /transl_table=11
                     /translation="MNAVLDDLGFTPATLLTTGTRCLRPATLVGNTPVLWIGAPLAPR
                     GHGFWAKLEAANPGGGMKDRPALCMVERALGRGDLTPGARIIESTSGTMGLGLALAAT
                     TYGHPLTLVSDPGMEPLMCSMLAAYGATVDTVHAPHPVGGWQQARRDRVDALLATDPT
                     AWCPDQYNNPDNIDAYSPLALELIAQLGRVDVLVCSVGTGGHSAGIARVLRRYCPQLR
                     LVGVDTIASTIFGQPAGTRLMRGLGSSIYPGNVDYAAFDEVHWVAPGEAVWAARTLAR
                     THHATGGWSVGAVALVAGWTAATTNPDTRIAAVFPDGPHRYYDTVFNDNYCRVNDLLD
                     HAPPTEPVTIADPAEAVVTSWTRCTNVIDPHQLQSANTHAVAEAIG"
     CDS             67203..68462
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_590"
                     /old_locus_tag="pnf1590"
                     /product="putative transporter"
                     /protein_id="BAD60585.1"
                     /transl_table=11
                     /translation="MIATVGSWRELNRPSQLLMINQFAINLGFYMLMPYLAGYLSGAL
                     GLAAWTVGLVLGVRNFSQQGMFLIGGTLADRLGFKPLIVAGCLLRTAGFGLLAVVDTL
                     PALVIASAATGFAGALFNPAVRGYLAADAGKQRVETFAMFNLFYQAGILAGPLVGLGL
                     MTLDFQVTAACAAAVFAILTVGQLAALPSHPVCAGGEKTSVGQDWRTVVTNRTFVGFS
                     IAMIGAYVLSFQVYLAMPLHAAILSGQHPGTGLVTAVFVVFGTVSVLGQMRITRWLSV
                     RYGRRGGLAIGVGTLGVAFTPMLLFPGPGGSAAVAALLISAALLAIGSAAVFPFEMDT
                     IVAVSGNRLVATHYGFYNTVVGTGVLVGNLGTATLLDLARRSGSGALAWSVLVAIGVV
                     AAIGVYILGRIVPPETSQPAEVAVSRS"
     CDS             68643..69671
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_600"
                     /old_locus_tag="pnf1600"
                     /product="putative copper oxidase"
                     /protein_id="BAD60586.1"
                     /transl_table=11
                     /translation="MNDPSRRFLLGGALASTAGLALAGRSLLDASPAKAQAPVPAGHG
                     GGADGPTFRIGQTVDHTANGFNPTQVLRDFDYGTTTRLPDGRTLREWEVFASDEDIEV
                     APGVTFPAWTLNARVPGPTLRCREGELLRVHFRNGSEHPHTLHFHGIHPAEMDGIAGL
                     GAGIIQPGQSTTYEFDATPFGLHLFHCHVGPLAEHIARGMYGTFIVDPPTPRPPADEM
                     VMVMHGYNTTFDGEGNQLYAVNGIPFHYMHEPVRVKRNELVRIYLVNVLEYDPINSFH
                     VHGNFFDYYPTGTRLQSSEFTDTIVQGQGQRGICEMRFPHPGKYMFHAHKTEFAELGW
                     MGFFEVSD"
     CDS             69671..70858
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_610"
                     /old_locus_tag="pnf1610"
                     /product="putative metal cation transporter"
                     /protein_id="BAD60587.1"
                     /transl_table=11
                     /translation="MSTTTPATRRPWLLGVAALILLVLALIGLALLGGASLPDRAGPP
                     VEEIGVEQVVLEPGTIELNLRNTGPDPVAIAQIFVNDTYVDFTGPAEPIGRLSSAHLV
                     LDYPWQNGQPYKVSMLTSTGLVIEHDIAAAVETPRAGASFFGLMALLGTYVGIIPVVL
                     GMLFLPFLRSVGTTTVRVLLGFTIGLLVFLAWEGTREGFEIADTSGGPFGGASLVVLG
                     AILAFLTLTAVDQWLRSHRTAAAEQGAASGTRLALMIAIGIGLHNLGEGLAIGSAYAI
                     GELALGTFLVIGFTIQNTTEGLAVVSPLTERRPSLAALAGLGLIAGAPAILGAVIGAG
                     ANNPEVSALLLGIGVGAIIQVIVQITPSVREPGTTTIGIRTLAGIAAGLVTMWATGLL
                     VAA"
     CDS             70855..71265
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_620"
                     /old_locus_tag="pnf1620"
                     /product="putative iron sulphur protein"
                     /protein_id="BAD60588.1"
                     /transl_table=11
                     /translation="MNTDSVTTTPITRRTALAGACTLCAVAVTGCATGQASQSDGQPV
                     RVARAGIDIGGAAVFPEHRILVTQPSDGVYKAFSAVCTHQGCAVTDVDGDVVKCPCHG
                     SKFRLTDGSVAKGPAQRPLPERAVMVDGNTLIVS"
     CDS             complement(72017..72865)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_630"
                     /old_locus_tag="pnf1630"
                     /product="putative DNA-binding protein"
                     /protein_id="BAD60589.1"
                     /transl_table=11
                     /translation="MTVKLRLNHKLLAARAHEMGFSAAAVVRETGFSLTDLERDPDQR
                     TVTLTMLSRLHALLGLSVDEMLLSDRAAKGLAEHDRDAIDAIDAIDAIDAASHARTLL
                     AVLVSRDGIGVDVLLAATRWSIAEFEAALTYLRAQLDQTALQVVATDVVLHLALRPGA
                     LPGPLRAALARPTAMRRGLDADTAIQLLRLVRKEILRPVPGGPIPLPSEVNADRDIDT
                     RRLLDAGIAVGRGTKRGDELVITFDDYDGITDSEQAVAGLRIHPDVMFGLGLAERPAR
                     RRPASK"
     CDS             complement(72862..74415)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_640"
                     /old_locus_tag="pnf1640"
                     /product="hypothetical protein"
                     /protein_id="BAD60590.1"
                     /transl_table=11
                     /translation="MTSEQGLACDPIVDLDAANAWESLPVRRRRRHRVTVLLDPLDDA
                     AVVAALLDVHDQTGPVVTVHPTPATHSSSALALDILAALGRPVRYLAAEKANAPSSLW
                     HAVRAWVAAEDIERLVVLRAQRLHKDSWNALLDLWRETGVGLVLVCHATSRPAVLAML
                     PAGVNPRVVAPVSTLLRHFPPERSPDVDAEVEVLPDVPDADVVAFRAEAFRRLSRTDF
                     AQVDEVYRAGMAAACRWLHGHPGPVLPTTRAEEALRRMGPTGVRSLELRRGAEALAQR
                     YDESELRHIAVGLLCLNGPRSSEMHKLPYRFDDDDGLDCFLTGLVADSPTRNHTITLL
                     RGAQAGALLHGLLIQLPGHLTRAAGPGMTGRPITAAVAARIRAGTVSPVHAAALACAL
                     FTGFDRHELARIPIAGLSMDAGMLRWNNAERYLFDRSPIWVVTSVPRRARPMLAAART
                     FLGLRGVEPKKSLFTGAISSAGQIVPTTAARAGIALPTTISAAGSWTGTATAWWVGSP
                     LHNDMDYSR"
     CDS             complement(74412..75200)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_650"
                     /old_locus_tag="pnf1650"
                     /product="hypothetical protein"
                     /protein_id="BAD60591.1"
                     /transl_table=11
                     /translation="MTRGPITPTEAADDEGADHYLNLPGAHVVATDALLAVRDNLADV
                     IEAKAMMCVHGDAGLGKTLSVNTSLREQPAGSVCRVQFRARPTPRDIRHTLFEALAIG
                     GDPPRKPIEFDRVLKDVLAERFRVLVCDEAQWMSRECFEYWRHLWDDRFTDMAIVFVG
                     GGDCYEVLRREPMLSSRVYVWQEFRRMPRAQVLRVIPAYHRIWANTDPELIAFADKSA
                     GHGNFRSWAKITAHAARTLDKIGRDTVDGDVLGYVFSKLSGRSS"
     CDS             complement(75197..76756)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_660"
                     /old_locus_tag="pnf1660"
                     /product="putative recombinase"
                     /protein_id="BAD60592.1"
                     /transl_table=11
                     /translation="MADAAKRALQHAAVDRLAVLDQHGDLSSDHVRLTAQTLGVTERT
                     VWRWLADRRGAVRKDERRARFRIDAQLRVRFAYWRGNASALHRELRERERAGGPPAPS
                     LATLHRAIREDMTRGDIAGIREGERSRRKFDVFLKRPSTYRNAAWEADHVEAAVEVDV
                     DGRLMKPWVTWFVDTEHCVIMGVAVTPKTPNREAILAALRAAILRTPPYGPAGGVPTL
                     VRIDQGKDFLSRTVSDAMGAFAVRVVDLPGYTPHLKGSVETVNGAVERMLIAEMPRYT
                     HAPVGMNGTPTDPDAPALPFEVFVADLLGWVNWWNTTTEHNIDRLDGSSPLESWLADP
                     TPLHELDANKLWMFTLEDDRAHRKITTKGVARGRGRHYVADWMVGMVGARVRLRYMPN
                     HDHEVEVFDLASSRHLGSAWLADQATGEQIGRVRRARDRKAAQLRRDLKTAEKARRTR
                     YAAVTTVAPAQRLGAMTVAEVEAELGDEDYTELASLARPNLIPHSPPAPGWVLPVDLD
                     APEPQKKGRTR"
     CDS             77152..77934
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_670"
                     /old_locus_tag="pnf1670"
                     /product="hypothetical protein"
                     /protein_id="BAD60593.1"
                     /transl_table=11
                     /translation="MRGGSGMREAVLTTRLALRLFEPGHVAALHEIFADPATHPIGEG
                     PFSDIAATEAWIQHRITPRAGTGLCWYGVHHRGTGALLGNCGVFPRRTGAREPEIGYE
                     IRARDQGHGFAREAATAVLAEDLRPHPSMSNSPHPHELVGRRASFGIVEEAVVLGVGD
                     PGQIAHPGPARVRQLLDQLRDRHRRVRQFDGGDAVPADRAAGMPDEHQANGASAAQPQ
                     QPGHRARAEQVRAARSGSRSGRPAATPSPSAPPAARFCLPGS"
     CDS             complement(77931..79334)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_680"
                     /old_locus_tag="pnf1680"
                     /product="hypothetical protein"
                     /protein_id="BAD60594.1"
                     /transl_table=11
                     /translation="MPWSNAGAGRGVGGRSVVVDVPGRGLRKAAVQPLLTLDRRGALS
                     SAHVQLSAETLGVAERTVWRWSGWALRLRRDVRRQGSYTALVNSGISAEHPAGFEFDF
                     SYWFDCDCGRRVEVTAGEYEQQCGGDEESYPVCECGDSIDISTARPALRDLDDIDCHD
                     DQVDRHLWYHTSPYQDWPSPRYRSDITALIKRSLLSPSEHEKAIEGRTSLALHLGTYA
                     AAVENMLRRMHDQDSPTHRYWLHQVQVQLGATDLAPGVRGELSTWFGDVPMTALTDLG
                     ARAVRYVNTHESPGSISLAIDATVIVRVRTIPLPPAASALPATEAGEQAVTRAVAALT
                     AAQQLRPDTTGIPEEEIFESELDLVIAQMRGRIVDDEAVQRANEFASQFEESRNQEHE
                     ALSSLRAELAEIYLPNVNPQLRTRVDDAIAVGTAPGEYHLRLRQLAALIAQPHQVLRY
                     FDNAPWRKFDPPSRLTS"
     CDS             80062..81126
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_690"
                     /old_locus_tag="pnf1690"
                     /product="hypothetical protein"
                     /protein_id="BAD60595.1"
                     /transl_table=11
                     /translation="MISLAVVRFDFSRLPTERERKALTIRRDRLTAAQKTRTVAVANL
                     GKLSAERELTAVRVRDGFVRLPFPLVDDTSDRSAPAPEHRPTSTRLMTPNGIGLRLML
                     IALFEAQSRTAPGTRADGTPIPLHARVGSGRIGWTTLLSSSAQPAGDGKYRMSVVDKQ
                     MRQLQTTFTKLEREGLIEPADPKRRGRGRYEGFFLRYENIRSGETGDRYRVPDSEDPY
                     FDIPVSLFTNGWIHVLEDSELALLLITIRMYHRHGAEPQKLAAGTRLLHYGLSRDATE
                     SHLMLTRLGLIESHGDPARTDHGKVTDYKNIGAQPHEFLFLPAGLDRDASTTTLEEIQ
                     FQLDRETKGSARSIADAKTT"
     CDS             complement(81608..83131)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_700"
                     /old_locus_tag="pnf1700"
                     /product="putative monooxygenase"
                     /protein_id="BAD60596.1"
                     /transl_table=11
                     /translation="MTGPVLRHSVVVVGAGFGGLTMGAELKAAGVHDFVILEEGNDVG
                     GVWRENTYPGCACDVPSHLYSFAFDPHRDAQVRYPDQASILAYMRAVADRNGLREHLR
                     SSTSVKSAVYNDADGSWTLTTERGQHLHTEAVVWAVGQLHRPAVPQIPDAHTFGGRAF
                     HSARWDHTVDPTGHIAVVGTGSSAAQMVPELARTAASVTVYQRTPAWILPKPDSRFGP
                     GTRWALEHIPGLHRLYRAGLYHGADLVLAPIMRGGWSARPAAWIARAHLRRQVPDPAL
                     RVKLTPHYRIGEKRILMDSRFYPALALPHVELVTDPIDRITEEGIRTADTPHRRTHRR
                     HDVIVWATGFRAPELLGGITVRGRGGRDLHAQWAHWGRPEAFFGLAIPGFPSMYLIAG
                     PHSFTPANSNPALKRHQARYIMRCLELTARLGAPIEVAPASMANYRRWLNTELARTVW
                     PDGVPSWFKRRSDGQITNPWPASAREFGRLLDRHHPADTFTEVSVAAGAAGQDWQAG"
     CDS             83374..83670
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_720"
                     /old_locus_tag="pnf1720"
                     /product="hypothetical protein"
                     /protein_id="BAD60597.1"
                     /transl_table=11
                     /translation="MYALGVGYHFRDDVAESVYLHDVTKAEVMEALAYPRRWPQRIES
                     KVDARVLQIFSRTAEGNGVAVVVIQIDRWDWLIYAARPLEVDENAEYTVWEAQQ"
     CDS             83667..84023
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_730"
                     /old_locus_tag="pnf1730"
                     /product="putative regulator"
                     /protein_id="BAD60598.1"
                     /transl_table=11
                     /translation="MNIERRIEELTAQAADADLMGDFLAGRLVRSSEPADVSELPVPD
                     AAEVESVALIPTTVRFSKAQRDKLTELAKARGTDVSSLLRAWVDHQLEVTEHPERQLI
                     TVDEAIQALRNLPHSA"
     CDS             85135..86532
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_740"
                     /old_locus_tag="pnf1740"
                     /product="hypothetical protein"
                     /protein_id="BAD60599.1"
                     /transl_table=11
                     /translation="MACQTFPPSPFQVCGAILDKYLQTGGPNGFLLFPKSDELTNPDG
                     FGRRSEFLGGNIYWSPNTNAHPVAHEFLTKWGEYGYEGGFIGYPLTDEIVLSDGIGRR
                     QEFQGSWIYWHALTGAHNIQGAIRDKWLESGGERGPLGYPSTDEVVTPDGNGRFNRFE
                     RGMIYWSPSTGAHAVSGRILTLWSAAGYETSHYGYPTSDATAGAEPGSLIQQFEHGSI
                     YVLNDYLRALLVPAQGFASYDTGLHPGYCPDPLNSPPTCPVDLSDYDTVPDPFGTLVT
                     ANMQKAALVSTYFAANGRPNAHELWEHYYRNTGDDYVLSSALLDSWTAEESTDYPGLR
                     PPAELVNANKVEAINAAIAETARTGQTAKVIISTPWQVTAGISNDQVQSIGRYSLCST
                     TAVIAQPANPGQNPIELRQQTHIYDVYDYAAGDDYGNPAQDAVAVAVEGEKLGIAKPF
                     LVLGSSSVHSWSGIR"
     CDS             86639..87004
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_750"
                     /old_locus_tag="pnf1750"
                     /product="hypothetical protein"
                     /protein_id="BAD60600.1"
                     /transl_table=11
                     /translation="MSSAAPGNVSRPCSAGWGVGAGLFVSTVVFVPAVFVVRQWLDLP
                     EIPATPSHLRAHPVEVPDSYWITWLVAAVVLLAPGVALMLWPRMRRVAMGYTLTAGFV
                     AGLLAALTIGFELGGFAPT"
     CDS             complement(87248..88486)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_760"
                     /old_locus_tag="pnf1760"
                     /product="hypothetical protein"
                     /protein_id="BAD60601.1"
                     /transl_table=11
                     /translation="MDCNTSGLQHLVISGRRLGADSTALLLRWIFDPDSRDFDLAELA
                     VVTAMVGDEWEDTARDVTEVVLPLLAQHRIRFIQIGRADRRVRADGTGVVVFDDSRSP
                     HRLHIEGAYTLGTEMLTAGIQPQVGGSRRCSMSAKGEVLDPVIAAITHGRPYRHVVGF
                     EAGELSRARRDAGYDTALRRGEYPLVSWGWDRERVLAYIDEKTGRAWQKSACVFCPFA
                     LVTAANRAATLTRYAEFPDAGARMLLMEHTALALNAKQGLVGGKRAIDYVRAAGLTGV
                     LTAFESALAEQPHALYEVRRLARRTQTGGAKMVARSVRAVDVGSRDEMVAWLDGAPLR
                     VDIGGPDGSPALVDTHRELGDDGIARAVVPGRDGTGPHELEHFFVVAPAVVADKERPG
                     FADWWAQATGTDLALFPMST"
     CDS             complement(88832..90388)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_770"
                     /old_locus_tag="pnf1770"
                     /product="putative multicopper oxidase"
                     /protein_id="BAD60602.1"
                     /transl_table=11
                     /translation="MSSSQFPHPTSMTRRGFLALGTGVTAAAVLAACSKDSTASRTLV
                     EPDSEAVRAAENTRRAADAAVRDVSLHAEPATVDLGGVQVQTWAYGGKLPGQEIRITK
                     GDVLRAELTNALPVPSTVHWHGIALRNDMDGAPEVTQPQIPPGGTFGYEFTAPDPGTY
                     FFHPHVGVQLDRGLYAPLIIEDPADGKDYDLEAVVVLDDWLDGVNSRDPDKQLDQLRA
                     KGMSGMNMGGMNHGGMAMGGSSTMAMPTDPNAPLGSDTGDVSDYPYHLINGRTGADPV
                     TIAARPGQRIRLRIINAASDTAFRVAVGGHQLRVTHSDGFAVQPATTSSLLISMGERY
                     DAVVELADGVFPLVASAEGKTGQGFALLRTGAGAPPPAEVRPAELAAPPLTADRLVSA
                     ESVRLPLRKPDKTLDLTLENNAAKYLWMINGKAFPEHAMLDVTEGQRVRLRFVNKTMM
                     FHPMHLHGHTFQVVTAAGTGPRKDTSIVLPMQTLEVDFEADNPGQWMVHCHNAYHGEA
                     GMMSIVSYMR"
     CDS             complement(90598..90999)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_780"
                     /old_locus_tag="pnf1780"
                     /product="hypothetical protein"
                     /protein_id="BAD60603.1"
                     /transl_table=11
                     /translation="MQHQSSRASRSVRVLGLLVLLLGITVMHTGGFHLGSDAHHAGSS
                     PASITAGTTLHDEVTIGGGGHGLGHDAVHACVFILSTLTLAIGLVLLYRAGHLSRGIG
                     PMPTTASLRLHRERPPPWVVPSLAELSILRI"
     CDS             91259..91693
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_790"
                     /old_locus_tag="pnf1790"
                     /product="hypothetical protein"
                     /protein_id="BAD60604.1"
                     /transl_table=11
                     /translation="MRFPGRLRHAGSVVALLAAVLVVVPLIDCSVARGDVHVHASAHA
                     GAGHHLASSPGGDHVHAVIIDALDGHCLAHLDHCIAKSVVRGAAENLPPQKLLLFALA
                     SALLAAVAARGVAPGGVRGPPISRVPVAGGRATLTQFCIARR"
     CDS             91797..92924
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_800"
                     /old_locus_tag="pnf1800"
                     /product="putative pyridoxal-phosphate dependent enzyme"
                     /protein_id="BAD60605.1"
                     /transl_table=11
                     /translation="MDKLVLDARTDRSSALMVAPAPARFPQSLIGNTPVLWVGAPLAP
                     KGRGFWAKLEGFNPGGMKDRPALHMVLKAEQRGDLTPGARIIESTSGTLGLGLALAGI
                     ATHHPVMVVTDPGLEPIVARMLTAYGTQVDVVTEAHPAGGWQQARRDRVAELLAADPD
                     AWCPDQYSNPDNVDGYESLALELVEQLGGVDVLVCAVGTGGHSAGVARVLRQFNPEMK
                     LIGVDTVASTIFGQPAGPRLMRGLGSSIYPVNVDYDAFDEVHWVAPSEAVWACRTLAA
                     THHATGGWSVGAVALVAGWAARTHDTDTRIAAVFPDGPHRYFDTIYNDAYCDEHGLLD
                     ADPPVEPDTIAHPAERVVRSWTRTTTVVDPRQFIHDQELAS"
     CDS             92921..94285
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_810"
                     /old_locus_tag="pnf1810"
                     /product="putative transporter"
                     /protein_id="BAD60606.1"
                     /transl_table=11
                     /translation="MSVLAKFRSFDLPARLLMINQFGINLGFYMLMPYLAGYLAGPLG
                     LAAWAVGLVLGVRNFSQQGMFLIGGTLADRLGYKPLIVAGCLLRTGGFALLVFATSLP
                     GLLVASAATGFAGALFNPAVRAYLAADTGDRRVEAFAVFNIFYQAGILAGPLVGLALM
                     ALDFRMTAAAAAVVFAILTVAQLFALSTRRAEIRAERTSVLDDWRTVVANRRFVWFAV
                     AMIGSYVLSFQIYLALPLQAEFVAGAQAQTLVSALFAISGLVAVAGQLRITAWFRDRW
                     GTGASLVVGLGILAASFLPLALIPDPDRFGVPAAAAALLLCAMLLAVGTAAVFPFEMD
                     TVVSLSGGRLVATHYGFYNTVVGVGILTGNLATGAVVGAARAAGMDWALWVGLSVIGV
                     VAALALHRLDRPQHAEEDGQSTDVRGRHRIPEDHAIGTTLVEQEFDYTGRGHWPTKIP
                     AGRR"
     CDS             complement(94384..95028)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_820"
                     /old_locus_tag="pnf1820"
                     /product="hypothetical protein"
                     /protein_id="BAD60607.1"
                     /transl_table=11
                     /translation="MPLRSTTLRRYVPGVAVLLFVLAGCGDSDEAGKPTTTAGASAPA
                     TSTTVGAATSAPAATYNDADVTFLQMMYLHHAQAVQMADMVPSHSQNPQMLDLASAVK
                     AAQEPEMAQIRSLLEEFGKPVPSPTAGPMGPMGHDMPGMMSPEQMSSLQGMSGAEFDR
                     MWLQMMIGHHTGAVQMAQTELDTGANDQAKQLAAEIVSAQQREIDQMKAMLGQR"
     CDS             95453..96118
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_830"
                     /old_locus_tag="pnf1830"
                     /product="hypothetical protein"
                     /protein_id="BAD60608.1"
                     /transl_table=11
                     /translation="MADAAYGLWPLVILNTALFVAFALSFFHPRTNRDWRVMSGYTAF
                     LVALFTEMYGTPLTIYLLGSWLGSRFPLLRDSHAGGHLWNDLTGWTGDPHLSPFHLAS
                     YAAIGGGFWLIAAAWRPLHEAARANRLATTGPYARVRHPQYDGFLLVMIGFLLQWPTI
                     PTLVMFPILVVVYARLARSEEREVATRFGREWTDYAARTPAFIPHLGVGASLRAAGAG
                     RSR"
     CDS             complement(96540..96968)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_840"
                     /old_locus_tag="pnf1840"
                     /product="hypothetical protein"
                     /protein_id="BAD60609.1"
                     /transl_table=11
                     /translation="MKGGNIPMTTVKDMLATYPADLGDVDRDKLTRCIEDCIACAQAC
                     TACADACLSEGLVGELTKCIRTDMDCADICNATASVLSRHTGYDANITRAILQACATA
                     CKACGDECSAHADTHEHCRVCAEACRRCEQACDDLIRALG"
     CDS             complement(97150..99633)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_850"
                     /old_locus_tag="pnf1850"
                     /product="putative cation-transporting ATPase"
                     /protein_id="BAD60610.1"
                     /transl_table=11
                     /translation="MATHFDAHTHSPKERVTAVLDVRGLLFASQQNVVAARLARRPGV
                     YQVEVNPVAQTATVVYDQTQTTIAALRDWVIECGYHCAGRSVPAHICDPLTEPDPPTE
                     DKQTGDAGQLATTEPIEHAGHIAAAPAHTEHPAGAGDLRSPHDAMGHGGHAGMSMASM
                     VADMRNRFLVAVLFSIPIVIWSPIGRDVLRLDVPVPFGLREDVWALLLSLPVIFYSSW
                     IFFDGAVRALRARTLDMMVLVAVAIGSGWLYSLVITLTGGGEVFYEAATVLAAFVLLG
                     HWFEMRARGGANDAIRTLLDLAPPKALVLRDGEPVEIPTAEVAVGDLLLVRPGAKIAV
                     DGVVEDGDSEVDESMVTGESLPVHKAPGAAVVGATINSNGTLRVRATKVGADTALAQI
                     VQLVQEAQNSKAPGQRLADKAAFWLVFVALIGGGVTLAAWLLLSDRPFSAAILFAITV
                     VVITCPDALGLATPTAIMVGTGLGAKRGVLFKNAMALETSARIQVVVMDKTGTLTKGE
                     PEVTDVITDGIGETEVLRLIAAVERESEHPLAQAVVRYAENAGVGQVRAEKFENVPGH
                     GAIAEVEGRRVVVGNRRLAEREDIDLGALAARRDELAATGRTAVIAAVDGKAAAVIGI
                     ADAPRETSPAAVAALHDLGVEVVMLTGDNEATAKRIAERLGIDTVIAEVLPGDKATKI
                     AELQRSGRQVAMVGDGVNDAPALAQADLGIAIGAGTDVAIETADVVLMRSDPLDVPTA
                     LRIGRGTLGKMRQNLAWAIGYNTIALPIAAGVFEPAFGLMLRPEIAALSMSGSSLIVA
                     VNALALKRLRLPTPKPTHTGTSEATPVVA"
     CDS             101364..101591
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_860"
                     /old_locus_tag="pnf1860"
                     /product="hypothetical protein"
                     /protein_id="BAD60611.1"
                     /transl_table=11
                     /translation="MNTRYLPWYALALAVLVAGLAISGVSVSTLLLMLVVLACPLMMM
                     FMMGGHGHGGNDDKPYEMGKRHDHGPTSGRS"
     CDS             101631..102332
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_870"
                     /old_locus_tag="pnf1870"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAD60612.1"
                     /transl_table=11
                     /translation="MTTDPDAVEATADEPVTAVTRDTTPLLVAEGLEKAYRRGGRFLS
                     PRVPVLRGFDLRLLPGEVVGLVGENGSGKSTVMKILVGDLSADAGTVTRSGRLGYCPQ
                     QPVLYERLTCDEHIELFARAYRMTREAEHQARRELYAALGFERYASTRADRLSGGTLA
                     KLNLALGLLADPEVLLLDEPYAGFDWDTYLKFWEFVALRRSTGRSVLIISHFVADEHR
                     FDRIVELRDGRAVER"
     CDS             102329..103864
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_880"
                     /old_locus_tag="pnf1880"
                     /product="putative ABC transporter membrane protein"
                     /protein_id="BAD60613.1"
                     /transl_table=11
                     /translation="MTAVAAVPAPPRPAVWPFVRCFVEDYFRNPVNLIVLLLVPTVFV
                     LVAAGSIAQAMELLGRSLGSRPAVETATAGWAAAFLSGIAMYFQVRSARATDRRLVLA
                     GLSPARLVAARAAAGLVLGVLVSAVSLLALTARTGIGDPIRVIPATVMFAVIYLAIGA
                     VVGILATNPVNGAVVILFVWIIDVFIGQVGDTTEQISRWFPTHFVARWMVGLPTGHAG
                     RLGDLGASLVWVTAAALVAAAALVTSSRTTTRRAAGQLRTALRLGVVELSRNPALAVL
                     LIVVPVVFVLLAEITTPARSIVMPLRENGATVTSTFWFPEVHAGTMTPIAVGSLATLA
                     GLFLALDAADGDRRLRLAGYRAGVLLTARLGVIAMAVLVVTAAALAITATVFDARQWT
                     GYAAANLLLAATYALIGVIIGPLFGRVAGVFVAFLIPFLDLGLVQSPMLRPEPQPWAR
                     TLPGYGGSRVLIDTGLTDHFDEIGALLIALAWLTGLAAVAALLYIGGYPSHRSIRFGS
                     SHQ"
     CDS             complement(104632..106776)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_890"
                     /old_locus_tag="pnf1890"
                     /product="hypothetical protein"
                     /protein_id="BAD60614.1"
                     /transl_table=11
                     /translation="MTTALTPTGDDLPSPDTVVLLNRSLRPGTDQHALSRFGQDRWNL
                     SPGLLQHHSSALAVDFAQVPDEFRLPVKQIVWLLLNAEPDQPVNYRFTTARLSVSSVS
                     AVSRFLRSFTQWLHARAITRFADVTAADLDTYAIDVRAAEISHSQREDLLAAVVRAWS
                     VRDRLCPADRLPQGPPWNGDRIRDVLGQSRELAENRTLRVHPDTMTALLAWSLRFIEV
                     FADDIIAAFTEYLELSGAAYRARRTRVPKDEIYSHRRRPGEARQLLAAHLDEYRRRGL
                     ALPGRRTADGRLLVNTYFLSAQAGIPVAHKSITSLFAERGQMPIDDDTYLFAPITAVL
                     DGRPWRSRSIPYLQAPILARHLATACFVVIAYLSGQRPGETLNLERCCIDRDPATGLV
                     LLRGKHFKGVRGQDGAAVPDGEYRVDPWVVVEPVAVAVEVVGRLHDSALLFPNTIEVN
                     GISSPDRLKARVVHAARNDQLMTRDIEALLDWVNRYCAEHGRTDAIPPDPVKASISLG
                     RLRRTLAWFIVRRPRGLVAAAIQYGHVRTGMTLGYAGSYDSGFPDDLVFEEWLTRLDN
                     RADAHQRLRDGEHVSGPAAEVYRQRVESATRFAGRVLRSSRDAAALLANPDLQIYKGN
                     AMTCVLDPAKAACRLASDEQGTRRTPDVNDCRPTCANIARTDRDIAELSRHADQLRLI
                     VADPLAPPIRTLRERRELTRIDKIIAEHRNSA"
     CDS             complement(106773..108653)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_900"
                     /old_locus_tag="pnf1900"
                     /product="hypothetical protein"
                     /protein_id="BAD60615.1"
                     /transl_table=11
                     /translation="MSRGRAAVQPALGYRTPQRLFLGHNECRVRFFPENGGDHVDLDF
                     MCLPVPRELRNWFATAAAGATRPSGPRRTATSASDIVSTFLRFARYLAGLDNPPLSPN
                     GLRAVHLDGYILSGGVGTTLHRDLATLRSVLRFAPDVPAEFAARLSTARVAKNDERET
                     SYTEAEFNRILAHARSQLRAAARRIRAANRLLEHWRADRVDQVTDAQRWELGWLLDYV
                     DREGDVPRAGAVQPAAGKAHQAAVVSRHGGSSTVLAHLYPTYLEIGAAVALMIGLTGH
                     NLGTIRAATVHHHRTDADTGAAPTILVDWLKPRRGTRRAAMTVPLQDLTPDGARPAGR
                     DDLTTPFGLYTLLLELGHRVRAKTGSDGLFVAFTHKGNGKGRDIAGFRVQVPKSILLF
                     WGEDAKLPTDIADPDTSAPAVLRVRSRRLRLTFLERYQRPVAHTEITLVNEYLARNRG
                     NLAEYQQVVADVLSEQVAKARTAATIPVLSSEDIAQARTDPAGVAARFGVSAQTLTEL
                     VDGRLDTVVAGCTDNLNSPHSPPGKPCQASFLLCLSCPCARATPAHLPVQVLVHDALL
                     ARRPGMTPLTWAERFADPATRLLDLLEQHTTTAVADARANASRFDRLLVDRFLTHGLD
                     LQ"
     CDS             complement(108650..110212)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_910"
                     /old_locus_tag="pnf1910"
                     /product="hypothetical protein"
                     /protein_id="BAD60616.1"
                     /transl_table=11
                     /translation="MSVVVAVPELRLVRSDDYSATVPGVWRLQRCSYYIGRSAIVGGL
                     ALPEGLDVAALCARNATVEGQEFLINSDGRVVVEVNAFFASRRMRNRSASTREKYARG
                     LCVWLGYLDAVGGCWRGVGPEDVDAFKFWRMTDEANPLRVAGSSVSDNIQAINAFYEW
                     AQERLDVRNPVDRRLASWPRQGPLGRAEPFVATPHVVRDRDVKWLDQGGYACWRDLGL
                     RGLDRSGRELRGWRGRNSQRDCAFTDGLYGTGLRLSEWATLLTVELPADDESRGYYTC
                     RLASSCGKGGRGRRYWMPRSVLVDVLSYVESGRAAAVGRARAKGLYDQVSDPLLLVGQ
                     DCGRRVRLRAGDGAVSDVALDTLNARTRARIFRQTRTGLEPVSLWLNETGLPRLAAGW
                     EHTFTQANERLARAGLGSVSATAHMLRHSFALRWFSVGRLIYEQRFAHLSSEELRDFR
                     AQFGDTWYLVKTLLGHADIAVTMDVYLEPFRDLDVSLLIEHAHGAGMSALMAEMFSRH
                     PQVITRPAGVGA"
     CDS             complement(110347..111126)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_920"
                     /old_locus_tag="pnf1920"
                     /product="hypothetical protein"
                     /protein_id="BAD60617.1"
                     /transl_table=11
                     /translation="MSRKDRDAGAWFSVLDTPFRDELELRLRTASALTLETVALLRHG
                     VRPAGLPDSIRVMPHTVFEDADGDRLEVTDLGDGRERLTIAPDADAVRFGGSFQSVDV
                     PRDQLLALLARLTDRFTADFRTRSLVTGGADAEPDTARSPAHHTPHSRTPRSFPVNSF
                     QHDRRHDEQHDQSWLAQAHAVVASGWLAGGSMYALGAVTSEFPAIISSLMFLAGAVAV
                     ESGLRHYRTWRRITDELHMAGCTCPPGSGGVALRVRDRANR"
     CDS             complement(111422..111832)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_930"
                     /old_locus_tag="pnf1930"
                     /product="hypothetical protein"
                     /protein_id="BAD60618.1"
                     /transl_table=11
                     /translation="MSPLAAVVADHDRFYVVFSDVPPASERRFLDEREFVTEADARAW
                     AAEEVSAATQHSGSAWDFRGDLWRIPAGVRVEDESSLENVQALANVTWDHITKAVVWA
                     VGVPDDWNPDGGDAEPADGRGDPSAPWGDDEAPF"
     CDS             complement(111992..112456)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_940"
                     /old_locus_tag="pnf1940"
                     /product="hypothetical protein"
                     /protein_id="BAD60619.1"
                     /transl_table=11
                     /translation="MSASYAVPALLLGGPGVVFAALALSYRRDARRFPATGERPGATT
                     LSAAHGCLAALSFLWAVATMPLSAPLAVVAVGVGAASLTVLAVQLRAADRADRWEAAL
                     AVLSATAPLGEPEGCPAARPSSPVRSQDTRRLAVLRRRQCAPAQHRDPYSTD"
     CDS             113499..114560
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_950"
                     /old_locus_tag="pnf1950"
                     /product="putative recombinase"
                     /protein_id="BAD60620.1"
                     /transl_table=11
                     /translation="MRSLRETRSLVTDEELADFELDVLSEFVLARASSGVGDSTIRGD
                     TTHLGQVRQWFGRPLWEMEPQDADRYFGTVLRRVSSSTRAARARTVVSYFEFLEIRYK
                     VVLHEMTGRVVECPIDEVNRPRMSVDTMVRIPPTEAELEQLFTGWREDLVTCRKFAPS
                     ARNYMVARLAADVGLRVNEACMLDLDDIRWELGRFGKLNVRHGKGAFRSGPRQRLVPL
                     INGADTALTWFVEDVWAQFDADETLPRAPLFPSERRRAGSSGTRVTRDVIRRALGGAV
                     DRHLPTWSGRLTPHVLRHYCASQLYRTGVDILAIQELLGHSWITTTMRYVHPYGTRVE
                     DAVTAGHKRAAARWEGLIR"
     CDS             114557..114892
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_960"
                     /old_locus_tag="pnf1960"
                     /product="hypothetical protein"
                     /protein_id="BAD60621.1"
                     /transl_table=11
                     /translation="MKWNLRLVAANRGIWKSSELRRMLAARGLEISTGKMSGMWSSTP
                     AVLRPEELDVLCAVLNCGIAELITAEPDTVAAPTDAGEHVRAVGDQGPESVRRIVPKP
                     RTGRSLPPR"
     CDS             114889..116511
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_970"
                     /old_locus_tag="pnf1970"
                     /product="hypothetical protein"
                     /protein_id="BAD60622.1"
                     /transl_table=11
                     /translation="MTATSCRECGGRIEASTCPRGGRPRQYCLTCRPSKTAERRAEGA
                     KDYRDGSCVGCGTQLERAARTIGRPRIYCDACRGRRARTPSRSRRRNDAGPAQDNRSE
                     AYRDRRCTRCDAPIEVDGQRKGRPRIYCDGCFGRRVHEQRRHRTRPRSLDGLRFAEVF
                     GTITGRVEHEVLERLFDTARVGRWSVATVQRRSEELRRVLATAGDEPISLSQVRAELG
                     NVWQSRIAARVLDQCGLLIDDTESPTRQWIDRRTAELPPGFRDDVRAWLVVLHEGGQR
                     ARPRAEATLHAYYSRVLPPLTEWGSTRSHLREVTQADVSVALNRLNGHKRVGTFVALR
                     SLFRFAKRHRLIFLDPTRRLRAGAAPSRVLLPMTTGQVDAVTATAVTPLQRVVVALVA
                     VYAVRAHALRQLVLDDLDLARRRIRIGGSVHQLTEFTHDVLTDWLTYRQQRWPGTPNP
                     HVLVSSDSVLGNSPVEDYYLTWHLSLLGIQLEHIRGDRILEEALSTDTDPLHLTIMFG
                     LSEKSAADYARLARGITERPIEAVSHYPADWD"
     CDS             116873..117292
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_980"
                     /old_locus_tag="pnf1980"
                     /product="hypothetical protein"
                     /protein_id="BAD60623.1"
                     /transl_table=11
                     /translation="MPPKSRQGHRPHSVEKRTRRHEALFAPAEWALVAAAAATVGLKP
                     GAFIAKAAVGAARAFAAQRNGSAVRTSGQVEILIAEVRELRRLLGNVAGNVNDVAKHA
                     NSTGELGQNADAVLAYTRKINSRIDTWLVEQLRHGAL"
     CDS             117289..118920
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_990"
                     /old_locus_tag="pnf1990"
                     /product="hypothetical protein"
                     /protein_id="BAD60624.1"
                     /transl_table=11
                     /translation="MIGKAIRGWDGQRLVRYLFSKGKYNEHTNPTVIAAWQSDPDALQ
                     PVWVGPDDCDFAPGEIGKLANQVTALSDAIGLPTEQPEPGQPGYTKHGYIWHLPVAIG
                     AEDGELGHDTWRRIAEDMLHETGIAKAGDAGACRWIAVHHGKSVDGNDHIHIAAVLVR
                     ADTGKRFYPDNDWKAVRRVARRWEQALGLRMTAINDPSAVPTPTRGEQEKAKRRHAAG
                     DDGMLRATPGAAARVQLRQMITETAAIATSADEFVARLRDAGMLIDFKYDAIGQIKGW
                     AVAAPGDVSARTGEPIYFAPSRHLGADMSWPRITARWSASVPSRPGAAREAAATETAR
                     EPHAVLADSAERVRSVTTAVRGGRADVATLARELQDVISSWASIADGAARQGPLSRAA
                     WVYDRAARTRRGLAAVPAGQLAAELREVSRGLAAVRMLSGRGLQRDPSLQLGLAIAEL
                     LLEIAAWHQQNQRIAAARSAREAVGLVRAHGEATGAVPGQLPPRRAPAGTGHTPTVTA
                     HPGPAARPGEGRRELPAVRGVRELPSGPTRKEHRR"
     CDS             118917..120629
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1000"
                     /old_locus_tag="pnf11000"
                     /product="hypothetical protein"
                     /protein_id="BAD60625.1"
                     /transl_table=11
                     /translation="MNQPVIETPVMGIPREDTMRMALAARTLSGVLRQLRERRGRSAW
                     DDAENAARKNAVIDRHTVNRFSRADAEEWNTAEREGRIRAERHPDTGMTIRVAPLSRG
                     RFGVQAGWEDNHAEAVVGSEDLAARVADWLRADGSADAVDDLRRNVEDMHATSRPRRQ
                     RTLRDIELAEAREWAKENDADWYRWWELSYTNADTIDGRRLDEAEIINKWVDATGGVT
                     RSAVGVARRWLAEHDPEWTKNWVAEYDNCDTRDGRRSLEAEIVRRWRAQSRAGRGRGG
                     AGQEWGADTGAAEQGGDSQDRSTPTPLADRLRGRVPDRVLDDPRWHVAEDQFAVLTSQ
                     GADPDTLIESVAAIDFNNGKIRAPSGFAAWAMREAAKKGKAANAHTRSEEDARRSVAE
                     EWLMSADPDSPFDRARAAQLVGEIDDDFDALLARKYPGILDGDAEQARAKAAQHESNA
                     DTADDQARKDNTAAQQTDEAEAEDTVFVVDSDGTVITVPFVPAPEPPPEAEAEAASHA
                     ADADREHEAADSQHRAARTAEAAAQAPLTPPKQAKSNAKTRRRTPPPATPAATHTRNR
                     GRAH"
     CDS             complement(121255..121656)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1010"
                     /old_locus_tag="pnf11010"
                     /product="hypothetical protein"
                     /protein_id="BAD60626.1"
                     /transl_table=11
                     /translation="MTTTVGFLAGGKCPNTAEGRVHRGDNQGGLVGSVPVIFAFQHAY
                     YVARSGEQVRALVLPEAPVSSADTIQKGINTIPDKTNYCLTITELEPARYLVEVFERR
                     PSGETKTYRQNVTTVHRDGRTFIDTVTSADR"
     CDS             complement(121976..123847)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1020"
                     /old_locus_tag="pnf11020"
                     /product="hypothetical protein"
                     /protein_id="BAD60627.1"
                     /transl_table=11
                     /translation="MRTDKTGSPPSFARITQALDEWAFENSRPAGPASRRGQWTMYHC
                     PAHQDDDPSLGLIYNADKHKTVVRCFTGCSDTQVLATIGLPESAIWDRQWVRVPGSPA
                     RPRAPRPEVPKARGDAPVPPKPSKKERLGKVVGPRYQAAIYHYTDHRGRPLGEVVRMH
                     VPHERGTDKMFFQRKMDAGGRWSKGGFEPVLYHLPEVVQAIADGEDIHLPEGEKDVDR
                     IRAAGRFATCNAMGAGSFRLEHARQLTGARRVIIIADRDSAGYQHALQVKRMLVGRVG
                     EVLVVEAATGKDASNHFDLGHDFDEFVPVTDEQLERGFPGADEAIAAAEKAMEGVFRR
                     SFDPETGWRWQWAPEAETELGIERAPAKSVQNQQNPETTMAQTAIAPGEGVQITVYTK
                     PQCPQCDATKRTLDNLGFDYRIVDVTQDSAARQRLLDMGFQGAPVVEAGDVRFSGFRP
                     DKLKTLPGVMRADVLAEQEAAAAQPGFPSTADRLSVDAVQAWAGPYLRAAMRRGEIPE
                     VGSPQWAALPNGDPRKTGAVVEAALRYVQQATAAEATAPVARSQTSTVTATARNSSGR
                     PTFAQLQEARRGEQALRAANGPLTPSAGAAAAAGASMTPASRANTSAAPQRTPGRGR"
     CDS             complement(124251..124670)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1030"
                     /old_locus_tag="pnf11030"
                     /product="hypothetical protein"
                     /protein_id="BAD60628.1"
                     /transl_table=11
                     /translation="MNARATTIAADLVYAVRYRVRNLCADLRYCRALRLALLVKADGA
                     DWRRVLHTLMATYDVSTVRVGEHWFLIGPQDPRTLDRLPEGNRWAWYVCGPSLSATVN
                     PSLSWEETVPGFSPGTALDYCREWAEVAATTEQRSAA"
     CDS             complement(124667..125653)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1040"
                     /old_locus_tag="pnf11040"
                     /product="hypothetical protein"
                     /protein_id="BAD60629.1"
                     /transl_table=11
                     /translation="MADAKAGPEFDTLAAAVAETIAAWRAQNPTAEAVPRQVRREISR
                     AVRNDTRSRQLDVSITRTQLELDILHHQKAVVAAGFKPEKEEQHEAWARKQAELSDAA
                     TRLERRIHELPHLSATDRGRAVEALAQAHAVPGAAVRVKWEVNSAMEALKARVAEKVS
                     AIRLGITTVTRQLRSAPFRLAQWQADAMHNQARQPEGPSAWLTPGQAAALADLTAAAQ
                     RFDKASTQAREAKEAETDLAAVVTEFHEALTRTQQLGITSDRINQELRAAHQASQTEP
                     QRQGMWSKIQAAARGPLTPPAAAATGGRKFTFGAAPAAQAAPVAAAARRAAR"
     CDS             complement(125838..126953)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1050"
                     /old_locus_tag="pnf11050"
                     /product="hypothetical protein"
                     /protein_id="BAD60630.1"
                     /transl_table=11
                     /translation="MAKQYSPPPVVAPWSTDTAAYGGRADSGLWTDGVPAQGVSPLQR
                     AHAGEWRHTSSDRSAAVTPESRDWRRDPVRPAPGSGWRRALYLMSGKTLNLGESPAEV
                     RARELDRRIRTAIESDFCIGVVQLKGGSGKTTTAMGIGNAFAACRTDGVIAFDVNPDR
                     GNLARRTTARTESSALTLLAGPRPRRVQDVRTHTQLTPAGLDILASAADPATADSFSA
                     HDYRQLVDLASDYFPLMLADCGTGITHPATQAVLDEADALVIPLDAKKDSADEAVAAA
                     EYLHTAFAKDPVTGDPLLDERGERRWLYRGLLSRTVVVISHQQPGRRMFDASAATRWF
                     NHLVHAVHEIPYDRHLDEGGVIDPQLLHPRTVLAYSR"
     CDS             complement(126971..127423)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1060"
                     /old_locus_tag="pnf11060"
                     /product="hypothetical protein"
                     /protein_id="BAD60631.1"
                     /transl_table=11
                     /translation="MADTQSDAAGGRRWSRENFSCSDEVWGAAKKKWGQQLRQYPTWT
                     GWLEAALAEKTARTRQKLGISTFEPAPDRLPPGRRTPPDQAGTRPRRSFSCSVEVWQD
                     ARNAWWAEAESYPAWSDWAEEAVAEKAESDERSTQSESTEDKISSKTS"
     CDS             127809..128336
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1070"
                     /old_locus_tag="pnf11070"
                     /product="hypothetical protein"
                     /protein_id="BAD60632.1"
                     /transl_table=11
                     /translation="MSAMIIDQVRTYYSTYLPQTTASLDDPEEFFQELSDQISQRVEQ
                     ITAQLETNAIVPGQDYLERVGTLNTLRAQALESALAELLYSTPPEVDEDPEPSQTERD
                     LLVMQQEERAVDQRLEMAPGSPEAIEWDRRYPHLVEEVTWMLTDHGELTVEQKREQLA
                     QIMHRQDEARARLRP"
     CDS             128519..134980
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1080"
                     /old_locus_tag="pnf11080"
                     /product="hypothetical protein"
                     /protein_id="BAD60633.1"
                     /transl_table=11
                     /translation="MFTPVELATLRCKVEDEAYSYGGYNRPLEIFNPGTAPRYLTEGP
                     LKSLSVGERFGPTWLLVESYLRAHPDLYDETPSSVEARQAHRSAAAKSLTTEAAEHFR
                     AGRLARARELVDQAELANPYETGTYDGIRSRIDRLAGIVDELGLSRPQERFDGLPGGK
                     QAQVSVGDHSFSLEPRGGGRWVVYPKTGGAEDQSTLAEPMPTSEVMPRIRAYLASLPD
                     PQNPTPAAHAPSAATTAAAQRDPGNPTTPGDAPAEPLPIVIEHTAEDTLVRNTDKNNL
                     QLRQALHDAKFNWSRPQRFWYQRRATDFAVRTRRVGYLRASLTRLGLPFTETNPAREE
                     STTLTAAGVAEAAAPESAHEQQTTAETQHDSTAESAAAAEVSPTASGTPTPPLSSPDV
                     TGNTTTATPTSQTESPADRPAGTAEVRVPERPTAPQVDVPRSTQRRIEANLAAARTLQ
                     LVEAESRPPTAAEREVLAKWTSWGAAPQIFDAEREEFRSDAESLRALIGEEGWKQANR
                     TVLNAHYTDPMIVRAMWDHLRALGFTGGQVLEPGCGAGAFIGHAPEAASMTGIELDST
                     TARIAQVLYPHASIRVESFADTRLPEGHFDAAIGNVPFSSARLHDPVHNAGEHTMHNH
                     FILKSLALTKPGGVVAVVTSSFTMDNKNPAARREIAAQADFLGAIRLPNGTHRRVAGT
                     DVLTDILILRRRDGEARRLGGPFELAVTAELPLTRGQGETESVLVNEYFLNNPEMVLG
                     ELRAGTSVYGGLSVEVLDRGDLEQHLRAALARIAERALSEGIAHQPRELASGERRAAA
                     AAPGDPNEFPGHLRTTASGFEVLHTDGTYSELKVPSTQADELRALLDLRDTAVALLEN
                     EAASAEDSDEIEALRTRLNQRYDRYVERYGAINRCSWHPTGRVDDAGEPVMSVRRPPV
                     MRVFRDDPHAPVVLALEDYDATTDSAVKMAIMRQRVVAPRSPRLGADTAEDAVAICLD
                     THGKIDLPVIAGLLGVDDDEARVQCRGLIYPDPADNGRYVPAAEYLSGNVRVKLDQAR
                     EAAAANPETYSDNVTALTAVIPPDLGPAEIDARLGAVWIEAPDVQAFLNEILNDDTIT
                     VEHTKAGEWKVTGGRRGILSTQEFGTSRVPAPKLAQALLRQAPIRVYDPDESGEARIP
                     NPTETEAANEKAEQLNERFSEWVWENPVRAARLSEEYNRRFNNLVLRNYEADGKMLTL
                     PGLSKVYTPRPHQRAAVARMIAEPNVGLFHAVGAGKTLEMAMGVMELKRLGLVNKPAI
                     MVPNSMLDQFAREFLQAYPQARILAAGTEDLAGEKRRQFVARAATGDWDAIILTRGSF
                     QRLEVSRETAHWYFDREIEPRRQYLAELMSGSAKRSVVKRIEDAILKSEEKLKKKLGG
                     PTDPGITFEQTGIDYIVVDELHDFKNLATDTQIESAAIAGSQRAQKLHMVVEYLRDKH
                     NGRAITGATATPLANSITEAYVVQRYLRPDLLEGAGIRNFDEWAATFGKTKTELEMSV
                     DGNSWNLKTRLVGFRNVPELQRMFHVAADVKLPEDLNLPVPKLARRADGQRAPEVISV
                     PATETQLEYVRELGHRAQMVKSRAVDPTRDNMLKISSDGRAAALDLRLVKSLGLTPGT
                     AEEQGSPTLTTAEGAAIAGYLHSKSPSPSTARYVALFAQRGRHESQRQESQEIGEEEF
                     GLKLEAAADWMFEKWQAAKDQVYLGRDGQPHPRRGGLVVAFCDLGTPGEDWNAYDELK
                     AKLIARGAPPELFAYIHDAKNDKGKAALFTKARNGSIQFLFGSTSKMGVGVNIQDRMV
                     AMLHVDCPWRPADIEQRDGRGIRQGNQNEEIAVGRVVTEGTFDARMWAAQARKAAMVN
                     QFMKGSLTVREIDDIGDAALNANEALAIASGNPLVLEKAEIDIEVTKLERLRRAHQRS
                     QSMLQIRIRDANDAIPKLEAEIDAYTRAIEHRRPTKGDAFAAKVSGRFYDHRGDAGDA
                     LAARLLKLIEDPRAVWKEFEDHGVAEIAGFTLDARNVPTGRAALVSVVFSDIGDDVYV
                     TLDKATLQKGGTAVMLRLENAVNGLDKRLEVATGRLETERTERERSELRLGKPFEHSE
                     RLDALRERQKEINKELLGSKETETENASTDPAAAPGEAESIRSAAMHDAAAMVHQMGG
                     AAVVSGANGITIISDRGGRAR"
     CDS             complement(135068..135988)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1090"
                     /old_locus_tag="pnf11090"
                     /product="putative methyltransferase"
                     /protein_id="BAD60634.1"
                     /transl_table=11
                     /translation="MNEPSNPAASHRESKEREPDMTKTPSTPPSWPMRPGYREDLFRG
                     AAEYYSRYRPAYPQPLLDDLINRVGEGGVLVDLACGTGEIAIPLHTRFGHVYAVDLEP
                     DMIEVGRAKAEQAGAINISWSTGKAEDLVIDEPAAQLVTIGNAFHRLDRPLIAERVRQ
                     WLAPGGCLAILGSSTPWSGTEPWQAVAVDVVARWSGEPGRPASAAPAPAESNTPARRT
                     HEDVLREAGYVDVAEHQFPTPHTWTMDEFLGFLWSTSYTARIRQDPTLAERFETDLRA
                     QLLECEPSGQLRESIAHYYILGRNPEPALK"
     CDS             complement(135991..137124)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1100"
                     /old_locus_tag="pnf11100"
                     /product="hypothetical protein"
                     /protein_id="BAD60635.1"
                     /transl_table=11
                     /translation="MRTMYTVPDLRQLHLEVSTRCNAECPMCARNLFGATAPGLTETS
                     MTLDQFRACLPEHVLAQLEIVDICGAYGDPAIAPELLDICHHIHTINPSTTIRIYSNG
                     GLRTPTWWARLAEIPGITTIFAIDGLATNSVYRRKVDIDKVLANAAAFIDAGGRAQWD
                     YIAFAHNEHEIDSARARAAELGFAEFSVKKTARFLRPLYEPAPELRPGDGIDAAPIYD
                     RTGAVVGELRPPADERLVNEVVLWARSIEARAEYFDAFFDTCTIQCQALDSSAIFVSA
                     TGHVYPCCWLYVQATLPQLYRGQAATDAQVHDLLTASGGANTLDAAEHPLDEILASEF
                     FTAVERSWSTDTIAGGKLKVCSRVCGEGFSAYRRQFDRPDLVP"
     CDS             complement(137132..138091)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1110"
                     /old_locus_tag="pnf11110"
                     /product="hypothetical protein"
                     /protein_id="BAD60636.1"
                     /transl_table=11
                     /translation="MTRIPLRITPADTADTGRVVVEWIMSSVCNYACHYCPIYLHDNR
                     VRWPDYNSVHRFTRTVAEHYRGRDITFLLSGGEITLWPQLPRMAADLRALGIDVAVLS
                     NGTRPQPWWATHAPAFDHVLLSYHHERAEPGHFRAVVDTIAATTSVDVNVVIDPAAFD
                     TTMNLAAAVQADGKAPVHRKIMFLDGWARRADYSPDQHAALTAALATEVDQPGSRESA
                     LLKGDLDVEYLDGTHQVLTPSQIIDTGANTWPGWTCNVGAESLFIRFDEIWPASCREG
                     GRIGTIFDNNLALPTAGITCTARSCNCIAGIKATKSDPTAVHP"
     CDS             complement(138088..138906)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1120"
                     /old_locus_tag="pnf11120"
                     /product="putative methyltransferase"
                     /protein_id="BAD60637.1"
                     /transl_table=11
                     /translation="MTYDPHGLFTGAAPFYARHRPGYPAALFTTVSERFDLDGTQQVL
                     DLGCGTGQIALRLAPLVAHVHAVDPDTQMLHEGAKLATAAGIDNISWREGDSYHLDAL
                     DLPALDLVTMGASFHWTDRASLLADLDHRLTAAGAVVLASGGPPATATAPPWNDIVTE
                     VRTAHLGAARRAGTSTYTHPRLTHTEVLATSAFSDIDVTTWHWDLDRDIDSVIGLQFS
                     FSYSAPGQFSDESARAAFADDLRAALVEKFGADAVLTEHLTTELIIATRPNGGS"
     CDS             complement(138907..141036)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1130"
                     /old_locus_tag="pnf11130"
                     /product="putative phosphoketolase"
                     /protein_id="BAD60638.1"
                     /transl_table=11
                     /translation="MTTDWTTQVAAAAASVTAAEVDTARRALDYLCLAQLYLRDNVTL
                     STPLQPGHVKPAPAGHWGVCPPVNAVLAALGPYRRMPGTDVRVVHGGGHAGPSALAHA
                     WITGALDTGEDAFGHTEVDLARLCAQFPRTRFGGEITPLIPGHDHLGGQLGPALAIAH
                     GMGLDAPDRLVVAVIGDGECETGATAAAWLGARALIGTGTHGRVLPVILANGLRMGSA
                     SLLAALDPCDLARHLGGLGYEVITAGPSTDEITAAVARALTGLRPLQYGPSTVVVVTV
                     DKGHGVPKTVAGQQIAQTPRVHKVPLRNPRDDNAEFVALERWLSGYRPQELFTGGAPT
                     ATVRRALAPAATGRVELHAPRGCIAAASAVADRVAGADFGAAITATLRELNTVYGLRV
                     FSPDELASNRIELGAPDSGWTIEVLNEELCHAWAQGYQATGRRGVVVGYEAFAPITAS
                     LLAQQLLAHRLAAAAGRPPGPSLVYLLTSLGWHNTITHANPGLIDIAIGTADPSVHIY
                     LPADATRTAAALTFAVRKLGRASLVVASKHPMPAHPHTTIDAELRDGYAVWPHIADDL
                     DPEMVLVSIGDIAARELTRAATTITATRTATRLRYLHIHDLTSLGAPGRRDAAISAAD
                     FERLFPPGAAVLIATTCHPAAVHALLGERGAPRTVVVRGWANPPLPMSHDELLDHTGI
                     AATALHEAALALLDSTTCDPLIRQGAR"
     CDS             complement(141033..141500)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1140"
                     /old_locus_tag="pnf11140"
                     /product="hypothetical protein"
                     /protein_id="BAD60639.1"
                     /transl_table=11
                     /translation="MLPELPAIPVSTEGTLRRLHGRTVLVLDFAAPRGPHRGRRYRVE
                     HHHGTGGCSRVVFNIDGRAALRPPPWAAQQTSGAVALRLRPLPDRRHHRIPADLQQAL
                     TAADLGLDHITEPELIQILEMIVEAGNDQLRADRITVAVAAIAQAGADRKARR"
     CDS             complement(141490..142116)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1150"
                     /old_locus_tag="pnf11150"
                     /product="hypothetical protein"
                     /protein_id="BAD60640.1"
                     /transl_table=11
                     /translation="MTNILDELPCRAEWLTGARCDPITGLVAFPDLYPHAITDALARV
                     VAERTLLGLAIGDVDDLKSHVEHSNATDPDSFGHLAGNALMTQLGSVCRTWFADTAFP
                     AGCVSTFGGDEVIVAATGVTDAGFTASVTDLRDRCRAALPCSVSFATTVVGPGLVWPS
                     TDPAVRAKFLLAAVDRALFAAKAARRNTGGPAGALVTVDLARVMADAA"
     CDS             complement(142097..142774)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1160"
                     /old_locus_tag="pnf11160"
                     /product="putative hydrolase"
                     /protein_id="BAD60641.1"
                     /transl_table=11
                     /translation="MPQREIRAICFDIGGVLVQMPRGVLAAELAEVLDADVEHVRDML
                     IEHAKTRRTPPGELAAILATACGRPHTADAVADRLRLRVADMADPPLYPDAIPTLEQL
                     AGLGFRICLLSNAIGPDPDTQPARPPYFAHAEVVLHSWQIGACKPQPAAFRAIEAAMD
                     LAPQQLLNVGDSARFDIDGALAAGWSAIHLVRNSATPAHPDVARIGALTDLAPLLKGP
                     VRDQYSR"
     CDS             complement(142761..143897)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1170"
                     /old_locus_tag="pnf11170"
                     /product="hypothetical protein"
                     /protein_id="BAD60642.1"
                     /transl_table=11
                     /translation="MTARTITDVITRPLPPLPLTAAASAEVLPDWAQPARRHPAAQPW
                     PENLTRMAVGVVDSTGATGWFGPVSATVARMVFDQVAPAVIGRELAAWRAMASLAPHG
                     RHRQGAHLRLAVSAVELAAWDLRSHATGVPVGALLAGERRERIPVYATALGIDIDHPL
                     APDIAAWLVDEGFWAQKWGLPGAARGETPRADAARLRRLREAAGERARIGVDVGGRWP
                     ADYARQMLPVLAEAGVCWVEEPGPISDADLARHGLARAAGEHDYEPTDQLRTLGGDIQ
                     IWQPDPTWCGGLAHTLSMVELAARLNIRSLPHGSGLAAALALAASAPAAAVPAIEYHL
                     TLEPLRQDHQLDPLVPAAGHLDARTAAGLTSGYRFGEGDAGAAA"
     CDS             complement(143900..144964)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1180"
                     /old_locus_tag="pnf11180"
                     /product="hypothetical protein"
                     /protein_id="BAD60643.1"
                     /transl_table=11
                     /translation="MLETRADAERLAIRWGIDADDIMLIALNACGLDADIGVSRLRFR
                     LRLNSRPDDQLYMILSLGRRRSPFKLVDTKVLLGGEQVAVIDVAEADDAVLGYWRNEG
                     RVLTLNSNARSACTGCVFCPNTLEEANDPRLALDDLNAYFSTLVDDRLGTGLSSVEKV
                     TVCTGCFRFEQLALTHLRQVREAMTTHQCGGEIHFLSSVLTTPAGLAEAAAIGPFHLT
                     LTAEAFTKRDLILKESKAALTPTEMVRVLGDAVAAGIRTDFTYIIGLDPLDVAARHLA
                     DFVEVTTTFPRFQVYQSHTPMMDVFLADGARDIEFYLAARREIEELFGPTGLRPQPWE
                     NYRPLWYFSFADEPLTGTRI"
     CDS             complement(144971..145543)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1190"
                     /old_locus_tag="pnf11190"
                     /product="hypothetical protein"
                     /protein_id="BAD60644.1"
                     /transl_table=11
                     /translation="MDNPQADRYRVRTSQPVHRFPSGPQGSRWVGGEPVRTPPITQEH
                     RYRLPARDRLLIALCRGLDDTDPICSWARELVQLHGARRESSARAAECDCRRTELTAR
                     INDLTNTVEPLLAITYPQTIGVLIDRMAVAAEQAMHQLAASGARSERMHQAWTQLAEL
                     ELEYSDLVSDLFYVDNLCPPHPSTDTGHKR"
     CDS             145604..146359
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1200"
                     /old_locus_tag="pnf11200"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD60645.1"
                     /transl_table=11
                     /translation="MPKQPEYLSIAATLRAEVLAGSYDAEPLPGNADLAERFDVNMKT
                     AGRAVQQLVAEGLVIARPGMRAIATPPELRGTRWPMNGRYARARAARGLIFAGDVNGN
                     VRKDTVSREWVSAPLPIAHLLGVKEGARVFRRHSRTFIDDVATENTMMFFPEEIVAAA
                     PDLETAERIQVVALIEDAGHTVTRTANEIRARHTNPAEQELFGIDANSIVIEHIHGTY
                     GATDEPLEAVINVRPAHGGAITFDTYEAPLDNE"
     CDS             146372..147070
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1210"
                     /old_locus_tag="pnf11210"
                     /product="putative orotidine 5'-phosphate decarboxylase"
                     /protein_id="BAD60646.1"
                     /transl_table=11
                     /translation="MPTTTTVRGRLAIALDTSDLDTAVSIAKAVQPDIGVAKVGLQLF
                     SAAGRDAVRAMQDLGMDVFLDVKLHDIPNTVYGASTVLGALGVQYLTVHAGGGTAMLE
                     AAVRGLGEGASSAGFAAPTVLAVTVLTSAPDASPELLNERLAAAVAADCGGVVCAASD
                     LPVIRAAAPDILTVVPGIRPAGGEVHDQQRVATPADAIRSGASILVLGRAITAAPDPA
                     EAARAITEEVAQAL"
     CDS             complement(147185..147535)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1220"
                     /old_locus_tag="pnf11220"
                     /product="hypothetical protein"
                     /protein_id="BAD60647.1"
                     /transl_table=11
                     /translation="MNEPPERVSSERHLAAANGPLVPSALSIEQRRERLDERIAWLRD
                     RTNCTVHLRGDLRAVVVLWGPRPAHGLHAALSVATAGLWAPMWLAITWQRRPLRLQLE
                     VDDAGVVRATPIKR"
     CDS             complement(147813..148013)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1230"
                     /old_locus_tag="pnf11230"
                     /product="hypothetical protein"
                     /protein_id="BAD60648.1"
                     /transl_table=11
                     /translation="MRCNEPCPTISSSSMPVVGCWSMARTRLSRPPQNSVSCTRLVSR
                     RGDPTESRRTGCVWPGVLTSWW"
     CDS             complement(148014..148250)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1240"
                     /old_locus_tag="pnf11240"
                     /product="hypothetical protein"
                     /protein_id="BAD60649.1"
                     /transl_table=11
                     /translation="MEWAEAPPSLRPGYLDPRSLKHTVSNIADCLTDPGPIPRGVAVR
                     ARRMHESCSSQCRVKGRVAEVLAAPADSVEDDFE"
     CDS             complement(148299..148634)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1250"
                     /old_locus_tag="pnf11250"
                     /product="hypothetical protein"
                     /protein_id="BAD60650.1"
                     /transl_table=11
                     /translation="MRAIAIVRQDVAARDGQGGVESVRALARRMRLDLPARDTHVTTD
                     LTVLLAHVNSTQADVVVVPSEQHLRGWMDTVRRIAAVWTVDPPLCWPKDGGRPHSLTR
                     PDRHLEVSR"
     CDS             complement(148631..149461)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1260"
                     /old_locus_tag="pnf11260"
                     /product="hypothetical protein"
                     /protein_id="BAD60651.1"
                     /transl_table=11
                     /translation="MDRKPSLMYGYLRQELVGERVQEVEDAMREFAAREGFDLAVVHR
                     ECGAATGALWMLLRDVSQAWSRHIITPTPTHLKGGENDDRLTLLGQLQRLRPLRVWYL
                     DPDDAAALVRTVRRNRDIPSPRASAPTPPRTPIGQFELRLNLATRGLAQIQTHELLTR
                     AGLRHLSEPVEQIVLAVLAEAMTAAEPGIYARLAAGFPDLAPSNQITVWLLRRESTLE
                     VQVHETASRADELMSDPITAFAEHGRVQPETGGTLTWARIPLAATPSVSYSSLRSAVS
                     "
     CDS             complement(149466..150545)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1270"
                     /old_locus_tag="pnf11270"
                     /product="hypothetical protein"
                     /protein_id="BAD60652.1"
                     /transl_table=11
                     /translation="MAAAASHDPVALRDSPLIVSTDIGGDPDDAIALALAAMTEPRLA
                     LVVTADEFPDGRRSMLARHLLDLLGREDVVVAAGATAGERKYWAADGLVPAGAHPWPL
                     DLHTAVASLTDPDSSAPLRWLGIGPLTDLARLLETDSGRRTPLGLARRLRIWQMGGAL
                     EYRQPDRAEHNFRLDPKAVHTVVGRAENLTLVLSDHTFTPVMAVDPDSPVYRLLATSS
                     IPWAQVIAHHLDQWFARFHPASMLHDPLTLAALQGAFVSFDHREFRLEPDARMHLGPG
                     RIARLSSGVDYLGFLEWVLATLRAGVPARPGRARATTTDPAVRAAAAGSESLGNTVHF
                     AAHRTTSGSTSQFGQHDGLPKFRQG"
     CDS             complement(150548..151006)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1280"
                     /old_locus_tag="pnf11280"
                     /product="hypothetical protein"
                     /protein_id="BAD60653.1"
                     /transl_table=11
                     /translation="MATTLTETAAARCARYITENRFIGAEVDEHQQIILRAGPVDTIQ
                     MPRPLGERVRAELLRRGLATPTIENRATGFLTFVTQPARMGDPRPVRILSQLFKYQAI
                     RTVQGSLVTLPGPDDERRHWVEEPIGEERPDFDTVVSIVLDAAKNLSQAS"
     CDS             complement(150991..151236)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1290"
                     /old_locus_tag="pnf11290"
                     /product="hypothetical protein"
                     /protein_id="BAD60654.1"
                     /transl_table=11
                     /translation="MARAVDSRLSNKGSPRPAEPDVHLRFVWADRVFDYRGCRSAVKN
                     FLRKWSQGHNPAITAVELFDGFLPDHRMPCEELWLLP"
     CDS             complement(151251..151607)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1300"
                     /old_locus_tag="pnf11300"
                     /product="hypothetical protein"
                     /protein_id="BAD60655.1"
                     /transl_table=11
                     /translation="MAVQLVAGRRMSSDITTISAISVGNDQWVVEQLRGRTLTLGQAL
                     AAIRLAEVLPQPRPASDDDPLWADVTDWLDELGLGHAPLTVAGVLGVPCHLAPLPERR
                     GQQLTHRRRFPRWLVR"
     CDS             151988..152857
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1310"
                     /old_locus_tag="pnf11310"
                     /product="putative DNA-binding protein"
                     /protein_id="BAD60656.1"
                     /transl_table=11
                     /translation="MSPYSRRLHLGDRLRNLRQEQERSIQQVAKEADIDRTLLTRIET
                     GQRRVAADVSMKVAEHLGVEQHSPLWQEFYALARDAAQSGWWEGRAFRGLSDRQALPA
                     DLEAGASRIRWYDFALVPGLLQSPAYVRARHDATVTNDHSSDNPVEIRARERRQQEAL
                     TEGGPRIEVIVEETVVRRRVVPAPAMLEQLEHLLKLIDANEQIDFRILPVGGELLGLR
                     APRSPVSIYEFAAGDPPLVFVESLTDDVLLRDHAEVANHERLWKRLHEIALPPDESRV
                     LIARSAEILAKEQ"
     CDS             152854..153264
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1320"
                     /old_locus_tag="pnf11320"
                     /product="hypothetical protein"
                     /protein_id="BAD60657.1"
                     /transl_table=11
                     /translation="MKQVRNTIMTGHRPLDGYVKASASDGGGNCVLVRRKSGEELIFI
                     RDSKYGRDPRNRPEDEPVVEMPASAWEGLRAAALGDATSPAVPGQPVLEETVDGGMAL
                     QGADGTRLTFTAAEWSAFKAGLVAGEFEPRQVAA"
     CDS             complement(153375..153737)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1330"
                     /old_locus_tag="pnf11330"
                     /product="hypothetical protein"
                     /protein_id="BAD60658.1"
                     /transl_table=11
                     /translation="MFDEARYQPCRWVDPPIDVTVRVADIWPPARLRWGGATPLWQKA
                     MGLRVEDDVPGRLEELVVTSVGDLLGRVRFAPLLGDQRTAENMLLPPSTWQPIAADDV
                     RRLQTLVVEFGFEPGHLL"
     CDS             complement(153772..154794)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1340"
                     /old_locus_tag="pnf11340"
                     /product="hypothetical protein"
                     /protein_id="BAD60659.1"
                     /transl_table=11
                     /translation="MSVFDQYTDKAEASPVLGWLVLYSIFRGEVTPDELAKWFDEFDL
                     DTVHLPPPLRADDAFERVTGPQGVKAVYSLDDPTADRKTRPRRKSGDDAGDRVATLMV
                     RHVRRDSGQLVRHLVREVRDEERTELSYDTRLGVIAFIRSDDPDAAGAGKLRVEPDAA
                     AIADLPQGEQDRVEQLLAEVTDLHTWHSTYMGPDRLRAVVRRYVEALGGLKVRPTGGV
                     YFVTAEHESTLAGLREVVARFGSGSHFVRVPLPDEDEMREMIVNAFTNQAREDLEKLA
                     EDIAAAKANGAGDAALTNLHNRFQQLSRRAEEYSERLSDSLDDTHASLRLVNMQLAEL
                     MIRAAG"
     CDS             complement(154881..156524)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1350"
                     /old_locus_tag="pnf11350"
                     /product="hypothetical protein"
                     /protein_id="BAD60660.1"
                     /transl_table=11
                     /translation="MDSMSGKTLRKFADLARKAGRWVGLGSTAPERHATVVEGDRFDA
                     MTWTEVREQATALAEVEEELSRRFDYVPDLLRDVFLTVYKAEPTLREQAEMEPTRLPN
                     HAIVTALIGTPEYADLHRETVGDEYAAAMAVIAQRSTLAQMLEQSQDAQQTAEQSAAA
                     EQEAAEHATAVESALDAAAEQVDEDGAVPGQAAAAVDNAVAAAQAADDAAQQARAQAE
                     AAAGALGATLRADARQAMASAAEQAREEAALMAAWGLGPGQLQRMSFDERARLAERLR
                     GGRLGKFTDLVGRFRRLATAERTRKLEHVAGELVGITLGDDLTRLIPSETANLAHPAL
                     RAVFAARFAEKQLMLYETMGEDHSGRGAIIACLDCSYSMCAPHTGPDGRIASAEAWAK
                     ACGLALLDQARAEGRDFVGILFSSAEQVSVHRFPAGEAPLDRVLDFAESFFSGGTDFQ
                     TPLGIAVDILAEHHGDQAVQGGDIVLITDGDAEVTEEWMRTWKSAKSELDFRLFGVAI
                     TDPRRPAGRSAVLEALCDNLRTLDDLADPHPAADLFRVI"
     CDS             complement(156535..157752)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1360"
                     /old_locus_tag="pnf11360"
                     /product="hypothetical protein"
                     /protein_id="BAD60661.1"
                     /transl_table=11
                     /translation="MSGKQQVEHDSSDTARKLRAVTDELSDLFYERSEVVRAVVAAIL
                     AGKHSLILGPPGTAKSELARELTGRIVDAQLWEILLSKFTDPKKMFGPVDVAALTQGR
                     YTQLFEGRATTCHIAFMDEIFKCSVGALNETLAFLNERLYHPESGGAPISCPLISAIT
                     ASNELPSGEESAAIYDRLLVRLEVGYLADPSNFAALIRSAVQSPAAATAPTTVTLAAL
                     QQAVTIDVPAVAVPDGVVDTVCQLRTSLRRQSLVASDRRWKQAIRLLQASAFLDGRAE
                     VDDNDLPMLAHVLWDSVAERPTVEREVLALVNPDAREAMDLSDAIAEMAAQLDAKAGQ
                     SRETLSQWAIKEANHKLGKAGKRLEELRHNARSAGRSTATVDAALARHKAVYARVMTE
                     ALGVDVSTLTGSN"
     CDS             complement(157797..158240)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1370"
                     /old_locus_tag="pnf11370"
                     /product="hypothetical protein"
                     /protein_id="BAD60662.1"
                     /transl_table=11
                     /translation="MGGTTPLGLPPRRRRPPHGGKARGIRTPPQTGCHPRLPSVSFYD
                     AALPRVQRGASCEDSSVRGRPRVRGSGQCSPSIASAVSGSARSQRTQARRYSVNPRPR
                     AWRSFFASSYSSFSGRQVRWGALCGSLGVIAPSSLSGYPFVQPLC"
     CDS             complement(158280..158927)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1380"
                     /old_locus_tag="pnf11380"
                     /product="hypothetical protein"
                     /protein_id="BAD60663.1"
                     /transl_table=11
                     /translation="MSTESPDERLEELRNQVASLSEALVEMRNQHRLLSTKVERVDAT
                     AARSSQGLDEFETALGVLADRLASAAPGEAPAAAAPSGAGDGGAAPAAISAGADLDQI
                     DMDVLLEWVIANIGEWAQRKLPRSTTSSANGAICWCSEWYEHPEAVTVLWSLRRSWLE
                     AVVQPGTAMAVYFRDFFYPLLRNLTDPAGPFYACTPDRHDPEAKFVPVVPASFRP"
     CDS             complement(158924..160651)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1390"
                     /old_locus_tag="pnf11390"
                     /product="hypothetical protein"
                     /protein_id="BAD60664.1"
                     /transl_table=11
                     /translation="MMGDSALAWVWISVLVVGGICYGVYRIHEQGTSWLVIGLVGALL
                     CLLLAALAWVVWKAWPTETPETLLRDRKQIPDMLGKKAAERGVGLRASIESAKGVSMR
                     ELAPLIGRLKGKSVYASYEDFTIVMMGPRSNKTSAVAVPRILSAPGAVIATSNKPDLW
                     ILTGALRKDVGPVYVFDPSQIAYAAQTWWWNILSGITTLRDAKKVAEHFIEENRGGGS
                     GQNEDPFFAPTGKNLLSWALLAASLSGRTMRDVLDWIDTYSDKPIDILHQHGNRRAAN
                     AFAAVLDLPAETRGGVFGEAQTALASIQDEETLRWITPPNTWEQPTTEKITELDLWSL
                     FAYEDGKAPTLYLMTQEGSGSAGAVIAAMVAKIFELGDLAASAHGGRVDPPLTLVLDE
                     CANICKIKRLPNLASHLGSKSMCVTAIFQSEAQVISTWGADDAAALWGASTVRILGAG
                     LQDEPFLRKISGLVGQYKPRERRRSHGPGGVTTSNDRGSLEPIMPVEEIAAMKKRNAL
                     LIRQESRPVLIDLIPWYTEPDKGDVERVRDEATKEVQNAAIEHLGPANPVAKALRRRL
                     DEQAKASAA"
     CDS             complement(160648..161388)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1400"
                     /old_locus_tag="pnf11400"
                     /product="hypothetical protein"
                     /protein_id="BAD60665.1"
                     /transl_table=11
                     /translation="MMRDVISAQDWDHDPVGATSAMVITVTDHVAALPRRWWGKALVW
                     NPELPGPATTFSWDLLARITDAADADRIAENLFSVVRDEAALYFVPEATLLTANLLLA
                     AVRGRRSLTDVLDWIHSGDLSEPYQLLHANEESGPTADLDTFGETPAGEQAAIWAVVR
                     QAMLPLDHSMILAALSAQTGALPGVGPLPVLEAAALTARREVFVVEVPGTRSAGAAAA
                     LRAELLLAAQEAGLVVRVVSVGPLRRGA"
     CDS             complement(161411..163036)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1410"
                     /old_locus_tag="pnf11410"
                     /product="hypothetical protein"
                     /protein_id="BAD60666.1"
                     /transl_table=11
                     /translation="MTTELITEAESAARQRAGAQAGLAERWLAKLGVTPAYRKQEQTD
                     ENEPGQAPFNPFLPFESLPPIPNARGENRPFGGYAHNVDAGRLYAGTTTQVQGLYPFP
                     AASGARVRGVPFGRHLHTAEPIGLDPSQWLVDGLVTNTGLWVQGQPGIGKSTCCKRLM
                     VGLVAYGFAAVIPGDIKDEYSPIVEALEGKVFRIGRGLHSLNPLDLGPLRGAIRAAVG
                     SHREQLVSQARGRRLDLLESLITIVGGQDLTATERLLLAMAVDQADDASARHHLPDPT
                     IPELVHILDEAGPPLQRVVAARDEYEYRREIRELRNTLVLLCEGPIKGMFDRSSSFSI
                     DADLPAVSLSLKAVEDDGDDVVAAAMMCAWAWSAGLIEGKQAAGERRNVFQPQDELWR
                     ALRAAPGLVEKSDRMTRLNRARGVVSAQSTHSITDLEALPTEADRAKAKGMVARNAIK
                     VIGGLDNAEMERLHAISPFTSGEKELVTRWSAPPTWVPGQRHPGRGKYLIKSGSRMGL
                     PVHVDLTPEELELYNTDGAFAGLNPDGRRSHAA"
     CDS             complement(163033..164532)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1420"
                     /old_locus_tag="pnf11420"
                     /product="hypothetical protein"
                     /protein_id="BAD60667.1"
                     /transl_table=11
                     /translation="MSETRGYGGYREVTGFGLGRLGTSGTAIILATVVGLAFTTFVSL
                     VLAFMGLLIAIPVLALTIVPVGDSRRTVVQHVAWNVRNAWANRRASDAHAADVLEEVS
                     RGENLPGVLAPLKPLTVEDGRGGSQCLLWNRRTGILSAVLKVSPVGTTLADTADTEAW
                     VRNYGSWLADLGFTPIISSVVFTCESSPTGGVDQRAYTLARMERDGRNAPKLAKTIMK
                     KVVNQSRTTTADVQMRVTVNFDLSKASPQPKTLSEGAAEVVRWLPRIESALAAAGATV
                     TERASTASVIRNIRAAFDPAIRVFLSDAPDEEADELLSWSDAGPLRTESTKDVYYHDS
                     GYSVTWVFKAPPSGVVRHHILLKLVSPGKYYRRFSLVYRPYTAAQAAEIVEREIQAGT
                     LRRIWNAKTKKDETQREYDDRVRARKAAQEESMGAGLGQFTMYITTTVRNEETLAAAC
                     ADIEDRVSASKLQFRRARGAQAAAFATSLGYGIEPTAGLSRSAAQRWLA"
     CDS             complement(164609..166336)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1430"
                     /old_locus_tag="pnf11430"
                     /product="putative membrane protein"
                     /protein_id="BAD60668.1"
                     /transl_table=11
                     /translation="MTVPGARAGARAVLRPMVFLGVLLAALVAGPGIVAAQPSANMPQ
                     KLSELTAEQKSWRDADGVIWCSEHPEFPGCEGNPDTGYLYPNDDTLYRAQINNGARER
                     TFDLSPGTVAENIVGKAVDSAFGKAAESIGRFAGDLLVESMTWWIGTDSISLSYAGVM
                     ADKQPVQKVVFFIMMAGILTSAMVMMISRRTEPGAQVLLGGVKYVVISSMALIVLSGA
                     IHAGDDFARQMIDTDANQFGQRVQAMLGTATIGNPGGVLILGLVGAILGFIQWVMGFI
                     RQAGIIVLYNMILFAAAGQLTTWGRQWFPRIAATCVALVLYKPMAAFIYSLGFQLIGE
                     EQSLTTLVTGLMVVALAVIALPAMLKFFDFMGMHVSGGSGALGVAVGGLAGGMLGAAA
                     LSGGGGGGGGTSAGTSAGGDGFANFMSATGPGGSGEPDPSPGNGGSQALTSGSAQSQL
                     ESGASQKAIGSGSSGVELEAGSGGPQPEHPDAAGTPATPSDAGGSGVDIAGAAGGGAA
                     GPAAGGGAAAAGAAGGGSAAAGAAGAAATGGATLAIQAGMSAANSAVEAADDVGSEMT
                     GDDLGPEMR"
     CDS             complement(166351..167022)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1440"
                     /old_locus_tag="pnf11440"
                     /product="hypothetical protein"
                     /protein_id="BAD60669.1"
                     /transl_table=11
                     /translation="MFTTREFAERPASQGPRPSRRWLLVAAAAVLVVAVGIVLVAVVR
                     DRSDNSATPAEPGAVATATPPRDLEWKLINGVRLPFGPDGPAEVDGPRAHGYSHTPQG
                     ALIAAWQISTRVLTDTRYEQLLGTQVRADLGQQQQVRNAVTQTRNLSPEEFDAAFRQP
                     VAFQFATYTPTFARIYFAVPSNKGGYDFQRRAVLWDGNDWVYQVDSGLPELPNSTGLK
                     GFTTF"
     CDS             complement(167039..167797)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1450"
                     /old_locus_tag="pnf11450"
                     /product="hypothetical protein"
                     /protein_id="BAD60670.1"
                     /transl_table=11
                     /translation="MPLTTREFREKTPLAGVRRPYLIGAAAAAALVLVTGIALIGPDS
                     GSGGQDLATGPGTSSSAAAAPTTPAKGSLVPQVPVSRSPADPDWLTAAPQGVSWQRVE
                     GVPLPFSASDGPSRIDGAVAAGYSHTPQGAAIAALQISMRILYSPDYARILDAQAAIS
                     DGDRQQILTARSTQPRLDPVAVQASTVQPAGFKIGAYTGDAATVYYAYPRPSGSYRIA
                     RQAVVWRDGDWRYSSDLIAPALPETADLTGFTPL"
     CDS             complement(167814..168260)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1460"
                     /old_locus_tag="pnf11460"
                     /product="hypothetical protein"
                     /protein_id="BAD60671.1"
                     /transl_table=11
                     /translation="MKQAAWAFVLATVLTVAGAGAVHAQPPTTTPAPTPSQQLSPQSP
                     GGGGSGEQIPIQDPKTGGVQWDKFGGDPANAPENLDSFIADALGWLRTLALACAVGGV
                     LITAGVLMIGIRGRSEQAKKALHSLPVVLGATVLSGSAYTVIHVFL"
     CDS             complement(168257..168544)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1470"
                     /old_locus_tag="pnf11470"
                     /product="hypothetical protein"
                     /protein_id="BAD60672.1"
                     /transl_table=11
                     /translation="MSTLLLAADWLAQVPNPPAKELPGELGNRVNDVLGYAKTICYAL
                     AFGGLLAVAGMLFVGLRGRSDTAKNALGHLPMVILGVVITGGAGGIIQAFQ"
     CDS             complement(168570..169100)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1480"
                     /old_locus_tag="pnf11480"
                     /product="hypothetical protein"
                     /protein_id="BAD60673.1"
                     /transl_table=11
                     /translation="MSAAPRRPVVGGIAGGVGTTTVAHLLDGIDMGVIEANGSQCVDV
                     LVTRATAAAVSWAIATAQRMPVRPVLVVVAGSEARWPSVVERRLKMAAANLSTPVLRL
                     PWFSPLAASDNPWDLLATGVFDADRKTYRWAEPARKFREELVPAVLALIEREPPTADS
                     SSELRPNDERPVMRVS"
     CDS             complement(169097..169753)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1490"
                     /old_locus_tag="pnf11490"
                     /product="hypothetical protein"
                     /protein_id="BAD60674.1"
                     /transl_table=11
                     /translation="MSRNPETMTPKFSWTASAAVLAGAALVVAGCSSGGSDHEQTTTP
                     PASTTSFVTPTETTSRVPATPPSTPLTAPAALPAEIGPVDQASVDAVAAAVARIWYGW
                     DTTRDLTQHDAKLRAVPLLEPRLAQLLRDYPPIAGPGADWLDLTARSAVLTVPADGVR
                     PGVEAGAPADTATSAVRLLEVTQKVNTPTGPMPDRHLVVGIALVKVGAEWRVSQVGSR
                     "
     CDS             complement(169750..170820)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1500"
                     /old_locus_tag="pnf11500"
                     /product="hypothetical protein"
                     /protein_id="BAD60675.1"
                     /transl_table=11
                     /translation="MTAMKSPLKWAALALALLLIPVLIVAVFVDGDKDNPSFAQGKLA
                     TGTVPPEYEAWVIRAGTMCEEISAPLIAAQIEQESNWNPNAVSPAGAQGLSQFMPYTW
                     PSYGVDANGNGVISPFDPPDAIMAQAKFDCTTVEQAKKDLASGRIKGDLIDIVLNAYN
                     CGYGCVLANGGPQIVNGETEGYAPGVKAKMAKYTQIGTGGGRVANCSQFRPGGGFGAN
                     VAAAALCWQGTPYAWGGGNIDGPSLGIRDGGVADSHGDYGKVGFDCSGLVVYAVGQAS
                     GKTIQLPHYTTSILNDPRGREVALGDIQPGDIVFPGGGDPQHVGIAIGDGKMVEAPQS
                     GDVVKISPLSNLGSGIEIRRFG"
     CDS             complement(170976..172295)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1510"
                     /old_locus_tag="pnf11510"
                     /product="hypothetical protein"
                     /protein_id="BAD60676.1"
                     /transl_table=11
                     /translation="MMSAAMIGGRVAGSLVIAASLTCIAPSVASADPGASPAVTDCAD
                     VITLAVPGTWETSAGADRNVVPGMLGQVTGPLLAALNSAPPTLSGSTPATTSAATSAA
                     KSATPRPSATAQKPATASVRAEQVPYVAQVGGPIAGMFTGNPLTLSQSRENGASALNT
                     RAKELAAACPLSKFVILGYSQGALIAGDFLSAVGNRKGAVDPSRILAGALLSDPKRSA
                     TAESDFAGSTGTSSGSSSTKLSSVSETLIGSNPGGEGVLGEREGGMGVLAERVTTMCA
                     PNDTVCSLSGKSKVVAAVVPLLNLTPEDLPDYLIGRGLELVKNVAEADPQVIAQAAKS
                     VITEFTKLGVAAATSPQTLPIALAEMVFSSTMLDDVSKVINMPEFDALVSLTKPDELI
                     QQASQAVSYLLLDAHRSYAGNYKVNASGDTATQWIVKWLTSKIQAGL"
     CDS             complement(172292..173803)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1520"
                     /old_locus_tag="pnf11520"
                     /product="hypothetical protein"
                     /protein_id="BAD60677.1"
                     /transl_table=11
                     /translation="MQKLKEGSAMTTLGPAAASACSDKAETPIPYSGSRRVGTPRSAA
                     HRRSTGIRTDLIRVAVAPAVATAVLMTACGVAQAAPSGQPGITGPAEPQEQPGVSTAP
                     VLPPKPQSQSPLGVILPDPPSHAPSEYETAPPSGGVQVGPYYDTPAPSTPAPQTYYYV
                     EPTPQYRAPAPEPSLGEELLTLHAPAPVPEKPKYWVPVGPERIGSKRASIPTPDWVPI
                     DVAWKANAYISEAQQATNTALQSVGIAPSRADALAGGTVIGAAAGTCIGATVIGVPAA
                     VFGGIAGGLIGGTIGGIAGAAMGTLIPVPVIGTVTSGVAGTAIGAAAGAAAGAAIVGI
                     PAAIAGGVAGGAIGGLVGFVLLADDGSEYTGPAPDGEIPMEEREVPPPGPTLADQFSE
                     QAAVAVDAGEQAVDWVQEQPGGEQVLEQAAAVVDQVDQWAQSEPTVTQAVGVVEQVAQ
                     DVVAAAQAAPETAAVADAVVEAVTEQPAFTPDQLGPLTDAANGALAAVQGLVR"
     CDS             174078..174536
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1530"
                     /old_locus_tag="pnf11530"
                     /product="putative DNA-binding protein"
                     /protein_id="BAD60678.1"
                     /transl_table=11
                     /translation="MTRRITRGFDPAALKRAREEHPNEDLRRRAEVARLAGVGVATIQ
                     QWEAGKKSPQVNLLFRVAAVLGVPMEQLVPIPREQRYLRDWRVLRGMLESDLAARTGI
                     SGSSIGRLEEGSAALTDENANRLAEALGITATEVRAAYDRARNRAVGAPA"
     CDS             174799..175479
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1540"
                     /old_locus_tag="pnf11540"
                     /product="hypothetical protein"
                     /protein_id="BAD60679.1"
                     /transl_table=11
                     /translation="MPSGHPEFFGEVVKARREYLSLTMAEVRAAGGPAQTTMVRTERG
                     ELGKPQKKIFAKFDTALRWVPGSAAAAYWNRETPVPLELEQPAAPPLNLAGSDVEVPL
                     DQVIALMELQRDLNAAAEARRELSADSVQDLATRLNREVSLIVGRWATTMLERNRGTE
                     AVHPGLEVIFADALSTPVDPGTPDAEERLYRRWLLGGRSAAGLGEELRQKFERRYRQG
                     GGDLDADQ"
     CDS             175508..175936
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1550"
                     /old_locus_tag="pnf11550"
                     /product="hypothetical protein"
                     /protein_id="BAD60680.1"
                     /transl_table=11
                     /translation="MTRLFATFHARSAPEQSVDDVARSVSAMLGRIVPGAEITALRAG
                     EYDRDSADPQILAALAKHFGVPPAYLAGADANVVRQVEKELLMLAATRDAGVRSLRLR
                     GKKVDIGELANHLKRLAKRRSDSPDEAATRDVPDTSDLGE"
     CDS             175956..176492
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1560"
                     /old_locus_tag="pnf11560"
                     /product="hypothetical protein"
                     /protein_id="BAD60681.1"
                     /transl_table=11
                     /translation="MTVVRGEGVVNKMTTRFAELSKLVPIPYPWDTREYIARVAEYRG
                     RPIELVPIAPGALSGTGCGTGSALWLELDDSDVIMYGADTEWHADHMIAHEIGHILLG
                     HGSTGGEPAPADDLPLHELMPSLSPDAIRNVLRRQDYDSDRERDAETFADMVMVEATL
                     PQRKPSRFRSTFFRARHR"
     CDS             176489..177670
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1570"
                     /old_locus_tag="pnf11570"
                     /product="putative membrane protein"
                     /protein_id="BAD60682.1"
                     /transl_table=11
                     /translation="MTSPIPGVIAWPVLLLLTAVILGRYWLLRDGTVDKLINRALVIA
                     LFGLLLREAWFEHLLIAILPFDDADVVHFARQISFGCILFTVSYIYGIAQLWAGADPE
                     YTWQRQRRYDLVALVSTITILIAGTPARRADQLIDQHMGAGAVIAWVAFYLPIAATAL
                     LVARISIRELRGADENTSWRERSVYLGVLAIAIAIGADSVFVPVVTALEVSADRPSAD
                     PDMEAKAWTFFGATVAAGAVVAVPLIGTVLSLSGWDRTSRYCRRLKPLWRDLTAAVPE
                     IVLALPQDRFGRVEPATRLHRMTVEIRDSLLQLKRYGAVDEPGQGADVYARRVAAAIA
                     AKNAGVAPQISKAPAGRPAFVGARDLTAELQQLLDLAAAWPTAKRQAGRTESPDTALT
                     Q"
     CDS             177679..179100
                     /codon_start=1
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /locus_tag="PNF1_1580"
                     /old_locus_tag="pnf11580"
                     /product="cytochrome P450 monooxygenase"
                     /protein_id="BAD60683.1"
                     /transl_table=11
                     /translation="MAVTTSTTSGGHSNPPLPHPKWRLPIINDLLTINPIKPTLTSLR
                     DAEQLGGIFERRLVDWPMIVVSDSELITEICDERNWAKHLGVPLRKMRHIARDGLFTA
                     RNDEPNWAKAHAVLAPAFTKEAMRSYHQTMLTTIGELLDYWAKRDGQWVDVGEDMNKL
                     TLEIIARTGFDYTFDSFTRSEVHPFVAAMLRGLTYISRNSNMPPFLQKTIGARAAARH
                     SRDITYVRTVVDDVIKARQASGTVGDHHDLLDRMLTVPDPASDELLDTTNVRSQILTM
                     LVAGHETSAGVLAFALYELSRRPELVAAARAEIETRFADGDLSTIAYDDVAKLRTLRR
                     IVDETLRLYPVAPGFFREARHETTIGGGRYRFGPGDWVLVLTLHAHRDPATWGPDAGE
                     FQPDRWLPERMRSLDGRQVFKPFGTGLRACIGRQFAYHEIVLALAHILHTFEFTPDPG
                     YELDIAEQITLKPHRFRLRLNHR"
     CDS             complement(179559..180257)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1590"
                     /old_locus_tag="pnf11590"
                     /product="hypothetical protein"
                     /protein_id="BAD60684.1"
                     /transl_table=11
                     /translation="MNPFLELGGPMASKDAARIAAEPYTPAFLAVYDLWVIKLSDRFA
                     WQCPAEVMLDQYNRFIGRKHLEVGPGSGWYLANAELPPESAVTLMDLNPEPLAHTRRR
                     LEGRTCEVRTVAASVLDPVPESAGVGFDSIGINFVLHCLPGDFGEKGVAFAHLAQVLA
                     DDGVLFGSTILNRKPSTLFGRVLTAIYTQVGAFNNAADDRGGLEKALRSAFTEVSLSE
                     VGDVTLFTARKPRR"
     CDS             181131..182879
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="PNF1_1600"
                     /old_locus_tag="pnf11600"
                     /product="hypothetical protein"
                     /protein_id="BAD60685.1"
                     /transl_table=11
                     /translation="MRELDRVLYSGPYVLIDVDNHSPRRTRSLDRAYAAIDTGEVATA
                     GGTLRPGNVGADIDPLPEHAVLGDAVAEVLVGWLHDQGISYIARESGRPGGRHVVGVG
                     ASPDQMEEWNRLCADTAQAFGVPVDDRSGGVLRLLAAPHRKGYAAPVLGGTLTLNALA
                     VRTRPSRVRSARPARRRPSPSSRPAPTSPDTSRSAREYGQVCAMIRRGCTPAEAWRVQ
                     NRPGSKASERGEHRWRRFVWLDAHTTVCAEEGLTPEQAWQRVSAASPAVCRKIGRRAW
                     QRLWERAVDQAGVQRPRRRRLPPASDPLNKSTGEDNARIAAVAAGLKAALDATDLGVR
                     RQRRRNCEILLLNLAPVLVRREGSISVRDIALRAGIDVKTFRACRDLLIAHGLLVTAH
                     HYAGGASDSHAYAMGPAARPHVEDAVSKISPTCPKDTPLPLPPSGRADRTLLRTRFRR
                     ERHQWRTRCAALDDLPPGESLASSSSPAMKAYRSLRYQQRWWRNLSCDEQEARRTARR
                     ATLETLAPSARSAWFAWLDRRNSLMAVVDRAAAGPFTSTDRSVLAAAPRTVHMGLQDP
                     SWQPGSRGSGQLVLAA"
BASE COUNT        29964 a        61276 c        62304 g        30482 t
ORIGIN      
        1 atggcatacg tcgaggttgt tctgaatcag aagggtggcg ttggcaagtc cacggtcgcc
       61 gtcaacctgg cggccaccac cgcggatgca ctgacaagct ccgagccggg caccatctct
      121 cccgttgcgg cggtcagcat cgacccccag ggctcagcag tctggtgggc agaccgcgtt
      181 gaggacctgc cgtttcatat cgtccaagca cacaacgaca ttgacggact gcgcgctctc
      241 aggaacagca gcagcatcga ccacttctac gtcgataccc ccggctggat cggccaagac
      301 gaagacgatc aagcagctgc cgaccctctc ggcaaggggc ccgcggccga ggcactgcgc
      361 gctgtcctcg aatccgctga ccacgtcatt gtcccgatcg aaccggagcc actcgccttt
      421 gatccgacgg ctcggacaat cgagaaagtc atcaagccgc gggggctgga tttccttgtc
      481 gtagtcaata attgggaccc acgagacggt gtggcggact tggaacagac caaggactac
      541 gtcaaggcca acggttggcc tctcgcgaac accgtgatcc ggcactataa ggtccacgcg
      601 cgtgccgcag ccgagggcat cgtggtgacg gagtacccgc gcaaccgagt cagcatggaa
      661 gcgcgagccg atttcagcaa gctcgctctc gagctcaagg cgggggcacg ctgatggccg
      721 gccggggcgg tcgcgcgaat ctcgccgacc tggtcggttc cactgggaag aactccacgg
      781 tcgatggtgt gaacgcgcgg accagttcgc ccgcgaaggg accgaccccc gaggtgatgg
      841 tcaatggggc gcccttggag atcaagctgg aagatctcgt tgcgaatccg ttgaatccgc
      901 gcgagaccat ggacgtggac gatctcgctt ctatcgtcga gattcagctg caaccggcat
      961 tgatcatcgg cagagaggcg tacttgaagc tctggcccga gctgaagtcg gagctgggtg
     1021 acgccaagta cgtcgtcatc aacggttgcc gacggctgga ggcagccagg aagttcggcc
     1081 ggactaccct tgagtgcgtc cgcaaggatg aagtcgcaga ctcgcgagcg agtctgcggg
     1141 cggcatccat ccgggagaac gtcgagcggg agaacctcga cgtgatcgag gaagcgaagg
     1201 ccgtcgaggc gctggtctcg gattgcgacg gcaacggagc gcgggccgga cagattctcg
     1261 gcaagacgaa gatgtgggtg tctcaacggc gggcgctcct gaagctcacc ccggagcttc
     1321 aggcgaagct ccgggcaggc gaactcgcta tccgcgaagc ccgagaactc ggccgagttc
     1381 ccgccgagga acaggtcgcc cgctggaagg ctcagctgga gaagaaggaa agggagcaag
     1441 cgggcgagac gtcggggtcc aactcctcga ggcgcgatgt cgacaccgtg aagatcgtca
     1501 agacgctcaa gaaatgggac gcggacaccg cggttctcgc ctctgcgctc ttcgtccatc
     1561 tggatcggag tggtgtgcac gagttgatcg agcagctgaa tcagatggct acctcgaacg
     1621 aggctgagta gtcgacctca cttctgtggg ggaagttccg gggccggtag accattggtc
     1681 taccggcccc gtctcaattc acggcgatca gttcgtctgg ccgagcccgg tgtgctccac
     1741 gcggtaaacc acggtttacc cctcgggggc acctgcggtc gctgtcggcg ccgcatgtct
     1801 ctggtcttcc gttgtccgtc gcgcggctcg tggagttgct ggaggaactt cccacacaac
     1861 cacaacgcgg gtaaaccgcg gtttacccgc gttgtcccga ccaccttccg tcggggcgag
     1921 gtgcccggca ttcgcagcaa ggaacatggg taaaccgcgg tttacccatg tgagccttcg
     1981 atccaggcga gaacttcccc cacaacctcc aaaggggtaa accgcggttt acccccacct
     2041 cgccagcact cggtcgactt ccgcttctgc cgcatcgagc aaggcgtcga tgtcggccat
     2101 ggattccagc gcgcgccgtc gggcagcgag accgcggtcg aagtggtcgt tactgagtga
     2161 cgggcaccta ctcccgacgg tgagatcagg gacgaagtcg actccgttgc ctcggcggcg
     2221 ttgtcgtggg cgatgggttg gcgctctacc gaggatgtgt gcggcggtga ttaccccgat
     2281 cgagccgggg gtgagcggcg agggattgag ggcaggattg ccgtcccggt cgagtgcaaa
     2341 gagtagcgga cctgtgctgc ggggggatgt gcgctcaggg agcgtctcgt tctcaaggtg
     2401 ttgctccagg aggtaggttg cggtcggtcg gtggacgaca gcgaggactg ccgaccaacg
     2461 ccggaaagcg gcgacgggac agctcgggca gtcgtcggca gcacgaagaa cgagaagggg
     2521 cccggcgccg atctcgatgc ggtcctcgcg gatcacgacc tcggatcgat ccagtcctgc
     2581 gatgagcggg aaggagaggc cggagcgggc caggtggagt atgaccgcgt cgcggcggcc
     2641 gaagagcccc gtcggccatc cccatgtggg aaggttcggc aggaccgcct cgatcagttc
     2701 gtgaagccgt tcggtccgtg aagcgcggac aggattcagc agatcgcgga cgtgtggtga
     2761 tcggccaggt gcgggaaacc ccgcattgcg atgcgcccag ttgatagcac tgaggcggcc
     2821 tcgttgggtt gacggtgccg ccggcgcgga ggccaggtac tcgccgatca cgctcgggtc
     2881 ggcgggaatc ggtctatagc cgtgtacggc gcaccagtca gcgaagcggg cgtagtcata
     2941 gcggtagcgc gcggtgaggg cagcgctcac catggcagcc gggtggcggc gttgccgacc
     3001 agaggagcgt gttcgcgggc atacacacgg agcatggcga cggacttgtg ccgggtttgg
     3061 cgctggatct cgtagtcgct ggcgccgagt cggtagctct gcgtgacgaa gccgctgcgt
     3121 agtgagtggc ccgcgaatga ggccgctgtc tctttgtcgt acccgactgc catcaagcgg
     3181 cggcgcagca tgtcaccgac ggcttcggct gtcagcgcgg tagaagcgat gttcccgtgg
     3241 cggtcgaccg cacggaaggc ggggtttcgc gggttggtga gttcgggcca gcggccgcgg
     3301 cacacgtgct gctcgcagcc gtcgccggtc ttgctcagaa cctgttgaac agcaacgcga
     3361 ccgccagcgt cgtgggctgc cacgaggtcg agccagcgac gccacgcgca cggtgggcat
     3421 gttgcgggct cgctgccccg tgggagtgcg accaccactt cctcttcctg cgatcccttc
     3481 gagatgcgca gccggacgtg gaggccgtcg agtctgtgtg gcgtgatgtc ctcgagccag
     3541 cgctcggtca tctccgaggc tcggaacgcg ccagtaaacc ccatcagcag cagtgcggcg
     3601 tcgcgatggg cggcgatgcg ctgagcgtcg ctctcggcct ggcggcgggc ttgggtgaca
     3661 agctcgcgta cgtcgtcgac gaggacaggt tcggcgcgct cggggcggcg ctcgcccttc
     3721 gcccggcaag ccctacggat gccggtcaac accccggcga cgatccgcgc cgagcccgga
     3781 tgcgggtacc cggccgcccg gtggtgatcc ccgatcgcgg caacccagcg ggtgagggtc
     3841 ggcggggcat agcggcgtcg tcctttgcta tcgcgcagcg cggccgcttc gctgatgtag
     3901 agggccaccg tgagtggatg ggcgggcagc gcctggtgcc cccgtgcggc gtttgccgcg
     3961 caccagcgct cgaaccgccg ccagtccgtc gcataggagc gaatcgtatt gcgtgcacgg
     4021 gcggtggcgg tggactcccc gatgagccgg acatcttcgc ttgacagcga cggcagcggc
     4081 gccaccgtca attccgcgcc ggagtctaca tcggccattc cgagaggctt tagcacctcc
     4141 cgaatgtggt cgatctccgc atcggtcagc gccggtgccg ccgccgggcg gtagacctcg
     4201 atctccttgc tggtcatgtg caggagctta gccgtgtata ccgacatcca tactcgcaca
     4261 aaaggttctg tgtcggtgaa tggaaaacgt cacggaggac tacggtttca gatgttttcg
     4321 atacactagc ctcattggaa ctatcgacat ggaggtcaga accgatggaa ctggcgacgc
     4381 acaccccggt gccggggcag ctggctctgt gggaacccga agtcgagcag ccgcacgcgc
     4441 agccgtcaca gccgcaccgg ccggccggcc aacacacctg ccccaacccg gagtgcggct
     4501 accccgcgac gggggcgagc gcacggggac gcctccgaga ggacgtgaag gtcgtctggc
     4561 tcgtgcccga ccccgaccag ccggacaccc cggccgagcg ccgctactgc aaccgctgtc
     4621 gcccgcggcc gccgcagcaa atcgccgatg tcgaatgcgc ggcctgcgac cacggcgggc
     4681 cgttgcttgt cggggagctc gcgaaggcgc tgcgcaccag ggggacagtc cccgtagccg
     4741 tccgcgcatg gctgctggac cacggatggc gcgagcagga gggcggagag ctcctctgtc
     4801 ccgaccaccc cgccgccgtg agatgaagat caaaatatcc agctattgca atctgagcat
     4861 caaatctgcc cacggcacat gtcgtgccga atgtggcgcc cggctcgcag gtcggcggtg
     4921 taatgctatg accgatgtca ggcaactggc ggcgtagtgg acgctgcgag gacaggggga
     4981 agtgatggca gcggattcac ccgcactcag ctcggtcgga gagagcgtaa acggctctgc
     5041 tacaacggat caccccatag ccggttcgcg tccaccgtgg tcgcgcgtgt tcttccgggg
     5101 gttggcggcg gtgacgctgg tgtatccgct ggtgtattgc agcagctacg cggtggttgt
     5161 aggagacacg ccgctggcgg ttgccgtcgc gttctgcttc ggcgttctcg cctccggcgt
     5221 gatcggcatc ggcgcgttca tggtgcggcc gcggtcgtcg atggtgaccg agacgcgggt
     5281 cgtctgcggg ctgctcgggt ttcgtcgccc cgagcccgcg cggtggcggc gccggccgct
     5341 gttggtgtgg tgcgttgtcg tccctgtact cctggcggcg gtgcactttg ggctcgacac
     5401 agtgatcggc gcggtatggc acccggtttc agatgctgaa cagttacgag cgaacgccga
     5461 gcgggcggag atactcaccc gcaacggcgc gctcagcgct gcggtgctgt acccgttctt
     5521 ggtcgcggcg gtgccagagg agatccgcta ccgcgcactg gtcttgctga ctcagcgggc
     5581 cgtcggcgcg tgcaccatcc ctcgttgggt cgggttcctt gtggtggcgg ccgtcgccgg
     5641 gctgagcatc gcgctgttcg ctgcggcgca ggcggagtat ggaccgatga acctcgtgac
     5701 ttctgcgatc ggtggagtga tctatacggg gttggtgctc tacacccgct cgttgtggcc
     5761 cgcgatctct tgccacggct tctacgacct catggcgatc tcgctgacga tcctgtgacc
     5821 cccagacagg ccgtgccccg ggcggcgtgc tcggcagagg cggacccggg gcgtacgaga
     5881 acacgttagg ttgcccgaga actggcggtc aaccaaagtt tctggctgcg acacagtcaa
     5941 aacggccgtt ttagaacacg ggtcgtccgc tggcctgcgg ccaggcgggg ctgcctattc
     6001 ggaggactga cgcaggtgag ggcgggtcag gcccttcccg cgccgctcgt tgagcacctc
     6061 gacgactccg cgggtgcggt agacggtgcg ggccccgcga ttctcatgct cgaccttctc
     6121 gtcgaaggtc tcgcggtatt gggtcacggt cttgccgtcg acgccgagca ggcgggcaat
     6181 ggcgccgagg gtgcggaact cgtcgggctc gtcgggcatg gggaagggag ccggccggtt
     6241 ggcggcttcc cagcgctcgg cgaaggcgtc gagctcgtcg gagtcgtact ccggggcggg
     6301 ggtgccttta ccggtgcgtg ggcggggttg tttcggggca gggaagtcgt cacggccggt
     6361 ccagttgttg cggatcgagc cgtagctgcg gccgcgctgt tcggcccatt ccttcaatgt
     6421 gatcagggtt cccacaccct cattgtggtt ggcggcaggt ccggcgtggt ggtcggccgt
     6481 cggcacggtg gggatcatcg ctgcttcttc tctctctcgc ggtggcaggg tgtcgaagtg
     6541 tcgaatcagg gcgattcgct tgctaagctt ggcgatgccc ttcttttgcg agtggggcac
     6601 tgtcgggcgg cctggcgtgt ccgagctgcg gtctttgacc gaggcttcgc cggccgcccg
     6661 agccatgtcc tagtagccct ccaggaacgc cgtgagcgcc gcagcggcgg caacgctggg
     6721 ttcgggctcc ccggcgtgcg gccagtcctc cacgtgcaag ctcaggtcgt cccagagctt
     6781 gcgggcctcg gcgatcagca ccgcccggtc gatgccggtg cggcggccgt tcacccattc
     6841 ggccaggttc gggcaatagt gctccccggc ccagccctcg gcgatgatcc tggcctcgta
     6901 ctcagtgatc acggtgtcga agctgtcgtg gttgtagatg cgctgggcga ccgcctcgta
     6961 gacactgggc actgtctcgg tggtctgcca gacacgcact tcggtggtga acgtcagcac
     7021 gtcatcgggc atctcctcat cgcgacggtc gagccagaac ggtgccacct cggcaccgga
     7081 gacaccggtc aggctctcgc ggtcgatgcg cttgttgccg tacatgccgg aggtcccggt
     7141 gtagtcgatg ctcccgtcgg gatcgaggat gaagccgtag tcggggtcgt ccccgcaggc
     7201 gaacaattcg ccgctgtagg cggtgaccca caggcggctg cggtagccgc cggggtggac
     7261 gaggatatcg ccggtccagg ggccggtggg cccggccgcg cgggccgcga cgccgcggcg
     7321 agcgcggtcc tcgtcggcgg gggtccaacg ggagcggtcg aacatcgtga atgtcatcgg
     7381 agtagtccca ttcgtgaaag gtttggggga gagaggtttc aggcgcgttc gacgcgcacg
     7441 atgaggtagc ggtcggtgtc gaggtggccg gggccggcca tccgccagcc gtggcgggcc
     7501 agaacgtcgg tgggctcgtc ggggatgggg tcgagcgggt tggaggtcag cgagtacgtc
     7561 gcgaccggat cggtgtcccc gtcggcggtg atcacgatgt cggcgcgctg ggcgggcccg
     7621 tgctcgggtt cgacggaatc gtcggtgacg atccgggcgg tgaacacgac gccgctgctc
     7681 ggcagcggat gaggcagggc ggccacccgt tgtgcgtagg tcggcaaccg tgtcgcctgg
     7741 tcggcggtga tggcgccgac gatcaacgcg acggcggctt ccttggccgc ctcggcggtg
     7801 ctgaaggcga tgtactcgca cagcggctcg gcaccgtcgc gaaacacggt cagccgcacg
     7861 aggttcggtg actcctcggg ccgttcggcg aacgcacgga acccggccgt ctcgaaggtc
     7921 caccgctcga ggaccgccag cgccagcagc tcgtccgggt cggattcggt ggtccagcct
     7981 tccgccggcc gcccgccgaa cagcgcgtgc tcgcagttcc aatgcccgat ctcggcgcgc
     8041 aaccgttcgg gcagcgcgtg gtcggggtcg tcgctcacct cgtcggagaa caccgtccag
     8101 gtcgagcagc ccgccgtgaa ctgctgaccg tcgcagccgg tcacggtgtc gagggcgatg
     8161 acgtcgccga cccagctgcg gccgtcgagc gcggtggtga tcgcgtcggc ttcggcgtcg
     8221 tagcagccca gggcatcggt gggaatcgtg acgaatcgcc atgcttcggt gtgctcgcag
     8281 gcgacgccga cgattccgga ggtgacggcg cggaccgcga cccgggtcgt cggcgcggga
     8341 ggggcgagcg gggccggtgt gccccattcg gtgtggttgg tggtcaggtc gtccacggag
     8401 gagtcctttc cggaagtggt tgcgggagtg gacgagagag gaaggccagg gagggggccc
     8461 tgtgcgcggg ccccctccct ggccttcacg ccgtcggggc gtagcggtcg agctcttcgc
     8521 cggtgatggc ctccaccagc gcggagatca ggatctcggc ggcgggcggg gtgacggcgt
     8581 tgccgagctg gcgcacctgc tggcgcttgt tgccgagcac gatgtagtcc ttgcggaacg
     8641 ccatcgcgtc ctggatctcg tgcggctcca acatccggaa tcgggtgttc tcgatgtcgc
     8701 gctcggtgat catgtcgacc agggcgaagc ggtcgcgggt ggacagcgtc cccatcgggt
     8761 cggagaccgg gcgggcggtg ctgttgccgt agtagggcag cagcagcgag ttccacagct
     8821 ccggcgacat cccggtgggc ggggtgggcg gggtgaccag gccgtggtgg ttgccgctgg
     8881 cggtgacggt ggccagagcc tcggtcaccg gccgcgcatc cgaggagccg ccgcgcagct
     8941 cggcgacgaa gggcaagaac gccaccgccg tctcgttgcg ggtggtctgg gtgcgcagcg
     9001 gcatcgaggc cagctgagcc tccttgccgt cgcggccctc catcgggatc atcagcggcg
     9061 gcggcacgac caggccgtgg ttggagccgt cggcaacgac cgtggcgaga ggttcgtgca
     9121 ggccgatcgt gcgggggcgg tccgagcgga gcagcgccag aaacggctgc gggatcgcca
     9181 ggccgtcgtt ctcgcgggtg gtacgggcgg ccatgggccc ggtgacctgg gtggcgtcgt
     9241 cgcgccaggt gcccccggcg ggaaccatca tcggcaccat ggaggcgtag cggcgcatgc
     9301 cgacgcgaat gcgttccatg gtcttggggg ccaggggctt gtcccggtcg ccgatgcggg
     9361 tgcccggcag ggtccagtcg atcgcggcgg ccgccgggag cacgggcggc tcaatcacgg
     9421 cgttgcggca ggtgtagcga gggcagcggt agaagtactg ggtgcggtag cggcccatgt
     9481 cggcaccagg gcgtttgaat gcctggagcg cctgtaccca cccgcattcg gcgcagtagg
     9541 ccatcggacg caaccacttg ttccagtcgg gcgtgcggcc gagcttgaga tcccagtacg
     9601 cgacgtagag ccggtcccgg ctctgcggtg ccgccggggt gcggaccggc tgcgcatgag
     9661 cggagttcag ggcgatgacc ctgaccccgt agcccagggc gcggatctca ccgatccagc
     9721 ggtgccactg atcccactgg cggacctcga cgacgttctc cacgaccccg gcgcgaacgc
     9781 ggccgccgcg ctcgatcacg ccgcgcaggt acatcgggac ctcttccatc agtgcccggc
     9841 tgcggtcggc ttcctcgtcg cgctggaggt cgagcagatc gccctggagg gtgttgtgga
     9901 agtcgcgctt cttgccgcgc gccgaggacc actgcgggca ctccggcgaa gcccagaaga
     9961 tgtcggccac aggccatttc acgatctgcg ccttggcctc ttcggtgctc aaatcgccga
    10021 ggaaatgatc ggcctcgggg tagttggtgg catgggtctc gatggccttg tcccagtggt
    10081 tcgccgcgcg ggtgacgcac acaccgggca ccttcgatgc gccctgggtg gagccgccag
    10141 cgccgcagaa ccaatccatc agttcgagca tgggaatcgt cccttcgtga tttgcgagtg
    10201 gggtagaagg ggcggggtgt ccggtcccgc ttccttctat gtcatatatt acccgttaaa
    10261 gttgatcgag gtcaagaact ttcttgacgt gtcattattc gaaatagact ggactgcaac
    10321 aactttgagg ggacacctac gacctgccgt aatccctcgg ggatcactac cgatgcaatg
    10381 gatgctttag atacactagg tgtgtggaag ggtgtcgccc cgcgttcgcc cccccgtcaa
    10441 cgaagccggt agggccgcca acgacgtcgg cccggcggca agctcggggc cccgtcctct
    10501 caccgccggc cgtcccgccc cggtcatccg cctgcatccg tcggtgcccg gtgggagact
    10561 cgtcgggacg gcgtggacga accgcgcagc ggcccaacta cacaggaacg ggagcacccc
    10621 gcccatgacc gaagtcgatc gcgtacaggt cgtgcaggag atgtggccga ccatcggccc
    10681 ccacgacgcc gactcgctcg ccgcggccgc cgtcgcctcc cgcgagatct tccgcatgct
    10741 cgcgcacgcc accatcaccc gcaccgacgc gctcaaggcc ctgccgtaca tggtcgatgg
    10801 ctacaccgtg ctgggagggc tcgccgaggc cgccagctcc gagcgccagg gcctcgaaca
    10861 gctcgccgtc tgggccgagc acttcgccaa cgatcccacc ctgcgccacg ccgaacaccg
    10921 cgatcagcag ggcggcggca tcgcccaagc ccagcaggcc gccctggaga ccgccgagga
    10981 cctgcgcgag gccgccgggc acgccgaggc cctcatgcgg gcactccagc gcgcccaggc
    11041 gcacaccagc ccgctctacc acgacgacga ggaatcatga ccagcgccca cgccgcaggc
    11101 gaacccaccg actacttcgc accggtgtac gcgatcctcg accgatgggc cgcagacggc
    11161 gcggccgccc ccgacccggt gccggtgatc ctgggcgacg gcagccacgc caccatgacg
    11221 cgcgactggc tcaccttccc ccgcacagag ggcacgatct ccggcaaatc catgtcgctg
    11281 agactgctcg agaaggcgcg cggcacgctg accccatcga accgccccac ggacgagaag
    11341 gaccgatgac cgcctcctac accgccgacg aactgcgcac gttgctcgaa accggcgctg
    11401 ccgcagccga ttcccgttac cagcgggccg cgatccacct gctgaacttc accgagctgc
    11461 ccggccgcac cgccctgaac gcctacatcg agaccgatac cgtcaccatc gacggccgcg
    11521 acgtgcgcgc cgcctggatc cgcgactggg acggcatggg ccgcctggaa aacctcggct
    11581 acctcagcgg cggcgaggaa cgcctcgtcc ggcgcgccgc cagcatggcc cacggctctc
    11641 cagtcgacct gtgcgccacg ctgagctccc ttggccacgc ccacgcccgt cgcgtcctgg
    11701 aagccgtcgc gatctgcctc ggcgccgatg agtactacga catcaccccg acccccgcac
    11761 tcctcgaaaa ccagcgcttc gaggaacaac tgctcgctgg cgagctgagc cgccgcgggc
    11821 tcggccccga tggacagccg gtgccgaacc cccagtcagg agagaccgag tgaccagcct
    11881 gccgacccag gaacagatct ggaccaacgc cgccgacgcc gccgaccgcg cggcgctggc
    11941 cctgtccgat gtgcgcgact ggctgagatc cgattggtcc gacaccaagc ccctgaccga
    12001 cgaagcggtc caggcgcgca gcgcggccta cgcccggctc gagacgctca aggacgagat
    12061 ccgcgacctc gaacatcaat tgcgcggcgg cgcgagaagc ctccgcgacc ggcgataacg
    12121 agacgaccgc tcaacgaggg gactggaaat gttcgacgag actccgatca gctgggaaga
    12181 cttcaaggcg cggcggccca gcgacgccga gaacgccgcc cggctcgccg acctggtccg
    12241 ccgggcccgc accgtccggg cgcacggctg ggacgactac cggtacgtgt ggtcgtccgg
    12301 cgaggtcgcg ggcgtcgcgt acttgctcga cgacgaggac gtgctccgcg acgccgacga
    12361 aaccgccgac agcgtgctga gccgctacgc ctgcgacctg ttcggcgtca ccggcggcca
    12421 cgacgacatc gccgccggcc accccggcac ccgcgcctgg ttcgaccacg cccggcagga
    12481 ggctgaacgg tgagtacgct tctggccgac gcggaggctc gggtcgcgac gctcgcccag
    12541 gcccacccag agatgtatcc gcagccggtc gagctccgcc gccgcgcgca tccccgtgac
    12601 ccggcgaccg agacagcaat cgcgttgtac cagtggagaa ctccggtctt caaggcgcgc
    12661 cgcgaacggc gtgtggtgga gcacatcgtg gtcgaccccg acgtgtacgc ccgcctcgac
    12721 gggcgcggcc gggacgcgct gttggcggtc gagctcaccc gggccgatca tgtacgtcga
    12781 accctgtcgg cggccccgct cggcctggcc gcgacgtggc agctcgaccg gctgctgcgg
    12841 cggagcggca ccggccgcgc cgacacggcc gtgatcaccg gcgtgctggc ggccgcggcg
    12901 ggcgcgttcc tgccgctgcc cgtcgccccg cccgtgcgcc tggtcctgct cgccgtcgtg
    12961 atcgcgaccg tggtgtgggc attcgacgcc gccatcacgc gcggtctcca tctccacgcg
    13021 gaccgggtcg ccgcgcgctg gatcggggcc gacgcggtgc gctacatgct catgaccctg
    13081 tccgccgacg aacaccatcc cgagggcgcg gccgcctggc gggtccggtg gctgggttac
    13141 cagccgaccc tccggcatcg gctgaagtcg ctgaaccgcg tccacgcggt cactgagaac
    13201 ctccgcccgg tcgagtgagg acgacaccga gcgatcatcc gcaagacggc catcaacatg
    13261 gggcctcatc atgcgccggg cgcagctgca ccacgaacga ctcgtccgtc actaccggcc
    13321 agcatttcac acaccaggcg tcacagtgac gaaatccgcc ggtgcccccg gagtggaggt
    13381 ttgggctgcg gagagccgga tatgcggtgg tttccccgcc gatgctcccg gccccggaca
    13441 ggtccgggca tttccccggc tccgatgtga ttgttcgaag tcgtgttcag tgctgacctg
    13501 tgggttcggt tctggttgaa gaggacttcg atcatcggcg tgtctcgaac tccggttcag
    13561 tagcgtgctt ttcgctcgta ctcgtcttca gtgagggacc agggatggcc ggggattcgt
    13621 cggtggctga tcggggtgtg ttgaccgcgg aggaggcccg ctggcaggtg gcggtgcagc
    13681 gggcggaggt gatcggccgt ctcgcgcagg gggatcgggt gagcgtggct gctgccgatg
    13741 aggccgccgc ggagttgggg gtgacgcagc ggcaggtgta tgcgctggtg aagcggtggc
    13801 gggctggtga gggggtggcg tcggatctgc tgccgcgccg ttcgtcgggt ggccggggtg
    13861 gtgagcggct gtctgatgag gtggaggaga ttgtgcgggc ggtgctgcgg gcgcggtatc
    13921 tgactcgtca gcggcggtcg gtggcggtga tctgccggga gatcgatcga gagtgcaagg
    13981 tgcgcgggtt acggccgccg tcgcggtcgg cggtgcagcg ccggatcagc aggctggatc
    14041 cggtgaagac cgtgaccgcg cgggagggcc agggggtggc caggtcccgc agacccgccg
    14101 gcggggtggc acctgcggtg acgggggtgt tggagcgggt gcagatcgat cacactccgg
    14161 cggatgtgat cgtggtcgac gagcatcacc ggctgccgat cgggcgtccg tatgtgacgg
    14221 cggcgatcga cgaggccacc aagtgcgtgc ccgggctcgt gctcacgttg gaggcgccgt
    14281 cggcgacctc ggtgggactg tgtttggcgc acatggcgat cgacaaacgc gcgtggctgg
    14341 aacgcatcgg ggtgcaggcg gtgtggccga tgagcggcaa acccgtccag ctgtataccg
    14401 acaatgcgac ggagttcaag agcgaggccc tgcggcgggg ttgtggtcag cacggtatcg
    14461 cgatcgacta ccggccgcct ggtgccccgc attacggcgg gatcgtggaa cgcctcgtcg
    14521 ggacgatgat gcggatggtc cacgaattgc cgggtacgac gttttccgac actcgcgagc
    14581 gcggcgacta cgacagcgac gcgaaagccg ttctcaccct ggccgagttg cagcggtgga
    14641 tggcgttggc ggtggcctgc tatcacggtg aaccccatga cggtttgggt gggcggaccc
    14701 cgggtggggt gtgggcggag aaggtggccg cccatggtgc gccgccgacg gtgacgaacg
    14761 agacggcgtt tctggtcgat ttcctgccgg tggagcgcag atcgttgcgg cgcaccggat
    14821 ttgtgctcga tcacgtgcag tactacagcg acgccttgaa gccgttgatc gcgcggcggg
    14881 agcagttgga gaaggtggtg ttgcgccgcg acccacgcga tatttcccgg atctgggcgc
    14941 tgcatccgga gaccggcgag tatctggagg tgccgtaccg gatgtggtcg cggccggcga
    15001 tcagcctgtg ggagcagcgc gcggcggtgg cgcggttgcg ggagcagggc cgcgccgaga
    15061 tcgatgagaa cgcgctgttc gcgatggtcg agcagatgcg ccacatcacc gccgacgcga
    15121 ccgcgacaag ccggcgagcg cgccgcaaca ccgaacgccg caaggcgacc ccggcacgca
    15181 gccgtgccca agccatacca ccggcaccac cggtgccgac gccgggtgcg gcgccggtgg
    15241 cggtggcgcc gttcgaggtg atcgagcagt ggtgagtatc ggtgagccgg tggatctgtc
    15301 gcatctgcat ccgtcggcgc agcggccggc gatgttgccg gatgctgagc ggatccagta
    15361 cgtgcgggcg gatcggtgga tcggctacac ccgcgcgagg gaggctttgg cccggctgga
    15421 gggcttgctg agtatgcccg gtaagcagcg gatgccgaat ctgctgctca tcggcgcgac
    15481 gaacaacggt aagtcgatga tcatcgagaa gttccgtcgc gaccacccgc cggtctcgca
    15541 tgaggatcgg gaggagatcc cggtgctgac catgcagatg ccttcggagc cgtcggtgtc
    15601 gcggttctat gtcgcggtgc tggccgcgct aggggcgccg atccggccgc gggcaccgcg
    15661 gctggccgag ttggaacagt tggtgctgcg cctgttgcgg gcctgcggtg tgcgggtgct
    15721 ggtgatcgac gaactgcaca atgtgctcgc cggccggggt gacacgcgcc gcgagttttt
    15781 gaacgtgctg cggtttctgg gcaacgagct gcggattccg ctggtcgggg tcggcacccg
    15841 ggacgcctat ttggcggtcc gttccgatcc ccagctggag aatcggttcg cgccgttcac
    15901 tctgccgctg tgggagccag gcgaccaggc gtgcgcgttg ctggcgagtt tcgcggcgtc
    15961 gttcccgctg cggcggtcct cgtcgatcgc gaccgaggag atggcgtcgt acctgttcac
    16021 ccggtgtgag ggcacgatcg gggagctgac cgcgctgctg tcggatgcgg cgatcgcggc
    16081 gatcgaatcc ggggaggagg ccatcaacca gcgcaccctg ctgctggcgt cgtatgcggg
    16141 gccgaccgag cggcggcgga tgttcgaacg cgagctggcg tgagcccatc cccgccgcgg
    16201 cgctggccgc tgcacccgcc accgggtgcg ttggagtcgc tgtcgtcgtg gctggaccgg
    16261 ctcgcccgca tctacgaggt gccggtacgg gagctgctgg gaccgaatct cggtgtgctg
    16321 gtgggcatcc gggatgttct cgacgaggat ccgcccccgg cggtgttcac cgcgctggct
    16381 gagcgcacgg gtgtgccggc ggggcaggtg cgggcgatga cgctgcccgg atgggtgccg
    16441 tggctgttcg acgcctaccc gctgcccgaa cgcgacgcca ccgacgggtt ctacacctat
    16501 gtccgccaat attcggtgct gctggcaccg cgggaggcac cgcggttcga ggtgacccac
    16561 cgtcgccgct ggcggggccc atggattccg gaacgcccgg tgcggcgatc gtgcccgcag
    16621 tgcgcggccg gaccggatcc ggcccgcgcg ctgatctggc agttgccgct cacggtgagc
    16681 tgcctcgagc accgctgccg gctggcgctg gataccgaca ccctcgcggc cgagatagca
    16741 ggccagccct accagcccgt tccggtcggt gaaccagtgg cggccctgga cggttacacc
    16801 cgtcaagccc tgatcaacgc cgcggtgagg ttgccgggcc gcacggtgca cgccggggtg
    16861 tggtttcggc tgctgcgctg cctgctcgac gaactcagcc tcgccggttc caccggcacc
    16921 cgcagctcgg agcggcttct cgaacagatc tgggacgcga ccggtgaacc gatccgcgcc
    16981 gggctggcgg tgtggcagcc ctacgagaac ctggaatgga ccacccagga gaaactgctg
    17041 accgccgccg cgacagcgct ggtgctggcc accgaccggc gcatccagcc ccggggaact
    17101 ctcgcctggt tgctgaccga accgcaacca ctgcccgtct acgacggcga cccaccacgg
    17161 ccaccgacac ccgacccgcc cgcacagacc aggcgcgacc tcatgcagac gatgaacgcc
    17221 tggtacgcgc gggcccgcat cgatgccgac gccgcccgcg cgatgctgcg gctgctgacc
    17281 gcactcgata cgacaccggc gcacgccacc cggcaccgcg acgtgctgat cagcgagggc
    17341 atccccgcgc gattcctgcg cgacgatcta ctgcggtgcc caggccggcg cacccgcgac
    17401 gaaaccgaaa ccctgctggt ggccgaaggg ttcgatcccg gtgaggtggc ctatgagctg
    17461 gactgttgcg tcgccgagac gatagcgctg tgggaggttc ccgacgaggg tgtgctgatc
    17521 ggcgaggacg aactcggcca gatccgcgcc cgcttggagt tgtgaggggt gccccgatgg
    17581 ccgctacacc cgcaaccggg cccgatcgaa tcgttgtcgt cgtgggtcca gcggctcgcc
    17641 acggtctatc agctgccggt gaaagtgctg gtggcggacc tgtgcgccga tttctcgccg
    17701 aacatgcgcg cgttcgcgaa ccggctgcac catccgccgc cagcgctgct ggacgcgctc
    17761 gccgtccgca ccggcgtccc ggtgccccgg ctggcgacga tgaccctgtc cgggtgggtg
    17821 ccgtggctgt tcgagaaact gtggccgcgc gagttcgagc agcaacagct gttcgacaac
    17881 tatgtggggc gtcaatcggt gttgctgctg cccgggacca tcgagcgcga catcgtccgc
    17941 cgcatcaaat cccgatggga cgcgccctgg ctgccgtacc cgcgcagacc gcgggcctgc
    18001 ccggtctgcg ccaccgaccc ggactccggc cgcgccctgg tgtgggatct gccgctgatg
    18061 ctcagctgtg tcgagcaccg ctgccgcctc gaacgcgccg gcgcggtcgc aggcggtgac
    18121 gccccggtgg tcgctgtgga cgagacggtc accacgatgg acggctacac ctaccaagca
    18181 ctcaccaccg ggctggtgcg gttaccgggc cgtaccgtgc acgccggggt gtggtttcgg
    18241 ctgctgcgat gcctgctcga agaactctgc gtgtcccgcc tggcgtgcag tgcccgcacg
    18301 gacgcggtcc tggaaaccat ctgggacacg atcgagctcc cgatgcgcgg ccggatcgcg
    18361 atgctggagc cgtatgagtg cctggactac gatgtcgccg agacgctgat gcgggccgcc
    18421 gcattggcgc tggcgctggc cgccgaacgg tccattccgg cggtcgggga actcgggtcc
    18481 gcgctcgccc cggtgccgta ccggccggtg ccgcccggag atcccccagt gcgacgctgc
    18541 gcgccgtcgc ggctcgatct gctgaatccg ccccgctggt ggcccgccgc gccggtgcag
    18601 gccggtacgg cacgggactg gtcacaggtc gctcgacgtt atgcgctcaa gcgagggttc
    18661 ccggcatggg tcttcggtgg gctcaccgac gaacccggac tcgactagct gtcggggtga
    18721 tccgggcata ccggcccggc gtcggtgaca cgccagcggc gcaccgacag ccagcgccgg
    18781 accagtgccg ggatttcgcc ggtgtcgcgg agttcggtgg cgtagacgcc ggtgagcaag
    18841 gggccgccgc agtcgcaggc cgcgcactcg atgtcggcga tcggcacttc tcgggggcgg
    18901 caccggtggc agtggcgggc ctcgatgagg ccgccgtcgt cggccggttc gagccagacg
    18961 accttgatgt cttcgaggag tcgcccgcgt tcggaggtct cgtgggcggt gtagccgcag
    19021 gcgtcgttcg ggcagaccgc gggcggctcg ggaaggttca tgcgagcggt ctgcttgagc
    19081 cgccacgcca gattcggccg ctcgcgagcg aactcgcgtg tgctggagtt ggtttcagca
    19141 tgttcgtcgg cgtcggccgc cggtagcggc cggatcggat ccggctcggg tacgaggcca
    19201 ccgaggtcga ccaggccggt cggcgccgcc tccgtcacca ccgcgctgga accgcccgga
    19261 gaaccaggtc gcccatcggt gggatcaccg gcggggacac cgagggtttg cggtgtggcg
    19321 gtcgcggttt cggtgatggc cggcgcgata cccggtgcgg ggtctgcctg gtcgaccacg
    19381 acggcggccg gtgcactggt tgtcgggagt ggggttgcgg ggccggagtg gggccgggtg
    19441 ccgatgctgt tcttgtcgag gtgtccatag agggtgccgc gtttgacgcc gaggatgtcg
    19501 gcgatctgct ggacggtgtg gcggccctcg tcgtagaggc gctgggcctg ttcgatctgg
    19561 tggacggtga gcttggggcg gcgcccgccg gtgcggccgc gggcgcgggc ggcttcgagt
    19621 ccgtcgcggg tgttggcgac gatcagctct cgctggaact cggcgagcac cgagagcatg
    19681 ccgaacatgg cgcggccttc ggcggtgtcg gtgtcgatgc cctgttcgag gactttcaac
    19741 ccgatgccgc gtgcgcggag gtcggcgccg aggttgacca ggtgcagcat cgagcgaccg
    19801 aggcggtcca ggcgggtgat gacgatggtg tcgccgcggc gggcgagggt gaggacgaga
    19861 tcgagtttcg gtcgcgatgc cttcgcgccg ctggcagtat cgatgtggat gtcgcccggt
    19921 tcgactccgg cgcggcggag cgcgtcgatc tggtgggcgg ggttctggtc ggcggtcgac
    19981 acccgcccgt agccgatcaa catgatgtcg aaaatagctg aaatcgggtt tgccgacgtt
    20041 gattcccggc acgagttttc gacactctta tcttggggtt tctcccgctc acgcaaggtt
    20101 gtcggcaaat gatcgttttc cgacaatcac tatctgagcc gaacatgctc ccaaccaggt
    20161 tcgcgccgac tccactacat cagtacgcat ctggtttgag ctgtttcgat tcatcgtttg
    20221 caacctggat ttaattgatg ccatagtgtg gagactgaac taggtctaca cgaggagtgt
    20281 gctgcatggc tgtccggttc aagctcggtt actactcacc attaaccgac gacccgctga
    20341 atcgcgatta tgtcggttac ttcccgcgca tgaccgaaga ggaggcatgg acagcgggcc
    20401 ggggagtatg gaaggcgaac aaggaacggc tatcaaggga gaagttcgcc ctgatcatcg
    20461 gtgacagccg ggtgtgcgcc gttgccgaga tccgcggcgt gtcggtgtat gaggatcggg
    20521 tggctgtcga tggggaggcg ctgggcgaag gtcacccggt gcgcgacgcc tggatcggca
    20581 aaccggatcc ggtggtgaac gcttcgcaga acccggtcgg ctactgcgac ctccccgaag
    20641 aggccgaatt ccgggaacgg ccctgcggct gcgggtgcgg ggagatcagc acccgcgact
    20701 tcctgcccgg ccacgacgtg cgcgccttcc aggaccgggt acggcgcatg ttcgccggat
    20761 cggcactgga gttcttccgc tgggtcgacc gcatcggcgc cgagcacggc cttccgctac
    20821 tggccaaccc caccggtggc acggcactgc ccgacgagca ccgcgagccg ccgaatccgg
    20881 accccggtga gcagtcgccg cacgacccgg gaatctccta cgccgccctg tccgactctg
    20941 gagatttgtt gtccggcaac gaatctcgtg cggagagcgg agagcctgtc tgagactgtc
    21001 cgggccgcta cgcaggaacc accggcagct cagtcggcgg tccccgccgg cccgggtccg
    21061 gcgggttgcc tcgccgaact gctcgatggc ttcgatgatc cggttgtacc ccttgctcca
    21121 gcagttcgag gtcagggcgt ccgggcgggg gtactgtcgc ccggcacgcc actgcggcgc
    21181 gcttcctaga tgcactgatt ctcgccgtgc gtctgaagcg cggagaccgg aaccggggtc
    21241 ggctcgtcat cgggatgctg gttgtcgact gtcagcgcac gtaggacaca acgctcatca
    21301 ttccggcctc gccgtgatag gcgttgtggc agtggaccat ccattgtcca gggttgtcgg
    21361 cgtcgaagtc gacctcgacg gtctgcatcg gcagcacgat ggaggtgtcc ttgcgcgggc
    21421 cggtgcccgc agcggagacc acctggaagg tatgaccgtg cagatgcatg gggtggaaca
    21481 tcatcgtctt gttgaccaac cgcagccgaa cccgttgtcc ctcggtcaca tcgagcatgc
    21541 tgtggtcggg aaatgccttg ccgttgatca tccagaggta cttggccgtg tcgttttcga
    21601 gggtgaggtc gagtgtgttg tccggcgtgc ggttgggcag gcgtacggat tcggcgccga
    21661 ccagtcggtc cgcggtgagc gggggagccg acagttccgc gggacggacg tcggcgggcg
    21721 gcggtgtgcc accgccggtg cggatgagag cgaagccttg gcccgcttta ccttcggcgg
    21781 aagcgaccag cggaaacacc ccgtcggcca gttcgacgac ggcgtcgtag cgttcgccca
    21841 tgctgatgag caggctggag gtggtgaccg gctgcaccgg gaaggcgtcg ctgtgggtga
    21901 cgcgcagctg gtggccgccc acggcgacgc ggaaggcggt atcggaggcg gcgttgatga
    21961 tccgcagccg gatgcgctgg ccagggcggg cggtgatcgt caccggatcg gcgccgatcc
    22021 ggccgttgat cagatagtac ggatagtctc tcacgtcccc ggtgtcggag ccgagcgggg
    22081 cgctggggtc ggtgggcatc gccatcgtgg acgatccacc catggtcatg ccgccgtggt
    22141 ccatgccgcc catatccatg ccagacatgc ccttggcgcg cagctgatcc agttccttgt
    22201 ccgggtcgcg gccgttgacg ccgtcgagcc agtcgtcgag caccacgacg gcttccaggt
    22261 cgtagtcctt gccgtcggcg gggtcctcga tgatcagcgg agcgtacagg ccacggtcga
    22321 gctggacccc gacgtgtggg tggaagaagt aggtgccggg gtcgggtgcg gtgaactcgt
    22381 agccgaaagt gccgcccggc gcgatcggcg gttgtgtcac ctcgggtgcg ccgtccatgt
    22441 cgttgcgcaa cgcgatccca tgccagtgga ccgtcgacgg tgcggacagt gcgttggtga
    22501 attcggcccg cagcacgttt cctttggtga tacggatttc ctggccgggc agtgtgccac
    22561 cgtaggccca ggtctggacc cgtacgccgc cgaggtcgac ggtggcgggc tcggcgcgca
    22621 gccgcacctg ccgcacagcg gcaccggccg cccgccgcct gttctcggcc gcgcggaccg
    22681 cttcggagtc cggttcgacg agtgtgcgtg aagcggtgga gttcttggag catgcggtga
    22741 gggcggcggc cgcggtgacg ccggcgccga gggcgaggaa gccgcggcga gtcatcgggg
    22801 tcgagtgggg gaactggctc gaggacatgg gtttctccct gggggtgaag gattcggggc
    22861 accgcgccct ggcgtcgggg cggcttcctg tgatctggta cagccagtgg gccgccgaat
    22921 gccttgcagt ggcttcatgc cgcaccggct gtcgctgccc gcccagaagg cggggcgtgt
    22981 acaccgcgcg actggattcc ggcagcggcg ggtcctgtca gatccgcaga atcgatagtt
    23041 cagccagaga ggggaccgcc cagggtggtg gccgttcgcc gtgcgcacgc cagtaccctg
    23101 tcgacggcat cgccccgacg ccgtgcatga ggtgtgcccg gtacaggaat accaggccga
    23161 tcgccagagt cagcatcgac acgatgaaca cacaggcgtg caccgcttga tgtccgagac
    23221 cgtgatcacc gcccaccatg gttacctcgt cgtggtggtg ggtcctcacg gctgtgacgg
    23281 cgggagcaga ggagtcggcg tggtgcgccc cggaccggag cgtgtcggac ccgctgtgga
    23341 acccgctggc gtgcatgacg gtgatgccga caatcagcac cagcaggccg agcacccgga
    23401 ccgaccggga cgcacacgac ggctggtgct gctgcatcac accgtcatcg tagtgcctgg
    23461 catcgccttg ctcgagccgc tacccccgtg gggtaatcct cgggcgcccg ctgcctcgct
    23521 cggcgacgca ggtctcgtgg gccgcggttc aggaggggtc gcagccgtcc gtggacggga
    23581 gccggtcggc cgcggccagg gcgtgcaggc agcactcggc caactcctcg ggtgagacat
    23641 cggttcggac cgagccctcc acggcagcgg ccgcgatcag gtcaacgatc atcgcctcga
    23701 ggtattgcgt tcggtcagta tctccaccga cgacgaacat gtggcttgtg gcctacaggt
    23761 acgtggtaca gagcgagaag atatacccca gcggggtata ttggtggtgg tgcagatcca
    23821 ctgaagtcgg gagaatggtg gtgcaatgag gtggccgagc gacgaagtcg cctggtccgt
    23881 gcgcggctgg gtcgcattcg cgactcgcgg cgtcaggtgt ggtttctttg gtcctgctac
    23941 agtcggctca ctgtgaggct catcggtcga ttgcgacatg gtggctccgt ggcggcgctg
    24001 ctcgccgcgg tgctgctcat cgtgccgatg gtcgactgct cgacagccgc agcccatgca
    24061 catgctgcat cggttcccgc gggggtcgag gaattcgcgc actcgatgag tgatcacgcg
    24121 cacgccgtgg tcgttgacgt gcgcgacggt cactgtgtgg cgcacgtcga tcactgtgtc
    24181 gcgaagtcgg tgctgcgtgc acccgagaat tttgcgccgc agcatgtgct gctgttcgcg
    24241 ctggtatcgg cgcttgttgt cgctgtgggc gttcgcggga ccactgcggg gggtgtgcgt
    24301 ggtccgccga tcgcgtgggg gcccgttgcc ggtggccggg ccattttgac gcagttctgt
    24361 atcgctcgac gctgacaggt cagcgccagg ccgacatttg tctgtcggcc ggtgtccgct
    24421 gccctgctca cagtgttcgc cgcctatagg gcggttcggt acagaaagcg acagtcatgg
    24481 acaaggtcgt gctcgatgca ctcgccgatc ggtccgcggc cctggtgggc gcgccggtag
    24541 ctgcccggta tccgcactcg ctgatcggca acacaccggt gttgtgggtc ggtgcgccgc
    24601 tggcgcccca ggggcgggga ttctgggcga aactcgaagg attcaatccc ggcgggatga
    24661 aggaccggcc cgcgctgcac atggtgcgca aggccgagca acgcggtgat ctggcaccgg
    24721 gggcgcggat catcgaatcc accagcggca ccctcggctt ggggttggcg ctggcgggga
    24781 tcgccaccca tcacccggtg acggtggtga ccgatcccgg tctggaaccg atcgtcgcgc
    24841 ggatgctcac cgcctacggc actcaggtcg acgtggtcac cgaggcgcat cccaccggcg
    24901 gctggcagca ggcccgccgt gaccgagtcg cggagctgct ggccggtgag cccgacgcgt
    24961 ggtgcccgga ccagtacagc aaccccgaca acgtcgacag ctacgaatcg ctcgcgctcg
    25021 agctggtcga gcagctcggc gaggtggatg tgctggtgtg cgcggtcggc accggcggac
    25081 actccgcggg tgtcgcgcgg gtgctgcgcc ggttcaaccc ggggatgaag ctgatcggag
    25141 tcgacacagt cgcctccacc atcttcggac agcccgcagg cctgcggttg atgcgggggc
    25201 tcggatcgag catctacccg atcaacgtcg actacgacgc cttcgacgag gtgcattggg
    25261 tcgcgccgtc ggaagcggtc tgggcgtgcc gcaccctggc cgcgacccat cacgcgaccg
    25321 gcggctggag cgtcggcgct gtcggactcg tcgcgggctg ggcagctcgg acccacgatg
    25381 ccgataccag gatcgcggcg gtgttccccg atgggccgca ccgctacttc gacaccgtct
    25441 acaacgacac ctattgcgag gagcacggcc tgctcgatgc ggacccgccg gtggaaccgg
    25501 acacgatcgc ccatcccgcc gaacgtgtgg tgcggtcctg gacccggtgc accaccgtcg
    25561 tcgatccgag gcagttcatc cacgaccggg agccggcatc gtgaccgtag tcgcgaaatt
    25621 ccgcagcttc gatatggctg cccgtctgtt gatgatcaac cagttcggca tcaacctcgg
    25681 cttctacatg ctgatgccgt atctcgccgg ctacctggcc ggtccgctcg ggctggcggc
    25741 ttgggcggtg gggctggtgc tgggtgtgcg gaacttctcc cagcagggca tgttcctcat
    25801 cggcggcacg ctggccgacc ggctcggcta caaaccgctg atcgtcgcgg gctgtctatt
    25861 gcgcaccggc ggcttcgcgc tgctggtgtt cgccacctcg ctgccgggac tgctgatcgc
    25921 ctcggccgcg accggcttcg ccggagcgct gttcaacccg gccgtacgcg cctacttggc
    25981 cgccgacacc ggtgaccggc gcgtcgaggc gttcgcggtg ttcaacatct tctaccaagc
    26041 ggggatcctc gccggtcccc tggtcgggct ggcgttgatg gccctcgact tccgggtgac
    26101 cgccgctgcc gcggcggtgg tgttcgcgat cctgaccgcg gcgcagttgt tcgcgctgcc
    26161 gacgcggcgg gccgagaccc ccgccgagca cacctccgtg ctcgacgact ggcgcaccgt
    26221 ggtcgcgaac cgccggttcg tagggttcgc ggtggcgatg accggctcct acgtgctgtc
    26281 gttccaggtc tacctcgccc tgccgctgca ggcggaattc gtggcgggcg cacaggcgca
    26341 ggcgctggtc tcggcgctgt tcgtcatctc cggcgttgtg gcggtcgccg gtcagctgcg
    26401 catcaccgcc tggttccgca acaggtgggg caccggacgc agcctcgtcg tcgggctggg
    26461 catcctcgcg gcttccttcg tcccgctggt agtcgtcccg gatccggatc gattcggtgt
    26521 cccgcccgca gccgccgcgt tactcgtgtc ggcggtgttg ctggccgtgg ggaccgcggc
    26581 ggtgttccca ttcgaaatgg acaccgtcgt gtccttgtcc ggtgggaagc tcgtcgccac
    26641 ccactacggg ttctacaaca ccgttgtcgg tgtcggcatc ctcaccggca accttgccac
    26701 cggtgccgtg gtcggcgccg cccgcgccgc cgggatggac tgggcggtct gggccggcct
    26761 gagcatgatc ggtgtcctcg ccgcgttcgc tctccaccga ctggaccgcc cgcagcccgt
    26821 cgcggaaaaa ggccggtcga cgcgcactcg cgggcgccac cgcatccccg atcaacacac
    26881 cgtcggcact gcgccggccg agcagcaatt cgagtacacc ggacgcggcc actggccgac
    26941 gaagatcccc gccgcgcgac gctgaccagg tgcgcacaat ctgtgtgcac ttcgggtccg
    27001 gggtgctgct ctgtccggaa cgctccagat gtcgttatcg ccgggcagcg gcttctcgca
    27061 ggctcatctc tgctcgagca ttgccttcat ctggtcgatc tcgcgctgct gggccggcac
    27121 gatcgcggcg gccagctgct tggctcggtc gttggctccg gtgtcgagtt cggtctgggc
    27181 catctgcacg gcgccggtgt gatggttgat catcatctcc agccacatcc ggtcgaattc
    27241 cgccccggac atgctctgca gcgacgacat ctgctgcggc gacatcatgc ccggcatgtc
    27301 atgacccatg gggcccatcg ggccggtggc cggggacggt acgggcttgc cgaactcctc
    27361 gagcagcgaa cggatctgtg ccatctcggg ctcctgcgcg gttttgatgg ccgaggcaag
    27421 atcgagcaac tgctggttct gcgagtgcga cggcaccaga tccgccatct gaatggcctg
    27481 cgcgtggtgc ggatacatgc tctgcagaaa cgtcacatcg gcatcgttgt aggtgcccgc
    27541 cggcgcggac gtcgcggcgc cgacggtcgt cgatatagcg ggcgcgctcg gtcccgcggt
    27601 cgtggtgggc ttgtcggcct cgtcgctgtc gccgcatccg gccagaacga acagcaggac
    27661 ggcaacgccg ggaagatatc gtcgaagcgc ggtggaacgt agaggcatgg cgaactcctg
    27721 tagtactaga gccgggacaa catgacttca cgcgttgagg aaggcgcgaa acgaacgatt
    27781 taagcccatg aagccgcccg cctttggctg cgatgctctg accccaagga cgaggggcga
    27841 ccggccggag cgtgccgcgt tcgggcactt gaaatgagcg agtagaagag cccagtacac
    27901 actctggtat cggacgatcc gtgtcggcta gatcggcggt agtaccagcg gcggggctgt
    27961 tcagccgagc gcctgaatga ggtcggtgca ggcttgctcg cagcggcggc atgcttcggc
    28021 gcacacgcgg cagtgctcgt gagtgtcggc gtgggcggag cattcgtcgc cgcaggcttt
    28081 gcaggcggtg gcgcatgcct cgaggatcgc gcgtgtgatg ttggcgtcgt agccggtgtg
    28141 ccgggacagg acggatgcgg tggcgttgca gatgtctgcg cagtccatgt cggtgcggat
    28201 gcacttggtg agttcgccga ccatgccctc cgaaaggcag gcgtccgcgc acgcggtaca
    28261 cgcctgggcg caggcgatgc attcctcgat gcacttggtg agcttgtcgc ggtcgacgtc
    28321 gccgaggtcg gcgggggtag gtggcaagca tgtccttgac cgtggtcatc aggtattgcc
    28381 tcctttcgct ggcggatgcc gggctggccg ggacggccgc gcctccttcg acctcctgcc
    28441 cttgtgggta gccaccgcga aacgacgcaa acgcgccccg tggaccgtcc cgcaagcagt
    28501 cgaggccacc tgtcggcgta ctcgacgtgg tgatcgggtg gcgggcgagc gaaccaactg
    28561 tcggtgggcc agatcctgct gatggacaac ccgctgctgc gggaagcgtt gcggccgcaa
    28621 cacatcaagc cgcggttgct cggtcactgg ggtacgacac caggtcttca ctcgaacgag
    28681 tccggcggca acggaattca cgcgcagcag gcggatgtcc ggctcatcga cgggcacagc
    28741 ctttctcggt tgccctcgga cccggccgcc gcgctctacg cgatcacccg cgtcgcctcg
    28801 gaggttccgg tgtgcgcggg tttcggtatg gggagccgga gtcgtttgag ggcgagggcg
    28861 ttgacggcga cgatgaggct ggatccggac atggacagtg cggcgatctc cgggcgcagc
    28921 atcaggccga aggcgggttc gaagacgccg gcggcgatgg gcagggcgat ggtgttgtag
    28981 ccgatggccc aggccaggtt ctggcgcatt ttgcccagtg tgccgcggcc gatgcgcagg
    29041 gcggtgggca cgtcgagcgg gtcggatcgc atgagcacga catcggcggt ttcgatggcg
    29101 acgtcggtgc cggcgccgat ggcgatgccc aggtcggctt gggcgagggc gggggcgtcg
    29161 ttgacgccgt cgccgaccat ggcgacctgg cggccgctgc gttgtagttc ggcgatcttg
    29221 gtggctttgt cgccgggcag tacttcggcg atgacggtgt cgatgccgag ccgctcggcg
    29281 atgcgtttcg cggtggcttc gttgtcgccg gtgagcatga ccacctcgac gccgaggtcg
    29341 tgcagcgcgg cgacggccgc cggtgaggtt tcgcggggcg cgtcggcgat gccgatgacc
    29401 gccgcggcct tgccgtccac ggcggcgatc accgcggtgc gtccggtggc ggccagttcg
    29461 tcgcgacgtg cggccagcgc gccgaggtcg atgccctctc gttcggccag ccgccggtta
    29521 ccgacgacga cacggcggcc ctcgacctcg gcgatcgcac cgtggccggg gacgttctcg
    29581 aacttttcgg cccgaacctg acctacccct gcgttttccg cgtagcggac gacggcctgg
    29641 gcgagggggt gttcggattc gcgttccacc gcggcgatca ggcgcagcac ttcggtttcg
    29701 ccgatgccgt cggtgatgac gtcggtgacc tcgggttcgc ccttggtgag ggttccggtc
    29761 ttgtccatta ccaccacctg gatgcgggct gaagtctcca gtgccatcgc gtttttgaac
    29821 aacacaccgc gtttggcgcc gagcccggtg ccgaccatga tcgcggtagg ggtggccagc
    29881 ccgagggcgt ccgggcaggt gatgaccacc acggtgatcg cgaacagaat cgccgccgag
    29941 aacgggcgat cggacaacag cagccaggcc gccagcgtga cgccaccacc gatcagcgcg
    30001 acgaacacca gccagaacgc cgccttatcg gccagacgct ggcccggagc cttcgaattc
    30061 tgcgcttcct gcaccagttg cacgatctgc gccagagcgg tgtccgcacc gaccttggtc
    30121 gcgcgcaccc gcaaggtgcc gttggagttg atggtcgcgc cgacgaccgc cgcgccgggg
    30181 gccttgtgca ccggcaggct ctcgccggtg accatcgact cgtcgacctc gctgtcaccg
    30241 tcctccacga ccccatcgac ggcgatcttc gcgcctgggc gcaccagcag cagatcaccg
    30301 accgcgacct cggcggtggg aatctcgacg ggttcgccgt cgcgcagcac cagcgctttc
    30361 ggcggcgcga ggtcgagcaa ggtgcggatg gcgtcgttgg cgccgccgcg ggcgcgcatc
    30421 tcgaaccagt gccccagcag cacgaacgcg gccagcacgg tggcagcctc atagaacact
    30481 tcgccgccgc cggtcaacgt gatcaccagc gagtacagcc aacccgagcc gatcgccacc
    30541 gcgaccagca ccatcatgtc cagcgtgcgg gcccgcagcg cccgcccggc gccgtcgaag
    30601 aagatccacg acgaatagaa gatcaccggc aagctcagca acaacgccca gatgtcttca
    30661 cgcagcccga acggcaccgg cacgtccagc cccagaacct ccctgccgat gggcgaccag
    30721 atcacgatcg gaatcgagaa cagcaacgcg accaggaacc ggttgcgcat atcggccacc
    30781 atggctgcca tcgacatccc ggcatgcccg ccgtggccca tcgcctcgtg cggggaacgg
    30841 aggtcaccgg taccacccgg gtgtccctcg tgagcagggg ccgccacggc gtgtccggca
    30901 tcgtcgatgg gttccgcggg cgccagctga ccggcgtgtc cggtgtgctc gtgatacccg
    30961 tcgccggagg gtgggtccgg ttcggtcagg ggatcgcaca ggtgggcggg caccgagcgt
    31021 ccggcgcagt ggtagccaca ttcgacgacc cagtcccgca gcgccgcaat cgtggtctgg
    31081 gtctggtcgt agaccacggt cgcggtctgc gcgaccgggt tgacctcgac tcgatgcacg
    31141 ccggggcggc gagcgagccg ggcgacgaca acgttctgct gcgaggcgaa cagcaggcca
    31201 cgcacatcga gcacggcggt ggctcgttcc ttcggcgggg gcagatgggt atcggaatgg
    31261 gttgtcacgg ggtcactcct ccagaggccg gtagtcgacc gtatcggttg cggacagtgt
    31321 ttcggcgcgg gatggacggg cagcgcgggc cacgaccgcc agaccggcca ccacgatgac
    31381 gtcgccgatc acgccggcga gggtgatcgg ctcatcgagc accaccaccc cgaggatcac
    31441 cccgacgacg ggaaccagca gcgtccacgt cgtgaccgcg gtgagcgagg cccggcgcag
    31501 ctcaccgaac cacaacagat acggcagggc agttgccacc agcgcgagta ctgccagagt
    31561 gagcgtgaat cgactgctcc acgcgatcgt ggtgggcggt ccctcgacca cgcacgcgat
    31621 tcccgccagc acggtgcctc cgagcaagaa ctgccaggca cccaacacca gcaaatcgat
    31681 gctggacaac cgccgcgcca gcagggcacc caccgcgatg ccgaacgccg ccaacaacgc
    31741 cagaccagca ccacgaccac cacccgacgg tgccgcgata atcaccagac caccgaaacc
    31801 gacagcgaca ccggtgatcc cgagcaaccg cggccgctca ccgaacaacc accacgcggg
    31861 cagcaccacc agcagcgacg ccgagttgct cagcaccgac gccaccccgg tggtgacgcc
    31921 ggtgatgctg gcgaacatcg caccgaacgc caccgtcaca ttcagcaacg ccagcacccc
    31981 gatcagcgac cacacggcag caccgcgcga aaccagcagc gccaccctgc caccgcggcg
    32041 accagtaagg ccgtcgctgc gaccagggcc cgcagtgccg cgaaccacag cactggcgca
    32101 tcgccgaccc cccacatgat caacgtgaag cacgatcccc atgccaccac cacgatcagc
    32161 atccgcgccg gtcgcgcacc ggcccgaccg gccgagaccg gcaagcctgc cgtaacggta
    32221 cgatgatctg cgcgcatcga cgcgtccttc ccgatatgga acaccgatca gtcgaccacg
    32281 atcaatgggt aggccccgtc acggtgtgac gcaggtgccg cgtccgatgg cgaggcaacg
    32341 ggatcgaatc gagcgcagcg ctggctcgcc ggaagccact ccgcgcaggg gccggggcct
    32401 catcgaatac gtgagcgcct ccggctacat gcaggcaagc ggtagtgggt agccgccgtt
    32461 cccgggcaca aactctgcgc attgtcaaag gggtcggagc ggggcggtcg gcgggactgt
    32521 catggcaccc tccaaagcgc tacccggccc ttactacccg gcgccaccgc tcttcgtccc
    32581 tcggccggag ccgatatcgc cgcgcagcgt agccagccgc tgatggtatt catccgcatc
    32641 gatctcaccg cgggcgaatc gctcggccag cacctgctcc gcactcgggc gcacgatcgg
    32701 cgcgccgccg accggcgcgg agggctgggc caggtaccgg actgtcagaa tcaccccaac
    32761 gatcaccaac gcccagaaca acaccatccc gacagtcatg agcccgtaac cccacccgct
    32821 catcccgtcg ccgtaccaga acatcatcgt gcactcctcg atcgataaga actcacctcc
    32881 gcgtcgggac agccctataa cctgtcgtgt cggcgggggc gagcgctccg tattctctac
    32941 ggtccgcgtc gctgagcgcg gccggtagag accaggtgcc cttccggcgc acccgaaggt
    33001 ccctaccccc agtaggtctc attcacggga ggggagggtg acgttgcgtt cgcgctcacg
    33061 tgtgacgtcg gcgcggatgg tggccaagcg cgaacgcggc catcgatacc cccaatagcc
    33121 tcgcgggcat gcagccgccg cgcggtggcg atgatgcgtt cgcgcggttg cttcggcatc
    33181 gatacgcaac tcggttcgtg tggctcggca ggggtgagcg atcctgcgtc gtggtgacac
    33241 cctcgtcatg acgcggctgg accgactcgg ccgctcggtg ctgcacctgg tcactctcgg
    33301 cgcggaattc cgtaacggct gtgccgacaa cattcccacc gtatccggaa gccgggtcga
    33361 catacttgcc ggcctgcacc tgcctgacca agggcgttct tgcccgcgat caggtcggcg
    33421 acccctccgg gcagcccgac cgcgaccggc ccgcggaacc ggtcggccgc cgcccgcggt
    33481 gcgccgggcc gcaggccgct gcgtgcccgc ctccagacgg catcgcccaa gaggtccacg
    33541 cattactggt ccctgaaccc ctgttcaggg gcatcagaac gcgaattcgg tgccgtaacc
    33601 tgtcgtttgc acagtgccgc tggtgggatc agcgcggacg atgacgaacg gcatggccga
    33661 gaccggtgat aggcatcccc cgacgttcag cgcggtattg gagtgcgcga aggtatacgg
    33721 gaacgttgag ttctcgtcca gggtgactcc gccgactact gccgcggtca cagtgcccgg
    33781 ggccagattc accgcaagcc ctccggtgcg gccccctccg acaccggtac cgacgctgat
    33841 accgggcgga gcgtctatca ccagatcgat gccggagtcg aggccgaaag aaggtgagac
    33901 tctggcgatg acgccggcct tgggggggac gcctatcgag atgccgttgg aaatgttcac
    33961 ggcgcagccg accagatatc cggcgacgat ctgcccgcct ggcagcgacg aggctccgtc
    34021 gagatcgatc gaatactcgc cggacgtcgt gaccgcgtgc acgaaaggta tgccggatac
    34081 gacatcaccg tcagcgggta cgacattggt ggaacctacc gacgcgatca ggcgcagccc
    34141 gccggaactg aactcccccg gtgccgcgcc gaccgcagta tcgacaacgg caactgcacc
    34201 ggtggcggcc accatcaccg ccgtgatcgc cgccagaatc agcgaatgct tgtgtttcat
    34261 cacgctccag tcgagtagtc atcgagacga aacttcacaa aaggacccgc acagcaacta
    34321 tcgttgcgca tggtgttcgg cgtgtgcgga ccgaaacctt acccggtggg tgcagctcag
    34381 tcgccgccat cgtgccgcaa cagcggtgat ggggcagtgc tgcatggcgg tggcggtgat
    34441 ctacccgacc aaggcggtga cgacgaagtg gcagtccgtc ggcggcatgc ctgcttcagg
    34501 caaccgtaag ggccgccggc ccggcgcccg cagacagccg cgctcgtagt ttgaagccga
    34561 tgccgtcata tcgtgtgacc ggggccgatt tggatgatca acgaaaaaag attgaacgtt
    34621 gtattccagg tcggaccaaa atgaaacaag tactccacca cagtgctctc ctatgctcgg
    34681 cgaatcacac ggctgatgag tctgcagctt gtgtcgtgag tatgactcca atatggccca
    34741 gtgcacccac tgacacgaga acatcatcgt tgcacttctc gatcgctgcg aactcaccgc
    34801 tgtcgtgtcg tgtcgcgaga tccccatacc gctgccgcgc cggccgtggc gagcgcccca
    34861 tactccctac ggtccccatc gccgagcgcg gccggtagag accaggtgcc cttccggcgc
    34921 acccgaaggt cccggtaccc cagagcagac ctgctacata cgctgctgcc cgctgccacc
    34981 gcaggcaggc gggagcccgg cgcatacgga acggatgcga gtgctgcatc gacctcagca
    35041 cctcgtcagc aacctatgcc aggaggtcga atgccggagg gaccgtcgga gatttacgac
    35101 agtccctgcc ggacgcgtcg gtcgcgacgc cacgatcacg ctcacccgtg gagccgcgcc
    35161 ggggcgtgtc acatcggctg catcatcatc gggcaaccgc ccatcaggct gcacatccac
    35221 tggcacaaca tttgcatggg gttcattacg tcgatttcct ctcgggggtc gtcgaccgat
    35281 ccgaccgcag ggtggcgggt ccgccgggtt ggtcgtgcgg tgtcgttgag gttgccgcat
    35341 cgataccccg cacgggtagg gacctttgac ggtcggacgg aggtccttcg atgccgctcg
    35401 aggctacctc gtcccatccc ggcaaccggt gtgccagcgc agaccggagg tgatcgcgaa
    35461 agaagggaat gcgatgaaca ctcggtatct tccgtggtac gcgctcgcgt tggccgtgct
    35521 ggtcgctggt ctcgccattt cgggcgtgcc ggtctcgacg ctgctgctgc tgctcgtcgt
    35581 actggcctgc ccgctgatga tgatgttcat gatgggcggc cacggacacg gcggcaacga
    35641 cgagccatat gagatgggca aacgccatga ccatgacccc acttccggcc ggtcttgaac
    35701 gcccacagag gtgtatgagt tacttcggag aactccgtga ccactgagcc caccacagcc
    35761 gaggccacgg cggccgagcc tggcaccgca gtcacacgag acacgacgct gtcgccactg
    35821 ctggcggccg aggggctgga gaaggcttat cgccgtacat ccgcggatac ccaaccaacc
    35881 gccgcgtccg gttcagatcg tcatgaaccg aaccaccatc acctccccgc cgccacgacg
    35941 cccggtagcg gggagccgcg cacgattgcc ggtatcacca cggccacccg gcagatcgct
    36001 gctgagaaac gacgagtcca cactgaagag gacttcgaaa atcactgaag gtgacttcga
    36061 aacgtgacat ccgaggtgct gacctgcgaa ttcgtggtgc tgactccgga taactgccat
    36121 tatccggagt cacaccaaaa aacactacgg tgagataccc tcacgcagtg agattcgtca
    36181 tctcgatgtc agttggcgat ctggggattc gtcactcgtg tcagtagcat tcgtcacctg
    36241 atgtcagtaa agacctgttc aagccctgta ttgcagatga ggcgacgagt cgaaatcgtt
    36301 cgtagaacct cttcagagat gtcagtaatg acgagtcacg actgacattt cacggtcgcg
    36361 gcggagccgc tcatgtagcg gtcgacggag gcgacagcgt caggctttga cgaagctggg
    36421 gcgcgcgttt gccgatcttg gtcagggcgg cgtcggcgcg gggtggattg cagcggcgcc
    36481 aggatcggga cggcgatctt ccatgcgtcg actgcgccgc cgtggtcgcc gttctcccat
    36541 cgggccatgc ctacgtcggc tcaggtacgc ccgtagacgc ggtggtgtgc cttgggatcc
    36601 cagaaggtgg gtggccagca gatgatgcga ttccgcagcg ccccactcgt tgagcgctcg
    36661 cagggttttc gctcaccaac atggtcggcg tcgatccatg gttcggtcac ccggagtgct
    36721 tcgtgggctt ggttgcggtc acctcccggc ctaccggacc gaacgggccg caaccatgtc
    36781 gacgacgagg ttcgcgcgcg atcggcctcg cgcgatcgta ggacgaattc gtttcgatcg
    36841 tgcggaacag aggtgaccca ccatcaggcc cgctcgtctg cgctacgacg tgggcaccca
    36901 ccctagtggg agacctgaaa ccctacttca cctgcataaa cccggtcatc cacggccagt
    36961 cgatcgccga catcgacaca acatcgacaa cttacggaga cgcccatgtc gtcaccacca
    37021 acccgggcac cctcagatcc cggtgtttgt gtcggggcgg atgctgggcc gggtcggtaa
    37081 ccaccagttc cagtcgccga gcaggcgcat gagggcggga acgaggacaa ggcggatgag
    37141 gacggcgtcg aggaagactg cgacggcgag ggcgagtccg agttgtttga gttcgagaat
    37201 gtcggcggtg aggaagcttg cgaagatggc gatcatgatc gcggcggcgg cggtgatggg
    37261 gcgggcggtg tgagtgagcc cggcggcgac ggcgtgctcg ttgtcgccgg tggtgtccca
    37321 gtattcgcgg atgcggcgga tgaggaagac ctcgtagtcc atcgagagtc cgaacaacag
    37381 cgcgaacacg acggtgggta ggtagacctg cacgaagccg gggctggtga agtcgaggat
    37441 gttctccccg aggccccatt ggaatacagc gacggtgata ccgagggcgg cgccggtggc
    37501 gagcaggttc atcgcgatgg ccttgatcgg cagggcgatg ctgcggaacg cggcgatgag
    37561 gaagatcagc gaggcggtca gcaccagggc cacgaccagc ggcagtttgg aggtcatctc
    37621 gtcggagagg tccacgaact cggcggtgct gccgccgata cggatctcgg ctcctgccgc
    37681 gtcagtcgct gtgttgcgca ggtcgcggat gaggtcggtg gcctccatcg agtcgaacgc
    37741 gaccgacggg agcgcaagcg ccagcactcg tccgtcgttg agctgggcgg gcagaacggt
    37801 gtcgatgcgg tcgtcgtcgg cgatctcggc caggaaccgg ttgacctgtg ctgcggggtc
    37861 cccggtgagc ggggtgtcgc cggggccggt ggcgatgatt tcgaccggtg agagtgctcc
    37921 ggcggggaag tttgtggtca acgcggtggt ggcgcgtccg gtcggtgtgt cgtcgagggc
    37981 ggtggtgccc atgtcgaggc cgtagcggat cccgaatacc gggagtgcgg cgatgaccag
    38041 caccgccacg gcagccgtgc cgaacaggac gggtcggcgc atgacgagat aggcccagcg
    38101 cgcccagcgg ccactgagag ctcccggagc gttcgcggtg ctgtcggcgg gtcgccagcg
    38161 ggcggggagc gcgccgcggt tgatggcagg gcccagggcg gcgagcaggg cggggagcag
    38221 agtgacggcg acgatgagca tgctggtgac cgcggtggcg acgccgatgg cgatgccacg
    38281 gaagatcggt gcctggataa tgatcaacgc gcacagcgag atcatcacga ccaagcctga
    38341 gaccagaatc gttttgcctg ctgtggccag tgagcggccc acggcggccg cgatcgcggc
    38401 gtggtcggcg acggtgtggt gggcgagttc ttcgcggaag cggctgacga tgaacatcgc
    38461 gtagtcgata ccgacgccca ggcccaccat ggtggccatg gcaacggtca gcgaatcgaa
    38521 cgcggtcacc gtggtgaggg tgaacaacac cccgaccgcg gtcaacaagc ccgcgatggc
    38581 tactccgatc gggaccgccg cggcggccag ggcgccgagc gcgaggacga gcagtatcag
    38641 cgcgaccggg atgccgatcg cctcggcgcg ggccaggtcg gcgttctgta gttcggtggc
    38701 cgcgttctgc accgccgagt acccggtcag ccccacatcg atggagtcgt cgccggtgct
    38761 ggcgatggcg tcttgcaggt cgcgagcgac cctcgcgcgt tcggccatgt cgccgtccat
    38821 gccggccagt gcgatcgcga cgtgaccgtc ggccgagatc tgggatccgg gcagcccgtc
    38881 gtagggaccg acgacatcga ccacaccctg cacctcctcg gccgcggtga ccgtgcgagc
    38941 gacgactgca cggaagtcgg agtcggtggc ggtgagggcg ccggattgga gcacgatgac
    39001 cgcctgctcg gccccgaact gtgggaagtg ctgggcaaca aggcgatcca cctcggtgga
    39061 ctccgagcct tcgacgccga agtccatggc gccgagccgg ttctcgagta gtgggtaggc
    39121 caccgcgcat accgccagca gcactcccca gatcgccagg gccgtgcgtc tgcgtcgcgc
    39181 catgagaaca ccccaccgat acagcagccc gggtgagtca ggtggcagtg gttgctgggg
    39241 tgacctctcg gtcacggcgg actgctgctg ctggttcatg tgttctccct ccgtagccga
    39301 ccacaattga tcgctagtgg acgatgtgat cgttgaaatg agattaatca tgatagctgt
    39361 cgatatcaat acccagttcc gctatcatcg ccgtatgacg attaatgctg acgggggttg
    39421 cctcgtcgag acgcaggggt tggatccagc ggtggcgttg ttccacagcc tctcggatgc
    39481 gacgcggttg gcgatcgtgc gccggttggc gtgcggggaa gcccgcgtcg cggatttgat
    39541 ggcaggtctc gagttggcgc agtcgacggt gtcggcacat gtggcgtgcc tgcgcgactg
    39601 cggcctggtc gtgggccgcc cccagggccg acaggtgttc tacagtctcg ctcgtccgga
    39661 gctgatggac ctgctggcat cggccgagac gctgctcgcg gcgaccggca acgcggtggc
    39721 gttgtgcccg aactacggca ccgacgccac caccacggag acgacggcgg aggtgcgggc
    39781 atgagcgacg catgcggctg cggccacgac gaacccgctg gtgagggcga ggccgaggag
    39841 cgggaacccg aaaagctctg ggaagtcagc gaactgcgtg ccgccgcggt cgccggtgtg
    39901 ctgctggtcg cggcgctgat cgtcggctgg accggtggcc ccagcgcggt cgagctcggc
    39961 ttggagatcg cagcgctgct ggtcggggct tacaccttcg tcccgtcgac gttcaaacgg
    40021 ctggccaagg gcaagatcgg ggtcggcacg ctgatgacga tcgccgcgat cggcgcggtg
    40081 atcctcggcg aggtcggcga agccgcgatg ctggcgtttc tgttctccat cagcgaaggc
    40141 ctcgaggaat acgcggtcgc ccgcacccgc cgtggtctgc gggccctgct gaacctggtt
    40201 cccgaccgag ccacggtgtt gcgcgacggc accgaaacca tcgtcagccc agcggagctg
    40261 cgggtcgggg accggatgct ggttcgtccc ggcgagcggg tggctaccga cggtgtgatc
    40321 gccgaaggcc gtagctctct ggatgtttcg gcgatcaccg gtgaatcggt accggtcgag
    40381 gcagggccgg gcgcggaagt gtttgccggg tcgatcaacg gcaacggcgt tcttaccgtc
    40441 gaggtcacca ccaccgccga agacaactcc ctggcgcgga tcgtgcggat cgtggaggcc
    40501 gagcaggccc gcaagggcga tgcccaacgc ctggccgaca agatcgccaa acccttggtg
    40561 cccggcatca tgatcgccgc tgccgcgatc gcggtgatcg gtgcgatcct cggtgatccg
    40621 gtgacctgga tcgaacgcgc gctggtggtg ttggttgcgg cgtcgccgtg tgcgctggcg
    40681 atctcggtgc cggtcaccgt cgtcgctgcc atcggtgcgg cgagcaagtt gggtgtgctg
    40741 gtcaagggcg gtgccgcgct cgaggcgatg ggtcgggtgc gggaggtcgc gttggacaag
    40801 accgggacgc tgaccgcgaa caagcctgcc gtggtcgaga tctcggctgt cgcgggcacc
    40861 gagcaggcga cagtgctcgc ggtcgccgcg gcgctggaat cgcgtagcga acatcccctc
    40921 gcccgcgcca tcctcgccgc cgtcgacacc ttcactcctg ccaccgacgt cgaggccgtt
    40981 accggcgctg gattgaccgg gctggtcgac gggcgtccgg cgcggctggg ccgacctggc
    41041 tggatcgagc cgggtgactt ggccgccgac gtggagcgga tgcagcacgc gggtgcgacc
    41101 gcggtgctga tcgagctcga tggccaggtg atcggcgcga tcgccgtgcg cgatgagctg
    41161 cggccagaag cacatgaggt catcgatcgg ttgcacgcct tgggtattcg tgtgtcgatg
    41221 ctcaccggtg acaacacccg caccgctgcc gccctggcta ccgaggccgg gatcgaggac
    41281 gtgcacgcgg acctgcgccc cgaagacaag gcccgcatcg tgggcgaact acgcgccgac
    41341 cggttcaccg cgatggtcgg cgacggcgtc aacgacgccc ccgcactggc caccgccgac
    41401 ctcggtgtgg cgatgggtgc gatgggtacc gacgtcgcca tcgaaaccgc cgacgtcgcc
    41461 ctgatgggtg aagacctgcg gcacctgccg cgtgctctcg agcacgcccg ccgcgcccgc
    41521 cggattatgc tgcagaacgt cggtttgtcg ttggggttga tcacggtcct gatcccgctt
    41581 gccctgttcg gggtgctcgg gttggcggcg gtggtgctgg tgcacgagct cgccgagatc
    41641 gtcgtcatcg ccaacggtgt ccgcgccgga cgcaccaaac cccttgcctc gcttccggaa
    41701 tcgacggcaa agcccgcccc ggtgctggct ggagcatccg cgtgaccgcc accgcgtcgt
    41761 ctgctcccac cgtgtcgcgg tgggggcggc gactgcggtg ggccatcacc gcggcggtac
    41821 tcgccggcct cgacctcgcg ctcaaagcgt gggcgcagac cgcgctggac ggggcgccgg
    41881 tcgaggcggg tccggtggat ctgcggttgg cgttcaaccc cggcgccgcg ttctcgatcg
    41941 ccgccgacgc accgagctgg gtgatgctgt ccatcaccac ggtgatcacc actggggttg
    42001 cggtgggcgg atgggtgctc gcgccgcgcg cgagcctgct cacccgggtc gcgctcgccg
    42061 caatactggg cggtgccgcc gccaacgtta tcgaccgggc accggacggg ttggtcaccg
    42121 actacttgca caccggctgg tggcccacct tcaacctcgc cgactccttc atcgtgctcg
    42181 gcgcgatcgc cctcatcatc accaccttga tcggaaactc cgatgagcga gaacaactct
    42241 cacccgatca ccacaccgac aagcgggact gaaccgggcc catcgcgtcg atgggcaggg
    42301 ttggcggcgc tggtcgtcgc cctgctcacc gtcgggctgg acctgatggt cctcaacgtc
    42361 gccctgccca ccctcgcgca ggacctgggt gcgagcacca cccaattgca gtggatcgtc
    42421 aacgcctaca ccctcgtctt cgccgcgctc atgctgcccg caggcggctt cggcgaccgc
    42481 tacggccgca aacggctact gctggtgggt ttggtcgcct tcgtcgccgc ctcggcgtgg
    42541 gccgcctaca gcgggtccac cggctcgctg atcgcagcac gcgcggtcat gggcatcggg
    42601 gccgcgatca tcgtcccgct ctcgctgggc atcctgccga ccctgttcgg ccccgaccag
    42661 cgtcgccgcg cgatcgcggt atgggtcggc gcactgggcg tcggcctgcc attgggcccg
    42721 atcgtcggcg gctggcttct gcagcatttc tggtggggct cggtgtttct catcaacgtc
    42781 ccggtcggtg tcgccgccct ggttgcctgc gttgtgctgt tgcccgaatc ggccgacccg
    42841 cacgcaccgc cgctggactg gctcggaatc atcaccgccg ttcccggtac ggcggcggtg
    42901 gtgttcgccg tcattcaggc gcctgagtac gggtggaccg atcccatcgt gctcaccact
    42961 ctcgccgccg gtgtcgtgct gatcgtggga ttcctggtgt gggaacggca tactcgctac
    43021 ccgctggtcg atctggggct gtttgccaat cccgcattca cctggcccac tctggccgcg
    43081 acggcgggca cgttcactct cgtgggcgtg ctgttcgtgc tgccgcaata cctgcagatc
    43141 ctgcgccact acgacgcctt cggcacaggc ttgcgcttgg ttcctttggt gctggcgatc
    43201 atcatcgccg cggccgccgt cgacaagatt gtcacccgcg tcggcgccaa gatcccgatc
    43261 gtcaccggaa tgctcatcgc tgcagcggga ttcgtgctcg cgtcccgcat cactgccgac
    43321 tccggctacg gcttcgtcgc ggtgtgcctc ggggttgtgg gcttgggcgc cgggctggcg
    43381 ttggcaccgg cggtcgacgc ggtcatggcg agtctgcccg aacaccgcag cgccgcagga
    43441 gctgggttgt tgatggccat tcgacaggtc ggtgccgcgt tcagcgtcgc cgtcttgggc
    43501 accttgctca ccctcgtcta cacccgcgac ctcgaccccc acctgagcgc gctacccgag
    43561 gctgtggtgg gcgcggcgcg cgacaacgtc gctggggcac aactggccgc gaccggcgtt
    43621 cccggcccag cgggtgccga tctggccgcc accagcgccc acgcctacac cgaagccatg
    43681 tccgcggtat tcctggccag cgccgccgtc agcgcggtac ttgccgcggc tatcgccgcg
    43741 aaactcccca aacagacgcc accgccgata ggaacgtcac cggcgcccgg tccgcgatga
    43801 actagacagt cggtagcgag ccgccgcggg tgcagctcaa ccacgcctgt tcgccgaatc
    43861 acagtgcact ctccgagaaa ggcatccgcc agcatggtta cctcgatcct gcaggccatc
    43921 ggactcttcc tggtgaccaa tatcgacgac atcatcgtgc tctcgctgtt ttttgcccgc
    43981 ggcgcgggaa ctcgcggaac cacggtcgcc atcgcgacgg gacaatatct cggtttcgga
    44041 gcgatcctcg ccgcgtccgt cctcgtctcc ctgggtgtga cggcgttgtt gccggaagaa
    44101 gctatcgcct acttcgggtt gattcctctg ctgctgggtc tgctcgccgc ctggagagcg
    44161 tggcgaaaca gcggcgacga cgatgaacgg ttcgagggca agaaggtagc agtgtggacg
    44221 gtggccgcgg tgaccttcgc caacggaggc gacaacatcg gcgtctacgt cccggtcttc
    44281 gccaccgtgg gaacggcagc gatcgtcgcc tactcggtcg tgttcctgct gttggtcggg
    44341 gtactggtga tcaccgcgaa gttcctcacc acccgcaagg ccattgccga gatcttggaa
    44401 cggtgggaac acatcctgtt cccactcgtg ctggtcgttc tcggaatcgt catcctcgtc
    44461 agcggcggcg cattcggcct ctgatcggat accactcaca tatccgcgca accagatcac
    44521 caggatggga gcacagcagg gtgacttgcc tctacccgcg ctcgagttgc cgaccgctgt
    44581 ccggccgcga ccgcagacgg ggcgtgccga ggtgagcgcc cccgagcatc gctggtcagg
    44641 cggcgtttcg ctgactcccg gtctcatgac attcaccggc gagatcggcg acgcacctgc
    44701 ccacgcgcac gccgccgtgc aggtgctctt cgtcgcgcgc gggcgactga ccctcaccga
    44761 cgcgaccgga tacaccacac ccgccctcgc cgcgatcatc ccacccggcg tggtccacca
    44821 ggtccacacc gaacccggta ccagcggatt cctcgccttc ctggaccccg acagcgcgac
    44881 cgcccacgca gcgctggccc aactggacgg gcaaccccgc caggcagcca ccacctgggt
    44941 cagcgccgcc acacccgcac catccctgtc tgtcggcgac ccggtcacca ggcccgtgcg
    45001 ccggtcctcg catccggtcg tggcgcaggc gctgcgccgg gcaaccgact gggtgggagg
    45061 gccaccctcg ctgggtgaac tcgccgccga catcggaatt tcggtcagtc gcctctccca
    45121 tatattcacc gcgcaggtcg gattgccgta tgtggcgtgg cggcggtggg tgcggctaca
    45181 gctcggattc gcggtcgtgc gcggcggcgg ttccctgacc gccgccgcgc acgcagcggg
    45241 attcgccgac agcgcccacc tcacccgcac ctgccgcgac ctgatcggca tctctccgac
    45301 cgaagcactc atcgccaccg gatggcggcc cccaccagca cgcgaccgag ccgtcaccga
    45361 ataacgcgac tcccggcgcg cggactacct cactgcccgg ccacaggcac ctcgcccggc
    45421 acagtttcta ccgagccagg gggcaccggg gacggtgccg gtgcagcatc tgccggtgcc
    45481 ggtgccggtg gagcttctgc ccgcgtaggt gtcggggacg cggcagattg cgtcggatga
    45541 tcggaggccg gttggggcag cccgagtgtg gtgacgacac cggtcgcctc gttgaacacc
    45601 aacgacccgc gaccgaaatc gacccgcaca ccacccggga cgggatactc gttgctgcgc
    45661 ggcgcgccca gcacgccgtt gtccccgccg agctgggcga accgttgccc gatgcgcccg
    45721 gctacttcat agacctgacc gtcgggggct tggaacaggt acccgttgac gaacctggcg
    45781 tactgtccgc cctcggcagt gggcaccggc tccgaggcgg ccaaccccag ccgcccctgc
    45841 ggtccaccgg catcgaccca acgccgagcc aacacattgc ggtcgaccag atccaacagt
    45901 ttgcccgtca acaccgccaa cgccgacaca tcagcatcag catcggcatc gggttgcgca
    45961 ggcgccggtg ccgaatcctg gccgcccggt gcctgtctgg gccccgcccc cgaactcaca
    46021 cccgccgcga tagcacggat acggtccatg agcgcatagg cggcgtcccc ggcgcaggtg
    46081 gtgttaccga catcgcggtg ggagaacacc accggcaact gcacctgttc accctcgcca
    46141 tacggagtga attcggtgcc ctcggagatc atcgtggtgg tccctcgagg atccaaaccc
    46201 gcaacacgag cacgccaccc gatgaactga cccatcgcgg tgatcgccgc ctgggtcggt
    46261 tcctcggact cgtgatcacc catgaacgcc accccggcgg tgttttcgtt gaacccgccc
    46321 gtgtgcgcgc cctgcacggg ccggtccaaa ccaccgaaat gtccttcgaa gatctggccg
    46381 tatttgtcga cgagcgcgtg gtagccgata tcgcaccacc ccaacgtttc ggcgtggtag
    46441 gcgtagatgc cgcgcacgat cgccgcggac tcggctttgc tgtagtcgtt gcggcctgcg
    46501 gtgtgatgca ccacgatccc gcccaggccg tcgtcgtagg tcgggtcctc acaccggatc
    46561 gattcatcgg cgccccactg ggcgcggctg atcacccggg gcccgccacc ggtcagcgga
    46621 gccgcgatcg ccgacaggtt ctcctcacca cgaccgggat cgagcaacac cgcgctcatc
    46681 tccgggactg cgagcccgag atggtcaggg cccgcgaccg gggtaggtcc ctgaaatccg
    46741 ggttcggccg tggcggtagg ttcgtgggtg cttaggattt gcaccgcgtc ggtgtcaccc
    46801 acatacaccg gttcactacc ctgcatgcgc cccgggccgg gcgacgagcc gaaatactgt
    46861 cgtcggtccc ggcctcgaac cacggacccc aggaaccgtc gagttggcgg gcccgcacca
    46921 tcgtggtgac accctccaga ttcggcgcgg tcaacccgat catgctgaaa cgactctcgc
    46981 gggtgagttc tgtgacctgc gcgccgaccc gatcgaccag ctgctcgggc accacacccg
    47041 gatccaacgc cggagtccgg gccgatatcg gcgccgcccc cgcggcggca acaaacccga
    47101 tcggcccgac ccgggaaccc tccggaagcg gcggcgcgcc gggtacaagc cgcagatccg
    47161 cgaccctcag gtccggcaac tgcatgccgg ccagctcgcg taacggcaac accaccctcg
    47221 gcgcccccga caaccccacc tgggtggtcg cggtaggcga aactccatcg gcttcactgt
    47281 cgttggagaa ccggaactgc cccccaccac cgaggaaacc ggccgtgacc ggcgccgtga
    47341 ccacagctac cgcgaccagg ggaagcacat aggttcgttt gcgggcgtag ttcggcacca
    47401 gtactcctac ttcggtagaa accgcgatgg cgggtccgaa ccatccgacg gaaccagcac
    47461 caccgatcac accaaccaca accaacccaa agaatgaagt gttacttgag actgtagcca
    47521 gggtgtagcc gtcctctgat gcgacacacg ggccagccgc cagatcgatg agccgtcatc
    47581 ggcacggata gtcagctgat ttcttcaagc ccgccctacc acctgcgcgc gaagctgaag
    47641 ccgtgaccac gctcatctcg cccctgatcc gctacggcta cgcgccggtg atgctgctcg
    47701 gaatcaacgg caccggaata gccctagccg ccaccggcgc cagcaagctc tggctcatcg
    47761 ccctgctcgg gctcgcggtc gcggtctcgt tcaccgccga acgcctcctg ccgtaccaag
    47821 cagcctggaa caactctcac ggtgacaccg gccgcgacac cgcccacacc ctcgtcaacg
    47881 aaaccctcat cctgggcagc gtggccgcca ttcccgtcct ggccgcggtc gtccctggtg
    47941 acgggatctg gccgggcagt tggcctttcg tcgtccaggt tctggtcgcg atcctggtcg
    48001 ccgatctcgg gatcaccctg gcccactacg caagccacaa gatcggtgtt ctgtggcggt
    48061 tccatgctgt gcaccacagc gtgcaacgct tctacgggct caacggtctg atgaaacacc
    48121 ccctgcacca aacgatcgag atgaccgccg gagtcacccc gctgctgctg gccgggatct
    48181 cggtcccggt cgcggcggtc ttgtcactgg cggtggcggt gcagttgctg ctgcagcact
    48241 ccaacgccga ctatcgcgtc gggcctttca aatatgttct ggcactgaat gaaggccacc
    48301 gtttccacca cctgaaatgg gcgggcatcg gtgacgtcaa cttcgggttg ttcaccctga
    48361 tctgggatca cctgctgggc acctacagct acgacccgca ccggcggttc tccagcgccg
    48421 acctcggtat ggctgccaaa cccgactacc ccgtcggcta cctcgcccag ctcgccgaac
    48481 cgttcacccg ccacggcgcc tgcgaaccca cacccgaggc gagcgtcgtg ctccgcgcca
    48541 ccgaacaggc gaagaacgcc tgactctcac ccactaccgc tcaacctgaa aggacatgac
    48601 catggcgaag attcgcgccg ctgcccgcgc ccgctaccac gaagagatgc aggccgcgaa
    48661 caccacgacc gacccggccc gccgctggaa ccatctcgaa cgcgcccaca tcctgtccca
    48721 acccgacccc tggctgcaca ccgccaacca catcgcaatg ttcgccctcg cggtgcgtca
    48781 acgcgaccgg cgagaagccc tcgggcagat catccggatc attgttgccg caccaggatc
    48841 cctggccggg ctcgctccgg aaggcaacac cggtcgcgcg aatgtcggtc tgcgccaaac
    48901 catgaccacc ccacccgatc tcgccgcact gttggatccg agtccaacca ggtagccgcc
    48961 cgttcagggt tgatcggtga ggggtgtcgg tagcatggcc gccgtgcgca atgacttccg
    49021 atttgtctgt ttcgtccgga ggtggatccg atgaccgccc gctcggtatc acgccgcacg
    49081 cggcttctga ccaccgtcat cgcggtgctg gtgatcgtcg tcggcgcggt ggtgttggcc
    49141 gctgcccgca ccgacgacaa tcgcccggga aacagtgtgg aatcgacgac cggcgagccg
    49201 gcgctggcgg tgcgcccgga cagccaccgc ctgtccgggc ccaccgatgc ccgggtgacg
    49261 ttggtggagt tcctggactt cgagtgtgag gcgtgccggg cgatgttccc gatcatggaa
    49321 cagctgcgcg ccgactacag cgatcgcgtc gcgttcgtgg tgcgatactt cccgatcccg
    49381 tcgcatttca actccggccg cgccgcgcgc gccgcgcaag cagccgccga ccagggcagg
    49441 ttcgaacaga tgtatcagcg cctgttcgaa acccaagccg actggggaga gcagcgggcc
    49501 ccagccgacg aggtgttccg gggtctggcc gccgagctgg gtttggacct gggcgcctac
    49561 gacctggcct acaacgaccc ggccacggcc gcgcgagtac gagccgactt cgacgagggc
    49621 ttggcgctgg gggtggtcgg cacccccagc ttcttcctca acggtgagaa gatcagcggc
    49681 ggcagctacc gcgacatggc cgcagccctt gacgccgccc tggattgacc tcgcccggcc
    49741 cggtcttcat gccctggcgc gaccgattcc gggagcgaaa cggccggtgc tggccaggta
    49801 cgcctgatag tcgggtccgt gtacgcgagt caggtagggc tcttcgacga tgcggacctg
    49861 tagctcgatc gtggtcagca gcagggcgaa tccggctacg gccacggggt tgggaatgag
    49921 cagggtgatc ccggcggcga agagcagcat cgcggtgaag atcggattgc ggacgagtct
    49981 gaacaccccg gtgcgcacca gtgtcgtggt ttcggtgtcg tcaacgccga tgcgccagga
    50041 atcgcccatc tggttctggg cgtacaccgt cgccgcgatc ccggccaggg ccgcgacgag
    50101 gccgatcccc tgaatcgggg cagcggtcaa gattgccacc ggcgccacga gatcggccag
    50161 ttgcagtagc ggtgccgcca caccgacccc gatcgcgagg aggaacccga cgccggcgat
    50221 ccattccagc gaacccgggc ggccactgat gccgcggaat ccagtggagc cggtcgcgcg
    50281 gtgctggcgc cagctgcgcc agccgaagcc cagcgcggcg aagagcagat acagggccag
    50341 tgcccaccaa gcggtcatga gtgtttcctc gattggagat gatgtcgaaa tctgtgggcc
    50401 tgcccggttc gggcgaggtc accaggtcgt gttccggcag cgttcggtgc tgccgtcggt
    50461 ttcgatctgc acggtggcgt ggccgaggtg gtactcctcg gccaacagtt gctgggctga
    50521 gcccagtacg gtgtccaggt cggcgtcgcg gtcgatcacc acatgcgcgg aggcgacctc
    50581 catgcccggg gtcagggtcc atacgtgcag gtcgtgtacc tcgcgcacac cgtcgagccc
    50641 gcgcagggac tgctcgatct cggtgaggtc gagttcggcg ggtgcgtgct ggaacaggat
    50701 gcgcaaggct tggcggccga ggctgaacgc gcgcggcagc acgaacagcc cgatcgccac
    50761 gccgatcgcg gggtcggcgt agcgccagcc gaagaacagg gtgatcagcc cactggccag
    50821 gaccccgagc gagccgagca tgtcggccat gacttcgagg tacgcgccac gcacgttgag
    50881 gctgtccttg gcgccctggc gcaggatcag catgctgatc acgttcatcg ccaagcctac
    50941 gaccgccacg atcgccaccg gaagaccagg cacttccgga ggatccgaca gccgtccgat
    51001 ggcctcgtag aggacccagc ctgcgaccgc gaacagcaag actgcgttga acagggcggc
    51061 aaagacctca ccgcgataca tcccgaacga gcgagcccca cctcgggtgg cgtggcgggc
    51121 gatcatgatc gccaccagcg ccatcgacac accgaacacg tcggtgaaca cgtgcgccga
    51181 atccgacaac agcgccagcg acgaggtcga cagaccgacc acgacctggg tgatgaatgt
    51241 gaccaggccc aggccgatcg cgaccgccag tcgggtggtg taccgcgccg aggcgctgcc
    51301 ctgatttgga ttgctcgtgc cgtggctgtg tcctgcgccc atcgtcggaa ctccttgccg
    51361 ctgtggtggc ttcaccatcg cccatacccg acaacatgaa tcttaacatg cgcatgcgtg
    51421 catgttaagt actcggggtg aagcggctgc ttctgcgacc ggccgaaatt ccgggtgcgc
    51481 agggagggct cgccgcctca ctactacgat gcatagtaga agagtgttcg ggcgtgtcga
    51541 gcagtcttgc gaagggatgc atacatgcgg cctcatatcc ggtggcttgt ggttttcgtg
    51601 atcgtgtttg cggcgttggc ggcggctttg tggccgcggt cggattcgac gaccgcgctg
    51661 cccgaaagag tgttcgggca acccgatgcg gcgaccggcc gtatcgaaga tgggccgccg
    51721 caggatcagc gagtcggtgc gccagcgctc ccgccgtgcc cgattcccgg tggcgtatct
    51781 gctggtggcg ggccgctgcg cggtgtgctc gcgcgatgcc tgggctcggc cgaacaggtc
    51841 gatctcggag tcgccctgac cggagaaccg acattgatca acctgtgggc gtcatggtgt
    51901 gcgccatgtc gaagcgagat tccggtgctg aatgcgtacg cctccgatcc ggactcgatt
    51961 cgcgtggtgg ggatcaacgt gcaagacgac cccaccaccg cagcagaact tctagcagaa
    52021 ctacaagcgg gctacccatc cttcgtcgat ggcggcgcgg tgcagaaggc gttgccggca
    52081 cccccggtgc tgccgctgag cttcctcgtt caacgcgacg gcaccgtccg gcgcatcacc
    52141 acaccagcgg ttttcgacaa ccctgcccaa atcgatgcca cgatccgcga gatgacccga
    52201 tgacccacct acgcacgacg aaagccgcac gccatggtca ccgctacggc cgcgcgaggc
    52261 accggcagct ccggctgctg gcggcgatgg cgctggtcat cgccgcggtt accgctgtga
    52321 tcagctgtgc ctcgggctcc gactcggtcg ccaccggtgg cggcacgttc gatttcgtct
    52381 ccccgggcgg gcagaccgat atcttctacg atccgccgga aagccgaggc aagatcggtg
    52441 ttctcgccgg tcccgatctc atggccgagg acaagaccgt ctcggtatcc gactacaccg
    52501 ggcaggtcgt ggtgatcaat ctgtggggtc agtggtgtgg gccgtgccgg gctgaagccg
    52561 acgacctcga acgggcctac gccgccacca aggcatcggg tgtgcagttc gtgggaatca
    52621 acgtccgcga ccagcaacgc gacaaagccc aggacttcgt gattgataac aaggtcagtt
    52681 atccgtcgat ctatgacccg ccgatgcgca cgctggtcgc cctcggcggc agctacccga
    52741 ccagtgtcat tccctccacc ctcattctgg acaggaagca gcgggtcgcg gcggtgttct
    52801 tgcgcgccct gctgaccagc gacctgcagc cagtcatcga gcgcctggcg gccgagcagt
    52861 gaccgcactc gcccaaggca tcggtaccag ttttcaagac gctgccgcga ccgggccgtt
    52921 gttcctggct ctggccgcgt gcatggtggc cggcctggtc tccttcgcct cgccgtgtgt
    52981 ggtgccgctg gtcccgggat atctgtccta tctcgccggt gtctccggtg ccagcgcaac
    53041 gctttcacaa gctgatgaca tcgggccggg ccggagttcg gaccggtggc gcgtggcggg
    53101 cgcggccacc ttgttcgtcg ccggattcac cgtcgtgttc gtgctggcga ctgcctcggt
    53161 gttcggtgtg atcaccgcgc tgcggctcaa tgccgatcta ctccagcgca tcggcggggt
    53221 ggtcacgatc gtgatggggc tggctttcat cggattgatc ccggcgctgc agcgcgacac
    53281 ccggttcgcc cccgtgcgag tgtcttccct tctcggcgca ccgcttctgg gagcggtgtt
    53341 cgggctgggt tggacgccgt gtctgggacc cactttgacc ggagtgctat cggtcgcagc
    53401 cgggaccgag ggaacgaccg cgacccgcgg ggtggtgttg atcgtggcgt actgcctcgg
    53461 tctcggcatg ccgttcgtgg ttctcggatt cgggtcgtcg cgtgcactgc gcggcatcgg
    53521 ctggttgcgg cggaataccc gcaggattca gacgatcggc ggcatcctgc tcattctcgt
    53581 cggcaccgcg ctgatcaccg ggatatgggc gcaattcgtc gcctggatcc gcgacgagtt
    53641 cgtcaccgca gtagtcctgc cgatctgacc caccttgcgt gtgccgccga tgggttcggc
    53701 ccagcgtgcg tggatcagtc gatgccccaa cgctgttcgg tgagcacgcc gttgccttcg
    53761 agccaggcga ccggatcgat cttgttgctg tcctggtccc agatctcgag gtgcaggtgc
    53821 gggccggtgg actgtccacg gttgccgacc gcggcgatca cgtcaccagc gctcacccgg
    53881 tctccggcct gcacgtagta ctcgttgatg tggccgtaga ccgcgatcgt gccgtcgtcc
    53941 tgctgcacac gcacccattg cccgaaaccc gacgccggac cggcctcgat caccgtgccg
    54001 cccatggccg aacggatcgg agtacccaac gcatcggcga tgtcgacacc gtagtggaac
    54061 gcaccccagc ggctgccata tccggagctg atctctcgcc cgaccggcag cactgcgggc
    54121 gccgctgcgg gcgcggtcac cgacggggaa gccgtctgca ggtccttgat gatctgttcg
    54181 gcctgcgcga gcggcgcggc aagctcatcg ggcaagcccc ccaacccgaa tggagccgtc
    54241 gctggtgtgg atgccggtgc cgcggcggag acggccgcat cggagtccgc gtcggcatcc
    54301 gaaatcccgc cggcccgaag gtcggtcgtt gccgcggtcg cgggcgcggc ttgggccatc
    54361 gtgcccagca gggccccggc ggccaccgcg acgccggcta cacctttgaa ccgatctgtg
    54421 gagtcggctg ccatgcggtg tcgtgcacga ggttcgtcgg tgacctctcc gagcagttcc
    54481 ttcacggaca gggaaccgga ggtcattcgg tggtgcggca cagcaggtcc taacgtcggc
    54541 gaacggtcgt ggagtggtct attggtaggt cgatgatgcc gtgggtccgg gtggggtgaa
    54601 ctcaattcat cggcaacgtg ggcgcaccgc gctgggcgag catggcacga atcgcctgcg
    54661 actccgcggt ctgcgcgtca tcgatctgct tggccagcgc cgcgacagcg gggaccgtcg
    54721 cgttgtcacg ggccgcccgc gccatcgaca ccccaccttc gtggtgacga agcaacagct
    54781 gcagatacag ggtgtcgaat gcggcacccc gggccctacg cagctgcgcc agttcctcgg
    54841 tcgtggccat tccgggcatt cgcattgatt cctgggcggg catctgatga tcagtccccg
    54901 cggtgtggga gtccccgcgg cgcatccaga gcatcggctg ctcagacgac agcggtcgat
    54961 cccacaacat cagccagcca cgcatcatcc ccaactggct ctgctgggtg gtcagcacgt
    55021 cgaaggccaa cgtccgcacc gcaggatctt cggcctgctc caacgctgtc gccgacatct
    55081 cgacagcttg attgtggtgg gtcgccatgt cctgggcgaa ccccacatcc acgacgtcca
    55141 gcgctggcgc cgaggagtcc gaaccgagca ctccgcgcac ccagaacccc gcgagcagtc
    55201 ccacgatcac cgcggcaacc aaggctgctg cccagatcgc gctcgatcgg cgccgcgctg
    55261 gcggggtcgc ttcgggcgtt ggcgattcag atgtcaccgc cgacctcctg aaggggtggt
    55321 ggaaccggca ccggcggggg ggagcggaac ggcgtcgggc cccggcggac tgggatcaaa
    55381 cggtggcggc gcgtcagggt cgaacccgcc accggaggca cagctcgcgc ctggctcagg
    55441 gtgggtgttc gggttctgac gcaaagctgt cacgaatcgg cggatgcggg gatcatcgac
    55501 actgtcgagc ttgagctggc gaccccagga ctgcagcgcc acagcagaat ccagattcgg
    55561 atacggcgac atgaacatat acggcttgcc ctcgacctcg ccgcgcaacg ccgcgagatc
    55621 ctcgccgctg agacgatcag cgttgtaggt cacccagata gcgccgtgct cgagcgaatg
    55681 aacagcgttc tcgctgcgga tcggagttgt atacacctct cctgtgcagg tggcccagct
    55741 ctgatcatgc gggccaccga acggcggtgc ctggtcgtag gcgactcgct gggtcgcccg
    55801 cacatgacta cccgccggat actcctgctt ggtgactccg tcgatcatct cggaggggtc
    55861 ggactggcca ctgcctggaa catagcgctg cgcctcggag tactcccgat acttcggcac
    55921 gtaatacaac gcaagcccaa cggtcaacag gatgatcgcc gctgctgccc cgatcaacag
    55981 ccatggcggc tgcttgccgc cgatggcggc ggcggtggcc tttttcccgg cacgggggcc
    56041 gcgtttcgaa ctgcgcgccc cggacttgtt gttcatgcgg tattccttcg tgctgacgaa
    56101 ccagcatcgg tgacgtggcc ggtcgaaatg atcgcggagg caggagccgc gtcgtgttcg
    56161 cgtaccaaag aggcaaccgg gcgagagacc gccgagcggt cgggacgacg gggatacaga
    56221 tcattcaaaa aggcgttgta ggcggccaac tcatcatccc cgaccaggtc tgaccggcga
    56281 tcggctacgg cgttgtcgcg catttcgtca cgccgccagc ggatggcgaa gacgatgacg
    56341 acgacgagag cgaccggctc gccgtaggac cacgccagcg caccggcgag atactggtcg
    56401 cgcatcgcct cgatgcccca ctgcggcggc ggagtcgcga agaactccac cagcggcgtg
    56461 gtcgccatca tcaagattac gccgaagaac acatgcaaag gcatctcgac gaacagatcg
    56521 aagaaccggc cgaggttcgt ctgccggatc ggcaggggac ccacggacaa gatcggcacg
    56581 acgaacaaca agccgctgag caggaagaac agttcgagta gttggtggcc gaggaccgtg
    56641 gaggcgacgt tgtcgaatac cggtgtcaga tagatgccgt agtagctgaa caggaacagc
    56701 gggatggtga aacccgggtg cagcatccat cgcatcgtgc ggctgcgtaa cccgctcacc
    56761 gccacggcga gcacgagtcg accgagcccc cgatggggtg tggcgcgaag cagcatcagc
    56821 cctggacaac cccacaccaa caacggtggg atcgtcatcg acagcgtcag gtgctggaac
    56881 atccacacgc tgaacaactg gtagccatag gcttcgatcc ccagtccggt gatggcggcc
    56941 agcagcagac acccggcgag gaagcatgcg gtgcgccacc agggccaggc ccgctgcaat
    57001 cggcgtagcc gtacgagacc gatcaggtag aggatcgagg ccgccagcgc cagcgcgggc
    57061 agtacaggga acgacggggg attccatgcc agcatcgaac cgatcgatgg cggcgtatcg
    57121 ggcaacggga tcgcagcgag tagctcgggc gagatcatgg cagtttcagc gcttggttcg
    57181 tgtggcggca cgcagtgtca ccacggcccc accgatcagc acgatcaccg ccacaatcag
    57241 tggccacggc aggctcgacg acagcgccgt agccgaagat tcgccagctg ctgtgacact
    57301 ggacggcgac ggcgcaccgg acggtgctgt ggtcgtcgcc gacccgctgg cgtaggtgaa
    57361 ctcgtaggag ccggtaatgg gatgcccgtc gtcggagaca acccggtagg ccacggtgta
    57421 cttctgggcc ggcatggtcg ggctcaccgc cacccgcacc gtcttaccct cgaccttgga
    57481 aacctgcgcc gcccagctgg tccccgcggc atcggtcagg ccgacgttgg cgaatgcggt
    57541 cccgatctgc tgattgaacg tcaacgtgat cagcgtgaga ggcgtgtcga cgactgcgtc
    57601 agcggctgga accgaggagt cgagctgact gtgcgctcgt gccgaccccg ccgtcagtgt
    57661 caaccccaga gctgtcagca tcaccgcaat cgcagtccgt ccgagcactt ccggcctcca
    57721 gattcgtacg cagtgcgcgg aggccgtcgt cgccgcgcgg cgtccaccga cccgacgccc
    57781 gtcaactatg ctacatagtt gaccgctcgc gtccagtctc cgattcagga catgaccaca
    57841 caagccacta cggcacaggt cagcagcccg gccggtgcgg cgactgcggc gacgatcgga
    57901 gacaaaccca tcagcaccca ccgcgacgat cgccgcggcg ggttggaaga ctccagccgc
    57961 tgcaggcgct gctgcaagac ctgccctgcc agcgacaacg tcgaggccgg ttcggtgcct
    58021 gtcgtcgcgg cgactgcgca cagtgctgaa cggatggtcg ccgggctcgt cgcagctgcg
    58081 gcgcagtcgt cggcggcgaa ctcggccaac gccgcgacag ctttcggtgc atcggcgaac
    58141 agcgggatcc agggcatggc tgcggcgaga acctcacaac ccctgatcag ccgatggtgc
    58201 ccgccgcgaa ggtgggccag ttcatgggcc agcaccgctt gacgttgacc atcgttgagc
    58261 ttgcgggcca acccctcggt ggctacgacc atcccggggc ggccgtcgac gctgtaggcc
    58321 atcggcttgg ggtggtcgag ccacatcacg ggcatgtcct cgtctccgcg gcgcgccacc
    58381 acgctgacga catcccgatg gtaggcgcgc acccgcgctc ctgcccgggt gtggcgccgt
    58441 gcgctcagcg cgacccgata cgagagaccg acgacaccgg caagtgcggc gactgtcagc
    58501 gggtcggcaa gccagtgtgg caccgagtgg actacgcggg tcaggcacaa catcgcagct
    58561 tcggctacac ccactccggg tgcgtgtccg ggccacagcg ccgcggtcac tgcgacaccc
    58621 gcgagcacga ctgccgaacc caagctgatc agccagcatg ccaccgcggt acgcggtgtc
    58681 atcgacggtg tgatgcgttg caggatggcc ggcgaagcga gcgacagcag tgccgccgcc
    58741 cacgccgcgc ccaaggctac gatcatttcc tcgaacgctt cctggggcgg gtacgcccgc
    58801 ggtggaatgc ttcggattcg gcctcggtca cgatcgaagc caggtggagc aggaccgact
    58861 cggggtcgtt gctcgagtcg atgatgccgc gtacaacctc ggcggtcgct tcggcacgtg
    58921 agcgggtggg ccggtacagg tatgcccggc ggtgcatcac ccgcaccacc cattccttct
    58981 cgtgcagatg agtcagaacg gtcaggatgg tggtgtaggc atacggatcg ggcaggcgct
    59041 cgaggatctc gcgcaccgtc agcgcttcgg aggtgcccca caaaacgtcc atcacccggg
    59101 cttccagagt gcccaatccg ttcatcgcct tgtccttcct gcacgtcgcc gctcgcggtg
    59161 ttctcagctc acgatcggga tcccgtcccc gcgagacgcc gacagtggcc gaactcgatg
    59221 ggaatctggc cgaagtcacc ggaccaacta ttcctgatcg tcgaggtagc gcgccacacc
    59281 acccattcgg cttcagccca gatctacgta ccgctaagta ctatgcaaca tagttgatcc
    59341 tgagaagtgt cttagagtta gctggaatgt gatgtcggcc acggtctcac agctgggtca
    59401 gcccttatgg ttccggtcgt gccgttcgtc ccctcatcag gttctggcac gcaaccggtg
    59461 aagcgatgac ttcccccggc agggaaccat cgcttcaccg ggcactaagg agtccaggcg
    59521 ccgtctcggc ccgctcccac cttcgaccga cgacggcacc ccgtcgacgt gacctgcgaa
    59581 ccgataccgg tggaggaacc aacaatgtct caggccgaag cgcccgaaag cgcagacgac
    59641 ctgcacacat caccatcatc accctcgaga gatcggctcc gcggcatttt gcgccacgat
    59701 ctgccctcat cagtggtggt attcctggtg gcgctgccgt tgtcgctggg catcgcgatc
    59761 gcctccgacg cgccgatcat ggccggcctc atcgccgcag tcatcggtgg catcgtcgca
    59821 ggtgcggtgg gcggctcgcc catgctggcc agtggcccgg cggcgggatt gaccgtcgtc
    59881 gtggccgagc tggtcgccaa gttcggctgg caggtcacct gcgcgatcac cgtcgccgcc
    59941 ggtgcgctgc agatcctgtt cggcctcagc cgcatcgccc gcgccgcgtt ggcgatctcg
    60001 ccggtggtcg tgcacgccat gctcgccgga atcggcatca cgatcgcgct gcaacaggta
    60061 cacgtactgc tcggcgggac ttcacgaagc tcggtgtggc agaacctcag tcagctcccc
    60121 gcgcaactga cacgcctgca ctggggtgac ctgacgatcg ggcttatcgt catcgtgacg
    60181 ctgctttcgt ggaagaaggt cccaggcgcg ctgggacgta tccccggcgc cctggtcgcg
    60241 gtagtcgccg cgaccgccgt gtcgctggtg gtgccgctgg gcgtggaacg catcgtgatg
    60301 aacggatcgt tgttcgacgc gatcgctctg cctgcgctgc ctgatggcaa gtggctggcg
    60361 gtagcgaccg gcgtgttgac cgtggcgttg atcgccagcg tggaaagtct gctctccgcg
    60421 gtggcagtgg acaagatgca ctctggcgcg cgaaccgatc tgaaccgcga actcatcggc
    60481 cagggcaccg ccaatatcgc ctccggcatg ctcggcgggc tcccgatcac cggtgtcatt
    60541 gtgcgcagcg cgaccaacgt cgccgccggc gcgaagtcca aggcatcgac gatcctgcac
    60601 ggggtgtgga ttctgttgtt ctcggtgctg ctggccgggg tcgtgcagca gattcccaag
    60661 gcggcactgg ccgggctgtt gatcgtgatc ggtatccaac tggtcaagct cgcccatatc
    60721 cgtctcgcgc accgcaccgg cgacctgtgg gtctacctga tcactgtggc cggggtgatg
    60781 ttcctcaacc tgctcgaagg cgtcctgatc ggcctgatcg tcgcgatcgc gctgttcgtc
    60841 tggcgcgccg cgcgcgccga cattcacgcc gaaccggtcg gtgatctgga ctcgcttcgc
    60901 tggcgcgttg tcatcgaagg ctcatgtagt ttcctatcgc tgcccaaact ttcgagcacg
    60961 ctggactcgg tacccgaagg cgccgatgtg accatcgaac tcaccgtcga cttcatcgac
    61021 cacgccgcca cggaggtgct gcacgaatgg caacgccgcc accgggatgc cggcggcacc
    61081 gtcctcatcg acgaactcgg ctctcacgct ctctcggcca ccacccaggg cccgcctcaa
    61141 cgtgcgtcct cggcccaagc tcggggtgtg gagccgtgga aggcatggca ggacacgaac
    61201 gcgcaagcgg tgccgcactt cgacgcgctg cggcccatgc tcgacggaat ctcgcgctat
    61261 caccgccgcc acgcgccgtt gatgcgggcg catctgagcg agctgcgcga ccgtcaggat
    61321 ccgaccacgt tcttcttgac ctgtggcgat tcccgagtcg tgcccaacct catcacccac
    61381 agtggacccg gtgacctgtt cacaatccgc aacatcggca acctcatccc ctccgacggc
    61441 ctcgatactt ctgtcgatgc cgcgctggcc ttcgcggtcg aagaactcgg tgtctccacc
    61501 atcgtcgtct gcgggcactc cggatgcgga gcgatgggcg cactgctggg caagccgacc
    61561 aagaactcac cggcagtgcg tgactggctt gcccacgccg agccgagcct gcgggcatac
    61621 cacgacaacc atcccgttgc tgctgccgcc gaggcggccg gattcgatgc ctacgaccag
    61681 ctggccatcg tcaatgtcgc cgtgcagatc gccacggcga cccaacatcc atcgctggtc
    61741 tcggcagtag cacaaggaca ggtacagatc gtgggtctgt tcttcgacat cgccacggcc
    61801 actgtctggc atgtcagccc gaccacagtc accgcgcacc ataaccagct cgccaccagc
    61861 accgtgcacg cctagtcggg agaccatgac taacacgttg atcaccggat ccggtgcgtc
    61921 cacaacggcc cgcaccggtg tcggtcgacg ttgatcatgc aatggtcact agtgaccggg
    61981 ccgttgccgt ggctgttgtc aggagtcggg gctctctgcg cggcttggtt gatcggagcg
    62041 cgacgacgtc tgagcgctca ggccgtcgcc gagtgcgcgg gactgggctt cggtgcggcc
    62101 atcgtcatct gggtggtggt cgaacgatgg tggcgaccgt tccccgacgc gctgccacgc
    62161 tcggtgtaca cctgggtggg catcgcggtc gcggcgctgg ctttgctcgc tgttcggata
    62221 tcggtgacac cgcgatggat ccgacggatc gccgcagtga cagccgcagt atgcgtgatc
    62281 accgcgtgcg cggtgcagat caatctggag ttcggcgcgt acccgactct ggaagacctg
    62341 ctcggaacgg gcagcgacaa ccggatatcg ctgaccgcgg tgccggccgc gcaacctaac
    62401 ccggtgaccg gctggccgat cgaaagcgtg tggagccctc cgccgcccac acaggtcgac
    62461 ggccgtgtcg ttcgcgcggt gatcccgggg acacgctcgg ggttccgcgc tcggcctgcc
    62521 gaaatctatc tgcccccggc ctatttcacc gatccccgcc cgttgttgcc agtgctggtt
    62581 ctgctgcccg gacagcccgg gagtcccgtc gattggctca acggcggacg tgtggaccag
    62641 accatggacg ccttcgccgc cgcacacggc gggcttgcgc ccgtgacggt gatcgctgac
    62701 gcgaccgggg gagcgtggcg aaacccactg tgtttggact ctcgtctcgg aaaggtcgcc
    62761 tcgtacctag ctatcgatgt tccggcgtgg gtgaacggac gtttgcaggt tgatcccgac
    62821 ccgagacgtt gggcgatcgg tggcatgtcc tatggcggaa cctgcgcgct gcagatcgcc
    62881 accaactatc ccgatcgcta ccccagtttc ctcgacctgt ccggcgacgc cgaacccagc
    62941 ctcggtgacc ggcgacaaac cgtgcaggcc gccttcggcg gtgacaccgc cgccttcgaa
    63001 cgcgtcaacc cgccgacgct gctgaggact cgccgctacc cgaactcggc gggagctctc
    63061 gtcaccggca ccgaggacga caccacgctc agcgcccaac gcagcattgc cgccgctgcc
    63121 cgagccgcgg gcatgacgat cacgacccgc gagctgccgg gaggccacaa ttggtcggtg
    63181 tggtcggctg gactgcgcat cgagatggac tggctcgcac agcgactcgg ccttacgcga
    63241 tgatcgctgg gatcgactac gccgacagcg cgcccgagtc ggcacatgat ccagcaggtg
    63301 agggacggcg tgaggtcctt cgcggcagcc atcagcggga gccattcggt gccgcgccac
    63361 attgttgggg cggcagggcc gacaaggagc atggagatca gcacccgagg actgccgagc
    63421 gaacgccgct gcggtgtgtg ggctgtcagc atgccaaccg aactgaattg ggcccccata
    63481 tatctggctg gtgtgcgtga atgacctgac atcccccagc tcttggtgga tctcttcgtt
    63541 gggcgcgcac ggcactcatc agcacaggaa tccccggtcc atgctgcgca cgctcatcca
    63601 gtacggactg gatgggatcg gtaccgacgg atcggtgagc cgcgcgatca atcgctccgc
    63661 ggacgccacc cagtggttgc atccggtgat gctcgccgtg gacagattcg gcattgtgtt
    63721 ggctccgttg gcgctgttcg ccgcaaggtg gagtacccgc agaactgccg ctgctgctcc
    63781 gtttccggcg atcagcacgg cggttgcggc atccggactg gcgtatctgc tcgcccggat
    63841 caccgcggcg tcggcgcagc accacccgcc atgcgcgatc gatcagacaa gaatagtgct
    63901 cgagtactgc accaacacct attcccttcc cgatgccacg ctgagcgctg ctgccgcggt
    63961 ggcggcggtg ctcgcgcaga tcgaccgaaa tctggggatt gcggtgtggg ccagcgtcag
    64021 cggattcctg gttgcccggg tctacgtcgg tcacgactac ctcatcgatg tcgtgctggc
    64081 gctcacgatc gggacctcag tggcggtagt cctcacctcg atcacgcgcg cggccgcgcc
    64141 cctggtgaac cgaaccatga ccaggaccag acggcggcgg tgcgcccgtc gtacagcgac
    64201 gggtcacccg cgggcaggat cggataccga ggctcggtga accggcccgt gaggatcagc
    64261 acaatgccca tcgccagccc ctgcatgaac atcagccgcg tggtccacct gcagcgtcgt
    64321 gtgttccaga ccgaattcgt cgtgcaggac cgattcgatc cccgatctca cggaatggca
    64381 gtcggccgca tcggcgacga gcacatgcgc cgacagcgac ggctgccccg aggtgatctg
    64441 ccaaatgtgc agatcgtgga tctcgctcac ctgcggcacc gaggccaggc ggctaccgat
    64501 ctggtccggg tcgagatgtg caggcgcggc ctcgagaaag atgcgcccgg actcgcgaac
    64561 aagcgaccat ccagccttgg ccatcagcac cgccactacc agcgcggcga tcgcgtcggc
    64621 gcgggcgaat ccggacagcc acaccacagc gccggcgatg gcggtgccga tgaacgcgta
    64681 caagtcgttg aggatgtgct ggaacgcacc ctcgacattg aggctggtgc ggttggcctg
    64741 gctgatactc catgccgcga cgatgttgac cacaatgccc accaaggcgg tgatcaagac
    64801 cagcggaccg gaaacctcgg gcggattgac gagacgctgg acgccctcgt agagaaacca
    64861 tgccgcgagc agcagcaggg tgatcccatt ggcttgagca gacaggatct cggcacgttt
    64921 gaatccgtag gtgaaccgcc cccgcgcggg ccgtttggcc agccggatcg cgatcagcgc
    64981 cagcacgatc gacgcggcgt cggtgagcat gtgcgcggca tcggagagca atgccagcga
    65041 ttgcgccatc acaccgacga tcacctccac tgccatgaac gcgacaatca acccgagtgc
    65101 caggaccagc cagcgcctat ctgcatcggc cgatacgccg tgcgaatgac catggccatg
    65161 gtgtgcgttg gcgttgttgt cgtgggcatg tccgccggtc gtggcggtgt gctccgccag
    65221 cgcgtgctcg gctcccatag tcgacatccc ttctgttggc aggcccaatg gccgagggca
    65281 gcgtagctga tcggtgttgc atgcgcatat ttgaatatga tttccgttgc ccggccggct
    65341 cgacgccgtc cggaaaacgg cggtgattga tgagagtaac tatcccgcaa cggcattgag
    65401 gcctaggtca cgttgggtca cggtgatcgc cttcagttcg gtaggcccgc agcgccaggt
    65461 ccgatcggtc cgatgcgact cgccgtgcgg tgcggtgacc gtgatcatcc aggcgtgacg
    65521 gggcgtacga tcggctgccg tgcggcgcta cgtgcggtac ccgagcgtgt ggccggcgat
    65581 cgccatcgtc acggcaagta tcttgctggc cctggctctg tctgactgcc gcctcctcgg
    65641 gcccggcgac atcgcccaac acctccatcg caccaccacc acagcaccag catcggtatc
    65701 ggtatcggca tcggcatcaa gtgcagcggc cctcgaaggc tgcgggcacg ctgatctcgg
    65761 agctgatcac acacactgtc cgtatgacgg ggtgcgggcg accggggttc ttcctcgcgg
    65821 cgaggaccgc gtatcgatcc cagcggtgac ggagatggct accgagcagg ctgtagtgca
    65881 agaggaccac agccgggcgc ccccacgtgg cggcgcgccg ttctccgcgg cgggcgctca
    65941 gatattgatc cgtttcggaa tcagcaggcg ctgatcggtc agcgtcaggc cgacgtgcag
    66001 tgatccgtcg gccggtgtcg gctgccctgc tcatgctcgc tgccgaacag aacggacatc
    66061 gtcatgaatg ctgtgctcga cgatctgggc ttcactcctg cgactctgct gaccaccggt
    66121 acgcgctgcc tgcgccccgc cactttggtc ggtaacaccc cggtcctgtg gatcggggct
    66181 cccctggcgc cccgcggaca cgggttctgg gccaaactcg aagccgccaa ccccggcggc
    66241 ggcatgaagg accggcccgc cctgtgcatg gtcgaacggg ccctcggccg cggtgacctc
    66301 acccctggcg cccggatcat cgaatcaacc agcggaacaa tggggttggg gttggcgctt
    66361 gctgccacga cgtacggcca tccgctcacc ctggtcagcg accctggcat ggaacctctg
    66421 atgtgcagca tgctcgccgc ctacggcgcc accgtcgaca ctgtgcacgc accccatccg
    66481 gtcggggggt ggcagcaggc tcgccgtgac cgtgtcgatg cgctgctggc caccgacccg
    66541 acagcgtggt gtcccgacca gtacaacaac cccgacaaca tcgacgccta cagcccactc
    66601 gcgctggaac tgatcgccca actggggcgc gtcgatgtac tggtctgttc ggtcggcacc
    66661 ggcgggcact cggcgggcat cgcccgcgtc ctgcgccggt actgcccaca gctgcggttg
    66721 gtcggcgtgg acaccatcgc ctccaccatc ttcggccaac ccgccggtac ccggttgatg
    66781 cgcgggctgg gctcgagtat ctatccgggc aatgtcgatt acgccgcgtt cgacgaagtg
    66841 cactgggtcg ccccgggcga agcggtgtgg gccgcccgga ccctggcacg cactcaccac
    66901 gcgactggtg ggtggagcgt gggcgcggtc gcgctggttg caggctggac cgcggccacc
    66961 accaaccccg acacgcgcat cgccgcggtc tttcccgacg ggccccaccg ctactacgac
    67021 accgtcttca acgacaacta ctgccgcgtc aacgacctac tcgatcacgc gccgcctacc
    67081 gaacccgtca ccatcgccga ccccgccgag gctgtggtca cctcgtggac gcgctgcacc
    67141 aacgtgatcg acccacatca gttgcaatct gcgaacaccc acgcggtcgc cgaggccatc
    67201 gggtgatcgc gaccgttggc tcatggcgcg agctcaaccg gcccagtcag ctgctgatga
    67261 tcaatcagtt cgccatcaac ctgggcttct atatgctcat gccctatctc gccgggtatc
    67321 tttccggcgc gctcgggctg gccgcgtgga cggtcggact cgtgctcgga gtgcgcaact
    67381 tctcccagca agggatgttc ctgatcgggg gaactctggc cgacaggctc ggcttcaagc
    67441 cgctgatcgt cgccgggtgt ctgctgcgca ccgccggatt cggtctactc gccgtagtcg
    67501 acaccttgcc cgcactggtg atcgcctcgg cggccacagg cttcgccggc gccctgttca
    67561 accctgcggt ccgcggctac ctcgcggccg acgcagggaa gcagcgggtg gaaaccttcg
    67621 cgatgttcaa cctgttctat caggccggca tcctggccgg cccgctcgtc gggctcgggt
    67681 tgatgaccct ggactttcag gtgactgccg cctgtgcggc cgcggtgttc gcgatcctga
    67741 ccgtcggtca actcgcagcg ctgccgtctc accccgtctg cgcaggcggt gaaaagacct
    67801 ccgtcggcca ggactggcgg acggtcgtca ccaaccgaac gttcgtcggg ttctcgatcg
    67861 cgatgatcgg cgcctacgtg ctctccttcc aggtctatct cgcgatgccc ctgcacgcag
    67921 cgatcctgag cggtcagcat cctggcaccg ggttggtgac agccgtgttc gtcgtgttcg
    67981 gcaccgtgtc ggtgctcggg cagatgcgca tcacacgatg gctgtccgtt cgctacgggc
    68041 gccgaggggg cctggcaatc ggagtgggga cgctcggtgt cgcgttcacg ccgatgttgt
    68101 tgttccccgg ccccggtggc agcgcagcgg tggcggcgct gttgatatcg gcggcgttgc
    68161 ttgccatcgg cagcgcggcg gtcttcccgt tcgagatgga caccattgtc gcggtgtccg
    68221 ggaaccgtct cgtcgccacc cattacgggt tctacaacac cgtggtcggt accggtgtcc
    68281 tggtcggcaa cctcggcacc gcgacgctgc tcgacctcgc ccgtcgcagc ggatccggcg
    68341 cgctggcctg gtcggtgttg gtggccatcg gcgtcgtggc agcgatcggc gtctacatcc
    68401 tgggacgaat cgtgccccct gagacctcgc aaccagccga ggtcgcagtc agtcggtcgt
    68461 aatcggcaaa ggactgttgg acgtgtggcg gccaggatcg gattcccgtc ggattcgatc
    68521 tcggccgtcc gtcgacagcg gacgacgttg gtcggccggt cggcactgga tgcccatacc
    68581 ggccggtggc aatgtttcgg catgttgaat ccaaattttc ggtatgccaa actatcggga
    68641 ctatgaatga tccgagccgc cgttttctgt tgggcggtgc actggcgagc accgccggat
    68701 tggcgctggc gggccgcagc ctgctcgacg cgtcaccagc caaagcccaa gcaccagtcc
    68761 ctgccggcca cggcggcgga gccgacggcc ccaccttccg catcgggcag accgtcgacc
    68821 acaccgccaa cgggttcaac ccgacccagg tcctacgcga cttcgactac ggcaccacca
    68881 cgcggttgcc cgacgggcgg accttgcgcg agtgggaggt cttcgccagc gacgaggaca
    68941 tcgaagtcgc ccccggtgtc accttccccg cctggacact caacgcccgc gtccccggcc
    69001 cgaccctgcg ctgccgggaa ggagaattgc tgcgggtgca tttccgcaac ggctccgagc
    69061 atccgcacac cctgcacttc cacggcatcc accccgccga gatggacggc atcgccggcc
    69121 tcggcgccgg gatcatccag ccaggtcagt ccacgaccta cgagttcgac gcgaccccgt
    69181 tcgggctgca cctgttccac tgccacgtcg gcccgctggc cgagcacatc gcgcgcggca
    69241 tgtacggcac attcatcgtc gacccaccga ccccgcgccc acccgcggac gagatggtga
    69301 tggtgatgca cggctacaac accactttcg acggtgaagg caaccagctc tacgcggtca
    69361 acgggatccc gttccactac atgcacgaac cggtgcgggt gaaacgcaac gaactggtcc
    69421 gtatctacct ggtcaacgtg ctcgagtacg acccgatcaa cagcttccat gtccacggca
    69481 acttcttcga ctactacccg accggcaccc ggctgcagtc ctcggaattc accgacacga
    69541 tcgtgcaggg ccaaggccag cgcgggatct gcgagatgcg gttcccgcac ccgggcaagt
    69601 acatgttcca tgcccacaaa accgaatttg ccgaactcgg gtggatgggg ttcttcgagg
    69661 tgagcgactg atgagcacca ccacccccgc tacgcgccga ccttggctgc tcggcgtggc
    69721 cgccctgatc ctgttggtac tggcgttgat cgggctcgcc ctgctcggcg gggcgagcct
    69781 gcccgaccgc gccggcccac cggtcgagga gatcggcgtc gaacaagtcg tcctcgaacc
    69841 cggcacgatc gagctgaacc tgcgcaacac cgggcccgac ccagtcgcaa tcgcgcagat
    69901 cttcgtcaac gacacctacg tcgacttcac cggccccgcc gaaccgatcg ggcggttgtc
    69961 ctctgcgcac ctggtgctgg actacccgtg gcagaacggg cagccctaca aggtctcgat
    70021 gctcacctcc accggactgg tgatcgaaca cgacatcgcc gccgcagtcg aaaccccaag
    70081 ggcgggagcg tcgttcttcg ggttgatggc attgctggga acctacgtcg gcatcatccc
    70141 cgtcgtgctg ggcatgctgt tcctgccctt cctgcgctcg gtcggcacca ccaccgtgcg
    70201 agtcctgctc ggtttcacca tcgggctgct ggtgttcctc gcctgggaag gcacccgcga
    70261 aggattcgag atcgccgaca cctccggcgg cccgttcggc ggggcatcgc tggtcgtcct
    70321 gggcgcgatc ttggctttcc tgacgctgac cgcggtcgat caatggctgc gcagccaccg
    70381 aaccgccgcc gccgagcaag gcgccgcgag cggcacccga ttggcattga tgatcgcgat
    70441 cggcatcggc ttgcacaacc tcggcgaagg cctcgccatc ggatccgcct acgccatcgg
    70501 cgaactcgcg ctcggcacct tcctcgtcat cggcttcacc attcagaaca cgaccgaggg
    70561 cctggccgtc gtctcacctc tgaccgagcg ccgcccctcg ctggccgcgt tggccgggct
    70621 ggggctcatc gccggtgcac cggcgatcct gggcgcggtc atcggggccg gtgccaacaa
    70681 tcccgaagtc tccgcgctac tcctcggcat cggcgttggc gcgatcatcc aggtgatcgt
    70741 gcagatcacc cccagtgtgc gcgaacccgg tacgaccacg atcggtatcc gcaccctcgc
    70801 cgggatcgcg gccggtctgg tcacgatgtg ggcgaccgga ctgctggtgg ccgcatgaac
    70861 acagactctg tcaccacgac acctatcacc cggcgtactg ccctggccgg tgcgtgcacc
    70921 ctgtgcgccg tcgcggtcac cggctgcgcg accgggcaag cttcacaatc ggatggtcag
    70981 ccggtgcgcg tcgcgcgcgc cgggatcgac atcggcggtg ccgcagtgtt tcccgaacat
    71041 cggatcctgg tgacccaacc cagcgacggg gtgtacaagg cgttctccgc ggtgtgcacc
    71101 catcaaggct gcgcggtcac cgacgtcgac ggcgacgtcg tgaaatgccc gtgccacggc
    71161 agcaaattcc ggctcaccga cggttctgtc gccaaaggcc ccgctcaacg tccgctgccc
    71221 gagcgggctg tcatggtcga cggcaacact ctcatcgtca gctgaaccaa cgaacccgac
    71281 gaaagctgca tttcccagcg ggtttacggg ccagcactcg gaatgtcgca ccgccacggg
    71341 tgcgccgacg gcatcgtcat cgggccgaca ctggcacccc aagaactgtc gagacctgct
    71401 gtgccacact tttgccggtg agccccccga cggatgtggc tggacggccg catcgacgta
    71461 ttcatggcgg agacgcagcg ccggggactg gtctgccccc cgcgagcccg tcggtctgga
    71521 aatccaagcc agggtcgagg ccgtcgcgat ggcgttgcgg gtgaccgaac agaccgctcg
    71581 cagagacttc ggcgacgaga ccatacagaa catggccagt tccatggcat tccaactcgc
    71641 acacgagcag cccggcgccg acgtcctcac cctcacaccg gactcgcgtc gtctcgactg
    71701 gggtggccgg gcggaccaac gccggtgtgg cgatcggtgc tcagctcgcc ctgaccgcga
    71761 ctccgaccgc gaacacgccc ggaccagatc catcagatcg tcaacctggt gtcttctggg
    71821 tctcatcgaa gcactctgcc gtccgcccgg ccaaatcgcg gttcccgaag cgttaattca
    71881 tcgaacggtg cgcgagttca gcaaggcgat cgcgctgctc gacacaggag cgcgccccga
    71941 agagggcggc gaccccaccg aactgcgggc cgcactgacc gccaacgtca ccgctctcga
    72001 atccacactg taggaactat ttcgatgcag gcctccgccg ggcgggccgc tcggccagcc
    72061 cgagaccgaa catcacatca ggatggatcc gcaggcccgc gacggcttgt tcggaatcgg
    72121 tgatcccgtc gtagtcgtcg aaggtgatca cgagctcgtc gccacgtttg gtgccgcgcc
    72181 cgaccgcgat tccggcatcg agaagccggc gggtgtcgat gtcgcggtcg gcgttgacct
    72241 ccgagggcag cgggatcggc ccgcccggga ccgggcgcag gatttccttg cgcaccaatc
    72301 gcagcaattg gatcgcggtg tcggcgtcca ggccgcgccg catcgcggtc ggccgcgcca
    72361 acgccgcccg gagcgggcca ggcagtgcgc ccgggcgcag cgcgagatgt agcacgacgt
    72421 cggtggcgac gacctgcaac gcggtctgat ccagttgcgc gcgtagatat gtcagggcgg
    72481 cctcgaactc ggcgattgac catcgtgtcg ccgcgagcaa gacatcgacg ccgatcccgt
    72541 cccggctgac cagcaccgcg agcaaggttc gggcgtggct ggcggcgtcg atcgcgtcga
    72601 tcgcgtcgat cgcgtcgatc gcgtcgcgat cgtgttcggc gagccctttc gcggcgcgat
    72661 cggacagcag catctcatcc acgctcaaac ccagcagagc gtgtaggcgc gagagcatcg
    72721 tcagcgtcac cgtgcgctgg tcggggtcgc gttcgaggtc ggtgaggctg aatccggtct
    72781 cccgcacgac cgcagccgcc gagaacccca tttcgtgggc gcgggcagcg agcagcttgt
    72841 ggttgaggcg cagcttgacg gtcaccggct gtagtccatg tcgttgtgca gcggcgaacc
    72901 gacccaccac gcggtggccg tgcccgtcca cgaacccgcc gccgagatcg tcgtcggcag
    72961 cgcgatcccc gcacgcgcgg cggttgtggg cacgatctgg cctgcggagc tgatcgcacc
    73021 ggtgaacagc gatttcttcg gctccacacc acgtaacccc aggaaggtgc gggccgcggc
    73081 aagcatcggg cgcgcccggc ggggcacgct ggtgaccacc cagatcggag accgatcgaa
    73141 cagatagcgt tcggcgttgt tccagcgcag cattcccgcg tccatcgaca acccggcgat
    73201 cgggatccgg gccagttcat gacggtcgaa cccggtgaac aacgcgcacg ccaacgccgc
    73261 ggcatgcacc gggctcaccg tgcccgctcg gatccgcgcg gccaccgccg cggtgatcgg
    73321 gcgcccggtc atgccgggcc cggccgcgcg ggtcaaatgg ccgggcagct ggatcagcag
    73381 cccgtgcagc agggctccgg cctgggcacc gcgcaacagg gtgatcgtgt ggttacgggt
    73441 cggggaatca gcgaccaggc cggtgaggaa gcagtccaac ccgtcgtcgt catcgaaccg
    73501 gtagggcagc ttgtgcatct ccgaactcct gggtccgttc aaacacagca gccccaccgc
    73561 gatatggcgt aattcagatt cgtcgtagcg ctgcgcgagc gcttccgcgc cccgccgcag
    73621 ctccaacgac cgcacaccag tcggccccat ccgccgcaac gcttcctcgg ccctggttgt
    73681 cggcagcacc ggtcccggat ggccgtgcaa ccatcggcac gccgcggcca tcccggcacg
    73741 gtagacctcg tccacttggg cgaagtccgt gcgcgagagc cgccggaacg cctcggcgcg
    73801 aaacgccacc acgtcggcgt cgggcacatc gggcaacacc tcgacctcgg cgtcgacatc
    73861 gggtgagcgt tcgggcggga agtggcgaag cagcgtgctc accggtgcca ccacacgcgg
    73921 gttcaccccg gccgggagca tcgccagcac ggcggggcgt gaggttgcgt ggcagaccag
    73981 caccaacccg accccggtct cgcgccacag atcgagcagc gcgttccagg agtccttgtg
    74041 tagtcgttgc gcgcgcaaca ccaccagccg ctcgatgtcc tcggccgcga cccatgcgcg
    74101 taccgcgtgc cacaggctcg acggggcgtt ggccttctcc gccgcgagat accgcaccgg
    74161 tcggcccagc gcggcgagga tgtccaaggc cagcgcagag gaggagtgcg tcgccggtgt
    74221 cgggtgcacc gtgacgaccg gtccggtctg gtcgtgcacg tcgagcaggg ccgcgaccac
    74281 ggccgcgtcg tcgagcggat ccagcagcac ggtgacgcgg tggcggcgcc gacggcgtac
    74341 cggcagcgat tcccacgcgt tcgccgcgtc caagtcgacg atcgggtcgc aggccaagcc
    74401 ctgctcgctg gtcatgagct gcgcccggac agtttggaga acacgtaacc gaggacgtcg
    74461 ccgtcgacgg tgtcgcgccc gatcttgtcc agcgtgcgcg cggcgtgggc ggtgatcttg
    74521 gcccaggacc ggaagttgcc gtgcccggcg ctcttgtctg cgaacgcgat cagctccggg
    74581 tcggtgttcg cccaaatccg gtggtaggcc gggatgacgc gcagcacctg cgcgcgcggc
    74641 atccgccgga actcctgcca cacatacacc cggctcgaca gcatcggttc ccggcgcagc
    74701 acctcataac agtcaccgcc gccgacgaac acgatcgcca tgtcggtgaa ccggtcgtcc
    74761 cacagatgac gccagtactc gaaacactcc ctcgacatcc actgcgcctc atcgcagacc
    74821 agcacccgaa accgttcggc cagaacatct ttgagcacac gatcgaactc gatgggctta
    74881 cgcggcgggt ccccgccgat cgccaacgcc tcgaacaacg tgtgccggat atcgcgcggg
    74941 gtgggccggg cccggaactg cacccggcac accgaccccg cgggctgctc ccgcagagac
    75001 gtgttgaccg acaacgtctt tccgagtccg gcgtcgccgt gcacacacat catcgccttg
    75061 gcctcgatca catcggcgag gttgtcgcgc actgccagca gcgcgtcggt ggccacgaca
    75121 tgcgcgccgg gcaggttcag atagtgatcg gcgccctcgt catcggcggc ctcggtcggt
    75181 gtgatcggtc ctcgggtcac cgcgtgcggc ccttcttctg cggttcgggt gcgtccaaat
    75241 cgactggcag cacccatccc ggtgccggtg gggaatgtgg aatcaggttc ggccgcgcca
    75301 ggctcgcgag ctcggtgtag tcctcgtcgc cgagttcggc ttcgacttcg gccacggtca
    75361 tcgcgcccag gcgctgcgcc ggtgccacgg tcgtcaccgc cgcgtaccgg gtgcgccggg
    75421 ccttctcagc agtcttgaga tcgcggcgca gctgggcggc cttgcggtcg cgtgcccgcc
    75481 gaacgcgccc gatctgttca ccggtggcct gatcagccag ccacgccgaa cccagatgcc
    75541 tgctgctggc caggtcgaac acctcgacct cgtgatcgtg gttgggcatg taccgcaacc
    75601 gaactcgcgc cccgaccatc ccgaccatcc aatccgcgac atagtggcgc ccgcgccccc
    75661 gcgcgacgcc cttggtggtg atcttgcggt gcgcccggtc gtcttcgagg gtgaacatcc
    75721 acagcttgtt cgcgtcgagt tcgtgcagcg gggtcggatc ggccagccac gattccagcg
    75781 gcgacgaccc gtcgagacgg tcgatgttgt gctcggtggt ggtgttccac cagttcaccc
    75841 aacccagcag gtcggcgacg aacacttcga acggcaacgc tggcgcgtcc ggatcggtgg
    75901 gggtaccgtt catcccgacc ggggcgtggg tgtagcgcgg catttccgcg atcagcatcc
    75961 gctccaccgc accgttgacc gtctccacac tccctttcaa gtgtggggtg tagccaggca
    76021 ggtccaccac ccgcaccgcg aacgcgccca tcgcgtcgct gaccgtgcgc gagaggaagt
    76081 ctttgccctg atcgatccgg acgagggtgg gcaccccgcc ggctgggcca tagggcggtg
    76141 tccgcaggat cgccgcgcgc aacgcggcca ggatcgcttc gcggttcggg gtcttcggcg
    76201 tgacggccac gcccatgatc acgcagtgct cggtatcgac gaaccaggtc acccacggct
    76261 tcatcagccg cccgtcgaca tcgacttcca ccgctgcttc cacgtggtct gcttcccagg
    76321 ccgcgttgcg gtaggtgctg ggtcgtttga ggaagacgtc gaacttgcgg cgcgagcgtt
    76381 caccctcgcg gataccggcg atgtcgccgc gggtcatgtc ctcacggatc gcccggtgca
    76441 acgtcgccag gctcggtgcc ggtggaccgc cggcacgttc gcgttctcgc agttcgcggt
    76501 gcagcgcgga ggcattgcca cgccagtacg cgaaccgaac ccgcaactgt gcgtcgatcc
    76561 ggaaccgagc tcgccgctcg tctttgcgca ccgcgccgcg gcggtcggcg agccaccgcc
    76621 acaccgttcg ttcggtgaca ccgagggttt gcgcggtcaa ccgcacatga tcgctgctca
    76681 gatcgccgtg ctggtccaag accgccaggc ggtcgaccgc ggcgtgctgt agcgcgcgct
    76741 tcgcagcatc ggccaccagc ttcgccttcc gaacccgctg gcctgcacca aatccggggc
    76801 aagcgcactg cccctcattc gatcacgaca acctgctcgc cggtcggttt actgacattc
    76861 tgatgacgaa ttgctactga catttcaatg acgagtctca cgcagggcgc atttagatac
    76921 attagaataa caggtgtcgg tgcggggtct cgaaccgggc acggcggtgc gacttcccgc
    76981 tggagtgaca gtgaggcgag ctggacttgt cccagctggt gtcagtagtt ttcgcagtga
    77041 gtgtcagtag agggtgcgcg gttgcccgct gaattgttag tggggtgagc tggggcctcg
    77101 tgggttactt cgggtcgtcc gggaggtgtc ggacggggga ggagcgagtc ggtgcgcggt
    77161 ggatcaggga tgcgggaggc cgtgctcacc acgcggctgg cgttgcggct cttcgagccc
    77221 ggtcacgtcg cggcgctgca cgagatcttc gctgacccgg ccacccaccc catcggggag
    77281 gggcccttct ccgatatcgc cgcgaccgaa gcgtggattc agcaccggat cacccctcgg
    77341 gccggaaccg ggctgtgctg gtacggggtc caccaccgtg gcaccggtgc attgctgggc
    77401 aactgtggtg tcttccccag gcgcactggt gcgcgcgaac ccgagatcgg ctacgagatc
    77461 cgcgcccgcg accagggaca cggcttcgcc cgcgaagcgg ccaccgcggt cctcgccgag
    77521 gacctgcgtc cgcacccgtc catgtcgaat tcaccgcacc cgcacgaact cgtcggccgt
    77581 cgtgcaagtt tcggcatcgt ggaggaagcg gtcgtactcg gtgtcgggga cccgggccag
    77641 attgctcacc cggggccggc ccgggtgagg cagctgctcg atcagctgcg agaccggcat
    77701 cgtcgggtgc gccagttcga tggcggtgac gccgtcccag ccgatcgggc cgcgggtatg
    77761 ccagatgagc accaggcgaa cggtgccagc gcggcgcagc cacagcagcc aggccaccgt
    77821 gcccgggctg agcaggtgcg tgcagcacgg tctggttctc gatccggtcg gccagcagcc
    77881 acgccctcac cgtccgcacc gcccgcggca cgattctgtc tacccggctc ctaggatgta
    77941 aggcggctcg gcgggtcgaa tttccgccag ggagcgttgt cgaagtacct gagtacctgg
    78001 tgtggctgtg cgatcagagc agctagctga cgcaaccgca ggtgatattc gccgggcgcg
    78061 gtgccgacag cgatggcgtc gtccacgcga gtgcgcagct ggggattgac gttgggtaga
    78121 tagatctccg cgagttcggc gcgcaggctc gacagggctt catgttcctg attgcgagac
    78181 tcctcgaact gcgaggcgaa ctcgtttgcg cgctgtactg cctcgtcatc gacaatgcga
    78241 cctctcatct gtgcgatgac aaggtccaac tctgattcga agatctcctc ttccgggatt
    78301 ccggtggtgt cgggtcggag ttgttgtgcc gccgttagtg cagcgacggc ccgcgtcacg
    78361 gcctgctcgc ccgcctcggt ggcgggcagc gcggacgccg cgggtggcag cgggatggtc
    78421 cgcacgcgca cgatcaccgt cgcgtcgatg gcgagtgaga tcgacccggg cgactcatgg
    78481 gtgttgacgt agcgcaccgc ccgcgcgccg aggtcggtca gcgccgtcat cggcacatct
    78541 ccgaaccatg tgctcaattc gccgcggact cctggtgcca ggtcggtagc gccgagttgg
    78601 acctggacct gatgaagcca gtaccgatgt gtcggcgagt cctgatcatg catgcgccgc
    78661 agcatgttct cgactgcggc ggcgtaggtt cccagatgaa gggccagcga ggttcgtccc
    78721 tcgattgcct tctcgtgctc ggagggcgat agcaaagagc gcttgatcaa cgccgtgatg
    78781 tcactccgat acctcggaga cggccagtcc tggtatggac tggtgtgata ccagaggtgt
    78841 cggtccacct gatcatcgtg acagtcgatg tcatcgagat cgcgaagggc agggcgtgct
    78901 gtggagatgt cgatgctgtc cccgcactcg cacacggggt atgactcctc gtccccgccg
    78961 cattgctgtt catactcgcc ggccgtgacc tcgacgcgtc gcccgcagtc gcagtcgaac
    79021 caatagctga aatcgaactc gaaaccagca ggatgctcag ccgatatccc ggaattcacc
    79081 agcgcagtgt acgaaccctg cctgcggacg tctcgtcgca gtcgcaacgc ccagccggac
    79141 caccgccata ccgtccgctc tgcgaccccg agcgtttctg cgctcagctg cacgtgcgcg
    79201 ctgctcaacg ctccgcggcg atccaaggtg agcaacggct gcaccgcggc cttccgcagc
    79261 ccacgcccag ggacgtcgac caccaccgac ctcccgccga cgccgcgacc agcgccagca
    79321 ttcgaccacg gcaatcagca gcgcggcagc agaatctagg tcgatccgtc gtcctgccct
    79381 actgacaccg aagtgggaaa atctctgaca cttcggtggg aaatcgcaca ccgcgacggc
    79441 gcgctgccgg ttcctgcaag gtgagccgtg cccgcgccgc tacatgagcc ctaccgtgtc
    79501 gattagcgaa accgcggcac tgtcgcgggg tctccccgaa agttcaccgg ggagacccgc
    79561 ggccgtcggc tacgcgagca gccggtgggc cgccgtagcg acggcgcatg ccgccatgat
    79621 cgccgggatc gggcccgcca cgaggaatgc actggtcgca gccagggccg accaagtgcc
    79681 gatcaacgcc cagcggacgg gcagccgctg gggcgcacta ccctcaggct cgcggacagg
    79741 cgtgcgccga gttaccttgt tcatggttct gctttctctc aacggatgga aatcgggaac
    79801 ctcgcggcct ttgggggtgg agccccgaag gccgctcccc gatctcgttc gggatcgaac
    79861 tccaccgcag gcactgtccc tcgaatcggg cttctgacct gcggcttgag acctttgtac
    79921 cggcttccgc agggtctgta tactgggcga tggcgacgtc ttaacccgcc agaaagaccc
    79981 cggtcctcgt cgaaggcgaa gccgttttct ggcgggtcaa gacgttcaga tcaagaatcc
    80041 ggatcagttt gagaatttct ggtgattagc ttggcggtgg ttcggttcga cttcagccgc
    80101 ctgcccaccg agcgtgaacg caaggcgctg accatccggc gagaccgttt gaccgccgcg
    80161 cagaagacgc gcacggtagc ggtagccaac ctgggcaagc tctcggccga gcgcgagctg
    80221 accgccgtac gggtacgcga cgggttcgtc cggcttccct ttcccctggt cgacgacacc
    80281 tccgatcggt ccgcgccggc ccccgaacat cggccgacct cgacgcggct gatgacgccg
    80341 aacggcatcg gcctgcggct gatgctcatc gccttgttcg aagcccagtc gcgcaccgcg
    80401 cccggcaccc gcgccgacgg caccccgatt ccactgcacg cccgcgtcgg cagcggacgc
    80461 atcggctgga cgaccctgct gtcgagctcc gcccagccag ccggtgacgg caagtaccgc
    80521 atgagcgtcg tcgacaaaca gatgcggcag ttgcagacca ccttcaccaa gctcgagcgc
    80581 gagggactga tcgaacccgc cgatccgaaa cgccggggcc gcggccgata cgaaggattc
    80641 ttcctccgct acgagaacat ccgttccggc gaaaccggcg atcgctatcg cgtccccgac
    80701 agcgaagacc cgtacttcga catcccggtc tcgctgttca ccaacggctg gattcatgtc
    80761 ctcgaggaca gcgagttggc actattgctg atcaccatcc ggatgtacca ccgccacggc
    80821 gccgaacccc agaaactggc cgcgggtacg cgtctgctgc actacgggct gagtcgcgac
    80881 gctaccgaat cgcacctcat gctcacccgg ctgggcctga tcgaatccca tggagacccg
    80941 gcacgtacag accacgggaa ggtcaccgac tacaagaaca tcggtgcaca accacacgag
    81001 ttcctgttcc tccccgccgg cctcgatcgc gacgccagca cgacgacact cgaagaaatc
    81061 cagtttcagc tggaccggga gacaaagggg tccgcgagat ccatcgcgga cgcgaagacc
    81121 acgtagatct ccgagcccta ggggtccagg ttgaagtact cgccatcgtc gatctcgtgc
    81181 ctgtgccgag tgccgccctc ggaacgccag atgatcttga cggtgaagct cttcggcggc
    81241 tcgaatccca ccttttgggc cactgccgga agcttccact ctcctgtcag cgcagtcgtt
    81301 tccttgtgtt cgaccttgag gttttgtgct cgttgtttcg ctgctccact gggctcgcag
    81361 agtggcgctg acctcatagg cggtgtcgag tccttcgttc gccagcacaa ccaggcagct
    81421 gccgtgtcct gggccgatgc gcctggtgaa agccaacacc gaccactcga cgtccttgcg
    81481 ttccgtatcc ggcggttgct ggccgtgctc tcacaaccga gatgttgcca cgcccaccgg
    81541 cccggcgtgg cagattatcg accgcttggt tgctcgctcg cgtctctccc cggtcacccc
    81601 atgtgggtca gcccgcctgc cagtcctgtc ctgcggcgcc ggccgccacc gagacctcgg
    81661 tgaaggtgtc ggccgggtgg tggcggtcga ggagccgtcc gaactcgcgg gcgctggcag
    81721 gccagggatt cgtgatctgc ccgtcggagc ggcgcttgaa ccacgacggc acgccgtcgg
    81781 gccacacggt gcgggccagc tcggtgttca gccatcgccg atagttcgcc atcgaggccg
    81841 gggcgacctc gatcggcgct cctaggcggg cggtcagttc caggcaccgc atgatgtagc
    81901 gggcctggtg gcgcttcagc gcggggttgc tgttggccgg ggtgaagctg tgtggcccgg
    81961 cgatcaggta catcgacggg aatccgggga tggcgagccc gaagaacgcc tccgggcgac
    82021 cccagtgtgc ccattgcgcg tgcaggtccc ggccgccccg gccccggacg gtgatgccac
    82081 cgaggagctc tggggcgcgg aatccggtgg cccaaacgat cacgtcgtgg cggcggtgcg
    82141 tccggcggtg cggggtgtcg gccgtgcgga tgccctcttc ggtgatcctg tcgatggggt
    82201 cggtgaccag ctcgacatga ggcagggcca gggcggggta gaaccggctg tccatcagga
    82261 tgcgtttctc cccgatgcgg tagtgcgggg tgagcttgac ccgcagcgcg gggtcgggga
    82321 cctggcggcg caggtgggcg cgggcgatcc aggcagcggg ccgggccgac caccccccgc
    82381 gcatgatggg ggccaggacg aggtcggccc cgtgatagag gccggcccgg tagagacggt
    82441 gcaggccggg gatgtgctca agtgcccagc gggtgccggg tccgaagcgg gaatcgggtt
    82501 tgggcaggat ccacgcgggg gtgcgctggt agaccgtgac agatgccgcg gtacgggcca
    82561 actcgggaac catctgcgcc gcagacgatc ctgtgcctac caccgcgatg tgtcctgtcg
    82621 ggtcgacggt gtggtcccag cgggcggagt ggaatgcccg cccgccgaaa gtgtgggcgt
    82681 cagggatctg cgggactgct ggccgatgca actggccgac ggcccacacc acggcctcgg
    82741 tgtggaggtg ctgcccgcgt tcggtcgtca gcgtccagct gccgtctgcg tcgttgtaca
    82801 cggcggactt gacggaagtg ctgctgcgca ggtgctcccg cagcccgttc cgatcggcga
    82861 cggcgcgcat gtaggccagg atcgacgcct gatcggggta gcgcacctgc gcgtctcggt
    82921 gggggtcgaa agcgaacgag tacagatgcg acggcacatc gcaggcgcat ccggggtagg
    82981 tgttctcccg ccataccccg cccacgtcgt tgccctcttc gaggatgacg aagtcgtgga
    83041 cgcctgccgc tttcagttcg gcacccatgg tcagcccgcc gaatcctgcg ccgaccacca
    83101 cgacactgtg cctgagtacc ggcccggtca cggtcgcgct cccgatgctg atggcttcct
    83161 gcggagcgtc ccgcttctgg tgggcgacgc gctaccggct cgtccgttgt tcatggcgag
    83221 accgtcctct ccttacgcac attccagtgt gtctacaact gctgttagag cgagtgtatc
    83281 taatgtatcg gaataatgta gctgagaagt tgcgaccctt gcgacgggtg gcggtagccg
    83341 ttcggccacg cctgtccaag tccgcgtatt cgcttgtatg ctctaggagt gggttatcac
    83401 tttcgcgacg acgttgccga gtccgtgtac ctccacgacg tcacgaaagc cgaggtcatg
    83461 gaagcgctgg cgtacccgcg gcgatggccg cagcggatcg agtcgaaggt cgacgccagg
    83521 gtgctccaga tcttcagccg cacggctgaa ggcaacggag tcgcggtggt ggtgatccag
    83581 attgatcgct gggattggct gatctacgca gctcggcccc tcgaggtgga cgagaacgcc
    83641 gaatacaccg tttgggaggc acagcaatga acatcgaacg ccgaatcgaa gaactgaccg
    83701 cgcaggccgc cgacgccgac ctgatgggcg acttcctggc cgggcgcctg gtccgcagca
    83761 gcgaaccggc cgacgtgtcc gagctgcccg tgccggacgc ggccgaggtg gagtcggtgg
    83821 cgctgatccc cacgacggtc cggttctcca aggcccagcg ggacaagctc accgagctgg
    83881 cgaaggcgcg cggcaccgac gtgtcgagcc tgctgcgggc atgggtcgac caccagctcg
    83941 aggtgaccga gcacccggag cggcagctga tcaccgtcga cgaggcgatc caggcgttgc
    84001 ggaacctgcc gcattcggcc tgaccggaga acgggcggcg gggccggggg agccccgccg
    84061 cctcacagcg ggaacagcga ggattggtcg gcggcgtcgc cggtccagga caggacgttg
    84121 gggaggttcg cgtccggggc gaaggtcagg taggtcccgt cgacgctgtc gcagccgatc
    84181 gcggtcgcgt agtcgtagcg gcggcgcgag ttcacccggc ccatgtggac ccacttgccg
    84241 acgctggaag cgaccgcggc gaggttggcc gcctccgggc cgagcttcca ggcggtgtcc
    84301 ccggccagga acagggcgtc gatctcgtcc catcacccgc ctcgcccggc tctacgagat
    84361 cccgctgcga cgacccggcg gcaggcagcg gtccaagatc cccgacgact ggctgtggtg
    84421 ccaatacgtc gcctcggccg aaccctccca cagatcgccg cagccgtcgg catgagcaaa
    84481 tcagcgatca gccgccgcgc caaaaaggcc ggtatcccca tccggccgcc cggcggcccc
    84541 agccacgcca tagccgtcgc ggtcgccggg tacgaggtcc tgcgaccagc tatcgagtca
    84601 gtcgcgggat ttcaccgact gaagatcctg gcgaccaccg cccgacacaa cacctacgaa
    84661 tccgccgcag cggccttgca actcggcctc aacgacctgt actcgatcct catcgaagca
    84721 gaagccgacc tcggccttca cctcctcgac cggatcggca gcacgaccaa ggtccggctc
    84781 gctccgcacg gtcgcgatgc tgttgtcgct atgcaatcgc tgctcgccac acgacccgcc
    84841 tgagcagctc cctggccgaa gccctgcccg taccggtact tccgggcaac gaccacacga
    84901 aggtcgcatg cactgctcgg ccgaggttgc ttagcagaca tacggatcga cttctactgc
    84961 aagacaacaa caatcctgcg tcgccaacac aacatctcac cagatcgccg ccagtttgcg
    85021 gaggggagca gacaacccgc gtgttcgaat gtatgttcga agcagtggca ccgatgaggg
    85081 gtgtcgctcc cctcacatcg aggggacgca gcgcgacgaa ggagtaagca agctatggca
    85141 tgtcagacct tcccaccgtc accgttccag gtctgtggcg cgattctcga caagtacctg
    85201 caaacaggtg gcccgaacgg attcctgctg ttcccgaagt ctgacgagct caccaacccg
    85261 gacggattcg ggcgacgctc ggagttcctg ggcggcaaca tctactggtc gccgaatacc
    85321 aacgcgcatc cggtcgcgca cgaattcctc accaagtggg gagaatacgg atacgaaggc
    85381 gggttcatcg gctacccgtt gaccgatgag atcgtgctgt cggacggtat cggtcgacgc
    85441 caggagttcc agggctcctg gatctactgg cacgccctga ccggagccca caacatccag
    85501 ggtgcgatcc gggacaaatg gctcgaatcc ggcggcgagc gtgggcctct cggctacccc
    85561 agcaccgacg aagtcgtcac tcccgacggc aacggccggt tcaaccgatt cgaacgcggc
    85621 atgatctatt ggtcgccttc aaccggcgcc cacgcggtca gcggccgcat cctgaccctg
    85681 tggtcagcgg cgggctatga gaccagccac tacggatacc cgaccagcga cgccaccgcc
    85741 ggcgcagaac ccggctcgtt gatccagcag ttcgagcacg gctcgatcta cgtactcaac
    85801 gactacctgc gcgccctgct ggtcccggca caaggattcg ccagctacga caccggcctg
    85861 cacccgggct actgccccga cccgctgaac tcgcccccga cctgcccggt cgatctgtcc
    85921 gactacgaca ccgttcccga cccgttcgga acgctggtca cggcgaatat gcagaaggcg
    85981 gccctcgtgt cgacctactt cgcggccaac gggcgtccca acgcccacga gctgtgggag
    86041 cactactacc gcaacaccgg cgacgactac gtactcagca gcgcgttgct cgattcctgg
    86101 accgccgagg agagcaccga ctacccggga ttgcggccac cagcagaact ggtcaacgcg
    86161 aacaaggtgg aagcgatcaa cgccgcgatc gcggaaaccg cgcgtaccgg ccagactgcc
    86221 aaggtcatca tctccacgcc gtggcaggtg actgccggga tcagcaacga tcaggtgcag
    86281 tcgatcggtc gctacagcct gtgctcaacg accgcggtca tcgcccagcc tgccaatccc
    86341 ggccagaacc cgatcgagct ccggcaacag acccacatct acgacgtcta cgactacgcc
    86401 gccggcgacg actacggcaa ccccgcccag gatgcggtcg ctgtcgcggt cgaaggggag
    86461 aagctgggca tcgccaaacc gttcctggtg ctcggatcgt cgtcggtcca ctcctggtcc
    86521 ggcatccgct gaggatggct atcgccccgc cgcaccgtcg cggcggggcg atgccgcaca
    86581 atagccacac gggggactga accagagtgc ctcacccgac cgatcaagga acctgcccat
    86641 gtccagcgcc gccccaggga acgtgtcacg accgtgtagc gcgggatggg gcgtcggcgc
    86701 ggggctgttc gtctcgacag tggtgttcgt acccgctgtc ttcgtggtgc ggcagtggtt
    86761 ggatcttccc gagatcccgg cgacgccgtc acacctgcgt gctcacccgg tcgaggtacc
    86821 tgactcgtac tggatcacct ggctcgtcgc cgcagtcgta ctgctcgcgc cgggcgtggc
    86881 gctgatgctg tggccgagga tgcgacgggt cgcgatggga tacaccctta cggcagggtt
    86941 tgtcgccgga ctactggcgg cgttgacgat cgggttcgaa ctcggcggtt tcgctcctac
    87001 ctgatcacca gggcgaccga gggttgccga gggcgccagc ggccaaacac gactcaccga
    87061 gcatcttgcc ggagaaactt gcctcggcgg ccgacagcgc caggctgccg gtggacgaga
    87121 cgtccccgtc gagaaatgac atcgaactga gaatcctgcc tatgacatcg cggtgagaac
    87181 gggcgagaac gcgcaggtca atcgccatga ccgatgacac ggggtctgag gatctacatg
    87241 tcgccggtca ggtcgacatc gggaacagcg ccaggtcggt gccggtggcc tgcgcccacc
    87301 agtcggcgaa tccgggccgt tccttgtcgg cgacgacggc gggggcgaca acgaagaagt
    87361 gctccagctc gtgcgggccg gtgccgtccc ggccggggac gaccgcgcgg gcgatgccgt
    87421 cgtccccgag ctcgcggtgg gtgtcgacga gcgccgggga gccgtcgggc ccgccgatat
    87481 cgacccgcag cggagcgccg tcgagccagg cgaccatctc gtcgcgagag ccgacgtcga
    87541 ccgcgcgcac cgatcgcgcg accatcttgg caccgccggt ttgggtgcgc cgggcgaggc
    87601 ggcggacctc gtagagggcg tgcggttgct cggcgagcgc gctctcgaag gcggtcagga
    87661 cgccggtgag tccggccgcg cgcacgtagt cgatggcgcg cttgccgccg acgaggccct
    87721 gtttggcgtt gagcgcgagc gcggtgtgct ccatcagcag catccgcgcc ccggcgtccg
    87781 ggaactccgc gtagcgcgtc agagtggcgg cgcgattggc ggcggtgacc agcgcgaaag
    87841 gacagaacac gcacgccgac ttctgccagg cccggccggt cttctcgtcg atgtaggcga
    87901 gcacccgttc ccgatcccag ccccacgaga ccagcgggta ctcaccgcgc cgcagcgcgg
    87961 tgtcgtaccc ggcgtcgcgg cgggcccgcg acaattcccc ggcctcgaac cccacgacgt
    88021 ggcggtacgg ccgtccgtgc gtgatcgcgg cgatcaccgg gtcgagcact tcgcctttgg
    88081 ctgacatgct gcaccggcga ctgccaccga cctgcggctg aatgccggcc gtgagcatct
    88141 cggtgccgag ggtgtaggcg ccctcgatat ggaggcggtg cggcgatcgg gaatcgtcga
    88201 agacgacgac gccggtgcca tcagcgcgca cccggcggtc ggcccgcccg atctggatga
    88261 accgaatccg gtgctgggcc agtagcggga gcacgacctc ggtcacgtcc cgtgcggtgt
    88321 cttcccattc gtcgccgacc atggcggtga cgacggccag ctccgccagg tcgaagtcgc
    88381 ggctgtcggg gtcgaagatc cagcgcagca gcagggcggt gctgtcggcc ccgagtcttc
    88441 tcccgcttat tacgaggtgt tgcagtccag aggtgttgca gtccaagggg gaccagcgga
    88501 gggactgtac ggtttcggcg ctgtcccggc gcggcgctga ggttcgtcag acctgtgctt
    88561 ggatcgtggg aatcatgggt tcggagtagg ccatgtgcgc gatgatcggg gtatggctga
    88621 ggcggcgacg agcagccggt gctgctatgg ctgaagctgg ccgacttgat cgacaagctc
    88681 attcagcagc tggctgcctc ggtgctgaca agcgccgctg gcccccgctc ttgcttatct
    88741 gctgctgggg gccgaccacc gagccgagct cgcagcctgg gtgccatcca gaagatgatg
    88801 tgctgccacg aacctgccat catcggaacc gtcagcgcat gtaggagacg atgctcatca
    88861 ttccggcttc accgtggtag gcgttgtggc agtggaccat ccactgtcca ggattgtcgg
    88921 cttcgaagtc gacctcgagg gtctgcatgg gcagcacgat ggaggtgtcc ttgcgtggcc
    88981 cggtgcccgc agcggtgacg acctggaagg tgtgaccgtg caggtgcatg gggtggaaca
    89041 tcatcgtctt gttgacgaac cgcagccgaa cccgttgtcc ttcggtcaca tcgagcatgg
    89101 cgtgctcggg aaacgccttg ccgttgatca tccagaggta tttggccgca ttgttttcga
    89161 gggtgagatc gagtgtcttg tcgggcttgc ggaggggcag gcgtacggat tcggcggaga
    89221 ccagccggtc ggcggtgagc gggggtgccg ccagttcggc cgggcggacc tcggcgggtg
    89281 gcggtgcgcc ggcgccggtg cggaggaggg cgaagccttg gccggtcttg ccttcggcgg
    89341 aagcgaccag cgggaatacc ccgtcggcca gttcgacgac ggcgtcgtaa cgttcgccca
    89401 tgctgatgag caggctggag gtggtggccg gctgcacggc gaagccgtcg ctgtgggtga
    89461 cgcgcagttg gtggccgccg acggcgacgc ggaaggcggt atcggaggcg gcgttgatga
    89521 tccgcagccg gattcgctgg ccggggcgtg cggcgatcgt gaccggatcg gcgccggtgc
    89581 ggccgttgat caggtggtac ggatagtcgc tcacgtctcc ggtgtcggaa ccgagcggtg
    89641 cgttggggtc ggtgggcatc gccatcgtgg aggaaccgcc catggccatg ccgccgtggt
    89701 tcatgccgcc catgttcatg cccgacatgc ctttggcgcg tagctgatcc agttgcttgt
    89761 ccgggtcgcg gctgttgacg ccgtcgagcc agtcgtcgag caccacgacg gcttccaggt
    89821 cgtagtcctt gccgtcggcg gggtcctcga tgatcagcgg cgcgtacagg ccgcggtcga
    89881 gttggactcc gacgtgtggg tggaagaagt acgtgccggg gtcgggtgcg gtgaattcgt
    89941 agccgaaagt gccgcccgga gggatctgcg gttgtgtcac ctcgggtgcg ccgtccatgt
    90001 cgttgcgcag tgcgatcccg tgccaatgga ccgtcgatgg tacgggcagt gcgttggtga
    90061 gttcggcccg cagtacatct cccttggtga tgcggatttc ctggccgggc agtttgccgc
    90121 cgtaggccca ggtctggacc tgcacgccgc cgaggtcgac ggtggcgggc tcggcgtgca
    90181 agctcacgtc ccgaacggcg gcatccgccg cccgccgtgt gttctcggct gcgcggactg
    90241 cctcggagtc cggttcgacg agtgtgcgtg acgcggtgga atctttcgag caggcggcga
    90301 gaacggcggc tgcggtgacg ccggtgccga gggcgaggaa gccgcggcga gtcatcgacg
    90361 tcgggtgggg gaactggctg gatgacatgg tttctccctg ggtgacgatg ggggttccgc
    90421 cgtggtgtca gggcggatgc ccgtgatctg gtgcagccag gtcgggtcgg atgccgggga
    90481 gtgcatcgag ccgtaccggc tgtcgctgct cggatagacg gcgatgaacg ccgcgccgcc
    90541 tggattccga cagcatgggc ctaccgcttc cgggaatacg cggaagcggt aggcctgtca
    90601 gatcctcaga atcgatagtt cggccaggga aggcacgacc caagggggtg gtcgttcgcg
    90661 gtgcaggcgc aaggacgccg ttgtcggcat cgggccgatg ccgcgcgaga ggtggcccgc
    90721 tcgatacagc agtaccaggc cgatcgccag cgtcagggtc gacaggatga acacgcaggc
    90781 gtgcaccgcg tcatggccga gaccatggcc gccgcccccg atggtgacct catcgtggag
    90841 ggtcgtcccg gcggtgatcg acgcaggaga ggagccggcg tggtgggcgt cggacccgag
    90901 gtggaacccg ccggtatgca tgacggtgat gccgagaagc agcaccagca ggccgagcac
    90961 ccggactgac cgggatgctc gcgacgactg gtgctgcatc acaccgtcat catagtgtcg
    91021 gcatcgccct actcgagcag gttacccctg cggggtaatt tcgatgcagg ttccgactgg
    91081 atatataccc catatgggta tatatagtgg tgtcgatgcg gatccgtgaa gtcgggaaaa
    91141 tggcggtcga aatgatgggg cgtgatcgac gaagccgccc attgggggcg tcgttacctc
    91201 gcatcagcca ctcacaccgt cgggagcttt tcctcggtcc tgctacagtg ggctcactgt
    91261 gaggttcccc ggtcgattgc gacatgccgg ctccgtggtg gcgctgctcg ccgcggtgct
    91321 ggtcgtcgtg ccgctgatcg actgctcggt ggctcgcggt gacgtgcacg tccacgcttc
    91381 ggcccatgcg ggtgctggcc accacctcgc ctcgtccccg gggggcgatc acgtccacgc
    91441 ggtgatcatc gatgcgctgg acggtcattg cttggcgcac ctcgatcact gcatcgccaa
    91501 gtcggtggtg cgtggtgccg ccgagaatct tccgccgcaa aaactgctgc tcttcgccct
    91561 ggcatcggcg ctgctcgccg ctgttgccgc ccggggtgtc gcgcccggag gggtgcgcgg
    91621 tccgccgatc tcgcgggtac ccgtcgctgg tggacgggcg actctgacgc agttctgtat
    91681 cgctcgacgc tgacaggtca gcgccaagcc gacgtgtttc tttgtgtcgg ccggtgtctg
    91741 ctgcctgctc acgtccgcgc cgcctacctg gcggttcgat acagaaagcg acagtcatgg
    91801 acaagctcgt tctcgatgcg cgcaccgatc gttcatcagc cctgatggtc gcgcccgcgc
    91861 ctgcccgctt cccgcaatcg ctgatcggca acacccccgt gttgtgggtc ggtgcgccgc
    91921 tcgcgcccaa gggacggggg ttctgggcga agctcgaagg attcaatccc ggcggtatga
    91981 aggaccggcc cgcgctgcat atggtgctca aggccgagca gcgcggtgat ctgacgccgg
    92041 gggcgcggat catcgaatcc accagcggca ctctcggttt agggttggcg ctggcgggaa
    92101 tcgccaccca tcacccggtg atggtggtga cggatccggg tctggagccg atcgtcgcac
    92161 ggatgctcac cgcctacggc acccaggtcg acgtggtcac cgaggcgcat cccgcgggcg
    92221 gctggcagca ggcccgccgt gaccgggtcg cggagctgct ggctgctgat cccgatgcgt
    92281 ggtgcccgga tcagtacagc aaccccgaca atgtcgacgg ctatgaatcg ctggcgctcg
    92341 agctggtcga gcagctcggt ggggtggacg tgctggtatg cgcggtcggc accggagggc
    92401 actcggccgg ggtggcgcgg gtgctgcgcc agttcaatcc cgagatgaag ctgatcgggg
    92461 tcgacaccgt ggcgtccacg attttcggcc agcccgcggg gccacggttg atgcgggggc
    92521 tgggctcgag catctacccg gtcaacgtcg actacgacgc attcgacgag gtgcactggg
    92581 tcgcgccgtc ggaggcggtg tgggcgtgcc gtaccctggc ggcgacccat cacgcgaccg
    92641 gcggttggag cgtcggcgcg gtggcgctgg tcgcgggctg ggcggcccgc acccacgaca
    92701 ccgatacccg gatcgcggcg gtgttccccg acgggccgca ccgctacttc gacaccatct
    92761 acaacgacgc ctactgcgac gagcacggcc tgctcgacgc ggacccgccg gtggaaccgg
    92821 acacgatcgc ccatcccgcc gagcgcgtgg tgcggtcgtg gactagaacc accaccgtcg
    92881 tcgatcccag gcagttcatc cacgaccagg agttggcctc gtgagcgtcc tggcgaaatt
    92941 ccgtagcttc gacctgcctg cccggctgtt gatgatcaac cagttcggca tcaacctcgg
    93001 cttctacatg ctgatgccgt atctggccgg ttacctggcc ggtccgttgg ggctggcggc
    93061 gtgggcggtg gggctggtgc tgggtgtgcg gaacttctcc cagcagggca tgttcctcat
    93121 cggcggcacc ctggccgacc ggttggggta caagccgctg atcgtcgcgg gctgtctgct
    93181 gcgcaccggc ggcttcgcgc tgctggtgtt cgccacctca ctgccgggac tactggtcgc
    93241 ctcggccgcg accgggtttg ccggagcgct gttcaacccg gccgtgcgcg cctacctcgc
    93301 cgccgacacc ggtgaccggc gggtcgaggc gttcgcggtg ttcaacatct tctatcaggc
    93361 gggcatcctc gccgggcccc tggtcgggct ggcgttgatg gctctggatt tccggatgac
    93421 cgccgctgcc gctgccgtgg tgttcgcgat cctcaccgtg gcccagttgt tcgcgctgtc
    93481 gacgcggcga gccgagatcc gcgccgagcg gacctcggtg ctcgacgact ggcgcaccgt
    93541 ggtcgccaac cgccggttcg tatggtttgc ggtggcgatg atcggctcct acgtgctgtc
    93601 gttccagatc tacctcgctc tgccgctgca agcggaattc gtcgcaggcg ctcaggctca
    93661 gacgctggtc tcggcgctgt tcgccatctc cggtctggtg gcggtcgccg gtcagctgcg
    93721 catcaccgcc tggttccgcg acaggtgggg caccggagca agcctggtcg tcgggctggg
    93781 catcctcgcg gcctcgttcc ttccgctcgc gctcattccg gaccccgatc ggttcggtgt
    93841 cccggccgcg gctgccgcgc tactcctctg cgcgatgctg ctggccgtgg gaactgcggc
    93901 ggtgttcccg ttcgagatgg acaccgtcgt gtccttgtcc ggtgggcggc tcgtcgccac
    93961 gcactacggg ttctacaaca ccgtcgtcgg ggtcggcatc ctcaccggca acctcgctac
    94021 cggcgccgtg gtcggcgccg cacgcgccgc cggcatggac tgggcactct gggtcggcct
    94081 gagcgtgatc ggtgttgttg ccgcgctcgc tctccatcgc ctggaccgcc cgcagcacgc
    94141 cgaggaagat ggccagtcga ccgacgttcg gggccgccac cgcatccccg aagaccacgc
    94201 catcggcacc acgctggtcg agcaggaatt cgactacacc ggacgcggtc actggccgac
    94261 gaagatcccc gccgggcgac gctgaccacg gcctactggt gcagtgccct tcgtgtccgg
    94321 ggtgctgatc tgccggaaac gctggcagat gtcgtcatcg ccgggcaggt gcttctcgca
    94381 cgctcacctc tgcccgagca ttgccttcat ctggtcgatc tcgcgctgct gtgccgacac
    94441 gatctcggcg gccagctgct tggcttggtc gttggctccg gtgtcgagtt cggtctgggc
    94501 catctgcacg gcgccggtgt gatggccgat catcatctgc agccacatcc ggtcgaattc
    94561 cgccccggac atgccctgca gcgacgacat ctgctccggc gacatcatgc ccggcatgtc
    94621 atgacccatc gggcccatcg ggccggcggt cggggatggc accggcttgc cgaactcctc
    94681 gagcagcgaa cggatctgtg ccatctcggg ctcctgcgcg gctttgacag ccgaggcgag
    94741 atcgagcatc tgcgggttct gcgagtgcga gggcaccata tccgccatct gaacggcctg
    94801 cgcgtggtgg agatacatca tctgcagaaa cgtcacatcg gcatcgttgt aggtggccgc
    94861 cggcgcggac gtcgcggcgc cgacggtcgt cgacgtcgcg ggcgcgctcg ctcccgcggt
    94921 cgtggttggc ttgccggcct cgtcgctgtc gccgcatccg gccagaacga acagcaggac
    94981 agcaacgccg ggaacatatc gccgaagcgt ggtggaacgc agaggcatga cgaactccta
    95041 gctagagccg gggacaacgt gaccttcaca ttgagaaatg tgtgaaacga accgctgagc
    95101 ccgaggaagg gggccttcca tcgttgccgc tgaccatcga aaaaccgccg acaacgatgc
    95161 cgaagcaccg gctgattcta gaccgctggt gcgcgccggg gccgcagctg cgaggttttc
    95221 cgctcgtgtc cgatgcgaaa gcggtcggtt gtgtcctgtg agggcacata atcaggccgt
    95281 cgcattccgg cgcgcgtgtg tcacggcagt aagtgtcttt gggtcccttc gtcgctgaca
    95341 ttggcccata ggcatccgac gctgcggcag agattgttga ccttacttct cgaaggagtg
    95401 ggtcgcccgg catccatggg atgtggggaa tggttggcag aggacttcgg cgatggcgga
    95461 tgcggcatac ggcttgtggc cgttggtcat tttgaacacg gcgttgttcg tggcgttcgc
    95521 gctgagtttc ttccatccgc gcacgaaccg cgactggcgg gtgatgagtg gttacaccgc
    95581 gttcctggtg gcgctgttca ccgagatgta cggcacgccg ctgacgatct atctgctggg
    95641 gagctggctg ggctcgcgtt ttccgctgct gcgcgacagc cacgcgggtg ggcacctgtg
    95701 gaacgatctg accggctgga ccggcgaccc gcacctgagc ccgtttcatc tggccagcta
    95761 tgcggctata ggtggtgggt tctggttgat tgccgcggcg tggcggccgc tgcacgaggc
    95821 cgcccgcgcg aaccggttgg ccaccaccgg cccctacgcg cgggtgcgcc acccccagta
    95881 cgacggattc ctgctggtga tgatcgggtt cctgctgcaa tggccgacca taccgacact
    95941 ggtgatgttc ccgatcctgg tcgtggtgta cgcgcggctg gcacgcagcg aggaacgcga
    96001 ggtcgccacc cgattcggcc gcgagtggac cgactacgcc gcccgcacac cagcattcat
    96061 tccgcacttg ggcgtgggtg cgagcttgcg cgccgctggt gctggaaggt cgcgatgacc
    96121 ggccgagtcc gaccggcatc acccgccggt cggcttacac cgacgcaccc tgcgccccac
    96181 tcacgaagac gaaatcgggg ccgatgagca ggaggtcggt aacaccggca cgcatctgtg
    96241 tgcacgtatc aagcgatgac accgctacgc cgaccgaggc actgccatca ccgaccgcat
    96301 gagcaagacc cgcgccgcgc tcgccagggc cgcggtcggg acatggtggg gcttgttcga
    96361 catggtgggg ccttttcatc gggctgttca ccgtcggaac ggcgtggttc gccgtgatca
    96421 tcggcggcct gatccggacg gtatgtggtg cgattcggtt acctcgcgag cgcgcacgta
    96481 gaaagatatc ggacgacctg tatcggtgag gtcggcggtg ataccggcgg tggggccgtt
    96541 cagccgagcg cccggatgag atcatcgcag gcttgttcgc agcggcggca cgcttcggcg
    96601 cacacgcggc agtgctcgtg agtgtcagcg tgggcggagc attcgtcgcc gcaggctttg
    96661 caggctgtgg cgcacgcctg cagaatcgcg cgggtgatgt tggcgtcgta accagtgtgc
    96721 cgggacagga ctgatgcggt ggcgttgcag atgtccgcgc agtccatgtc ggtgcgaatg
    96781 cacttggtga gctcgccgac caagccctcc gacaggcagg catccgcgca cgcggtacac
    96841 gcctgggcgc aggcgatgca atcctcgatg cacctggtca gcttgtcgcg atcgacatcg
    96901 ccgaggtcgg ccggataggt ggcgagcatg tccttgaccg tggtcatggg gatattgcct
    96961 cccttcactg cccggaggcc gggccggccg ggatggcgcg cctcttcgac ctcctgccgc
    97021 gtgggtagcc accgcgaagc gacgcaaacg cgcccagtgg gcggtccccc aagcagccga
    97081 gcccacctgc cggcgtaccc aacgtggtga tcgttttctc ggttgccctc ggccccgggc
    97141 cgccgtgtcc tacgcgacta ccggtgttgc ctcggatgtt ccggtgtgcg tgggtttcgg
    97201 tgtggggagc cggagtcgtt tgagggcgag ggcgttgacg gcgacgatga ggctggatcc
    97261 ggacatggat agtgcggcga tctccgggcg cagcatcagg ccgaaggcgg gttcgaagac
    97321 gccggcggcg atgggcaggg cgatggtgtt gtagccgatg gcccaggcca ggttttggcg
    97381 cattttgccc agtgtgccgc ggccgatgcg cagggcggtg ggcacgtcga gcgggtcgga
    97441 tcgcatgagc acgacatcgg cggtttcgat ggcgacgtcg gtgccggcgc cgatggcgat
    97501 gccgaggtcg gcttgggcga gggcgggggc gtcgttgacg ccgtcgccga ccatggcgac
    97561 ctggcggccg ctgcgttgta gttcggcgat cttggtggct ttgtcgccgg gcagtacttc
    97621 ggcgatgacg gtgtcgatgc cgagccgctc ggcgatgcgt ttcgcggtgg cttcgttgtc
    97681 gccggtgagc atgaccacct cgacgccgag gtcgtgcagc gcggcgacgg ccgccggtga
    97741 ggtttcgcgg ggcgcgtcgg cgatgccgat gaccgctgcg gccttgccgt ccacggcggc
    97801 gatcaccgcg gtgcgtccgg tggcggccag ttcgtcgcgg cgggcggcca gcgcgccgag
    97861 gtcgatgtcc tctcgttcgg ccagccgccg gttaccgacg acgacacggc ggccttcgac
    97921 ctcggcgatc gcaccgtggc cggggacgtt ctcgaacttt tcggcccgaa cctgacctac
    97981 ccctgcgttt tccgcgtagc ggacgacggc ctgggcgagg gggtgttcgg attcgcgttc
    98041 caccgcggcg atcaggcgca gcacttcggt ttcgccgatg ccgtcggtga tgacgtcggt
    98101 gacctcgggt tcgcccttgg tgagggttcc ggtcttgtcc attaccacca cctggatgcg
    98161 ggctgaagtc tccagtgcca tcgcgttttt gaacaacaca ccgcgtttgg cgccgagccc
    98221 ggtgccgacc atgatcgcgg taggggtggc cagcccgagg gcgtccgggc aggtgatgac
    98281 caccacggtg atcgcgaaca gaatcgccgc cgagaacggg cgatcggaca acagcagcca
    98341 ggccgccagc gtgacgccac caccgatcag cgcgacgaac accagccaga acgccgcctt
    98401 atcggccaga cgctggcccg gagccttcga attctgcgct tcctgcacca gttgcacgat
    98461 ctgcgccaga gcggtgtccg caccgacctt ggtcgcgcgc acccgcaagg tgccgttgga
    98521 gttgatggtc gcgccgacga ccgccgcgcc gggggccttg tgcaccggca ggctctcgcc
    98581 ggtgaccatc gactcgtcga cctcgctgtc accgtcctcc acgaccccat cgacggcgat
    98641 cttcgcgcct gggcgcacca gcagcagatc accgaccgcg acctcggcgg tgggaatctc
    98701 gacgggttcg ccgtcgcgca gcaccagcgc tttcggcggc gcgaggtcga ggagggtgcg
    98761 gatggcgtcg ttggcgccgc cgcgggcgcg catctcgaac cagtgcccga gcagtacaaa
    98821 cgcggccagc acggtggcgg cctcgtagaa cacttcgccg ccgccggtca gtgtgatcac
    98881 cagcgagtac agccagcccg agccgatcgc gacagcgacc agcaccatca tgtccagtgt
    98941 gcgggcccgc agcgcccgca cagccccgtc gaagaagatc cacgacgagt agaagatgac
    99001 cggcaggctc agcaacaacg cccagacgtc ctcacgcaga ccgaacggca ccggaacgtc
    99061 cagccgcagc acgtcgcgcc cgatcggcga ccagatcacg atcgggatcg agaacagcac
    99121 tgccacgagg aaccgatttc gcatgtcggc caccatcgat gccatcgaca tcccggcatg
    99181 cccgccgtga cccatcgcgt catgcggaga acgcaggtcg ccggcgccgg ccgggtgctc
    99241 ggtatgagca ggggcggccg cgatgtgccc agcatgctcg atgggttccg tggtcgcgag
    99301 ctgaccggcg tctccggttt gcttatcttc ggtgggtggg tccggttcgg tcagcgggtc
    99361 gcagatgtgg gccggcaccg accgtccggc gcagtggtag ccgcattcga tgacccagtc
    99421 ccgcagcgcg gcgatcgtgg tctgtgtctg gtcgtagacc acagtcgcgg tctgcgccac
    99481 cgggttgacc tcgacctgat atacgccggg gcggcgagcg agcctcgcgg cgacaacatt
    99541 ctgctgcgag gcgaacagca ggccacgcac atccagcacc gcggtgacac gttccttcgg
    99601 cgaatgcgta tgggcatcga aatgggttgc cacggggtca ctcctccaga agccggttat
    99661 tcaacggtgt tgcctgcgga cggtgatttc cggtgcggat gggcgggcga cctcatcgaa
    99721 tggtgagcgc ctccctatac gagtagcgag cggtggtgta gccgccgtcc ccggcgcgaa
    99781 actctgcgcg tcgccgcagg gttggagcgg tgcggtctgc gccgggcgga cagtcatggc
    99841 accctccgag tactactcgg cccttactat cggtcgccgc cgctgttcgt acccggtccg
    99901 gaaccgatat cgccgcgcaa tgtagccagt cgctggtggt attcgtcggc atcgatctca
    99961 ccgcgggcga atcgctcggc cagcacctgc tccgcactcg ggcgcacgat cggcgcgccg
   100021 ccgaccggcg cggacggcag ggccaggtac cggaccgtca gaattacccc ggcgagcacc
   100081 agcgcccaga acaacaccat cccgaccgtc atgagcccgt aaccccaccg gctcatcccg
   100141 tcgccatacc agaacatcat cgtgcactcc tcgatcgata cgaactcacc gctgtcgtcg
   100201 cgacatcctc atacccgctg tcgtgtggtt cggcgcgagc gatccgcact cccaacggtc
   100261 cgcgtcgccg agcgcggccg gtagagacca ggtgcccttc tggcgcatcc gaaggtccct
   100321 acccccggcg ggtatcacca agcagacttg atacatacgc tgccgccagc tgccactgca
   100381 ggcgaatacg gaacggatgc gagcgcttgc gactgtcgac cagcagtcga gggtcagctt
   100441 ctgcgctgtc gggatatcgg cgcgcgaata ggcgcacaca tggatgatcg cacccctcgt
   100501 catggaggtg atcggatggg cgaggtactg cacaccgcga tcgaggtcgt ggccatcgcg
   100561 gtcgggaccg ggatcctcct actgatcgtg ctgtgcgcac ccagcgtatc ggagctggcc
   100621 gacatcctcc gacagcaccg ctgcacaacc ggccggcacg atgcgccgac aatcccgaat
   100681 ccgagacacc accgccgaac cgcgccgctc ctcctcacac cgcaaactcc atctgcctgg
   100741 tcgacatctg cagacgaaca gttcacgcgc actcttctcg ccgacgaaga cgctgccgct
   100801 cgccagctac tcaccgggcg aatgagcaag tccgcctacc ggatacggat gcaggagttg
   100861 gcgcgccgca acgagcgaac ttcccgaccg ccaccctgat cgaccgatac gacgccgcaa
   100921 cctgcacagc cagctcggtg atcagcattc accgtgccat cgaccgcagc accttgacag
   100981 cgacgcaggc cgcggtcgaa ctgggcccgc atcggccgtg acaccaccat cacgtacggc
   101041 cggggagccg attcgggggc gtgtcacatc ggctgcccca tcatcgggca accgcccatc
   101101 aggctgcaca tccattgaca caacatgtgc atggggttca tatcgtcgat ctccttctcg
   101161 tcgagcgatc cggccgcagc ggccggcccg caggggttgg acgtgccggt gtcgtcgagg
   101221 ttgccgcgtc aataccccgc attggtaggg acctttggcg gtcggatgga ggtcgttcgg
   101281 cgccgctgga ggcgacctcg tcccatcctc ggctacgggt gtgcgagcgc agagtggagg
   101341 tgatcgcgag agaagggaat gcgatgaata ctcggtatct tccgtggtac gcgctcgcgt
   101401 tggccgtgtt ggtcgctggc ctcgccattt cgggagtgtc ggtgtcgacg ctgctgctca
   101461 tgctggtggt tttggcctgc ccgctgatga tgatgttcat gatgggcggc cacggacacg
   101521 gcggcaatga cgataagcca tatgagatgg gcaaacgcca cgaccatggc cccacttccg
   101581 gccggtcttg aacgcgccgc agaggtgtgt gagtcatctt ggagaacacc gtgactactg
   101641 accccgacgc agtcgaggcc acggcggacg agccggtcac cgcagtcaca cgagacacga
   101701 cgccgcttct ggtggctgag gggctcgaga aggcttatcg ccgtggtggc cggttccttt
   101761 cccctcgcgt gccggtgttg cgtgggttcg atctgcggct gctgcccggt gaagtggtcg
   101821 gcttggtcgg ggagaacggg tcgggcaaat cgacggtcat gaagatcctg gtcggtgacc
   101881 tgtctgcgga cgcgggcact gtcacgcggt cgggccggtt ggggtactgc ccgcagcaac
   101941 cagtcctgta tgagcggctg acctgcgatg agcacatcga attgttcgcc cgcgcctacc
   102001 ggatgacccg cgaagctgaa caccaggcgc ggcgtgagtt gtatgccgcg ttgggattcg
   102061 aacgctacgc gagcactcgc gccgaccggc tctccggcgg caccctggcg aagctcaacc
   102121 tcgcgctggg gttgctggcc gaccccgagg tgctgctgct ggacgaaccg tatgccggat
   102181 tcgactggga cacctacctc aaattctggg aattcgtcgc cctccgccgc agcaccggcc
   102241 ggtcagtgct catcatcagc cacttcgtcg ccgacgagca ccgcttcgac cgtatcgtcg
   102301 aactgcgcga cgggcgggcg gtcgaacgat gaccgcggta gcggcggtcc cggccccgcc
   102361 acgaccggcg gtctggccgt ttgtgcggtg cttcgtcgaa gactacttcc gcaacccggt
   102421 caacctgatc gtgctgctgc tcgtgcccac cgtcttcgtg ctggtcgcgg ctggaagcat
   102481 cgcccaggcg atggaactgc tgggccgcag tctcggatcc cgcccggccg tggagacggc
   102541 gaccgctggg tgggcagcgg cgttcctgtc cggtatcgcc atgtatttcc aggtccgatc
   102601 cgcgcgggcc accgatcggc ggctggtgct ggccgggctg tccccggcgc ggctggtcgc
   102661 cgcgcgagcg gcggccgggc tggtgctggg ggtgctcgtc tcggcggtgt cgctgctcgc
   102721 actcacagcc cgcaccggta tcggtgaccc gatccgggtg atacccgcga cggtgatgtt
   102781 cgcggtgatc tacctggcga taggcgcggt agtcggcata ctcgccacca acccggtcaa
   102841 cggggcggtc gtgatcttgt tcgtgtggat tatcgacgtg ttcatcggcc aggtcggcga
   102901 caccaccgag cagatcagcc gctggtttcc cacccatttc gttgcccgat ggatggtcgg
   102961 gcttccaacc ggccacgccg gacgccttgg tgacctcggc gcatcactgg tctgggtgac
   103021 cgcggccgca ctggtcgccg cggccgcact ggtcaccagc tcccgcacca ccacccgccg
   103081 ggctgccgga cagttgcgca ccgctctgcg cctgggtgtg gtggagctga gccgcaaccc
   103141 ggctctcgcg gtgttgctga tcgtggttcc cgtggtcttc gtgctcctgg ccgaaatcac
   103201 gaccccggca cggtccatcg tgatgcccct acgcgagaac ggcgcaaccg tcacctcgac
   103261 gttctggttc cctgaggtac acgccggaac gatgacaccg atcgcggtcg gctccctggc
   103321 cacgctggcc ggactgttcc tcgctctcga cgccgccgac ggcgatcgcc gactgcggct
   103381 cgccggatac cgcgctgggg tcctgctcac ggcgcggctg ggagttatcg cgatggcggt
   103441 actcgtggtc accgccgcgg cactcgcgat caccgcgacc gtattcgacg cccgccaatg
   103501 gaccggatac gccgcagcga atctgctact ggccgcaacc tatgcgctca tcggggtgat
   103561 catcggaccc ttgttcggcc gggtcgcggg ggtgttcgtc gccttcctca tcccgtttct
   103621 cgacctcggt ctggtgcaaa gcccgatgct gcgtcccgaa ccccagccct gggcgcgcac
   103681 cctgcccggc tacggcggca gccgcgtcct gatcgacacc ggcctcaccg atcacttcga
   103741 cgagatcggg gcactgctta tcgcactggc ctggttgacc ggcctggccg ctgtcgctgc
   103801 gctgctctac atcgggggat acccatccca ccgcagtatc cgattcggat cgtcacatca
   103861 ataggctgcc cgagagatcc gacgcttcca acatggatga cgacaccagg aacccgaggt
   103921 gccgaccccc agctcaacgc atcacagcga tgacaggtca gatcactgtg gggctgtggt
   103981 agggcctgct cctacttcct cagcgtcgac taccgggact ggaaactcga cgacccgtag
   104041 ggaaggcgtg ggcgccggcg acccatttgg gacgagatcc gcaggctcat cgaagaactc
   104101 gtcgccgaac cgttgcccac ttgcgcctga ccgcacgccg ctttccgcgc ctcgtggcgg
   104161 agcggagggt catgtcgagc tactttgcgg cctcatgccg gcttccggat gctgggccgt
   104221 gttgtcagct cgtgtgcgag gcgcgccgtt ggagaatggt gacttcgtgg ggtccgccgc
   104281 gagaagacgg gcgttctcag tggccagttc gtggatgatc tgtgcgtaga cggccacctg
   104341 ctgctcgagt tcggccttgt cggcgcgcag ttgctcgttg cgggcggtca gatcgatgac
   104401 gcgggcttgc agatgctgat aggcggcggg gacgccgttg gcatgggctc tgcgtgacag
   104461 gaattcctct cgcaggtcga tgtgcttgtg ggtcagcacc cagcgtttga cgccggcttc
   104521 ggcggcgagc tggagtacgg tcaacgcgcc ggtggagttt gtcggttcac cgggcgagta
   104581 ggcgttgcat ggctgcccga attgcggcgc gttcgtcgct gtctgatggg ttcacgcgct
   104641 gttccgatgc tcggcgatga tcttgtcgat gcgggtcagc tcacggcgtt cccgcagggt
   104701 gcggatcggc ggtgcgagcg gatcggccac gatgagacgc agttggtcgg cgtggcggct
   104761 cagttcggcg atgtcgcggt cggttcgggc gatgttggcg caggtggggc ggcaatcgtt
   104821 gacgtcgggg gtgcggcgag tgccctgctc gtcgctggcg agccgacacg ctgccttcgc
   104881 gggatcgagg acacaggtca tcgcgttgcc cttgtagatc tgaagatcgg ggttcgccag
   104941 cagcgctgcc gcgtcgcggg agctgcgcag gactcgaccg gcgaaacggg tcgccgactc
   105001 gacccgttgg cgatagacct ccgccgcggg gcccgagacg tgctctccgt cgcgtagacg
   105061 ctggtgggcg tcggcgcgat tgtcgagccg ggtgagccat tcctcgaaga cgaggtcgtc
   105121 gggaaatccg gagtcgtagc tgccggcgta tccgagggtc ataccggtgc ggacgtggcc
   105181 gtactggatc gcggcggcga ccaggccgcg ggggcgtcgc acgatgaacc acgccagcgt
   105241 gcgacgtagc cgtccgagac tgatacttgc cttgaccggg tcgggcggga tcgcgtcggt
   105301 tcggccgtgc tcggcgcaat agcggttgac ccagtcgagg agcgcctcga tgtccctggt
   105361 catcagttgg tcatttcggg cggcgtggac gactctggcc ttgagccggt cgggtgagga
   105421 gatgccgttg acctctatcg tattcggaaa cagcagcgca gagtcgtgga gcctgcccac
   105481 gacctcgacg gcaaccgcga ccggttccac cacgacccag ggatcgacgc ggtactcgcc
   105541 gtcgggtacg gctgcgccgt cctggccgcg gacccccttg aagtgcttgc cgcgcaacag
   105601 gaccaaaccg gtggccgggt cgcggtcgat gcagcagcgt tccaggttca gggtctcgcc
   105661 gggccgttgc ccggacaagt aggcgatgac gacgaagcag gctgtcgcca ggtgacgcgc
   105721 caggatcgga gcctgcaggt aggggatcga ccgactccgc cacggacgac cgtcgagcac
   105781 agcggtgatg ggcgcgaaca ggtaggtgtc gtcatcgatg ggcatctggc cgcgttcagc
   105841 gaagagtgag gtgatcgact tgtgggcaac cgggatgcct gcctgcgcgc tcagaaagta
   105901 ggtgttcacc agcagccggc cgtccgcggt gcgtcggccc gggagagcca gaccgcgtct
   105961 gcggtactcg tccagatgcg cggccaggag ttgtctcgcc tcgccggggc gccgccgatg
   106021 actgtagatc tcgtccttgg ggacccgggt ccgtcgggcg cggtaggccg cccccgacag
   106081 ttcgaggtac tcggtgaacg ccgcgatgat gtcatcggcg aagacctcga tgaacctcag
   106141 cgaccacgcc agcagggcgg tcatggtgtc ggggtgcacg cgtaatgtgc ggttctccgc
   106201 gagttctcgt gactggccga gaacgtcgcg gatacggtcg ccgttccacg gcgggccttg
   106261 gggtagccga tcggctgggc agagtcggtc ccgtaccgac cacgcccgca cgaccgctgc
   106321 gagtaggtcc tcacgctggc tgtgagatat ttccgcggcg cggacatcta tggcgtaggt
   106381 gtccaggtcg gcggcagtga catcggcgaa gcgggtgatg gcgcgtgcgt gcagccattg
   106441 ggtgaagctg cgcaggaatc gcgagacggc cgacacgctg gacaccgaca gccgggcagt
   106501 ggtgaaccgg tagttcacgg gctggtcggg ctcggcgttg agcagcagcc acacgatctg
   106561 tttgaccggt agccggaact cgtcgggcac ctgggcgaag tcgacggcca gcgccgaact
   106621 gtggtgttgc aggagcccgg gactcagatt ccatcggtcc tgaccgaacc gggacaaggc
   106681 atgctggtcg gtgccgggac gcagcgatcg gttgagcagt accacggtgt cggggctggg
   106741 tagatcatcg ccggtcggag tgagtgcggt ggtcactgta agtccagtcc gtgggtgaga
   106801 aatcggtcga ccagcagccg atcgaaacgg gaggcgttcg cgcgggcgtc ggcgaccgcc
   106861 gtcgtggtgt gttgctcgag aaggtcgagc agcctggtcg cggggtcggc gaagcgctca
   106921 gcccatgtca gcggcgtcat cccgggccta cgcgcgagca gtgcgtcgtg gacgaggacc
   106981 tgcaccggta ggtgcgccgg tgtcgctcgc gcgcacggac acgataggca cagcagaaac
   107041 gaagcctgac acggctttcc gggcggcgag tgcgggctgt tgagattgtc ggtgcacccg
   107101 gccaccacgg tgtcgagcct gccgtcgacc agttcggtca acgtctgcgc tgagactccg
   107161 aacctggcgg cgacaccagc ggggtcggtg cgtgcctgcg cgatgtcttc ggaggacagc
   107221 acggggattg tggcggcggt gcgggccttg gcgacctgtt cactcaacac gtcggcgacg
   107281 acctgttgat actcggcgag attgccgcga ttgcgcgcca aatactcgtt caccagcgtg
   107341 atctcggtgt gcgcgaccgg acgctgatac cgctcaagga acgtcaggcg cagtcgccga
   107401 gaccgcactc gcaacacagc cggtgcgctg gtgtcgggat cggcgatgtc ggtgggcagt
   107461 ttcgcgtcct cgccccagaa cagcaggatc gatttcggga cctgtacccg gaacccggcg
   107521 atgtcgcgtc ccttgccgtt gcccttgtgg gtgaaggcga cgaagaggcc gtcgctgccg
   107581 gtcttggctc tgacgcggtg ccccaattcg agcagcagtg tgtagagccc gaacggtgta
   107641 gtgaggtcat cgcgtccggc aggccgggca ccgtccggtg tgaggtcctg caacggcacg
   107701 gtcatggccg cgcggcgggt tccccggcgt ggcttgagcc agtcgaccag gatcgtcggc
   107761 gcagcaccgg tgtcggcgtc ggtccggtgg tggtggacgg tggcagcgcg gatagtgccg
   107821 aggttgtggc cggtcaagcc gatcatcagc gccacggcgg caccgatttc cagataggtc
   107881 ggatacaggt gcgccaacac ggtcgagctg ccgccatggc gactgacgac ggcggcctga
   107941 tgcgctttac cggccgcagg ttgtactgct ccggcgcgcg gcacatcacc ctcgcggtcg
   108001 acgtagtcca acagccaccc caattcccac cgctgtgcgt cggtcacctg gtcgacccgg
   108061 tcggcacgcc aatgctccag caggcggttc gcggcgcgga ttcgcctcgc cgcggcgcgt
   108121 agctgggagc gagcgtgagc gaggatgcga ttgaattccg cttcggtgta gcttgtttcg
   108181 cgttcatcgt tcttggcgac ccgggcggtg gacagacggg cggcgaactc ggcgggaaca
   108241 tcgggagcga accgaagaac cgaacgtaga gtggccagat cccggtgcaa cgtggttccg
   108301 acgcctccgg acaggatgta gccatccaaa tgtacagccc gcagcccgtt gggcgacagt
   108361 ggcggattgt cgagaccggc gagatagcga gcgaaccgta gaaacgtcga cacgatgtcg
   108421 gaagccgatg tcgctgttcg acgcgggccg gacggtcggg tcgcccccgc agccgcggtg
   108481 gcgaaccagt tgcgcagttc gcgtggcact ggcaggcaca tgaagtccag gtcgacatgg
   108541 tcgccgccgt tctcggggaa gaaacgcact cggcactcgt tgtggccgag gaacaatcgc
   108601 tgcggtgtcc ggtacccgag ggcaggctgg acggcggccc gaccgcggct cacgcgccga
   108661 ctcccgcggg ccgagtgatg acctgagggt ggcgggagaa catctccgcc atcagtgcag
   108721 acatccccgc accgtgggca tgctcgataa gcagtgacac atccaagtcg cggaacggct
   108781 ccaaatacac atccatcgtg acggcgatgt ccgcatgacc tagcagggtc ttcaccaggt
   108841 accaggtgtc gccgaactgc gcacggaagt cccgcagctc ctcgctgctc aagtgggcga
   108901 atcgctgttc gtagatcagc cttcccaccg agaaccagcg cagcgcaaac gaatgccgca
   108961 gcatatgcgc ggtcgccgac accgacccca gcccggcgcg tgcgagccgt tcgttggcct
   109021 gggtgaacgt gtgctcccac ccagccgcca gacgtggtag cccggtttcg ttgagccaca
   109081 acgaaaccgg ctccaagccc gtcctggtct gccggaaaat ccgtgcccgc gttctggcgt
   109141 tgagcgtgtc cagcgcgacg tccgacacgg cgccgtcgcc cgcgcggagc cggacgcggc
   109201 ggccgcagtc ctggcccacc agcagcaacg ggtcactgac ctggtcgtag aggcccttcg
   109261 ccctggcacg gccaaccgca gcggcgcggc cggactccac gtaggacagc acatccacca
   109321 gcaccgagcg aggcatccaa tacctgcggc cccggccacc cttgccgcac gaggacgcga
   109381 gccgacaggt gtaatagcca cgcgactcgt cgtccgcggg aagctcgacc gtcagcagcg
   109441 ttgcccactc cgacagacgc aggccagtgc catacaggcc atcggtgaac gcgcagtcgc
   109501 gctgagagtt tcgaccgcgc caaccacgca gctcgcggcc actgcggtcc aaaccccgca
   109561 agccgagatc acgccagcac gcatagccgc cctgatccag ccacttcaca tcccgatccc
   109621 gcaccacatg cggcgtcgcc acgaacggct cggcccgccc cagaggacct tgccgaggcc
   109681 acgaggccag ccgacgatca accggattgc gtacgtccaa ccgttcctgc gcccactcat
   109741 agaaggcgtt gatcgcctga atgttgtcgc tcaccgacga accagcgacc cgcaacggat
   109801 tggcctcatc agtcatgcgc cagaacttga acgcatccac gtcctccggc ccgacaccgc
   109861 gccaacatcc acccacggca tcgaggtagc ccagccacac gcacagacca cgcgcgtact
   109921 tctctcgcgt gctggccgag cggttacgca tacgccgcga cgcgaagaac gcgttgacct
   109981 cgacgaccac ccgaccgtcg ctattgatca gaaactcctg cccctccacc gtggcgttgc
   110041 gcgcacacag ggcggcgacg tccagccctt cgggcagagc gagcccaccc acaatggcgg
   110101 accggccgat gtaatagctg caccgttgca gccgccaaac acccggcacc gtcgcggaat
   110161 agtcgtcaga tcgcacgagg cgtaactctg gcacggcgac taccaccgac acaggcactc
   110221 cccgatcatc ggcccagcaa caactggaaa ccggctaaag acccatgcca taggacagca
   110281 cgactcgggg cgcaggttcg tgcgcggcga gctgcttccg cagtgccgcg gacacggcgg
   110341 gcccggtcac cggttcgccc gatcgcggac gcgcagtgcc accccgcccg agcccggcgg
   110401 gcaggtgcag cccgccatgt gcagctcgtc ggtgatgcgc cgccaggtgc ggtagtgccg
   110461 gagtccgctc tcgacggcca ccgcaccggc aaggaacatc aggctcgaga tgatcgcggg
   110521 gaactccgac gtcaccgcgc cgagggcgta catcgagccc ccggccagcc agccgctggc
   110581 cacaacggcg tgtgcctggg cgagccaact ctggtcgtgc tgttcgtcgt gacgtcggtc
   110641 gtgctgaaag ctgttcacgg gaaaactcct cggagtgcgc gagtggggtg tgtggtgggc
   110701 gggtgagcgc gccgtgtccg gctcggcgtc ggcgccgccc gtgacgagag agcgcgtgcg
   110761 gaagtcggcc gtgaatcggt cggtgagccg cgccagcaga gcgagcagtt ggtcgcgggg
   110821 aacgtcgacc gactggaagg acccgccgaa gcgcaccgcg tcggcgtccg gggcgatggt
   110881 gagtcgttcc cggccgtcgc cgaggtcggt gacctcgagc cggtctccgt cggcgtcttc
   110941 gaagacggtg tgtggcatga cgcggatgct gtcaggcagg cccgccgggc ggacgccgtg
   111001 gcgcagcagg gcgacggtct cgagcgtcag cgcgctcgcg gtgcgcagcc ggagttcgag
   111061 ctcgtcgcgg aacggggtgt ccagcaccga gaaccacgcc cccgcgtccc ggtctttgcg
   111121 cgacatcacg cccgcccctc gtcggtcagc gaggcccacc agccttcgac gaggccgtgt
   111181 gctgtccagt ccgcgagctg ggcatgcgcg caatcgcgat gtgcgaccac cgccgcggcg
   111241 cgctcgaccg ggtagcagtg cgaatgcgtc gagcagccct gagtccaacc gggtacgtcc
   111301 tcgacgagag cgtcgaattt ggtggagggc attgccctgc tcccttcggg ggatatgcga
   111361 gtggggagcg gcgggcggaa gtgtccggtt tccgccccgt cgcttcgggt gacggaaagg
   111421 gtcagaaggg ggcttcgtcg tcgccccacg gggcgctcgg gtcaccgcgc ccgtcggcgg
   111481 gctcggcgtc cccgccgtcg gggttccagt cgtcggggac gccgacggcc cacaccacgg
   111541 ccttggtgat gtggtcccag gtgacgttgg cgagggcctg gacgttttcc aacgagctct
   111601 cgtcctcgac gcggacgccc gccgggatgc gccacaggtc gccccggaag tcccaagccg
   111661 agccggaatg ctgggtcgca gcgctgactt cctcggccgc ccaggcgcgg gcgtcggcct
   111721 cggtgacgaa ttccctctcg tcgaggaagc gccgctcgga cgcgggagga acgtcggaga
   111781 agacgacgta gaagcgatcg tggtccgcga caaccgctgc cagaggactc atgggaatgc
   111841 cctttcgtag ggtgcgagtg ggatcgaaga aggcggggtg tccggtcccg cttccttcta
   111901 tgtcatatat tacccggtat atccgaaagg tcacgcactt tccgatgggc gagttggatt
   111961 ggttcccgcc cgatcggtct cgggcgggaa gtcagtcggt gctgtagggg tcccggtgct
   112021 gggccggggc gcattgccga cggcgcagca cggcgagccg tcgcgtgtcc tgcgatcgga
   112081 cggggctcga tgggcgcgcc gccgggcatc cctccggttc gccgagcggt gcggtggcag
   112141 acagaaccgc gagggccgcc tcccagcgat cggcccggtc cgccgcccgc agctgcaccg
   112201 ccagaacggt caggctcgcc gcgccgacac cgacggcgac cacggcgagc ggcgcggaca
   112261 acggcatggt cgccaccgcc cacaggaacg acagcgccgc gaggcagccg tgcgccgccg
   112321 acagcgtggt cgcgccgggt cgctcgccgg tggcggggaa ccgtcgcgcg tctcggcggt
   112381 aggagagcgc gagcgcggcg aacacgacac ccggcccgcc gaggagcagg gccgggacgg
   112441 cgtacgaggc ggacacagcc gtcagctccg cacccgtgcg gcggctggcg cgcccgcgtc
   112501 ggcggcagcg acccggaccg gatcggctgc ggcggacggg ccgccggaac cggcgggggc
   112561 cggatcgggt tgcgtgacgg cggctgccgg agtgaccggc gtgcccgggg aggccgactc
   112621 aggttcggag ttctccgccg gcggcggagt cagcggcgct tcggccgcag cggtcgacgc
   112681 acgtgagggg cgcggccgag gcttggcctt cgcccgcttc gccacagcgc ggatagcgtc
   112741 ggtgggcttg agtccgatcc gttccagcgc ggccgcctcg gctccggcat tggtggccgc
   112801 ctcgtaggca gccaccacgg catcctcggc agcttcctca tcggcgatca accgcgctgt
   112861 ctcggcccgg cgcgtctcgg acgcctgctg ccattccccg accttcaccg cgagttcgcc
   112921 gatgcgcgtc tccatatcgt cgtcgatgac cgcccgccgg tacgcggaca gagcatcggt
   112981 cgccatcttc ttcgccatgg gaaacctctc gtcgctcagc gctcactaat ggagcgatcg
   113041 aatctagtgt atctaatgta tctacagaac ggaggtggtc aaccatgcga acgggagtcg
   113101 ggggcgtgcg cgcctcgccc gacgggtgtc ccgttcgttc agtctgcgca ccggggcggg
   113161 ctgggaccgg gcgcccgcag cctcgatcca gcccccatgt tcgcggcacc ggcctcgtcg
   113221 cgtaccgcgc ccgcccagcg aacgaaagcg tttcccacgt ggactcaccg tgagccgcag
   113281 cgtggctgac cagccttttc agttagacaa ccgtcttgtt cgctgccgtc cggcattact
   113341 cgaatgtcgg tgtcgtgcag cgcagcagtc gtttctacct atccgtgcac gtcgtggtga
   113401 cgaatgaagt tctgtcactg tggtcggcgg gatcgctgcc ctggtgaggg aatttcatcc
   113461 acgatgaaca tcgaggggtt gggttggcac tggcggtagt gcggtcgctg cgcgagacgc
   113521 gcagtttggt gaccgacgag gagctggccg attttgagct ggatgtgctg tcggagttcg
   113581 tgctcgcgcg ggcctcatcc ggcgttggag acagcacgat ccggggcgac accacgcatc
   113641 tcgggcaggt tcggcagtgg ttcggccggc cgttgtggga gatggaaccg caggacgcgg
   113701 atcggtactt cggcacggtg ctgcgccggg tgtcgtcgtc gaccagggcg gcccgagccc
   113761 ggaccgtggt gtcctatttc gagttcctcg agatccggta caaggtcgtg ttgcacgaga
   113821 tgaccggccg tgtggtcgag tgcccgatcg acgaggtgaa ccggccccga atgtcggtgg
   113881 acacgatggt gcggatccca ccgaccgagg ccgagctgga gcagctgttc acggggtggc
   113941 gcgaggatct ggtgacctgc cgcaagttcg cgccgagcgc ccgcaactac atggtcgccc
   114001 gtctggcggc cgatgtcggg ttgcgggtca acgaggcgtg catgctcgac ctcgacgaca
   114061 ttcgatggga gctgggcagg ttcggcaagc tcaacgtccg ccacggcaag ggcgcgttcc
   114121 gcagtggacc acggcaacgg ctcgtcccgc tgatcaacgg ggcggacacc gcgctgacct
   114181 ggttcgtcga ggacgtgtgg gcccagttcg acgctgacga gaccttgccg cgcgcaccgt
   114241 tgttcccgtc cgagcgccgc cgggcgggca gctcgggcac ccgggttacc cgggacgtga
   114301 ttcgtcgcgc tctgggtggt gcggttgatc gccacctgcc gacctggtcc gggcggctca
   114361 ccccgcacgt gttgcgccac tactgcgcca gccagctcta ccggaccggt gtcgacatcc
   114421 tcgcgatcca ggaattgctc gggcattcgt ggatcaccac gacgatgcgc tatgtccacc
   114481 cctacggaac ccgggtcgag gacgccgtca cggccgggca caaacgcgcc gccgcacgct
   114541 gggaaggact gatccgatga agtggaacct gcgcctggtc gccgcgaacc gcggcatctg
   114601 gaagtccagc gaactgcgcc ggatgctcgc cgcgcgtggc ctcgagatca gcaccggcaa
   114661 gatgtcggga atgtggtcga gcacgccggc ggtgctgcga ccggaggaac tcgacgtgct
   114721 ctgcgcggtg ctcaactgtg ggatagccga actcatcacc gccgaaccgg acaccgtcgc
   114781 ggcgccgact gatgccgggg agcatgtccg ggcggtcgga gatcagggcc cggagtcggt
   114841 ccggcggatc gttccgaagc ccaggacggg ccggtccctc ccgccccgat gaccgccacc
   114901 agttgccggg aatgcggcgg tcggatcgag gcgagtacgt gtccacgtgg cggccgccct
   114961 cgccaatact gcctgacctg ccgaccgtca aagacggcag aacgacgagc cgaaggcgcg
   115021 aaagactacc gagacggttc gtgtgttggg tgcggcacgc agctcgaacg cgccgcccgc
   115081 acgatcggac gcccccggat ctactgcgac gcatgccgcg gccgccgggc ccgcacccca
   115141 tcccggtccc gccgacgcaa cgacgccggg cctgcccagg acaaccgttc ggaggcatat
   115201 cgggatcgtc gatgcactcg ctgcgacgcc ccgatcgagg tcgacggtca acgaaagggc
   115261 cgtccccgga tctactgcga cggttgtttc ggccgccggg tccacgaaca gcgccgccac
   115321 cgaacgaggc cgcgctcgct cgatggtctt cggttcgccg aggtcttcgg cacaatcact
   115381 ggccgcgtcg agcacgaagt tctggagcga ctgttcgaca cagcccgggt cggccgctgg
   115441 agcgtcgcaa cggtgcagcg caggagcgag gagttgcgcc gcgtcttggc caccgccggg
   115501 gacgaaccga tctccctcag ccaggtccgc gccgaactcg gcaacgtctg gcagtcccgg
   115561 atcgcggctc gggtgctcga ccagtgcggt ctgcttatcg acgacaccga gtcaccgaca
   115621 cggcagtgga tcgaccgccg caccgccgag ctcccgccgg gattccgtga cgatgtccga
   115681 gcctggctgg tggtgctgca cgagggcgga cagcgagccc ggccacgggc ggaggcgacg
   115741 ttgcacgcct actacagtcg cgtacttccg ccgctgaccg aatgggggag cacccgatcg
   115801 cacctgcgtg aggtcaccca ggccgacgtg tccgtagcgc tgaaccggct gaacgggcac
   115861 aagcgggtcg ggacgttcgt cgcgttgcgt tcactgttcc ggttcgccaa acgacaccgg
   115921 ctgatcttcc tcgacccgac ccgtcgcctc cgtgctggcg ccgcaccgtc gcgggtgctg
   115981 ctgccgatga ccaccggcca ggtcgacgcg gtcaccgcaa cagccgtgac acccctccag
   116041 cgcgtcgtcg tcgctctggt cgcggtctat gccgttcgcg cgcacgcgtt gcgacagctc
   116101 gtgctcgacg atctcgacct agcgcgtcgg cggatccgga tcggcggctc tgttcaccag
   116161 ctcaccgagt tcacccacga cgttctcacg gactggctga cctaccggca acagcgatgg
   116221 ccgggcaccc cgaacccgca cgtgctggtc tcctccgatt cggttctcgg caattctccg
   116281 gtcgaggact actacctgac ctggcatctg agcctgctcg gcatccagct tgaacacatc
   116341 cgcggtgacc ggatcctcga agaagcgctc tcgacggaca ccgacccgct gcacctgacg
   116401 atcatgttcg ggctctccga gaagtccgcg gccgactacg ccaggcttgc ccgcggcatc
   116461 acggagcggc ccatcgaggc cgtcagtcac taccccgccg actgggactg atggaggcgg
   116521 cccgctgccg cggccgcctc cctgccatcg tctcgatgcc ggttctgccg aaaccggacg
   116581 ccttctcgca cgccggatcg cgaaacacgt tgggttcccg ctgaaacacc ttcactctcc
   116641 gtgaacccac tgctttccgg tgagcaagat atcccaaaac cccggggttt tgggttgcgc
   116701 ccggggacgg gcgcgggaca cactcgaagt gattcgagtg tgtctaaagc ctccagagga
   116761 tctggaggcg ccgatgtacc cagacctgcg gtccggccac atcggctggc ccggcaggcg
   116821 actgccggcc ctgcgagcgc accagtgcgc ccggtaggcg aaaggacgtg aagtgccccc
   116881 gaagagcaga cagggccatc ggcctcactc cgttgagaag cggacgcgcc gccatgaggc
   116941 gctgttcgca cccgcggagt gggcactagt ggccgccgcg gcggccactg tcgggctgaa
   117001 gcctggcgcc ttcatcgcca aggcagccgt tggtgccgcg cgtgcgttcg ccgcacagcg
   117061 caacggctca gccgtccgca ccagcggcca ggtggagatc ctcatcgccg aggttcggga
   117121 gttgcgccga ctgctgggca acgtggccgg gaatgtgaac gacgtcgcca agcacgcgaa
   117181 ctccaccggc gaactcggcc agaacgcaga cgcggtcctg gcctataccc gcaagatcaa
   117241 cagccgcatc gacacatggc tggtcgaaca gcttcggcac ggtgcgctgt gatcggcaag
   117301 gcgatcaggg gatgggacgg gcagcggctc gtgcggtatc tgttctcgaa gggcaagtac
   117361 aacgagcaca ccaaccccac cgtgatcgca gcgtggcaat ccgaccccga cgcccttcaa
   117421 ccggtatggg tcggccccga cgactgcgac ttcgcgcccg gtgagatcgg caaactcgcc
   117481 aaccaggtaa ccgccctgtc ggacgcgatc gggctgccca ccgaacagcc cgagcccggc
   117541 cagccgggct acaccaagca cggttacatc tggcacctgc cggtggccat cggcgccgaa
   117601 gacggggaac tcggccacga cacctggcgg cgcatcgccg aggacatgct gcacgagacc
   117661 gggatcgcga aagcgggcga cgccggcgcg tgccggtgga tcgcggtgca ccacggcaag
   117721 tccgtcgacg gcaacgacca cattcacatc gccgcggtcc tcgtgcgcgc cgacaccggc
   117781 aaacgcttct acccggacaa cgattggaaa gccgtacgcc gcgtcgcccg gcgctgggaa
   117841 caagctctcg gtctgcgaat gaccgccatc aacgatccgt cggccgtgcc caccccgacg
   117901 cgcggggaac aggaaaaggc gaagcgccgc cacgccgccg gcgacgacgg catgctgcga
   117961 gcgacaccag gtgccgcggc acgggtacag ctgcggcaga tgatcaccga gaccgccgcc
   118021 atcgcgacca gcgccgacga attcgttgcc cggctccgcg acgcgggcat gctcatcgac
   118081 ttcaagtacg acgccatcgg gcagatcaag ggatgggcgg tcgcggctcc cggagatgtg
   118141 tcggcgagaa ccggcgagcc catctacttc gcgcccagtc ggcacttggg cgcagatatg
   118201 tcttggccgc ggatcaccgc ccgctggtcg gcctccgtgc ctagccgccc cggcgccgcg
   118261 cgggaagcgg ccgccaccga gacagcacgc gagccgcatg cagtgctggc cgacagcgct
   118321 gagcgggtcc ggtcggtcac caccgccgtg cgcggtggcc gcgccgacgt ggcgaccttg
   118381 gcccgcgagt tgcaggacgt cataagcagc tgggcatcca tcgccgacgg tgcggcgcgc
   118441 cagggcccgc tctcccgggc cgcctgggtc tacgaccgcg cggcccgcac ccggcgcggt
   118501 ctggccgccg ttcccgccgg gcaactcgcc gccgaactgc gtgaggtctc gcgcggactc
   118561 gctgcggttc gaatgctgtc cggtcgcggc ctgcaacgag atccgagcct gcaactcggg
   118621 ctcgctatcg ccgaactgtt gctggagatc gccgcatggc accagcagaa ccagcgcatc
   118681 gctgccgccc gcagtgcccg cgaagccgtc ggcctggtgc gcgcgcacgg ggaggccacc
   118741 ggtgccgtcc cgggccagct cccgccgcgg cgcgccccgg cgggcaccgg gcacacgccc
   118801 accgtcacag cacaccccgg tccggccgcg cggccgggcg aaggccgccg cgaactgcct
   118861 gcggtgcgcg gcgtccgtga actgccgtcc ggcccaacaa ggaaggaaca ccgacgatga
   118921 accagccggt cattgaaacg cccgtgatgg gcatccctcg cgaggacacc atgcgcatgg
   118981 cactggcagc acgcacgctg tcgggagtgc tgaggcagct acgggaacgg cggggccgct
   119041 ccgcctggga cgacgccgag aacgccgccc gcaagaacgc ggtcatcgac cgccacacgg
   119101 tcaaccgatt cagccgggcc gacgccgagg aatggaacac cgcggaaagg gaaggccgca
   119161 tccgagccga acggcacccg gataccggca tgacaattcg tgtggcccca ctctcgcgcg
   119221 gccgattcgg ggtgcaagct ggatgggagg acaaccacgc cgaggccgtg gtcggctccg
   119281 aagatctcgc cgcccgggtg gccgactggc tgcgagccga cggctcagcc gatgctgtcg
   119341 acgatctacg ccgcaacgtc gaggacatgc acgccacgtc ccggccacgg cggcaacgca
   119401 ctctccgaga catcgagctc gccgaggccc gcgaatgggc gaaagagaac gatgccgact
   119461 ggtaccgctg gtgggagctg agctacacca acgccgacac catcgatgga cgccgcctcg
   119521 acgaggccga gatcatcaac aagtgggtcg acgccaccgg tggcgtcacc cgcagcgccg
   119581 tcggcgtggc tcggcgctgg ctggccgaac acgatccaga gtggaccaag aactgggtag
   119641 ccgaatacga caactgcgac acacgcgacg gacgccgcag cctcgaagct gagatcgttc
   119701 gccgatggcg cgcccagtcc cgcgctgggc gtggacgtgg cggagccggc caggagtggg
   119761 gggccgacac cggtgccgcg gaacagggcg gtgattcaca ggaccggagc actccgaccc
   119821 cactcgcgga ccggctgagg gggcgagtgc ccgatcgtgt tcttgacgat ccgcgttggc
   119881 atgtcgccga ggaccagttc gcggtgctca cctcgcaggg cgctgacccg gacaccctga
   119941 tcgaatccgt tgccgcgatc gacttcaaca acggcaagat tcgcgccccc agcgggttcg
   120001 cggcatgggc aatgcgcgaa gccgcgaaga aggggaaagc agccaacgcg cacacccgca
   120061 gcgaggaaga tgctcgccgc tcggtggcag aggaatggct catgagtgcg gacccggact
   120121 caccgttcga ccgagcccgc gcggcgcagt tggtcggcga gatcgacgat gacttcgacg
   120181 ccctgctcgc ccgcaagtac ccgggcatcc tcgatggcga tgccgagcag gcacgagcca
   120241 aggccgcaca gcacgagagc aacgccgata ccgctgacga ccaggctcgc aaggacaaca
   120301 ccgcggccca gcagacggac gaggccgagg ctgaggacac ggtattcgtg gtcgacagcg
   120361 acggcaccgt catcaccgtg ccgttcgttc cagcaccgga acccccgccc gaagccgaag
   120421 ccgaagcggc cagccacgcc gccgacgccg accgcgagca cgaggccgcc gactcccaac
   120481 accgcgccgc ccgcaccgcc gaagccgcag cgcaggctcc gctcacccca cccaaacaag
   120541 ccaaatccaa cgccaagacc cgtcggcgaa ccccaccgcc ggccacaccc gcggcgaccc
   120601 acacccggaa ccggggccgc gcgcactgag gccgccacct catcgtcggg tggcccgcgc
   120661 gggcgagatc ctgccgcggg tcacccggga tcagcgtcgc cagacagaaa cgcccgcccc
   120721 tcatctgtgg tgcttatgct gggcactgag cagtggaacg cgaatcactg gctgctctgg
   120781 gacatggccc tcccctccgg ccatgtacac gaagatgccc atcggttgaa tccgatgggc
   120841 atcttctttc ctcgtccagt cccagcgagc cggggtcagc cgccggggcg gctgcggtca
   120901 caggatcgcg cggaactcga tggtcaccac cacgctgacc agatactcga tcggtgcggc
   120961 gagcagcggc acgatcgtgt ggtcgatgcc gacgacggtc ggcgcgtagg tctcaccggt
   121021 cagggtggtc tcttcggccg ccgccgtgcg agcacgctcc tgacactgtt cgacaagagc
   121081 ctcgacgcta tcgggaatct cggcggatga ggagacggtc cgggtggccg cgtacgcgac
   121141 cacatcgtcg tgcagggaag tcgggctgct catgatctcg tgtccttaca tcgaagggat
   121201 tgggtcctcg gcccacgccc ctcatagcgg gcatgcgccg gagtcgggga gggttcagcg
   121261 gtcagcgctg gtgacagtgt cgatgaacgt gcgcccgtcg cggtggacgg tggtcacgtt
   121321 ctggcggtag gtcttggtct cgccggatgg cctgcgctcg aacacctcga cgaggtaccg
   121381 cgcaggttcc agttcggtga tcgtcaggca gtagttcgtc ttgtcgggga tggtgttgat
   121441 gcccttctgg atcgtgtccg cagaggagac gggggcctcc ggcagtacca gggcacgcac
   121501 ttgctcccct gaccgagcga cgtagtaggc gtgctggaac gcgaagatga cgggcacgct
   121561 cccgaccagc ccgccctggt tgtcgccgcg atgcaccctg ccctccgcgg tgttcgggca
   121621 cttcccgcca gcgagaaagc ccaccgttgt ggtcaccgct ggcggtggtg gggctacaga
   121681 cagagcgggt tgcggcggcg gggtgggctc caagctgttg agccccacag cgagcgcgcc
   121741 cagtccaagc gcactcacgg cggccgcaat gccgagcgcc ttgtaccgag gtcggcgact
   121801 gggcgcgggc gccggctcgg gggctttctc aacggcgtcc gccggttgga actcgtgctc
   121861 ctgttcgtcg ggctccggca ggacctctgg aatcttcagg ggcgagagaa ctggagtcca
   121921 ccggccagaa gccgggacag gtcgatcggt gttggcgttc atcctcgttc ccctttcaac
   121981 gtccgcgtcc gggagtccgc tgcggggcgg cgctggtatt tgctctactg gccggggtca
   122041 tcgacgcgcc ggcggccgcg gccgctccgg cggacggggt cagcggtccg ttcgccgccc
   122101 gcagcgcctg ctccccgcgc cgggcctctt gcaactgggc gaaggtcggg cgcccgctgc
   122161 tattgcgggc ggtagccgtc accgtcgagg tctggctgcg cgctacgggg gcggtagctt
   122221 cggcggcggt ggcctgctgc acgtagcgca gggcggcctc caccaccgcg ccagtcttgc
   122281 gggggtcacc gttgggaagt gcggcccatt gcggcgagcc cacctcgggg atctctcccc
   122341 gccgcattgc ggcgcgcaga tacgggcctg cccacgcctg taccgcatct acgctcaggc
   122401 gatccgccgt ggacggaaac cccggctgcg cagcagccgc ctcctgttct gccagcacat
   122461 cagcgcgcat aacaccgggc agggttttga gcttgtcggg acggaatccg gagaatcgaa
   122521 cgtctcccgc ctccaccacg ggcgcgccct ggaaccccat gtccagcaat cgctggcgtg
   122581 cggccgagtc ctgggtgaca tcgacgatcc gatagtcgaa cccgagattg tcgagggtgc
   122641 gcttggtggc atcgcactgc gggcactgcg gtttggtgta gacggtgatc tggacgcctt
   122701 cgcccggcgc gattgcagtc tgtgccatgg tcgtctccgg attctgttgg ttctgcactg
   122761 atttcgcggg cgctctctcg atcccgagtt cggtctctgc ttccggggcc cactgccacc
   122821 gccagcctgt ctcggggtcg aacgaccgcc ggaacacacc ctccatggcc ttctcggccg
   122881 ccgcgatggc ctcgtcggca ccggggaatc cgcgctcgag ttgctcatcg gtgacgggca
   122941 cgaactcgtc gaagtcgtgc ccgagatcga agtggttgct ggcgtccttg ccggtcgccg
   123001 cttccacgac gagcacttcc cctacacgac cgaccagcat ccgcttgacc tggagggcgt
   123061 gctggtagcc cgctgaatcg cgatcagcga tgatgattac tcgccgggcg ccggtgagct
   123121 ggcgggcgtg ctctagccga aacgaaccgg cacccattgc attgcaggtg gcgaaccgcc
   123181 cggcagcccg aattcggtcg acgtccttct ctccttcggg gaggtggatg tcttcgccgt
   123241 cagcgattgc ctgtaccacc tcgggaaggt gatacagcac cggttcgaac ccgcctttgc
   123301 tccaccgccc gccggcatcc atcttgcgct ggaagaacat cttgtcggtg ccgcgctcgt
   123361 gcggaacgtg cattcgcacg acctcgccga gggggcgtcc acggtggtcg gtgtagtggt
   123421 agatcgccgc ctggtagcga ggaccaacca ccttgccgag gcgttccttc ttcgagggct
   123481 tcggcggaac cggggcgtca cctcgtgctt tcggaacttc cggtcgcggc gctcgcggcc
   123541 gcgccggcga gccgggcacg cggacccact gccggtccca gatcgctgat tcaggcaacc
   123601 cgatcgtggc cagcacctgg gtgtcggagc atccggtgaa gcatctgacc acggtcttgt
   123661 gcttgtccgc gttgtagatc aggcccaagc tcggatcatc gtcctgatgc gccgggcagt
   123721 ggtacatcgt ccactgcccg cgcctcgatg ctggtcctgc ggggcggctg ttttcgaatg
   123781 cccactcgtc gagtgcctgg gtgatccggg caaacgacgg aggtgagccg gtcttatcag
   123841 ttctcacggc gcaccacctc cacgggtgct tatgaatctg tgcttatgaa tctgatggag
   123901 ctaatgtatc taaaacggag cctgccacag ggctgcgagt ccgccgggac tgcttaccta
   123961 cgctttgcta ctccagccag accggccagc gtcatgccca cggccgcgcc gaggacacca
   124021 cccactgctc ccagagcttt ccgccccgtc cgcctacggc ctcgcgtgtg ggccgggttc
   124081 ggatgcgcca tgttcacggc gaccaccacg accacgatca gcacagcaac gaccgggtac
   124141 accagtagaa gcgacatttc tgatgacctc ctctttcgtc gtcgatggcc aacctgcacg
   124201 tggtgcgaat gtatctaaag cagtgtcgca gtttcgccag ccggccgcaa tcatgccgcc
   124261 gaccgctgct cggtagtggc tgcgacctcg gcccactctc ggcagtaatc cagggccgtg
   124321 cccggagaga atcccgggac ggtttcttcc cagctcagcg acggattcac ggttgcgctg
   124381 aggctggggc cacacacgta ccacgcccag cgattgcctt cgggcaggcg gtcgagggtg
   124441 cgcgggtcct gcggaccgat caggaaccag tgttcgccaa ctcgcacggt ggagacgtcg
   124501 taggtcgcca tcagcgtatg cagcacacgc cgccagtcgg caccatcggc cttgaccagc
   124561 agagccagtc gcaacgcgcg gcagtaccgc aggtcagcgc agagatttcg gacccggtag
   124621 cggacggcat agacgagatc cgcagcgatg gtcgtggccc gcgcgttcat cgcgctgccc
   124681 tcctcgccgc ggcggccacc ggtgcggcct gagctgccgg tgcggcgccg aaggtgaatt
   124741 tccgtccacc ggtggcagct gctgcgggtg gcgtcagcgg accgcgggcg gccgcctgga
   124801 ttttcgacca catcccctgc cgttgcggtt cggtctggct cgcttgatgc gcggcacgca
   124861 gttcctggtt gattcggtcg gaggttatgc cgagttgttg tgtgcgggta agggcttcgt
   124921 ggaactcggt cactaccgcc gccagatcgg tctcagcctc cttggcctcg cgtgcctgtg
   124981 tcgacgcctt gtcgaagcgc tgcgccgccg ccgtgagatc agccagggca gcggcttgtc
   125041 cgggcgtaag ccacgccgag gggccttccg gctgtcgcgc ctggttgtgc atcgcgtctg
   125101 cctgccactg cgccagccgg aagggagccg aacgcaactg ccgcgtcacg gtggtgatgc
   125161 cgagacggat cgcggagacc ttctccgcga cacgagcttt gagcgcttcc atggcactgt
   125221 tgacctccca cttcactcgc accgcggccc ccggcacagc gtgcgcctgc gccagcgcct
   125281 ccacggccct acctcggtct gtcgcgctca ggtggggtaa ttcgtgaatc cgtcgctcaa
   125341 gccgagtagc ggcgtcgctc aactccgctt gcttgcgggc ccacgcctca tgctgctcct
   125401 ccttctcggg cttgaatccc gccgcgacga ccgccttctg gtggtgcagg atgtccagtt
   125461 cgagctgcgt gcgcgtgatc gagacatcca gctggcggga gcgggtgtcg ttgcgtacgg
   125521 cgcgcgagat ttcccggcgc acttgccgcg ggaccgcctc ggcggtcggg ttctgcgccc
   125581 gccacgcggc gatcgtctcc gccaccgctg cggcgagggt gtcgaactcg ggcccagcct
   125641 tcgcgtcggc catcgtcgac tccttcctct cggggatcgg tcgctagcag tgggtgccgg
   125701 tcaagaaggg cacagcaccc agagccgcta gttatgttaa tggttcgagt gtatctaaaa
   125761 catggtcggt gtcatccctg ttgaccagat cgtgcattag cgggcgggcc gcaccaaccc
   125821 ggaagtgggc gagtacttca tcgggaatag gccagcaccg tgcgcgggtg cagcaactgc
   125881 ggatcgatca cgcctccctc gtcgaggtga cggtcatagg ggatctcgtg cacggcgtgg
   125941 accaagtggt tgaaccacct cgtcgccgcg ctcgcgtcga acattcgccg gccgggctgc
   126001 tgatgggaga tcacgacgac ggtccgggac agcaagcccc ggtacagcca acggcgctcg
   126061 ccccgttcgt ccagcagtgg gtccccggtc acggggtcct tcgcgaaggc ggtgtgcagg
   126121 tactcggccg ccgccaccgc ctcgtcggcg gagtccttct tggcgtcgag ggggatcacc
   126181 agcgcatcgg cctcgtcgag aacggcctgg gtcgctgggt gggtgatccc ggttccgcaa
   126241 tcggccagca tcagcgggaa gtagtcgctc gccaggtcga ccagctggcg gtagtcgtgg
   126301 gcggagaagc tgtcggccgt cgccggatcg gctgccgagg ccaagatgtc caggcccgcc
   126361 ggtgtcagtt gcgtgtgagt gcgcacgtcc tgcacccgcc gcggccgcgg tccggccagc
   126421 agggtcaacg ccgaggactc ggtacgtgcc gttgtccggc gtgccaggtt gcccctatcg
   126481 ggattgacgt cgaacgcgat tacgccatcg gtccggcagg ctgcgaaggc gttgccgatc
   126541 cccatggcgg tcgttgtctt ccctgatccg cccttgagct gtaccactcc gatgcagaaa
   126601 tcggactcga tcgcggtgcg gattcgccgg tcgagctccc tggcgcgcac ttcggcgggg
   126661 ctctctccga ggttcagcgt tttgcccgac atcagataga gcgcacgccg ccaacccgac
   126721 cccggggctg ggcgaaccgg gtctcggcgc cagtcccgcg actctggggt gaccgccgct
   126781 gaccgatcag acgacgtgtg ccgccactcg ccggcatgcg cccgctggag cgggctgacg
   126841 ccctgtgcgg gaacgccgtc tgtccatagc ccgctgtcgg cgcgccctcc gtaggccgcg
   126901 gtgtccgtac tccacggcgc caccacgggt gggggcgagt actgcttggc catcctctat
   126961 tcccttctgc tcatgaggtt ttcgatgaga tcttgtcctc ggtcgactcc gattgggtgc
   127021 tccgctcgtc gctctcggcc ttctcggcga cggcctcttc ggcccagtcc gaccacgccg
   127081 ggtaggactc cgcttcggcc caccatgcgt tgcgcgcgtc ctgccacacc tcgacagagc
   127141 agctgaacga gcgccgaggc cgggtgccgg cctgatccgg gggtgtgcgc cgaccgggcg
   127201 gcaatctgtc cggtgcaggc tcgaacgtgg agataccgag cttctggcgc gtgcgcgcgg
   127261 tcttctcggc gagcgccgcc tcgagccatc cggtccaggt cgggtactgg cggagttgct
   127321 gaccccactt cttcttggcg gcgccccaca cctcgtcact gcacgaaaag ttctctcggc
   127381 tccatcgacg tccccccgcc gcgtcggact gtgtgtcggc cacaggctct tccttcctct
   127441 cgacggcgtc gcgggctggg tcgccccgac cagccgcagg gttccactgt atctaaaggg
   127501 gcgtccacac ctaatagccc gagtaccccg cgccgacctt tcggatctat cgcgccatta
   127561 gatacattag agccataccg agtttacccg cggcaaccgt cgcaggtgaa accgcaaaac
   127621 ggatgtttta gatacatcag ctacaacgga accattgggg ctggtgacca tcgccgcccc
   127681 gccgccgaac aaggaggcga acatggcgcg gcgaacgcga agaatgcaga gcgaaggcca
   127741 gctcagcctg gaagctctat ggggtgaccc ggaccctacc ccctcgaccg tcgacaaccg
   127801 aaaggacaat gagcgcgatg atcatcgatc aggtcaggac gtactactcg acgtacctgc
   127861 cacagacgac cgcgtcactg gacgacccgg aagagttctt ccaggagctg agcgaccaga
   127921 tcagccagcg agtcgagcag atcacggcac agctcgagac gaacgcgatc gtgccggggc
   127981 aggactacct ggagcgagtg ggaacgctga acaccctgcg agcccaggcg ctggaatcgg
   128041 cgctggcgga gctgctgtac tcgacacccc cggaagtcga cgaggacccg gaacccagcc
   128101 agaccgaacg cgacctgctg gtgatgcagc aggaggagcg ggcggtggat cagcggctgg
   128161 agatggcccc cggcagcccg gaggcgatcg agtgggatcg ccggtatccg catctggtcg
   128221 aggaagtgac ctggatgctg accgatcacg gggagctgac ggtcgagcag aagcgcgagc
   128281 aactggcgca gatcatgcac cggcaggacg aagcgcgggc ccggctccgt ccgtagagcc
   128341 ccgcaccggc gaaggtgggg acgtccttgc cgccggggaa cggcattacc tgatcgacgg
   128401 gctagaggtc tgggaagcaa ccgccagcga ctcccaggag ggccgatggg aacgtgcccg
   128461 cagcatcggc acggccacca gcgctgagga agcaatccgc ttggcgcggg ccgacgcgat
   128521 gttcaccccg gtcgagctgg caacgctgcg ctgcaaggtc gaggacgagg cgtattccta
   128581 cggtgggtac aaccgcccac tggagatttt caaccccggc accgcccctc gctacttgac
   128641 cgaggggccg ctcaagtcgt tgtccgtcgg ggagcggttc ggcccgacct ggcttctggt
   128701 ggagtcctat ctgcgcgcgc acccggacct ctacgacgag acacccagtt cggtagaagc
   128761 ccgccaggcg caccgcagtg cggccgccaa atcgctgacc accgaggccg ccgagcactt
   128821 ccgggccggc cgactcgccc gcgcgcgaga actcgtcgat caggccgaac tcgccaaccc
   128881 ctacgagacc gggacatacg acggcatccg ctcccgcatc gaccggctcg caggcatcgt
   128941 cgacgaactc ggtctctcac gaccgcaaga gcggttcgac ggactgcccg ggggcaagca
   129001 ggcacaggtc agcgtcggcg accacagctt ctccctcgag ccccgtgggg gcggccgttg
   129061 ggtcgtctat ccgaaaaccg gcggcgccga agaccagtcc acgctggcgg aacccatgcc
   129121 gaccagcgag gtgatgccgc gcattcgggc ctacctggcc agtctcccag acccgcagaa
   129181 tcccacacca gcagctcacg ctcccagcgc tgcgacgact gccgcagccc agcgcgaccc
   129241 gggcaatccc acgacccccg gggatgcccc ggcggaaccg cttccgattg tcatcgagca
   129301 caccgcggag gacacgctcg tccgcaacac cgacaagaac aacctccaac tccggcaggc
   129361 cctgcacgat gccaagttca attggtcgcg ccctcaacgg ttctggtacc agcgaagggc
   129421 aacagatttc gcggtccgta cccgtcgggt cggctacctc cgggcctcgc tgacccgcct
   129481 cgggttgccc ttcacagaga cgaatccggc gcgcgaagag tccaccaccc tcacggcagc
   129541 aggcgtcgca gaggccgctg cccccgagag cgcgcacgag cagcaaacaa ccgctgaaac
   129601 ccaacatgat tcgacggcgg aatcggcggc cgcggccgag gtttcaccga cggcgtcggg
   129661 cacgcccacg ccacctttat cgtcgcccga tgtcaccggg aacaccacga cggcgactcc
   129721 tacctcccag accgaatcac ccgccgaccg gcccgccgga actgccgaag tccgggtgcc
   129781 cgaacgaccg acggctccgc aggtcgacgt gccacgatcg acccagcgcc gcatcgaggc
   129841 gaacctggca gcggccagga cccttcagct ggtggaggcc gagagccgtc cgccgaccgc
   129901 cgccgagcgg gaagtgctgg cgaaatggac ctcctggggt gctgctcccc agatcttcga
   129961 cgctgagcgc gaagagttcc gctcggacgc cgagtcgcta cgggcgctga tcggcgagga
   130021 aggctggaaa caagccaacc gcacagtcct caacgctcac tacaccgatc cgatgatcgt
   130081 tcgggcgatg tgggaccacc ttcgggcact cgggttcacc ggtggacagg tactcgagcc
   130141 aggctgcggg gcgggagcct ttatcgggca cgccccggag gcggcatcga tgaccggcat
   130201 cgagctggac tccaccacag cgcgcatcgc acaagtgctg tacccccacg ccagcatccg
   130261 cgtcgagtcc ttcgcggaca cccgtctccc cgaagggcac ttcgacgctg cgatcggaaa
   130321 cgtgccgttc tcctcggccc gcctccacga cccggtccac aacgccggcg agcacaccat
   130381 gcacaaccac ttcatcctca agtcgttggc gctgaccaag cccggcggcg tggtggcggt
   130441 ggtgaccagc tcgttcacga tggacaacaa gaaccccgcc gctcgccgcg aaatcgcggc
   130501 gcaagcggac ttcctgggtg cgatccggct gcccaacggc acgcaccgac gggtcgcagg
   130561 taccgacgta ctcaccgaca tcctgatcct gcgccgccgc gacggcgaag cccgccgact
   130621 cggcgggccc ttcgagctcg ccgtcaccgc cgaactcccg ctgacccggg gacaagggga
   130681 gacggaatct gtactggtca acgagtactt cctcaacaat cccgagatgg tgctcggcga
   130741 actgcgggcg ggcaccagcg tttacggcgg gctctcggtc gaggtgctcg accgcggcga
   130801 cctcgagcag cacctgcgcg ccgcgctggc tcgaatcgcc gaacgcgccc tgtccgaggg
   130861 catagctcat cagcccaggg aactggccag cggcgagcgc cgggcagccg cagccgctcc
   130921 cggcgatccg aacgagttcc ccggccatct gcgcaccacg gcgagcggat tcgaagtact
   130981 gcacaccgac ggcacctaca gcgagctgaa ggtgcccagc acccaagccg acgagctgcg
   131041 ggcactgctc gacctgagag atactgcggt tgccctcctg gaaaacgagg ccgcgagcgc
   131101 cgaggactcc gacgagatcg aggccctgcg cacgcgcctc aaccagcgct acgaccgcta
   131161 cgtcgagcgc tacggagcga tcaaccgatg ctcctggcat ccgaccggcc gtgtcgacga
   131221 cgccggggag ccggtgatgt ccgtacgccg gccgccggtg atgcgagtgt tccgcgacga
   131281 tccgcacgcg cccgtcgtgc tggccctcga ggactacgac gccaccaccg acagcgcggt
   131341 gaagatggcc atcatgcgtc agcgcgtcgt cgcgccgcgt agtccgcgcc tgggtgcaga
   131401 cactgccgag gacgcggtgg cgatctgcct ggacacacac ggcaagatcg atctgccggt
   131461 catcgcgggc ctgctcggcg tcgacgacga cgaagcccgc gtccaatgcc gtggtctcat
   131521 ctaccccgac cccgccgaca acggccggta cgttccagct gcggaatacc tctcggggaa
   131581 cgtgcgggtc aaactcgacc aggcccgcga ggcggccgcg gcgaacccgg agacctacag
   131641 cgacaacgtc accgcgctga ccgcagtcat cccgcccgac ctcggacccg ccgagatcga
   131701 cgcccgcctc ggcgcggtgt ggatcgaagc gcccgacgtg caggcgttcc tcaacgagat
   131761 cctcaacgac gacacgatca ccgtcgagca caccaaggcg ggggagtgga aggtcaccgg
   131821 cggccgccgc ggcatcctgt cgacccagga attcggcacc tcccgcgtac cggcgcccaa
   131881 gctcgcccag gccctgctgc gacaggcccc gatccgcgtc tacgacccgg acgagagcgg
   131941 tgaggcgcgc atccccaacc ccaccgaaac tgaagccgcc aacgagaagg ccgagcagct
   132001 caacgagcgg ttctccgaat gggtgtggga gaacccggtc cgcgccgccc ggctgagcga
   132061 ggaatacaac cggcgcttca acaacctggt gctgcgcaac tacgaggccg acggcaagat
   132121 gctcaccctg cccggcctgt ccaaggtcta caccccgcgc ccgcaccagc gcgccgcggt
   132181 ggctcgcatg atcgccgaac cgaacgtcgg cctgttccac gccgtcggcg caggcaagac
   132241 gttggaaatg gcaatgggcg ttatggagct caaacgcctt gggctggtga acaaaccggc
   132301 catcatggtg cccaattcca tgctcgacca gttcgcccgc gaattcctcc aggcataccc
   132361 gcaggcgcgc atcctcgccg ctggcaccga ggatctggcc ggggagaagc gacgacagtt
   132421 cgtcgcccgc gcggccactg gcgactggga cgcgatcatc ctgacacgcg ggtccttcca
   132481 gcgcctcgag gtctcccgtg agaccgcgca ctggtacttc gatcgtgaaa tcgagccccg
   132541 acgccagtac ctggcggaac tgatgtccgg cagcgcgaaa cgcagcgtcg tcaagcgcat
   132601 cgaagacgcg atcctcaagt ccgaggagaa gctgaagaag aagctcggcg gccccaccga
   132661 tccgggcatc accttcgagc agaccggcat cgactacatc gtggtcgacg agttgcacga
   132721 cttcaagaac ctggctaccg acacccagat cgagtccgcc gccattgcgg gcagccagcg
   132781 ggcacagaag ctgcacatgg tggtggagta cctgcgcgac aagcacaacg gtcgcgccat
   132841 caccggcgcc accgccaccc cgctggcgaa ctcgatcacc gaggcgtacg tcgtgcaacg
   132901 ctacctgcgc ccggacctgc tcgaaggggc cggaatccgc aacttcgacg agtgggcggc
   132961 caccttcggc aagaccaaga ccgagctgga gatgtcggtc gacggcaact cctggaacct
   133021 caagacccgg ctcgtgggct tccgcaatgt tcctgagctg caacgcatgt tccacgtcgc
   133081 cgccgacgtc aaactgcccg aggatctgaa cctcccggtg cccaagctcg ctcgccgcgc
   133141 cgacggacaa cgcgcaccgg aggtcatctc ggtgccagcc accgagaccc agctcgagta
   133201 cgtccgcgaa ctcggacatc gcgcccagat ggtgaagtcg cgggcggtcg acccgacccg
   133261 cgacaacatg ctcaaaattt cctccgacgg ccgcgccgca gcgctggatc tccggctcgt
   133321 caagtcactc ggcctcaccc ctggcaccgc agaagagcag gggagcccca cgctgaccac
   133381 cgcagaggga gccgccattg ccggatacct ccactcgaaa tctccgagcc cgtccacagc
   133441 gaggtatgtc gcactgttcg cgcagcgagg ccgccacgaa tcgcagcgcc aggaatcaca
   133501 ggagatcggc gaggaagagt tcggcctcaa gctcgaggcg gcagcggact ggatgttcga
   133561 gaagtggcag gccgccaagg accaggtcta cctcggccgt gacgggcagc cccacccccg
   133621 ccgcggcgga ctcgtcgtcg cattctgcga tctgggcacc cccggtgagg actggaacgc
   133681 ctacgacgag ctcaaagcca agctcatcgc ccgaggcgct ccgccggagc tgttcgccta
   133741 catccacgac gcgaagaacg acaagggcaa agcggcgctg ttcaccaagg cccgaaacgg
   133801 cagcatccag ttcctgttcg gttccacgtc caagatgggc gtcggcgtga acatccagga
   133861 ccgcatggtc gccatgttgc acgtcgactg cccctggcgg cccgccgaca tcgagcaacg
   133921 cgacggccgt ggcatccgac agggcaacca gaacgaggag atcgcggtcg gccgggttgt
   133981 caccgaaggt accttcgacg ccaggatgtg ggcggcccag gcgcggaagg cggccatggt
   134041 caatcagttc atgaagggct cgctgaccgt ccgcgagatc gacgacatcg gcgacgcggc
   134101 gctgaacgcc aacgaggccc tcgctatcgc cagcggcaat ccgctggtgc tggagaaggc
   134161 cgagatcgac atcgaggtca ccaaactcga acgcctgcgc cgcgcgcacc agcgcagcca
   134221 gtccatgctg caaatccgca tccgtgacgc caacgacgcg atcccgaaac tggaggccga
   134281 gatcgacgcc tacacccggg cgatcgagca ccgcagaccc accaagggcg acgcattcgc
   134341 cgccaaggtc agcggacggt tctacgacca tcgcggcgac gccggcgacg ccctggccgc
   134401 ccggcttctc aagctgatcg aagacccccg ggcggtgtgg aaggagttcg aggaccacgg
   134461 agtggccgag atcgcaggct tcaccttgga cgcccgcaac gtcccgaccg gccgcgccgc
   134521 tctggtgtcg gtggtgttct ccgacatcgg cgacgacgtc tacgtcacgc tcgacaaggc
   134581 gacgctccag aagggcggga ccgcggtaat gctccgcctg gagaacgccg tcaacggctt
   134641 ggacaagcgg ctcgaggttg ccaccgggcg gctcgaaacc gagcgcacgg aacgagagcg
   134701 ctccgaactc cgcctcggca aaccgttcga gcacagcgaa cggctggatg cgctccggga
   134761 acggcagaag gagatcaaca aagagctgct cggcagcaag gaaacggaga ccgagaacgc
   134821 ctccaccgat ccggcggcgg cgcccggcga ggccgaatcc atccggtcgg ccgcaatgca
   134881 cgacgccgca gcgatggttc accagatggg aggcgccgca gttgtcagcg gcgccaacgg
   134941 gatcacgatc atcagcgatc ggggcggccg ggctcggtga cgaactgcgc gatgtggtcg
   135001 aggcgcccgg ccagggtgcg ggcaagcgtg gacttgcccg cacctggagg gccgctcacg
   135061 acgatgatca tttgagcgcg ggttcggggt tgcggccgag gatgtagtag tgggcgatcg
   135121 actcccggag ctgtccggac ggctcgcatt cgagcagttg tgctcgcagg tcggtctcga
   135181 atcgttctgc gagagtgggg tcctggcgaa tccgggcggt gtaggaggtc gaccacaaga
   135241 acccgaggaa ctcatccatc gtccaggtgt gcggtgtggg gaactggtgc tcggcgacgt
   135301 cgacgtaccc tgcttcgcgc agcacgtctt cgtgagtgcg ccgcgcggga gtgttgctct
   135361 cggcgggggc aggcgccgcg ctcgcggggc gtccgggttc gccggaccat cgggctacga
   135421 catcgacggc gacggcttgc cagggctcgg ttccgctcca gggtgtgctg ctgcccaaga
   135481 tggccaggca tccgcccggg gccagccact ggcggacgcg ctcggcgatc agcggtcggt
   135541 ccaagcggtg gaacgcattg ccgatcgtga ccagctgcgc cgccggttcg tcgatgacca
   135601 ggtcttcggc cttgccggtg ctccaggaga tgttgattgc gccagcttgc tcggccttcg
   135661 cgcgtccgac ctcgatcatg tcgggctcga ggtccacggc atagacgtgg ccgaaccggg
   135721 tgtgcagggg aatcgcgatt tcgccagtgc cgcaggcgag gtcgaccaac acgccgccct
   135781 ctcccacccg attgatgagg tcgtcgagca gtggctgggg gtaggccggg cggtaccggc
   135841 tgtagtactc ggctgcgccg cggaagaggt cttctcggta gccaggtcgc atgggccagc
   135901 tcgggggggt cgacggggtc ttggtcatgt cgggttctcg ctccttgctc tcgcggtgcg
   135961 atgcggctgg gttgctgggt tcgttcatgg tcaggggacg aggtccgggc ggtcgaactg
   136021 acgccggtag gcgctgaacc cctccccaca gacccgcgag cacaccttga gtttcccgcc
   136081 cgcgatggtg tcggtgctcc agctgcgttc cacggccgtg aagaattcgc tggcgaggat
   136141 ttcatcgagc gggtgctcgg cggcgtcgag ggtgttggct ccgccggagg cggtgagcag
   136201 gtcgtggacc tgggcgtcgg tggcggcttg tccacgatac agctggggca gggtcgcttg
   136261 gacgtagagc cagcagcacg ggtacacgtg tccggtcgcc gagacgaaga tggcgctcga
   136321 gtcgagggcc tggcactgga tggtgcaggt gtcgaagaac gcgtcgaagt actcggcgcg
   136381 ggcctcgatg ctgcgcgccc agagcacgac ctcgttgacg agccgttcgt cggccggcgg
   136441 ccgcagttcc ccgacgactg ccccggtgcg gtcgtagatc ggggcggcat cgatgccgtc
   136501 accgggacgc agttcaggag cgggttcata cagggggcgc aggaagcgag cggtcttctt
   136561 gacgctgaac tcggcgaatc cgagttcagc ggcacgggcg cgggcggagt cgatctcgtg
   136621 ttcgttgtgg gcgaaggcga tgtagtccca ctgggcgcgg ccgccggcgt cgatgaacgc
   136681 ggcggcgttg gccaggactt tgtcgatgtc gactttgcgc cggtacacgc tgttggtggc
   136741 cagcccgtcg atggcgaaga tcgtggtgat gccggggatt tcggccagcc gtgcccacca
   136801 ggtcggggtg cgcaggccgc cgttggagta gatgcggatg gtggtggacg ggttgatggt
   136861 gtggatgtgg tggcagatgt cgagcagctc gggagcgatg gcggggtcgc cgtaggcgcc
   136921 gcagatgtcg acgatctcga gttgggccag gacgtgttcg ggcaggcagg cgcggaactg
   136981 gtccagggtc atcgaggttt cggtgaggcc gggggcggtg gcgccgaaga ggttgcgggc
   137041 gcacatgggg cattcggcgt tgcagcgggt ggagacctcg aggtggagtt ggcgcaggtc
   137101 ggggacggtg tacatggttc tcacctcggg ttcaggggtg gacggcggtc gggtcggact
   137161 tggtggcctt gattccggcg atgcagttgc aggaccgcgc tgtgcaggtg atgcccgcgg
   137221 tgggcagggc caggttgttg tcgaagatcg ttccgatccg gccgccctcg cgacacgacg
   137281 ccggccagat ctcgtcgaat cggatgaaca gggattcggc gccgacgttg caggtccagc
   137341 cgggccaggt gttggctccg gtgtcgatga tctgcgacgg ggtcaggact tggtgggtgc
   137401 cgtcgaggta ttcgacgtcg aggtcgcctt tgagcagtgc ggattcgcgg gagccgggct
   137461 ggtcgacctc ggtggcgagg gcggcggtga gcgcggcgtg ctggtcgggg ctgtagtcgg
   137521 cgcggcgagc ccagccgtcg aggaacatga tcttgcggtg caccggcgcc ttgccgtcgg
   137581 cctggacggc tgcggcgagg ttcatggtgg tgtcgaaggc ggcggggtcg atcaccacgt
   137641 tgacatcgac gctggtcgtc gcggcgatgg tgtcgacgac ggcgcggaag tggccgggtt
   137701 cggcgcgttc gtggtggtag ctgagcagta cgtggtcgaa ggcgggtgcg tgggtggccc
   137761 accagggctg cggccgggtg ccgttggaca ggaccgcgac gtcgatgccg agggcgcgca
   137821 ggtcggcggc catgcggggc agctgtggcc acagggtgat ctcgccgccg ctgagcagga
   137881 aggtgatgtc gcggccgcgg taatgctcgg cgacggtgcg ggtgaagcgg tgcaccgagt
   137941 tgtagtcggg ccagcgaacc cggttgtcat gcaagtaaat tgggcagtag tggcaggcgt
   138001 agttgcagac gctagacatg atccactcca cgacgacgcg accggtgtcg gcggtgtcgg
   138061 cgggggtgat ccggagcggg attcgggtca tgaccctccg ttcgggcggg tggcgatgat
   138121 cagctcggtg gtgaggtgtt cggtgagcac ggcgtcggcc ccgaactttt ccacgagcgc
   138181 ggcccgcagg tcgtccgcga acgccgcgcg agcggactcg tcgctgaatt ggcctggtgc
   138241 gctgtaggag aaggagaact ggagcccgat cacggaatcg atgtcccggt ccagatccca
   138301 gtgccaggtc gtgacgtcga tgtcggagaa cgccgaggtg gccaggactt cggtgtgggt
   138361 aaggcgggga tgggtgtagg tgctggtgcc ggcgcgccga gccgcgccga ggtgggcggt
   138421 gcgaacctcg gtgacgatgt cgttccacgg cggtgcggtg gcggtggccg ggggcccgcc
   138481 gctggccagc acgaccgcac cggccgcggt gaggcgatgg tcgaggtcgg ccagcagtga
   138541 ggcgcggtcg gtccagtgga agctggcgcc catggtgacc agatcaaggg cgggcagatc
   138601 gagcgcgtcg aggtggtagg agtcgccctc gcgccagctg atgttgtcga tcccggccgc
   138661 cgtggcgagt ttcgcgcctt catgcagcat ctgggtatcg gggtcgacgg cgtgcacgtg
   138721 ggcgaccaac ggtgccaggc gcagcgcgat ctggccggtg ccgcaaccga ggtcgagtac
   138781 ctgctgggtg ccgtcgagat caaagcgttc gctcacggtg gtgaacagtg cggccgggta
   138841 gccggggcgg tgccgggcgt agaagggggc ggcgccggtg aacaggccgt gggggtcgta
   138901 ggtcattcag cgggctcctt gccggatgag ggggtcacag gtggtgctgt cgagcaacgc
   138961 gagggcggcc tcgtgcagcg ccgtggcggc gatcccggtg tgatcgagta gttcgtcgtg
   139021 gctcatcggg aggggcgggt tggcccagcc ccgcacgacg acggtgcgcg gcgcgccgcg
   139081 ttccccgagc agcgcatgga ctgcggccgg gtggcaggtg gtcgcgatga ggaccgcggc
   139141 cccgggtggg aacagccgct cgaagtcggc ggccgagatc gcggcgtcgc gccggccggg
   139201 tgcgccgagg ctggtcaggt cgtggatgtg caggtaccgc aggcgggttg cggtgcgggt
   139261 ggcggtgatg gttgttgcgg ctcgggtgag ttcgcgggcg gcgatgtcac cgatcgagac
   139321 cagcaccatc tcgggatcga ggtcgtcggc gatgtgcggc cagacggcgt acccgtcgcg
   139381 cagctccgcg tcgatggtgg tgtgcggatg ggcgggcatc gggtgtttgg aggcgacgac
   139441 caggctggcg cggccgagtt tgcgcacggc gaaggtgagt gcggccgcgg tgcgggtggc
   139501 gtcggcgggc agatagatgt gcacgctcgg gtcggcggtg ccgatggcga tgtcgatgag
   139561 cccggggttg gcgtgggtga tggtgttgtg ccagccgagg ctggtcagca ggtacaccag
   139621 gctcgggccc ggcgggcgtc cggcagccgc ggcgagccgg tgcgcgagga gctgctgggc
   139681 cagcagcgag gcggtgatcg gggcgaacgc ctcgtagccg acgaccacgc cgcggcgacc
   139741 ggtagcctga tagccctgag cccaggcgtg gcacagctcc tcgttgagca cttcgatcgt
   139801 ccagccggaa tcgggggctc ccagctcgat ccggttggag gccagttcat ccgggctgaa
   139861 caccctcagc ccgtagacgg tgttcagttc gcgtagggtg gcggtgatcg cggcaccaaa
   139921 gtctgctccg gcgacccggt cggcgactgc gctggcggcg gcaatgcagc cgcgcggtgc
   139981 gtggagttcg acccggccgg ttgcggcagg tgcgagagcg cggcgcaccg tcgcggtcgg
   140041 cgccccgccg gtgaacagtt cctgcgggcg gtagcccgac agccagcgct ccagcgcaac
   140101 gaattccgca ttgtcgtcgc gcgggttgcg caagggaacc ttgtgcactc gcggcgtttg
   140161 tgcaatctgt tgcccagcaa ccgttttcgg cacgccgtgg cccttgtcga cggtaacgac
   140221 gacaacggtc gacggtccgt actgcaaggg ccgcagcccg gtcaaggcgc gggccacggc
   140281 ggcggtgatc tcgtcggtgg acggtccggc ggtgatcacc tcatagccca ggccgccgag
   140341 gtggcgggcg agatcgcagg ggtcgagggc ggccagcagc gaggccgagc ccatgcgcag
   140401 gccgttggcg aggatgaccg gcagcacgcg gccgtgggtg ccggtgccga tcagggcgcg
   140461 tgcgcccagc caggctgccg cagtcgcgcc ggtttcgcac tcgccgtcgc cgatcaccgc
   140521 gacgacgagc cggtcggggg cgtccaagcc catgccgtgg gcgatcgcca gagcgggccc
   140581 gagttggccg ccgaggtggt cgtggccggg gatgagtggg gtgatttccc caccgaaccg
   140641 ggtgcgggga aactgcgcgc acaggcgcgc caggtcgacc tcggtgtgac cgaatgcgtc
   140701 ttcaccggtg tcgagggcac cggtgatcca ggcgtgcgcg agcgccgacg gcccggcgtg
   140761 gccgcctccg tgcacgaccc gcacgtcggt tccgggcatg cgccggtagg ggcccaacgc
   140821 ggcgagtacg gcattgaccg gtgggcacac gccccagtgc ccggccgggg ccggtttgac
   140881 gtggccgggc tgcaacggcg tggacaaggt gacgttgtca cgcagataca gctgtgccag
   140941 gcacaggtag tccagggcgc ggcgcgcggt gtcgacctcg gcggcggtca ccgatgccgc
   141001 ggccgccgcg acctgggttg tccagtcggt ggtcatcgcc gggccttccg atccgcgccg
   141061 gcctgggcga tcgccgccac ggcgacggtg atgcggtcgg cacgcagctg atcgttcccg
   141121 gcttcgacga tcatctcgag gatctgaatc agctcgggct cggtgatgtg gtccaggccg
   141181 agatcggctg cggtcagggc ctgttgcagg tccgcaggga tgcgatggtg gcggcgatcc
   141241 ggcagcgggc gcaaccgcag cgccaccgct ccgctggtct gctgggcggc ccagggcggt
   141301 ggacgcaagg cggcgcggcc gtcgatgttg aacaccactc gtgaacagcc gccggtccca
   141361 tggtggtgct cgacgcggta gcggcgcccg cggtggggtc ctcggggtgc ggcgaagtcg
   141421 agcaccagca cggtgcggcc gtgcaaccgc cgaagggtgc cttcggtgga gactgggatc
   141481 gcgggcagtt caggcagcat cggccatcac ccgggcgaga tcgacggtga ccagcgcccc
   141541 ggcggggccg ccggtgttgc gccgcgccgc tttggccgcg aacaacgcgc gatccactgc
   141601 ggcgaggagg aacttcgcgc gcactgccgg gtcggtgctc ggccacacca ggccgggccc
   141661 aacgactgtc gtggcgaagg acacgctgca cggcagcgcg gcgcggcagc ggtcacgcag
   141721 atcggtgacc gaggcggtga acccggcgtc ggtgacgccg gtggcggcca cgatgacctc
   141781 gtcaccaccg aacgtcgaca cgcaccctgc cggaaatgcg gtgtcggcga accaggttcg
   141841 gcacaccgat cccagctggg tcatcagcgc gtttccggcc aggtggccaa agctgtcggg
   141901 atcggtggcg ttgctgtgct cgacgtggct tttgaggtcg tcgacgtcac cgatggccag
   141961 gccgagcagg gtgcgctcgg caacgacgcg ggccagggca tcggtgatgg cgtgcgggta
   142021 gaggtcgggg aaggccacca agccagtgat cgggtcgcag cgggcgccgg tcagccactc
   142081 ggctcgacac ggcagctcat cgagaatatt ggtcacggac agggcctttc agcagaggtg
   142141 ctagatcggt cagggccccg atgcgggcga cgtcggggtg cgccggggtg gcgctgttgc
   142201 ggacgaggtg gatggcagac cagcccgcgg ccagtgcgcc atcgatgtcg aagcgggcgc
   142261 tgtcgccgac gttgagcagc tgctgcggcg ccaggtccat cgcggcctcg atcgcgcgga
   142321 atgcggccgg ctgcggtttg cacgcgccga tctgccagct gtgcagcacc acttcggcgt
   142381 gcgcgaagta cggcggccgc gcgggctgtg tgtcggggtc gggcccgatc gcgttcgaca
   142441 gcaggcagat acggaagccg agcccggcca gctgttccag ggtggggatc gcatcgggat
   142501 acaggggcgg atcggccatg tcggctacgc gcaggcgcag ccggtcagcc accgcgtcgg
   142561 ctgtgtgcgg gcggccgcat gcggtggcga ggatggcagc cagttcaccg ggcggtgtgc
   142621 ggcgggtctt ggcgtgttcg atcagcatgt cgcggacatg ctcgacatcg gcgtcgagca
   142681 cttcggccag ttcggccgcc aggactccac ggggcatctg caccaggacc ccgccgatgt
   142741 cgaagcagat cgcccggatc tcacgctgcg gcaccggcgt ctccttcgcc gaagcggtaa
   142801 ccgctggtca atcccgcggc cgtgcgggcg tccaggtgcc ctgcggcggg caccagagga
   142861 tcgagctgat ggtcttggcg caacggttcc agcgtcaggt ggtactcgat cgcgggaacc
   142921 gccgcggcgg gtgcgctggc ggccagggcg agcgcggccg ccaggccgga gccgtgcggc
   142981 aggctgcgga tgttcaggcg cgcggccagt tccaccatcg acagggtgtg ggcgagcccg
   143041 ccgcaccagg tcgggtccgg ttgccagatc tggatatcgc cgccgagggt gcgcagttgg
   143101 tcggtgggct cgtagtcgtg ctccccggcg gcgcgcgcaa gcccgtgccg ggccaggtcg
   143161 gcatccgaga tcggaccggg ctcctccacc cagcacacgc ccgcctcggc caacaccggc
   143221 agcatctggc gggcatagtc ggcaggccac cggccgccga catcgacacc gatgcgggcc
   143281 cgctcgccgg ctgcctcgcg caggcgtcgc aaccgggccg cgtccgcccg tggtgtctca
   143341 ccacgggcag cgccgggcag tccccatttc tgagcccaga aaccctcgtc gacgagccag
   143401 gcagcgatgt cgggtgccag cgggtggtcg atgtcgatgc ccagcgccgt ggcatacaca
   143461 gggatgcgct cacgtcgctc accagcgagc agcgcaccga ccgggacacc ggtggcgtgg
   143521 ctacgcagat cccacgccgc gagttcgacc gccgacaccg ccaggcgcag gtgcgcgccc
   143581 tggcggtgtc gaccgtgcgg ggcgagtgag gccatcgccc tccaggccgc gagttcccgg
   143641 cctatcacgg cgggagcgac ttgatcgaac accatccggg ccacggtggc cgataccggc
   143701 ccgaaccagc ctgtcgcgcc ggtgctgtcg acgactccca ccgccatccg ggtgaggttc
   143761 tccggccacg gctgggccgc cgggtggcgc cgcgcgggct gtgcccagtc cggcagtacc
   143821 tccgccgagg ccgcggcggt gaggggcagc gggggcaacg ggcgggtgat gacgtcggtg
   143881 atcgtgcgag ccgtcatcgt cagatcctgg tcccggtcag tggctcgtcg gcgaagctga
   143941 agtaccacag cggccggtag ttctcccacg gctgcgggcg aagcccggtc ggcccgaaca
   144001 gctcctcgat ctcacggcga gcggcgaggt agaactcgat gtcacgggcc ccgtcggcga
   144061 ggaacacatc catcatcggg gtgtgggact gatagacctg gaaccgcggg aaggtcgtgg
   144121 tcacctcgac gaagtcggcc aggtgacgcg cggcgacgtc gagcgggtcc aggccgatga
   144181 tgtaggtgaa gtcggtgcgg atgcccgcgg cgacggcgtc gccgagtacg cgcaccatct
   144241 cggtcggggt gagcgcggcc ttggattcct tgagaatcag gtcgcgtttg gtgaaggctt
   144301 cggcggtcag ggtcaggtgg aacggtccga tcgcggcggc ctcggccagc cccgcaggcg
   144361 tggtgagcac gctggacagg aagtggatct ccccgccgca ctggtgggtg gtcatcgctt
   144421 cgcgaacctg ccgcagatgg gtcagcgcga gctgttcgaa ccggaagcac ccggtgcaca
   144481 cggtcacctt ctccacgctc gacagccctg tgccgaggcg gtcgtcgacc agagtggaaa
   144541 agtaggcgtt gaggtcgtcg agggccaggc ggggatcgtt ggcttcctcg agggtgttcg
   144601 ggcagaacac gcagccggta catgcgctgc gcgcgttgga gttcaatgtc aggacccggc
   144661 cctcgttgcg ccaatacccg agcaccgcgt cgtcggcctc ggcgacgtcg atgaccgcga
   144721 cctgctcacc acccagcagg accttggtat cgaccagctt gaacggtgag cggcgcctgc
   144781 ccagcgacaa gatcatgtac agctgatcgt ccgggcggga attcagccgc agccgaaacc
   144841 gcaaccgcga caccccgata tcggcgtcca gaccgcacgc attgagcgcg atcaacatga
   144901 tgtcgtcggc gtcgatgccc caccggatgg cgagtcgttc ggcgtcggcc ctggtctcga
   144961 gcatgtgtac ctaccttttg tgaccggtgt cagtggacgg gtgtggcggg cataagttgt
   145021 cgacgtagaa caggtccgag accaggtcgc tgtactcgag ctcgagctca gcgagctgtg
   145081 tccatgcctg gtgcatccgc tccgagcgcg ctccggacgc cgccagctgg tgcatcgctt
   145141 gttcggccgc cacggccatc cgatcgatca gtacgccgat cgtctgcgga taggtgatcg
   145201 ccagcagcgg ttcgacagtg ttggtcaggt cgttgatccg ggcggtaagt tcggttcggc
   145261 ggcagtcgca ttccgctgcg cgcgccgacg actcccggcg cgcgccatgc aactggacca
   145321 gctcgcgcgc ccacgagcag atcgggtccg tgtcatccag gccgcggcac agcgcgatca
   145381 gcaggcggtc ccgggcgggc aagcggtagc ggtgttcctg cgtgatcggc ggtgtgcgca
   145441 caggctctcc tcccacccag cgactgccct ggggaccgct cggaaagcga tgcacgggct
   145501 gactggttct cacacggtac ctatccgcct gggggttgtc caccaggtgg ataggggcgg
   145561 ggggagcacg gatatccgct accgctccgg tagcgtctgg gctatgccca aacagcccga
   145621 atacctctcg atcgcagcca ccctgcgggc cgaagtgctc gctgggagct acgacgccga
   145681 gccacttccc ggcaacgccg acctggcaga acgcttcgac gtcaacatga agaccgcggg
   145741 gcgggctgtc caacaactgg tcgcggaagg actcgtcatc gccaggcccg gaatgcgggc
   145801 catagccacc ccgccggaac tgcgcggcac ccgatggccg atgaacggcc gctacgcgcg
   145861 cgcccgcgct gctcgcggac tgatcttcgc tggcgacgtc aacggcaacg tccgcaagga
   145921 caccgtcagc cgcgaatggg tctccgcgcc cctgccgatc gcgcacctgc tcggcgtcaa
   145981 ggaaggggca cgcgtcttcc gccgccacag ccgcaccttc atcgacgacg tcgcgaccga
   146041 gaacacgatg atgttcttcc ccgaagagat cgtggccgcc gcccccgacc tcgaaaccgc
   146101 cgaacgcatc caggttgtcg cgctcatcga agatgccgga cacaccgtga cccgaaccgc
   146161 caacgagatc cgcgcccgac acaccaaccc cgccgaacaa gaactgttcg ggatcgacgc
   146221 gaacagcatc gtcatcgagc acatccacgg aacctatggc gccacagacg aaccgctcga
   146281 agccgtcatc aacgtccggc ccgcacacgg tggcgccatc accttcgaca cctacgaagc
   146341 accactcgac aacgaataga aggagccccc gatgcccacc accacgaccg tcagaggccg
   146401 gctggctatc gcgctcgaca ccagcgatct ggacaccgcg gtgtcgatcg cgaaggccgt
   146461 gcagcccgac atcggcgtcg ccaaagtcgg ccttcaactg ttcagcgcgg cggggcgcga
   146521 cgccgtgcgc gctatgcagg atctcggcat ggacgtcttc ctcgacgtca agctgcacga
   146581 catccccaac accgtctacg gggccagcac cgtcctcgga gccctgggcg tccaatacct
   146641 gaccgtccac gcaggcggtg gaacggccat gctcgaagct gcggtgaggg gactcggcga
   146701 gggcgcgagc agcgccgggt tcgcagcccc gaccgtgctg gcggtcaccg tgctgaccag
   146761 cgcgccggac gcatcgccgg aacttctcaa cgaacgcctg gcggcggctg tcgccgccga
   146821 ttgtggcggc gttgtctgcg cggccagcga cctgcccgtc attcgcgccg ctgcgcccga
   146881 catcctgacc gtggttcccg gcatccgtcc ggccggcggc gaggtgcacg accagcagcg
   146941 tgtggcgacc cctgccgatg ccattcgcag tggtgcaagc attctcgtcc tcggtcgagc
   147001 gatcaccgct gctccggacc ccgccgaagc cgcgcgggcc atcaccgagg aagtcgcgca
   147061 agcactttga tcgaacccgg ccgatcgttg aagcagctcg agatggtcgg ccggtttcgt
   147121 cccatggcga cgccaatagc gacgacgttc gggtcgcgcc cgaccagggc ggtccgcaca
   147181 tgcgctacct cttgatcggt gttgctcgga cgacgcccgc gtcgtccacc tccagttgaa
   147241 gcctcagagg ccgccgttgc caggtgatgg ccagccacat cggcgcccac agccctgccg
   147301 tggcgacgct gagcgccgcg tgcagaccgt gcgccggccg aggcccccac agcaccacca
   147361 ccgctcgcaa gtccccacgc aggtgcacag tgcagttcgt gcggtccctc aaccaggcaa
   147421 tccgctcgtc cagccgctct cgccgctgtt cgatgctcag tgctgacggc accagcggcc
   147481 cgttggccgc cgcgagatgg cgttcgctcg acacacgttc gggcggttcg ttcatcgatg
   147541 cctccgcatc atcagtcgga gaccggagta cgtgtctcgg ggcaggtgcg tgttcggcag
   147601 gcagcaggtt cccgccgata cttggtcgat caactcgacg tagtccgcac ggacaccccc
   147661 gagctgcgct cgggcatcat cgatctcggc ggaggtgacg cgcgctctcg gggcacggaa
   147721 tgcgatcgca cacaagcttg cgaaccgatc gacaattgcc cccaccgact cgggatggag
   147781 tcgggcatct acgttcggca ccggcgcgat ggctaccacc aggacgtcaa cacgccgggc
   147841 cagacgcagc ctgtgcgcct cgattccgtg gggtctcctc gccgcgaaac gagccgcgtg
   147901 caactcaccg agttctgcgg cggcctcgac aatcgggttc gagccataga ccagcagccc
   147961 acgacaggca tgctcgagga ggatatcgtc gggcagggct cgttgcagcg cactcattcg
   148021 aagtcgtcct cgacgctgtc ggccggcgcg gccagcacct cggcaactcg ccccttcaca
   148081 cggcactggg acgaacaact ctcgtgcatg cgccgcgcgc gaacggcaac tcccctgggg
   148141 atgggccctg gatcggtaag gcaatcggcg atgttagaaa ccgtgtgctt caacgacctg
   148201 gggtcgaggt acccaggccg caagctcggt ggcgcctcag cccactccat cgcttctcct
   148261 cccggctccg gaagcgggac cgaggcagac gagaccggtc atcgagagac ctccagatga
   148321 cggtccgggc gcgtgaggga gtggggacgg ccaccatcct tcggccagca cagtggcggg
   148381 tccaccgtcc agaccgctgc gattcgccgc actgtgtcca tccacccccg taggtgctgc
   148441 tcggacggca ccacaaccac gtccgcctgt gtggagttca cgtgcgccag caggacggtc
   148501 agatcggtgg tgacgtgggt gtcgcgggca ggcaaatcca gccgcatccg cctggccagc
   148561 gcccggacgc tctcgacacc gccctgccca tcgcgcgccg caacatcctg ccggacaatc
   148621 gcaatcgccc tcatgagacc gcgctccgca gcgagctgta cgagaccgac ggtgttgccg
   148681 ccagcggaat cctcgcccat gtgagcgtcc cgcccgtctc gggctgcacc cgcccgtgct
   148741 cggcgaaggc ggtgatcgga tcgctcatga gctcgtcggc acgggaggcg gtctcatgaa
   148801 cttgcacctc gagcgtcgat tcacgccgga gcagccacac ggtgatttgg ttgctcggcg
   148861 cgagatcagg gaagccggcc gcgagccgcg catagatgcc cggctcggcc gccgtcatgg
   148921 cctcggccag caccgcaagg acgatctgct cgacaggctc ggagaggtgc cgtagtccgg
   148981 cacgggtgag cagttcgtgc gtctggatct gggccagccc gcgagtggcc aagttcagtc
   149041 gaagctcgaa ttgcccgatc ggagttcgcg gcggggtggg ggcggatgca cgtggcgacg
   149101 ggatatcgcg attgcggcgg acggttcgca ccagggcggc ggcgtcgtcc ggatcgaggt
   149161 accacacccg cagcggacgg agccgctgca actgtcccag cagcgtcagc cggtcgtcat
   149221 tctctccacc tttgaggtgg gtcggggtcg gcgtgatgat gtgccgcgac cacgcttgcg
   149281 agacatcccg caggagcatc cacaaggcgc cggtggcggc gccgcactcc cggtgcacca
   149341 cggccaggtc gaagccttct cgagctgcga actcgcgcat cgcgtcctct acctcctgga
   149401 cgcgctcgcc gaccagctct tgacgcagat agccgtacat caacgacggt tttcggtcca
   149461 tcgtcttacc cctgtctgaa cttcggcagc ccgtcgtgct ggccgaactg cgatgtggaa
   149521 cccgacgtgg ttcggtgcgc ggcgaaatgg accgtgttgc cgagcgactc ggacccggcc
   149581 gcggcggcgc gcacagcggg atcggtggtg gtggcgcggg cccggccggg acgggccggt
   149641 actcccgcgc gcaaggtcgc gaggacccat tcgagaaagc ccaggtagtc gactcccgag
   149701 gagagccgcg cgattcggcc gggccccagg tgcatccgcg catccggctc gagccggaac
   149761 tcgcgatggt cgaaggacac gaaagcgcct tgcagcgcgg cgagggtcag cggatcatgc
   149821 agcatgctcg cggggtggaa tctcgcgaac cactggtcaa ggtggtgggc gatcacttgg
   149881 gcccacggaa tcgacgatgt cgcgagcagg cggtagaccg ggctgtccgg gtcgaccgcc
   149941 atcaccggag taaaggtgtg atcggacagc accaacgtca gattctccgc tcggcctacg
   150001 accgtgtgga ccgctttcgg atcgagccga aagttgtgct cagcgcggtc tggctggcgg
   150061 tattcgagag cgccccccat ctgccagatc cgcaggcgcc gcgccagacc gagcggggtc
   150121 cgacgaccgg aatcggtctc cagtaggcgc gcgagatcgg tgagcggccc gattcccaac
   150181 cagcgcaatg gcgctgacga atccgggtcg gtgagcgagg ctaccgcggt gtgcaggtcc
   150241 agcggccagg ggtgcgctcc ggcggggaca agcccatcgg cggcccagta cttcctctcg
   150301 cccgctgtgg ccccggctgc taccacgaca tcctcgcggc cgagcaagtc gagcagatgg
   150361 cgggcgagca ttgaccgccg gccgtcgggg aactcatcag cggtgacaac cagtgccagc
   150421 cgcggttcgg tcattgcggc caaggccagt gcgatcgcgt cgtccggatc gccgccgatg
   150481 tcggtggaaa cgatgagggg actgtccctc agcgccaccg ggtcgtggga agcagcggca
   150541 gccatgatca gctcgcctgc gacaggttct tcgcggcatc gagaacgatg ctgaccacgg
   150601 tgtcgaagtc gggacgttct tcgccgatgg gttcctccac ccagtgccgc cgctcgtcgt
   150661 ccgggccggg gagcgtcacc agcgaaccct gcacagtccg gatcgcttgg tacttgaaca
   150721 gctgggacag gatgcggacc gggcgtgggt ctcccatccg cgcgggctgg gtgacgaagg
   150781 tcaggaaccc ggttgcgcga ttctcgatcg tcggagttgc cagaccccga cgaagcagct
   150841 cggcccgaac tcgctcaccg agggggcggg gcatctggat tgtgtccacg ggcccggcgc
   150901 gcaggatgat ctgctggtgc tcgtccacct cggcgccgat gaagcggttc tccgtgatgt
   150961 acctcgcgca gcgcgccgcc gcggtctcgg tcagggtagt agccatagct cctcacaggg
   151021 catccgatga tcgggaagga agccgtcgaa cagctcgacg gcggtgatcg cggggttgtg
   151081 gccctgcgac cacttccgca agaagttctt gaccgctgaa cggcacccgc ggtagtcgaa
   151141 aacccggtca gcccagacga accggagatg aacatcgggt tctgccgggc gcggcgagcc
   151201 cttgttgctc aaccgcgaat caaccgcgcg agccacgaga tcggaacgaa ctaccgcact
   151261 agccatcgcg gaaacctccg tcggtgggtt agctgctgac cacgccgttc gggcagcggg
   151321 gcgaggtggc acgggactcc gaggacgccg gccaccgtga ggggggcgtg acccagcccg
   151381 agctcgtcaa gccagtcggt tacgtccgcc cacagcggat cgtcgtcgct cgccgggcgg
   151441 ggctggggga gcacctcggc cagcctgatc gcggccagtg cctgccccag tgtgagtgtg
   151501 cgcccacgca actgctcaac cacccactgg tcgttcccga ccgagatcgc ggaaatggtg
   151561 gtgatgtcgc tcgacatcct ccggcctgca accagctgaa cagccatgat caggccctcc
   151621 ctcgggggtc gaccgcgctg agtggcgggt tgcagggaag gggtgccaag cccggcggca
   151681 gagtcgcgcc accgtgttgt ccgaagccgc actgatatgt cgtcatcagt cccacctgca
   151741 ctggccttgt ctcggagtga ccaatcccca cggtcacttt gctctgccat gtgtcagaat
   151801 gtcacagtga caagcaacgt gcaatgcaaa cggcaaacat agaggttgcg gatcgttgct
   151861 gcccagtact ccgccaccgt caggggccgg aacatgtgac agaatgttgg atgtgacaaa
   151921 aagtcactgt gcgctagagg aggtgtgacc ggtgactcag ggcccgatct cggccaatgg
   151981 ctaccgaatg tcgccctaca gtcggcggtt gcatctcggc gaccgcctcc gcaacctgcg
   152041 ccaggagcaa gaacgctcga tccagcaggt ggccaaggaa gctgacatcg accggacgct
   152101 gctgacccgc atcgaaaccg gacaacgtcg agtcgcggcc gacgtcagca tgaaggttgc
   152161 cgagcacctc ggcgtcgagc agcattcgcc cctctggcag gagttctacg cgctcgctcg
   152221 agacgccgcg cagtccgggt ggtgggaggg ccgcgccttc cgtggactgt ccgaccgcca
   152281 ggctttaccg gccgatctcg aggcaggcgc cagccgaatc cggtggtacg acttcgcgct
   152341 ggttcccggc cttctccaat ccccggcata cgttcgtgcg cgccacgatg cgacggtcac
   152401 caacgatcat tcttcggaca atcctgtgga gatccgcgcc cgcgaacgcc gtcagcagga
   152461 agcgctcacc gagggtggtc cccggatcga ggtaatcgtc gaagagacag tcgttcggcg
   152521 gcgcgtcgtg cccgctccgg caatgctcga acagctggag cacctgctga aactcatcga
   152581 cgcgaacgag cagatcgatt tccgcatcct gcccgtcggc ggtgaactac tcggcctgcg
   152641 agcgccgcgg tcaccggttt cgatctacga gttcgctgcg ggcgacccgc ccctggtgtt
   152701 cgtcgagtcg ttaaccgacg atgtgctgtt gcgcgatcac gccgaggtcg ccaaccatga
   152761 gcggctctgg aagcggctgc acgagatagc cctacccccg gacgaaagcc gcgtactcat
   152821 cgcccggagt gccgaaattc tcgcaaagga gcagtgaagc aagtgaggaa cacgatcatg
   152881 accgggcacc ggccgcttga cgggtacgtc aaggcgtccg ccagtgacgg cggcggtaac
   152941 tgtgtcctcg tccgccggaa gtcgggcgag gagttgatct tcattcgaga cagcaaatac
   153001 ggacgcgacc ctcgcaatcg tccggaggat gagcccgtcg tcgagatgcc cgcctcggct
   153061 tgggaagggc ttcgggccgc tgccttgggc gatgccacgt cgcctgcggt tcccggccag
   153121 cccgtgctcg aagagacggt tgacggcgga atggcgctcc agggagcgga cgggacaagg
   153181 ttgaccttca ccgcggcaga atggagtgcc ttcaaggccg gactcgtcgc aggggagttc
   153241 gagccccggc aggtcgccgc ctaggccccc cgcccgccgg ctgacgacct ccccggctcg
   153301 ctacacgacc ccaccagaat ccaacgtccg tcgaccgagc caggtcgacg gacgttcgca
   153361 tctccgaacc cgtgctacag cagatgaccc ggttcgaagc cgaactccac gaccagggtt
   153421 tgcaggcgcc gaacatcatc ggcggcgatc ggctgccatg tggacggggg gaggagcatg
   153481 ttctcggctg tgcgctggtc gccgagcagc ggagcgaacc gaacccttcc caggagatcg
   153541 cccaccgagg tgacgacgag ctcctccagc cgcccaggga cgtcgtcctc cacccggaga
   153601 cccattgcct tctgccagag aggggtggcg cctccccagc ggagtcgtgc gggcggccag
   153661 atgtctgcca cccgcacggt tacgtcgata ggggggtcca cccaccggca cggctggtat
   153721 cgggcctcat cgaacatatg agcgacacta gttcaccagg cgggcgcggg cctatccggc
   153781 tgctcgtatc atcaactcgg cgagctgcat gttcaccaac cgcagtgagg cgtgagtatc
   153841 gtccagggaa tcggagagcc gttcggagta ctcctccgct cggcggctca actgctggaa
   153901 gcggttgtgc aagttggtga gggcagcgtc gccagcccca ttcgccttcg ccgcggcgat
   153961 gtcttcggcc agcttctcga ggtcttcccg agcctggttg gtgaaggcgt tgacgatcat
   154021 ctcgcgcatc tcgtcttcat cgggcagggg gacacggacg aaatggctgc cggacccgaa
   154081 ccgcgcgacg acctcacgca gccccgccag ggtcgattcg tgctcggcgg tgacgaagta
   154141 gaccccgccg gtaggtcgaa ccttcagtcc cccaagggct tctacgtagc ggcggacgac
   154201 ggcccgaagg cggtcggggc ccatgtaggt cgagtgccag gtgtgcaggt cggtgacttc
   154261 cgcgagtagc tgctcgacgc gatcctgttc accctgcggg aggtccgcga tggcggcggc
   154321 gtccggctcc acccggagct tccccgcgcc ggcggcgtcg ggatcatcgg agcggatgaa
   154381 cgcgatgacg cccaggcggg tgtcgtagga cagctcggtg cgttcctcgt cgcggacctc
   154441 ccgcacgagg tggcgaacca actgaccgct gtcccggcgt acatggcgaa ccatcagtgt
   154501 ggccacccga tcaccggcgt cgtcgcctga cttgcgccgc ggacgggttt tccggtccgc
   154561 cgtgggatcg tcgagggagt agaccgcctt cactccctgc ggcccggtga cccgctcgaa
   154621 ggcgtcgtcg gcgcgcaggg gagggggcag atgcactgtg tccaagtcga attcgtcgaa
   154681 ccactttgcc agttcgtccg gagtgacctc cccccggaag atcgaataca gcaccagcca
   154741 gcccagcacg ggactcgctt ctgccttgtc ggtgtactgg tcgaagacgg acatggggcc
   154801 tcctcatcag ccgcaattca aaacgttcgt tttcatctcc accgccccag agaagtcggc
   154861 ccggtggaga gcgcgctcgg tcagatgact cggaacaggt ccgctgccgg gtgcgggtcg
   154921 gccaggtcgt cgagggttcg caggttgtca cacagcgctt ccaacacggc gctacggccg
   154981 gccgggcggc gggggtcggt gatggcgacc ccgaacagcc ggaagtccag ctcgctcttg
   155041 gccgacttcc aggtccgcat ccactcttct gtcacctcgg catccccgtc ggtgatgagc
   155101 acgatgtctc cgccctgcac cgcctggtcg ccgtggtgtt cggcgaggat gtcgacggcg
   155161 atgccgaggg gtgtctggaa atcggttccg ccggagaaga agctctcggc gaagtcgagc
   155221 actcggtcga gaggggcctc cccggccggg aatctgtgta cgctgacctg ctcagctgag
   155281 gagaacagga tgccgacgaa atcgcggccc tcggcacggg cctggtcgag cagcgcgagc
   155341 ccgcaggctt tcgcccatgc ctccgcgctg gcgatccgcc catccggccc ggtatgcggg
   155401 gcgcacatcg agtacgagca atccaggcac gcgatgatcg caccgcggcc gctgtggtct
   155461 tcgcccatgg tctcgtagag catcagctgc ttctcggcga agcgggcggc gaacaccgcg
   155521 cggagtgcgg ggtgcgcgag attggctgtc tcggaaggga tcaggcgagt caggtcgtcg
   155581 cccagagtga tgccgacgag ctccccggcc acgtgttcga gcttgcgggt gcgttcggcg
   155641 gtggccaggc gccggaaccg gccgaccagg tcggtgaact tacccagccg gccaccgcgc
   155701 aggcgctcag ccagccgggc gcgctcgtcg aacgacatcc gttgcagctg ccccgggccg
   155761 aggccccagg ccgccatcag cgccgcttcc tcacgcgcct gttcggcggc ggaggccatc
   155821 gcctggcgag cgtccgcccg cagcgtggcg ccgagcgcgc ctgctgccgc ttctgcttgt
   155881 gcgcgggcct gctgagccgc atcatcggcg gcttgcgctg cggcgaccgc gttgtcgacc
   155941 gcggcggcgg cttggccggg caccgcgccg tcctcgtcta cctgctcggc ggcggcatcg
   156001 agcgcggatt caacggctgt ggcgtgctcg gcggcctcct gctcggccgc agcggactgc
   156061 tcggcggttt gctgagcgtc ttgggactgc tcgagcatct gggccagggt cgagcgctgg
   156121 gcgatcaccg ccatagcggc ggcgtactcg tcaccaacgg tctcgcggtg gagatcggcg
   156181 tactccgggg tgccgatcag ggcggtgacg atggcgtggt tcggcagccg ggtgggctcc
   156241 atctcggcct gttcgcgcaa ggtgggttcg gccttgtaga cggtgaggaa gacatcgcgc
   156301 agcagatccg gcacgtagtc gaaacgccgg gacagctcct cttcgacctc ggccagcgca
   156361 gtggcctgct cacgcacctc ggtccaggtc atcgcatcga accggtcccc ctccacgacg
   156421 gtggcgtgcc gctcgggcgc ggtcgagccg aggccgaccc atcggcctgc cttgcgggcc
   156481 agatcggcga acttgcgcag ggtcttgccg gacatcgaat ccatccccct tcggtcagtt
   156541 gctgccggtc agggtgctga cgtccacgcc gagcgcttcg gtcatcaccc gggcatagac
   156601 cgccttgtgc cgggccagcg ccgcgtccac tgtggcagta gaccggcctg cggaacgcgc
   156661 gttgtggcgc agctcttcga gccgcttgcc cgccttaccg agcttgtggt tggcctcttt
   156721 gatcgcccac tgcgacaacg tttctcgtga ttgaccggcc ttggcgtcga gctgggcggc
   156781 catctcggca atggcgtcgg acaggtccat cgcctcccgc gcgtcagggt tgaccagcgc
   156841 gagtacctcc cgttcgacgg tgggccgctc agcgaccgag tcccacagca cgtgggcgag
   156901 catcggcagg tcgttgtcgt cgacctcggc gcggccgtcg aggaacgccg atgcctgaag
   156961 aaggcgaatg gcctgcttcc agcgtcgatc cgacgccacg agcgactgtc gcctcagcga
   157021 ggttcgcagc tggcagacgg tatcgaccac cccgtcgggc accgccacgg ccgggacgtc
   157081 gatcgtgacc gcctgctgca acgccgcgag ggtgaccgtg gtcggcgcgg tggcggccgc
   157141 agggctctgg acggcggagc gaatgagggc ggcgaagttc gacggatcgg ccagatagcc
   157201 gacctcgagc cggacgagca ggcgatcgta aatcgcggcg ctttcctccc cactgggcag
   157261 ctcgttggag gcggtgatag ccgagatcag cgggcagctg atcggggcgc cgccggattc
   157321 ggggtggtag agccgttcgt tgaggaaggc cagtgtctcg ttgagagccc ccaccgagca
   157381 cttgaagatc tcgtccatga acgcgatatg gcaggtcgtg gcccgcccct cgaacagctg
   157441 ggtgtaccgg ccctgggtca gggctgccac gtcgaccggt ccgaacatct tcttcgggtc
   157501 ggtgaatttg ctcagcagaa tctcccacag ctgggcatcg acgatccggc cggtcagttc
   157561 ccgcgccagc tcggatttcg ccgtacccgg cgggcccagg atcagcgagt gcttccccgc
   157621 aaggatcgct gcgaccaccg cgcgtacgac ctcggaacgt tcgtagaaca agtccgacaa
   157681 ctcatcggtc accgcccgca gcttgcgcgc cgtgtcggac gagtcgtgct ccacctgctg
   157741 tttcccgctc atgacctctc cccgttttaa tgggtaccca tttaatgcgg acgacactag
   157801 cacagaggtt ggacaaatgg gtacccacta agtgaggatg gggcgatgac gcccagcgac
   157861 ccgcacaagg ccccccagcg aacctggcgt cctgagaacg acgagtacga cgacgcgaag
   157921 aaactcctcc acgcccgcgg gcggggattg acggaatacc tgcgtgcctg cgtgcgctgg
   157981 ctgcgcgccg accccgacac agcactcgcg atactcggcg agcactggcc cgagccgcgt
   158041 acccgcggac gtcctcgcac ggaggagtct tcgcacgaag cgcctcgctg aacgcggggg
   158101 agagcggcgt cgtagaacga gacggaggga agccgcgggt gacatccggt ctggggaggg
   158161 gtccggatgc cgcgcgcctt ccctccgtga ggaggccgtc gccggcgcgg tggaaggccg
   158221 aggggagtgg tgcctcccac cgtgctcgat ggcgacggcg tggcttggac ggcaagggat
   158281 tacggtctga aacttgccgg aacgaccggg acgaacttcg cctccgggtc gtgtctgtcg
   158341 ggcgtgcagg cgtagaacgg ccccgccggg tcggtcagat tgcgcagcag agggtagaag
   158401 aagtcgcgga agtacacggc catggcggtt cctggctgca cgaccgcctc cagccaggag
   158461 cggcgcagcg accacagcac cgtcaccgcc tcggggtgct cgtaccactc cgagcaccag
   158521 cagatcgcgc cgttcgcgga gctggtggtg gagcgaggca gcttacgctg ggcccactca
   158581 ccgatattgg cgatcaccca ttccagcagc acatccatgt cgatctggtc cagatcggcc
   158641 ccggcggaga tcgcggcagg cgcggcaccg ccgtctccag cgccgctcgg ggcagccgcg
   158701 gcgggagcct caccaggggc ggcggaagcg agccggtcgg ccagaacgcc gagcgcagtc
   158761 tcgaactcgt cgagcccttg ggacgatcgg gcagcggtgg cgtcgacccg ctccaccttc
   158821 gtggacaaca gccggtgctg gttgcgcatc tcgacgagag cttcgctcag ggacgcgacc
   158881 tgattgcgca gttcttcgag ccgctcatcc ggcgattcgg tgctcacgcc gcgctcgctt
   158941 tcgcctgctc gtcgagtcgc cgccgcagcg ccttggcgac cgggttggcc gggcccaggt
   159001 gttcgatcgc ggcgttctgc acctccttgg tggcctcgtc gcggactcgt tcgacatcgc
   159061 ccttgtccgg ttcggtgtac caggggatga ggtcgatcag cactgggcgc gattcctgcc
   159121 tgatcagcag cgcgttgcgc ttcttcatcg cggcgatctc ttcaacgggc atgatcggct
   159181 ccagcgatcc acgatcgttg gaggtggtga cacctccggg accatgggag cggcgccgct
   159241 cacgaggttt gtactgtccg accagtccgg agatcttgcg caggaacggt tcatcctgca
   159301 atccggcgcc gaggatgcgc acggtggatg caccccagag ggcggccgcg tcgtccgcac
   159361 cccaggtcga gatcacctgg gcttcggact ggaaaatggc ggtgacgcac attgatttcg
   159421 acccgaggtg cgacgccaga tttggcagcc gtttgatctt gcagatgttg gcgcactcgt
   159481 cgagaacgag agtcaagggt ggatcgaccc ggccgccatg agccgaggcg gcgaggtcgc
   159541 cgagttcgaa tatcttggcg accatcgccg cgatcaccgc tccggcggag ccggaaccct
   159601 cctgggtcat caggtacagc gtcggggcct tgccgtcttc gtaggcgaac aggctccaca
   159661 agtcgagctc ggtgatcttc tccgtggtcg gctgctccca cgtgttcggc ggggtgatcc
   159721 agcgcaacgt ttcttcgtcc tggatgctgg ccagcgcggt ctgggcctca ccgaacacac
   159781 cgccacgggt ctcggcgggc aggtcgagca ccgcggcgaa ggcgttggcc gcacggcggt
   159841 ttccgtgctg gtgcaggatg tcgatcggtt tgtccgagta tgtgtcgatc caatccagca
   159901 cgtcacgcat ggtgcggccg ctcagggatg cggccagcaa cgcccaggac agcaggttct
   159961 tgccggtcgg ggcgaagaac gggtcctcgt tctgtccgga cccgccgccg cggttctcct
   160021 cgatgaagtg ctcggcgacc ttcttggcgt ctcgcagcgt ggtgatgccg gaaaggatgt
   160081 tccaccacca cgtctgggcg gcgtaggcga tctggctggg gtcgaagacg tagaccggtc
   160141 cgacgtcctt ccgcagggca ccggtcagaa tccacaggtc cggcttgttc gacgtggcga
   160201 tcactgcccc gggtgcggac agaatgcggg ggaccgcgac cgcggaggtc ttgttgctgc
   160261 gcggtcccat catcacgatg gtgaagtcct cgtaggaggc atacaccgac ttgcccttca
   160321 ggcggccgat cagcggcgcc agctcccgca tggacacgcc cttggccgac tcgatcgagg
   160381 cgcgcaggcc cacacctcgc tcagcagcct tcttcccgag catgtccggg atctgcttcc
   160441 tgtcgcgcag caacgtctcc ggcgtctcgg tcggccatgc cttccacacc acccacgcca
   160501 gcgccgcgag caaaaggcac agcagcgccc ccaccagccc gataaccagc cacgacgtac
   160561 cctgctcgtg aatgcggtag acgccgtagc agattccccc gacgaccaga accgagatcc
   160621 aaacccacgc cagcgcagag tcacccatca cgcacccctt cgcagaggac cgacactcac
   160681 cactcgcacc accagacccg cctcttgggc cgcgagcagc agctccgccc gcaacgcggc
   160741 ggccgcaccg gcactccggg tgcccggcac ctcgacgacg aagacctccc ggcgcgcggt
   160801 gagcgccgcc gcctcgagca ccggcagcgg cccgacgccg ggaagcgcac cggtctgcgc
   160861 gctcagcgcg gcgaggatca tgctgtggtc cagcggcagc atcgcttggc ggaccaccgc
   160921 ccagatcgca gcctgttccc cggccggcgt ctcgccgaag gtatccagat cagcggtcgg
   160981 accggattcc tcgttcgcgt gcagtagctg atacggctca ctgagatcac cggagtgaat
   161041 ccagtcgagc acatccgtga ggctgcggcg gccgcgcacg gccgccagca acaggttcgc
   161101 ggtcagcagc gtggcttccg ggacgaagta cagagccgcc tcatcgcgga ccacggagaa
   161161 gaggttttcg gcgatccggt cggcgtcggc ggcatcggtg atcctggcca gcagatccca
   161221 actgaaagta gttgccgggc ccggcaactc cgggttccac accaacgcct tgccccacca
   161281 ccgtcgcggc aaagccgcaa cgtggtcggt cacggtgatg accatggccg aggtagcgcc
   161341 gaccggatcg tggtcccagt cctgtgcgga gatgacgtcg cgcatcacga tcctctcccg
   161401 agtcggtcgt tcatgctgca tggctcctcc gtccgtcggg gttgagtccg gcgaaagcgc
   161461 cgtcggtgtt atagagctcg agttcttcgg gcgtcaggtc gacatgaacc ggcaggccca
   161521 tgcgggagcc agacttgatc agatacttgc cgcgacctgg gtgacgttgc ccgggaaccc
   161581 aggtcggcgg agcggaccag cgggtcacca actccttctc gccagaggtg aacgggctga
   161641 tcgcgtgcag gcgctccatt tcggcgttgt ccagcccgcc gatgactttg atcgcgttgc
   161701 gcgcgaccat gcccttggcc ttggcccggt cggcttcggt gggcagcgct tcgaggtcgg
   161761 tgatcgagtg cgtgctctgt gccgaaacca cacctcgtgc cctgttcaga cgggtcatgc
   161821 ggtcggattt ctccaccaga cccggcgccg cgcgcaatgc gcgccacagc tcgtcctggg
   161881 gctggaacac attccggcgc tccccggcgg cctgcttgcc ctcgatcagg ccggccgacc
   161941 acgcccacgc gcacatcatc gcggcggcca ccacgtcgtc accgtcatcc tcaaccgcct
   162001 tgagagacag cgagaccgcg ggcaaatcgg cgtcgatcga gaagctcgac gaacggtcga
   162061 acatgccctt gatcgggcct tcacacaaca acaccagggt gttgcgcagc tcccggatct
   162121 cgcggcggta ctcgtactcg tcgcgcgcgg cgaccacgcg ctgcaacggc gggcccgcct
   162181 catcgagaat gtgcacgagt tccgggatcg tgggatcggg gagatgatgc cgtgcgctgg
   162241 cgtcgtcggc ctggtcgaca gccatcgcca gcagcagccg ctcggtggca gtcagatcct
   162301 gcccgccgac gatggtgatc agcgactcca gcaggtccag tcgccggccg cgagcctggg
   162361 agaccagctg ttcgcggtgg ctgccgacag cggcgcgaat cgcgccgcgc agcgggccga
   162421 ggtcgagggg gttgaggctg tgcaggccgc gcccgatccg gaacaccttg ccttccagcg
   162481 cctccacgat cgggctgtac tcgtctttga tgtcgccggg gatcaccgcg gcgaagccgt
   162541 acgcgacgag gccgaccatc agccgtttgc agcaggtgga cttgcctatg ccgggctggc
   162601 cctgcaccca gaggcccgtg ttggtgacca gaccgtcgac gagccactgc gacgggtcga
   162661 gcccgatcgg ttcagcggtg tgcaggtggc ggccgaaggg gacgccccgg acgcgggcac
   162721 cggatgcggc cgggaacggg tagaggccct gaacctgggt ggtggtgccc gcatacaacc
   162781 gacccgcgtc gacgttgtgg gcgtacccgc cgaacggccg gttttcgccc cgcgcgttgg
   162841 gaatcggggg caaggactcg aagggcagga acgggttgaa cggggcctgt cccggctcgt
   162901 tctcgtcggt ctgttcctgc ttgcggtagg ccggagtgac gcccaacttc gccaaccatc
   162961 gctcggccag acctgcttgg gcccccgcac gctgccgcgc ggcggattcg gcttcggtga
   163021 tcagttcggt ggtcatgcca gccacctctg cgcggcgcta cgggagagcc cggcggtcgg
   163081 ctcgatgccg tagccgaggc ttgtcgcaaa cgcggcggcc tgtgcgccgc gtgcccgccg
   163141 gaactgcaac ttggaggcgc tgactcgatc ctcgatgtcg gcgcaggccg cggccaaggt
   163201 ttcctcgttt cgtaccgtcg tggtgatgta catcgtgaac tggcccaacc cggcgcccat
   163261 ggactcttcc tgagcggcct tgcgggcgcg gacccggtcg tcgtactcgc gctgggtctc
   163321 gtccttcttc gtcttcgcat tccagatccg gcgcagggtg ccggcctgga tctcgcgctc
   163381 gacgatctcg gcggcctggg cggcggtgta gggccggtac accagcgaga agcgccggta
   163441 gtacttacct ggactgacca gcttgagcaa gatgtggtgt cgcaccaccc cgctcggcgg
   163501 agccttgaac acccaggtca ccgagtatcc gctgtcgtgg tagtagacgt ccttggtcga
   163561 ctcggttcgc agcggccccg cgtcggacca ggacagcagc tcgtcggctt cctcgtcggg
   163621 agcgtcggag aggaacaccc ggatggcggg gtcgaacgca gcgcggatgt tgcggatgac
   163681 gctcgcggtg ctggcccgct cggtcaccgt cgccccagcc gcagccagcg cggactcgat
   163741 gcgcggcaac cagcgcacca cttcggccgc cccctccgag agggtcttcg gctgaggaga
   163801 cgccttggac aggtcgaaat tgaccgtcac ccgcatctgc acgtctgcgg tggtcgtccg
   163861 cgactggttc acgaccttct tcatgatcgt cttggccagt ttcggggcgt tccggccgtc
   163921 tcgctccatc cgcgccaggg tgtaggcacg ctggtcgacg ccgccggtgg gggaggactc
   163981 gcacgtgaac accactgagg aaatgatggg cgtgaagccc agatcggcga gccagctgcc
   164041 gtagttgcga acccaggctt cggtgtcggc cgtgtcggcc agcgttgtgc cgacagggga
   164101 caccttcagc accgcggaca ggatgccggt gcggcggttc cacagcaggc attggctgcc
   164161 gcctcggccg tcctccaccg tcaacggctt gagcggcgcc agcacaccgg ggaggttctc
   164221 gcctcggctg acctcttcga gaacgtcggc ggcgtgggcg tcgctggcgc ggcgattagc
   164281 ccaggcgttg cggacgttcc acgccacgtg ctggacgacc gtgcgccgag aatcgcccac
   164341 cgggacgatc gtcagagcca gcaccgggat ggcgatgagc aatcccatga acgcgaggac
   164401 caggctgacg aaagtggtga atgccaggcc aaccacggtg gcaaggatga tggccgttcc
   164461 gctggtcccg agtcgaccca gcccgaaccc ggtgacttcg cggtaaccgc cgtaacctcg
   164521 agtctcgctc atcgtgtgct cctaacctgt gtcgcctgcc ctgctggtgt tgtctttcgt
   164581 gttgcgtgtc gccggaaacc ggtgtcgttc atcgcatctc cggcccgagg tcgtcgccgg
   164641 tcatctccga gccgacgtca tcggcggcct ccaccgccga attggctgcc gacatccccg
   164701 cttggatcgc cagggttgcc ccgccggtgg cagcggcacc cgccgctccg gcagctgccg
   164761 atccgccacc cgccgctccg gcggctgccg ctccgcctcc tgccgcgggc ccggccgccc
   164821 caccgccggc ggcaccggcg atatcgacgc cactgcctcc ggcatcgctc ggtgtggccg
   164881 gtgtcccggc ggcgtccgga tgttcgggct gcgggccgcc ggatccggct tcgagttcga
   164941 caccggacga gccggagccg atcgccttct gcgaggcccc ggactccagc tggctctgcg
   165001 cgctcccgga tgtcagtgcc tgcgaccccc cgttgcccgg ggacggatca ggttctcccg
   165061 agccacccgg cccggtggcc gacatgaaat tggcgaaccc atcacccccg gcggacgtcc
   165121 cggcggacgt cccgcccccg cctccaccac cgccgctgag cgcagcggcg ccgagcatgc
   165181 cgcccgccaa cccgccgacc gcgaccccga gtgcgccgga gccgccggag acgtgcatgc
   165241 ccatgaagtc gaagaacttc agcatcgcgg ggagggcgat caccgccaag gcgaccacca
   165301 tcaggcccgt gaccaaggtg gtcagtgact gttcttcacc gatgagttgg aagccgagcg
   165361 agtagatgaa cgcagccatc ggtttgtaga gcaccagcgc aacgcaggtg gcggcaatgc
   165421 gggggaacca ctggcgtccc caggtggtga gctgtccggc ggcggcgaac aagatcatgt
   165481 tgtagagcac gatgattccg gcctggcgga tgaagcccat cacccactgg atgaacccga
   165541 ggatggcgcc gaccaggccg aggatcagga caccgccggg gttgccgatg gtggcggttc
   165601 ccagcattgc ctgcacgcgc tggccgaact ggttggcgtc ggtgtcgatc atctgccggg
   165661 cgaagtcgtc gccggcgtgg atcgccccgg aaaggacgat caacgccatc gacgagatga
   165721 cgacgtactt gacgccgccc agcaggactt gcgcaccggg ctcggtgcgg cgggagatca
   165781 tcatcaccat ggcgctggtg aggattccgg ccatcatgat gaagaagacg accttctgca
   165841 ccggctgttt gtcggccatc actcccgcgt aggacaggct gattgaatcg gtgccgatcc
   165901 accaggtcat cgactcgact agcagatcgc cagcgaaccg tccgatggac tccgcggcct
   165961 tgccgaatgc cgaatccacg gccttgccga cgatgttctc ggcgacggtt ccggggctca
   166021 ggtcgaaggt cctttcccgg gccccgttgt tgatctgagc ccggtacagg gtgtcgtcgt
   166081 tggggtagag gtatccggtg tccgggttgc cctcgcaccc agggaactcg gggtgttccg
   166141 agcaccagat cacaccgtcg gcgtcgcgcc agctcttttg ttcggcggtc agttcagaca
   166201 gcttctgcgg catgttcgcc gacggttgcg ccgcgacgat tcccggtccg gcgaccagtg
   166261 ccgccagcag cacgccgaga aacaccatcg gccgcagcac cgctcgcgca cctgcgcgcg
   166321 cacccggaac cgtcatggtg gactcctctc ctagaaggtc gtgaaccctt tcaggcccgt
   166381 ggaattcgga agttcaggaa ggccggaatc gacctggtac acccagtcgt tgccatccca
   166441 gagcacagcg cggcgctgga agtcgtagcc gcccttgttc gaggggacgg cgaagtagat
   166501 acgcgcgaaa gtcggtgtgt aagtggcgaa ctggaaagcg acgggctgac ggaacgccgc
   166561 gtcgaactcc tccggagaca ggttgcgggt ctgggtcact gcgttgcgaa cctgctgctg
   166621 ctggccgagg tcggcgcgca cctgggtgcc gagcagttgt tcgtatcggg tgtcggtcag
   166681 cactcgcgtg gagatctgcc aggcggcgat gagcgcgccc tgtggcgtgt ggctgtagcc
   166741 gtgggcccgg gggccatcga cttcggcggg cccgtcggga ccgaacggca gtcgtactcc
   166801 gttgatcagc ttccactcca gatcgcgtgg cggtgtcgcc gtggcgacgg caccgggctc
   166861 ggccggagtc gcggagttgt ccgagcggtc gcgaacgacg gctaccagga cgattccgac
   166921 agccacgacc aacacggcgg ccgcggccac gagcagccag cgtcgcgacg gtcgggggcc
   166981 ctggcttgcg gggcgttcgg cgaattcccg ggtggtgaac attgacgttt ctccttcgct
   167041 acagcggggt gaatccggtc aggtctgccg tttccggcag cgccggggcg atcagatcac
   167101 tgctgtagcg ccaatcgcca tcgcgccaca ccaccgcttg cctggcgatc cggtaggaac
   167161 cggagggccg ggggtaggcg taatagacgg tggcggcatc gccggtgtag gcaccgatct
   167221 tgaatccggc gggttgcacg gtgcttgcct gcaccgcgac cgggtccagc cggggctggg
   167281 tggaccgggc agtgaggatt tgctgtcgat ctccatccga gatcgcggcc tgggcgtcga
   167341 gtatgcgcgc gtagtccggc gagtacagga ttcgcatgct gatctggagc gctgcgatgg
   167401 ccgcgccctg gggggtgtgg ctatagccgg ccgcgaccgc cccgtcgatg cggctcggtc
   167461 cgtcggaggc gctgaacggc aggggaacac cctccacccg ctgccaggac accccttgcg
   167521 gtgcggcggt cagccagtcc gggtcggcgg ggctgcggct gaccggcacc tgggggacca
   167581 gtgatccctt cgcaggggtc gtcggggcgg cggctgcgct gctactggtt ccggggccgg
   167641 tggcgaggtc ctgtccgccg gagccggagt cggggccgat cagcgcgatc ccggtgacga
   167701 gtaccagcgc cgctgcggcg gcagcgccga tcagatacgg acggcgaaca cccgccaggg
   167761 gagtcttctc tcgaaactcg cgcgtagtca gtggcattgt ggctcaacct ctttcacagg
   167821 aagacgtgga tgacggtgta tgccgacccg gacagcacgg tggcgccgag cacgacgggt
   167881 agcgaatgca gcgccttctt cgcctgttcg gaccgccccc ggatgccgat catcagcacc
   167941 ccggcggtga tcagcactcc gccgacggcg caagcgagtg cgagcgtgcg cagccagccg
   168001 agcgcgtcgg cgatgaagga gtccagattt tcgggggcgt tcgcgggatc tccaccgaat
   168061 ttgtcccatt gcacgccacc ggttttgggg tcctggatgg gtatttgctc cccgctgccg
   168121 ccaccgccgg gactctgggg gctgagctgc tggctggggg tgggggccgg ggtggtcgtc
   168181 ggcggctgtg cgtgcacggc tccggccccc gccacggtca ataccgtggc gagcacgaac
   168241 gcccaggctg cctgtttcat tggaacgcct ggataattcc gcccgcgccg ccggtgatga
   168301 cgacgcccaa gatgaccatc ggcaggtgcc cgagggcgtt cttggcggtg tcgctccgcc
   168361 cgcgcaaccc gacgaacagc atccccgcta cggcgagaag cccgccgaac gccagggcgt
   168421 agcagatggt cttggcgtag ccgaggacat cgttgacgcg attacccagc tcgcccggca
   168481 gttccttggc gggcgggttg gggacttggg ccagccagtc ggcggccagt agcagtgtgg
   168541 acattggctt ttccttcctc gtgatctggt taggacaccc gcatgacggg gcgctcgtcg
   168601 ttgggccgca gctcggagct gctgtcggcg gtcgggggtt cgcgctcgat gagggcgagt
   168661 acggcgggga ccagttcctc tcggaacttg cgggccggtt cggcccagcg gtaggtcttg
   168721 cggtcggcgt cgaacacgcc ggtggccagc aggtcccatg ggttgtcgct cgcggcgagc
   168781 ggcgagaacc acggcagtcg aagcaccggg gtcgacaagt tggccgccgc catcttcagc
   168841 cgtcgctcca ccaccgatgg ccaccgtgct tcgctgcccg cgaccacgac cagaacggga
   168901 cgcacaggca tccgctgggc ggtagcgatc gcccagctca ctgcggccgc ggtcgcgcgt
   168961 gtcaccagta cgtcgacgca ctggcttccg ttggcctcga tgacacccat atcgatgccg
   169021 tcgagcagat gcgcgactgt cgtcgtgccg acgccaccgg cgatcccgcc caccaccgga
   169081 cgccgtgggg ccgcgctcat cgcgaaccca cctgagacac gcgccattca gcgcctacct
   169141 tgaccagtgc gatgccgacc accaagtgcc ggtccggcat cggccctgtc ggggtgttca
   169201 ccttctgggt gacctcgagg agccgcaccg ctgaagttgc cgtgtccgcg ggggctccgg
   169261 cctctacgcc cggacgaacc ccgtcggcgg ggacggtcag gacggcggag cgggccgtca
   169321 aatccagcca gtcggcgccg gggcctgcga tcggcggata gtcgcgaagc agttgggcga
   169381 gtcggggctc caatagcggc accgcgcgga gcttcgcgtc gtgttgagtc aggtcccgag
   169441 tggtgtccca cccgtaccag attcgcgcca ccgcggccgc gacagcgtcg acactggcct
   169501 ggtcgaccgg gccgatctcc gccggaaggg ccgccggggc ggtcagcggc gtcgacggcg
   169561 gtgtggcggg aacgcgcgag gtcgtctcgg tgggcgttac gaaggaggtt gtcgacgcgg
   169621 gcggcgtggt ggtctgttca tggtcggagc caccggacga gcacccggcg acaaccagcg
   169681 cagcgccggc cagcacggca gccgatgcag tccaactgaa ctttggcgtc attgtttctg
   169741 gattcctact catccgaacc gcctaatttc gattcccgat cccaaattcg acaagggcga
   169801 gatcttcacg acgtcgcccg attggggggc ctcaaccatt tttccgtcac caattgcaat
   169861 tccgacgtgc tgcgggtctc cgccgcctgg aaaaacgatg tcccccggct gtatatcgcc
   169921 gagtgccacc tctcggcccc gagggtcatt gaggatgctt gtggtgtagt gggggagctg
   169981 gattgttttt ccgctggctt gcccgaccgc gtacaccacc agtccggagc agtcgaaccc
   170041 gactttccca tagtcgccgt gggagtcggc aacgccaccg tctcgaattc ccagcgacgg
   170101 gccgtcgata ttgccgccgc cccaggcgta gggagttccc tgccagcaca acgccgcagc
   170161 ggcgacattc gcaccgaaac cacccccggg gcggaactgg ctgcaattgg ccacccgccc
   170221 gccgccggtg ccgatctggg tgtacttggc catcttggcc ttgactcccg gggcgtaacc
   170281 ctccgtttca ccgttgacga tctgagggcc gccattggcc aaaacgcagc cgtagccaca
   170341 gttgtaggca ttgaggacga tgtcgatcag atcacccttg atgcgcccgc tggccaggtc
   170401 cttcttcgcc tgctcgacgg tggtgcagtc gaacttcgcc tgcgccatga tggcgtccgg
   170461 ggggtcgaag ggggagatca caccattgcc gttggcgtcg acgccgtaac tcggccaggt
   170521 atagggcatg aactgactga gcccttgcgc accggccgga gagacggcat tgggattcca
   170581 gttcgattcc tgctcgatct gcgcagcgat gagtggggcc gagatctcct cgcacatggt
   170641 gccggcccgg atgacccacg cctcgtactc gggcggaaca gttccggtcg ccagctttcc
   170701 ctgcgcgaaa ctggggttgt ctttgtctcc atcgacgaag accgcgacga tcaacaccgg
   170761 aattaagagc aacgccaagg cgagcgctgc ccatttcaat ggtgatttca tcgcggtcac
   170821 acctccccag atgtgtgtat ttaatgctca tatccaccgt ggttcggtgg cactgtgttt
   170881 atccggcggt gagttctgag agaactctgt cgagtggcga ctgtccgctg gtgcccggcg
   170941 ctcccatacc gggcgccagc ggaaaggtca ccggatcaca aaccggcctg aattttggag
   171001 gtcagccatt tcacgatcca ttgagtggcc gtgtcgccac ttgcgttgac cttgtagtta
   171061 ccggcgtagg atcggtgcgc gtccagcaac aggtacgaga ccgcctgcga agcctgctga
   171121 atgagctcgt cgggcttggt caagctgacc agcgcgtcga actccggcat gttgatgacc
   171181 ttggagacgt catcgagcat cgtggatgag aacaccatct cggccagcgc gatcggcagg
   171241 gtctgcggcg aggtagccgc tgccacaccg agtttcgtga actcggtgat taccgacttc
   171301 gcggcctgcg cgatcacctg cgggtcggcc tcggcgacgt tcttcaccag ctcgaggccc
   171361 cggccgatca agtagtcggg cagatcctcg ggcgtgaggt tcagaagcgg gacaaccgcc
   171421 gcgacgacct tggacttgcc cgacagcgag cacaccgtgt cgttgggcgc acacattgtg
   171481 gtcactcgct cggcgagcac acccattccg ccctcgcgct cgccgagaac gccttcaccg
   171541 ccggggttgg agccgatcaa ggtctccgag accgaggaga gcttcgtact cgacgagccg
   171601 cttgaggtgc cggtgctgcc ggcgaagtcc gactccgcgg tggccgagcg cttcgggtcc
   171661 gacagcaggg caccggccag gatacgcgac ggatcgaccg ctcccttgcg gttgcccaca
   171721 gccgacagga aatctccggc gatcagcgcg ccctgcgagt agcccaggat gacgaacttc
   171781 gacaacgggc acgcggcggc cagttccttg gctcgggtgt tcagcgccga cgccccgttc
   171841 tcgcgggact ggctcagcgt gagcgggttt ccggtgaaca tgcccgcgat cggcccgccg
   171901 acctgagcaa cgtaaggaac ctgctcagcg cgcaccgacg ccgtcgcggg cttctgcgcg
   171961 gtggcagagg ggcgcggtgt tgcggacttc gccgccgacg tcgccgccga cgtcgtcgcc
   172021 ggggtcgatc ccgacagcgt cggcggagcc gaattcaatg ctgcgagaag cgggcccgta
   172081 acctggccga gcattcccgg cacgacgtta cgatccgctc ccgcactggt ctcccacgtc
   172141 ccagggacgg cgagggtgat cacatcggcg cagtccgtta cagcgggact ggcgccgggg
   172201 tcggccgatg cgaccgacgg ggcgatgcag gtcagcgacg ccgctatcac cagcgagccg
   172261 gctacccgcc ctccgatcat cgcggcggac atcaccgcac cagcccttgc actgccgcca
   172321 acgcaccatt ggccgcatcg gtcaggggtc cgagctggtc aggcgtgaac gcaggctgct
   172381 cggtgaccgc ctccacgacc gcatcggcca ccgcagccgt ctccggtgcg gcctgtgcgg
   172441 cagccacgac atcctgtgcg acctgctcga caacgccgac ggcctgagtg acggtgggct
   172501 cgctctgagc ccactggtcg acctgatcga cgaccgcggc ggcctgctcg agcacctgct
   172561 caccgccggg ctgctcctga acccaatcga cagcctgctc accggcatct accgcaacgg
   172621 cggcctgctc actgaactgg tcggccaagg tcgggccggg cgggggcacc tcgcgctcct
   172681 ccatgggaat ctcgccgtcg ggggccggac cggtgtattc ggagccgtca tcggcgagca
   172741 gcacgaaccc gaccaggccg ccgatcgctc cgcccgcgac accaccagcg atcgcagccg
   172801 ggatgccgac gatcgcggca ccggcggccg cgccagcggc ggcgccgatc gcggttccgg
   172861 cgacaccgct ggtgacagtg ccgatcacgg gcacggggat gagcgtgccc atcgcggcac
   172921 cggcgatgcc gccgatcgtg ccgccgatca gaccaccggc gatgccgcca aagaccgcag
   172981 cgggaacgcc gatgactgtg gcaccgatgc acgttccggc cgctgccccg atcaccgtgc
   173041 ctccggcgag tgcatcggcg cgcgaggggg cgattccgac cgactgcaac gccgtgttgg
   173101 tggcctgctg ggcttcgctg atgtaggcgt tggccttcca cgccacatcg atcggcaccc
   173161 agtcaggcgt agggatggac gctcgcttcg agccgattct ttccggcccg accggcaccc
   173221 agtacttcgg cttctcgggc accggggccg gggcgtgcag ggtcagcagt tcctcgccca
   173281 ggctcggctc gggcgcgggg gcacggtact gcggggtcgg ctcgacgtag tagtaggtct
   173341 gcggagccgg ggtactcggg gccggagtgt cgtagtacgg accgacctgg acaccaccac
   173401 tgggcggcgc cgtctcgtac tcgctgggag cgtgcgaggg tgggtcgggc aggattacgc
   173461 ccaacggact ctgggactgt ggcttgggcg ggagcacggg agcggtcgac accccgggct
   173521 gttcctgcgg ttcggccggg ccggtgattc ccggctgccc cgacggggcc gcctgtgcca
   173581 caccgcaagc ggtcatcagg accgcggtgg cgacagccgg ggcgaccgcc acgcggatga
   173641 ggtcggttcg gattccggtg gagcggcggt gagcggccga tcgaggtgtc ccgacacggc
   173701 gggagccgct gtaagggatc ggcgtttccg ccttatcgct gcacgcgctt gcggcagcag
   173761 gacctagtgt tgtcattgca gagccttcct tgagtttctg cacctgctcc ggggcggttg
   173821 cacccgaatc ccggagttct ctgggccttc cccccgttgc accgggggga aggttccttc
   173881 acttcgtgac actgagggcc tcggctgtgg ttgcacccac accctcgggg ctcagcgcca
   173941 cacgctcaga cgctccctat cgcgccacct tcctgggatg atacgttatt cccatacgat
   174001 acttgcatac gttgcgagac ttctctaggg ggtgcggcaa ggtgttccct gatggaccac
   174061 cgaccccggc gcgcgcaatg acgcgacgca tcacgcgcgg attcgacccc gcggcgctca
   174121 agcgcgcccg cgaggagcat ccgaacgagg atctccgccg ccgggccgag gttgcgcggc
   174181 tggccggtgt gggcgtcgcc acaatccagc agtgggaggc tggaaagaaa tccccccagg
   174241 tcaatctgct gttccgggtc gccgccgtac tcggcgttcc gatggagcag ctcgtcccga
   174301 ttccgcgtga gcagcgctat ctgcgtgact ggcgcgtcct gcgcggcatg ctggaatcgg
   174361 acctggctgc ccgtaccgga atcagcggtt cgtcgatagg gcgcctggaa gaaggctcgg
   174421 ccgccctgac cgacgaaaac gccaaccgcc tcgccgaagc cttgggtatc accgccaccg
   174481 aggtgcgtgc cgcctacgac cgggcccgca accgtgctgt cggcgcgcct gcctgaattt
   174541 ctaccccgca ccaggctcgg cctgctcggc accgtgaacc cccttgcttc gggctctgcc
   174601 ggaacgctga gcggctccag caggcgggat cgtgcactcc actcctgttt cgtgagatca
   174661 cacacccccg gagcgtactt actctgcgtg ctgcctgcaa gcacttttca ctacgaaatc
   174721 actaacatat tgccctttcg ggctgaactg ccctggttgg gtgctgactt gtcgtgaaca
   174781 tttgactaca ctcttgctat gccctccgga catccagagt tcttcgggga agtcgtcaag
   174841 gctcgccgtg agtacctcag cctcaccatg gccgaggtgc gcgccgccgg cggtcctgcg
   174901 cagacgacaa tggtccggac ggagcgtgga gagctaggca aaccgcagaa aaagatcttc
   174961 gcgaagttcg acacggcgct gcgctgggtg cctgggtccg ccgcggccgc ctactggaat
   175021 cgggaaacgc cggtcccact cgaacttgag cagccagctg ccccgccctt gaacctggcg
   175081 ggctccgacg tcgaggttcc tctcgaccag gtcatcgcgc tgatggaatt acagcgtgat
   175141 ctcaacgccg ccgcggaagc gcggcgggaa ttgagtgccg actccgtcca ggatctcgcc
   175201 acacgcctca acagggaggt cagcctgatc gttggccgct gggccaccac tatgctggaa
   175261 cgtaaccgtg gcacggaagc ggtgcatccc gggctcgaag tgatcttcgc cgatgcactg
   175321 tccactccgg tcgaccccgg cactccggac gccgaagagc gtttgtatcg gcgctggttg
   175381 ctcggtggcc gctcggctgc tggcctcggg gaggagctac gccagaagtt cgagcggcgc
   175441 tatcggcagg gaggaggtga tctggatgca gaccaatgac gggtctttac cgccgctcag
   175501 cgcgcgcgtg acccgacttt tcgctacctt ccatgcccgc tccgcacccg aacagtccgt
   175561 cgacgacgtg gcacggtcgg tcagtgcgat gttgggcagg atcgtccccg gcgctgagat
   175621 caccgcgctg cgggcgggcg aatacgaccg cgactccgcc gatcctcaga tccttgccgc
   175681 tctcgcgaaa cacttcggtg tccctccggc ctacctggcc ggagcggacg ccaacgtcgt
   175741 gcgccaggtg gaaaaggaac tgctgatgct cgcagccacc cgcgatgccg gagtgcgaag
   175801 cctgcgcttg cgcggcaaga aagtcgacat cggcgaactc gccaaccacc tcaaacgact
   175861 ggccaaacgg cggtctgact cgccggacga ggcggcaact cgcgacgtac ccgatacgtc
   175921 tgacctgggg gaatagactc gagcgaaggt aggagatgac cgtagtgaga ggggagggcg
   175981 tggtgaacaa aatgaccacg cggttcgcag agctgagcaa actcgtgccg atcccatacc
   176041 cctgggatac tcgcgagtac attgcgcggg tagccgaata ccgcggccgg ccaatcgaat
   176101 tggtccctat cgcccccggt gccctctccg ggaccggctg cggaaccggc agcgcattgt
   176161 ggctggagct cgacgactcc gacgtgatca tgtacggcgc ggacaccgag tggcacgccg
   176221 accacatgat cgctcacgag atcggtcata tactcctcgg ccacggcagc accgggggag
   176281 aacccgctcc cgctgacgat cttccgctcc acgaactcat gccgtcgctg tcacctgatg
   176341 cgatccgcaa cgtcctgcgc cgacaggact acgacagcga cagggaacgc gacgcggaga
   176401 ccttcgccga tatggtgatg gtcgaagcga ctctgcccca acggaaaccg agccggttcc
   176461 ggtcaacctt cttccgagca cggcaccgat gacctccccg atccccggcg tcatcgcctg
   176521 gccggtgctg ctcctgctca ccgcggtcat ccttgggcgc tactggctgc tacgagacgg
   176581 cactgtggac aagctcatca accgcgcgct ggtcattgca ctcttcgggc tgctgctgcg
   176641 ggaagcatgg ttcgagcact tgctgatcgc gatcctgccg ttcgacgatg ccgacgtcgt
   176701 tcacttcgca cgccagattt ccttcggctg catcctgttc accgtctcgt acatctacgg
   176761 tatcgctcaa ctctgggcag gagccgaccc ggaatacacc tggcagcggc aacgtcgcta
   176821 cgacctcgtt gccctggtgt cgaccatcac catcctgatt gccggcactc cggcccgccg
   176881 cgccgatcaa ctgatcgacc agcatatggg cgcaggggcc gtcatcgcct gggttgcgtt
   176941 ctatctcccg atcgcggcca ccgccctgct cgttgccaga atcagcatcc gcgagttgcg
   177001 cggcgccgat gagaacacct cgtggcgaga gcgcagcgta tacctcggtg tcctggccat
   177061 cgcgatcgca atcggtgcgg actcggtctt cgtccctgtc gtaacggccc tcgaagtctc
   177121 agccgatcgc ccttcggcag accccgacat ggaggcgaag gcttggacct tcttcggcgc
   177181 caccgtcgca gcaggcgccg tcgtagcagt accgctgatc ggcacggttc tctccctttc
   177241 cgggtgggac cggacaagtc gctactgccg caggctgaaa ccgctgtggc gcgacctcac
   177301 cgcggccgtg ccggagatcg ttctcgctct gccacaggat cgattcggcc gagtcgaacc
   177361 ggccacccgg ctgcaccgaa tgacggtgga gatccgcgac agcttgctcc aactcaaacg
   177421 ctacggagcc gtcgacgaac ccgggcaagg cgccgacgta tacgcacgcc gcgtcgccgc
   177481 ggctatcgca gccaagaacg ctggcgtggc cccccagatc agcaaagcgc ctgccgggcg
   177541 ccctgcattc gtcggggcac gcgacctcac cgcagagctg caacagctgc tcgacctcgc
   177601 cgccgcctgg cccaccgcca agcggcaggc cggccgaacc gagtcgccgg acacggcact
   177661 gacccagtag gagttccaat ggcagtgaca acttccacca cctcgggtgg ccactccaat
   177721 ccgccgttgc cccacccgaa atggcggctg ccgatcatca acgacctact caccatcaac
   177781 cccatcaagc ccaccctcac ttcgctgcgg gacgccgagc aactcggcgg catcttcgaa
   177841 cggcgcctcg tcgactggcc catgatcgtc gtctccgact ccgaactcat caccgagatc
   177901 tgcgacgagc gcaactgggc caaacacctc ggcgtcccgc tccggaagat gcgccacatc
   177961 gctcgtgacg gcctgttcac cgcccgcaac gatgaaccga actgggccaa agcccacgct
   178021 gtcctcgcgc cagccttcac caaggaggcg atgcgctcct accaccagac catgctcacc
   178081 acgatcggcg aactcctcga ttactgggcg aagcgcgatg gccagtgggt cgacgtcggc
   178141 gaggacatga acaaactcac cctcgagatc atcgcccgaa ccggattcga ctacaccttc
   178201 gacagcttca cacgcagcga ggtacacccc tttgtcgccg ccatgctgcg cggactgacc
   178261 tacatctccc gcaacagcaa catgccgccc ttcttgcaga agaccatcgg cgcccgcgcg
   178321 gccgcacggc atagccgcga catcacctac gtccgaacgg tcgtcgacga cgtcatcaaa
   178381 gcccgccaag ccagcggcac cgtaggcgac caccacgacc tgctcgaccg gatgctcacc
   178441 gtgcccgacc cggcttccga cgagctcctc gacaccacga atgtccgcag ccagatcctc
   178501 accatgctcg tcgcgggcca cgaaaccagc gcgggagtcc tcgctttcgc gctctacgag
   178561 ctcagccgcc gccctgaact cgtcgctgcc gcccgcgccg agatcgagac acgcttcgcc
   178621 gacggcgacc tatccacaat cgcctacgac gacgtggcga aacttcgaac cctacgccga
   178681 atcgtcgacg aaacgttgcg cctctacccg gtcgcgcccg gcttcttccg tgaagcccgg
   178741 cacgagacca cgattggcgg cgggcgctac cggttcgggc ccggcgactg ggtactcgtg
   178801 ctcacactgc acgcccaccg cgaccccgcc acgtggggcc ccgacgccgg cgagttccag
   178861 cccgaccgct ggctgcccga acgaatgcgc tctctggacg gacgtcaggt attcaagccg
   178921 ttcggcaccg ggcttcgcgc ctgcatcggt cgccaattcg cctaccacga gatcgttctc
   178981 gcgctggcgc acatcctgca cacattcgag ttcacccccg atccagggta cgaactcgac
   179041 atcgctgagc agatcaccct caagccgcac cggttcaggc tgcgactcaa ccaccgctga
   179101 tcggcgggat cgcctggccg accgcgcggc gtagccgacg gctgccgacg cggaatgatg
   179161 attaatcggg agctcggccg cgcggccaac gatatcgggc aggatcggca gcgtgaccga
   179221 tatcgcggcc gccgacgagc gcgcaatctt ggaccagtta cgcagggcgc aggacgctca
   179281 ccacgggtgc gatcagccca ccgcgagcgc gttgatagac gcgctcgacg ccgattcgaa
   179341 tacgtagtga cgaacaccgc ggtcgcggtg cgcgcggccg cgcgccggtc cgcgaccgtc
   179401 agggcctcgc tctgcgcggc cagcgtcgcc gtgtcgccgc gttcggcgac ggtcagcgcc
   179461 aaccgccgaa tccgatcggc accgggctat caacgctgtc gagatcggcc aagtccaccg
   179521 gaagtcccgg gcgtgccggt gagccttcca cgccacgatc agcgtcgcgg tttcctcgcg
   179581 gtgaacaatg tgacatcccc tacctcgctg agactcacct cggtgaaggc gcttctcagc
   179641 gccttctcca gcccgccccg gtcgtccgct gcgttgttga acgccccgac ctgcgtgtag
   179701 atcgcggtca acacccggcc gaacagcgtg ctgggcttcc ggttgaggat ggtcgatccg
   179761 aacagcacgc cgtcgtcggc gagcacctgg gcgagatgag cgaacgccac gcctttctca
   179821 ccgaaatcgc ccggtaggca gtgaagaacg aagttgatcc cgatcgagtc gaacccaacc
   179881 ccagcgcttt cgggcacggg gtctagaacg cttgctgcga cggtacgcac ctcgcaggtc
   179941 ctaccctcca gccgacggcg agtatgcgcc agaggctccg ggttcaggtc catcagcgtg
   180001 acggcggact ccgggggcag ctcggcgttg gccaggtacc acccggaacc cgggcctacc
   180061 tcgaggtgct tccggccgat gaaccggttg tactggtcca gcatgacctc tgccgggcat
   180121 tgccaggcga accggtccga cagcttgatg acccacaagt cgtagaccgc caagaacgcg
   180181 ggcgtatacg gctctgcggc gatacgggcg gcatccttgc ttgccatcgg tcctcccagc
   180241 tcaaggaacg ggttcatcgt ctggaaccct cacacgccag ctgaccgtgc tggcgaagtc
   180301 cgggcccagg atctcacaca cccctggcac tcggcgcagg atcgcattgc cgcgcacccg
   180361 gaagaggtca ttgtgcgtta atgtatctaa agagtctata ggcatcagcg aggagggagg
   180421 ccgctatcga agtggaggct ctggcacacc aacgaccgtg gccagcagcg attcatcttg
   180481 gttaaccgaa atcagcgtgt cgcgcgcttc ggcgcaactc tccatgcaag gatgtcgcac
   180541 atggctggag taaagcgcct gtcgtactca cgaaagacgt acggcttcaa gctgcatgag
   180601 aacgtcgaca aactgatcga cgagttggcc gccgccgaaa ctggaggcga ccggagcagg
   180661 ttgctgacgt tgttggtgtg cgagaggcgt ggtgtcccag tcgacgagat cctcgttccc
   180721 gatgaggacg gccaggagtc actactcgaa ggcaccacga aacaggaggt cacaaggaag
   180781 cgccgacagt cggtcgcata gtccggggcc agctcacgcc ggcacgccct gacgaccagc
   180841 cgagaccaaa gaccacaaac cgaacaatcg accgggttaa ccacatggac gggagccctc
   180901 agccacgcct agccgagagc tcccggttcg tccatggggg atgagcattc gccttctcat
   180961 ctccacggtg taccccctca gcaacgaaag gccatccctt gctgaaggaa tccagggtcg
   181021 aggataccgc acgcccgaaa tccggttcaa ccgaaaccgc ggagtgtgtc gaaaactcac
   181081 cctcctcaaa cccaagcggc ggcccaccag ggcccccatc acagctcaaa ttgcgcgagt
   181141 tggaccgtgt cctctactcc ggtccctacg ttctcatcga cgtcgacaac cattcgccgc
   181201 gccggacccg gtctctcgac agggcgtatg ccgcgatcga caccggcgag gtcgccacgg
   181261 ctggtgggac tctccggccc ggtaacgtcg gcgcagacat cgaccccctc ccagagcatg
   181321 ctgtgctcgg tgacgccgtc gccgaggtac tcgtcgggtg gctccacgat cagggcatct
   181381 cctacatcgc acgtgagtcc ggccggcccg gaggtcggca cgttgtaggc gtcggcgcat
   181441 cgccggacca gatggaggaa tggaaccgcc tgtgcgccga taccgcgcag gcgttcggtg
   181501 ttccggtcga cgaccgctcc ggcggcgtgc tgagactgct cgccgccccg catcgcaagg
   181561 gttacgccgc acctgtcctc ggcggaacgc tgacgctgaa cgccctcgcc gtgaggacgc
   181621 ggcccagccg ggtccgcagc gctcgcccgg cgcgccggcg gccttcacct agctctcgcc
   181681 ccgcgcctac cagtcccgac acctcccgct ccgcgcggga gtacgggcaa gtctgcgcca
   181741 tgatccgccg tggatgcacc cctgctgagg cgtggcgggt ccagaaccgc cccgggagca
   181801 aggcttccga acgcggagag caccgctggc ggcgcttcgt ctggctcgat gcccacacca
   181861 ctgtgtgcgc cgaggaaggg cttacgccgg agcaagcgtg gcagcgtgtc agcgcggcca
   181921 gcccggccgt gtgccgcaag atcgggcggc gcgcgtggca gcgcctctgg gagcgtgcgg
   181981 tcgatcaggc gggcgtccag cggccgcgcc ggcgccgtct gccgcccgcg tccgaccctc
   182041 tgaacaagtc gacgggagag gacaacgcgc ggatcgccgc tgtcgcagcg ggcctcaaag
   182101 cagcactcga tgcgacagat ctgggcgtgc gccgccaacg acggaggaac tgcgagatcc
   182161 tgctgctgaa cctggctcca gtgctcgtcc ggcgcgaggg ctcgatctcg gtgcgggaca
   182221 tcgctcttcg tgcaggcatc gacgtgaaaa cgttccgcgc atgccgcgat ctactcatcg
   182281 ctcacggact tctcgtgacg gcgcatcact acgcaggcgg tgcgtcggat agccatgctt
   182341 acgcgatggg accagcggct cgtcctcacg ttgaagacgc agtttcgaaa atttccccca
   182401 cttgtccgaa ggacaccccc ctccccctac ctccctccgg ccgcgcggac cgcacactcc
   182461 tccgcacccg cttccgccgt gaacgccacc aatggcgaac tcgctgcgca gccctagacg
   182521 acctaccccc tggtgagtcc ttggctagca gctcgtcacc tgcgatgaag gcgtaccgct
   182581 cgttgcgcta ccagcagcga tggtggcgca acctgtcgtg cgacgagcag gaggcacgcc
   182641 ggactgcgag gcgcgcgacg ctcgagacgc tggcccccag cgctcgttcg gcctggttcg
   182701 cctggttgga tcggcggaat agcctgatgg ccgtagtgga ccgagccgcc gccggaccct
   182761 tcacctcgac cgaccgatcc gtcctggctg ctgcacctcg aactgtgcac atggggctgc
   182821 aagaccccag ctggcagccg ggcagccgtg ggagcgggca gctcgtcttg gctgcttagg
   182881 ccggatgccg atcgtgcggc gcgcgtaacg ccaggtggac gccccgagta gcttggaagt
   182941 ctggagccgg ggatgccttg agcgctggtg gcttgtgacg gagatggaca tggctaggac
   183001 ggcgacctga tcgtcgacgc ggtccagcgg gctggggcgt cccggtgtcg gctctgctag
   183061 ttggccgtgt cgaggtaatc accgcgtgag caaggaggca aggtgactgg attagtccga
   183121 gcagcgccgg ccgactcgcg cctcgacccg atgcggcagg acaaacggtt cgaggacagc
   183181 cacgagtgag aacttcccac acaacgccag agttgtctcg ggttgtggaa caggtcggtg
   183241 tctgcggaaa cttcccacac agcgaacacc gggtaaacca cggtttaccc gagaccggat
   183301 tgagtccgcc ggtggcgtca ccggaccgag gggccaccac cggtgaagcg gctttgtcag
   183361 gtgtggaaag ttcccacact gccgcaattc tgaaacgtcc gttttagcag tgcggccagg
   183421 ccgcgcggcg cacaggccgg tagccgagac gttcgccggg ctcttccggg tcgaccaccg
   183481 acgcctgaga gacgctcgcc agtccgtcac agtgacgaaa tgggttggag taagaccgac
   183541 ggcgggcaga cgcagtcttt cggtccaact tcaggtttgg ttcggggggg cttcaggcat
   183601 tcgtccgtgc tcgtcaggtc gcggcacgcc ggccgaatcg agccaggcgt tgacggcatc
   183661 gtctactgtc ttggagatga cgtagccgcg cttcttgatc cactcgagac gagcgatcgt
   183721 cgaagcatgg agctgcgtcc cgaactgctt tttgccgacg ccttttcgaa ccggcagctc
   183781 cacggccgcg gctactgggg aatctccgct ggtaggtgta ctgcgcgaag cgttcacggg
   183841 aactcctcca atgaagatgg accatcgggt tcttcggtgc ggtttcggcg aatcgccgcc
   183901 gtagccgttg acactagaaa actatcttat atcctctctt acagtcgcag ttaccaccgc
   183961 ggcgattctc aaacccaaat ccgaagtagc ccacaagatg tgggcgaagt acacggaggt
   184021 agaacc
//