LOCUS       AP006618             6021225 bp    DNA     circular BCT 25-AUG-2017
DEFINITION  Nocardia farcinica IFM 10152 DNA, complete genome.
ACCESSION   AP006618
VERSION     AP006618.1
DBLINK      BioProject:PRJNA13117
            BioSample:SAMD00061069
KEYWORDS    .
SOURCE      Nocardia farcinica IFM 10152
  ORGANISM  Nocardia farcinica IFM 10152
            Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae;
            Nocardia.
REFERENCE   1  (bases 1 to 6021225)
  AUTHORS   Hattori,M., Ishikawa,J. and Yamashita,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-SEP-2003) to the DDBJ/EMBL/GenBank databases.
            Contact:Jun Ishikawa
            National Institute of Infectious Diseases; Toyama 1-23-1,
            Shinjuku, Tokyo 162-8640, Japan
REFERENCE   2
  AUTHORS   Ishikawa,J., Yamashita,A., Mikami,Y., Hoshino,Y., Kurita,H.,
            Hotta,K., Shiba,T. and Hattori,M.
  TITLE     The complete genomic sequence of Nocardia farcinica IFM 10152
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101, 14925-14930 (2004)
COMMENT     This work was done in collaboration with Jun Ishikawa, Yasutaka
            Hoshino, Haruyo Kurita, Kunimoto Hotta (National Institute of
            Infectious Diseases) and Yuzuru Mikami (Medical Mycology Research
            Center, Chiba University), and supported by the Research for the
            Future Program of the Japan Society for the Promotion of Science.
            The genomic sequence assembly and annotation was carried out by
            Jun Ishikawa (jun@nih.go.jp). The complete and fully annotated
            genomic sequence is also available at http://nocardia.nih.go.jp/.
FEATURES             Location/Qualifiers
     source          1..6021225
                     /db_xref="taxon:247156"
                     /mol_type="genomic DNA"
                     /organism="Nocardia farcinica IFM 10152"
                     /strain="IFM 10152"
     CDS             1..1989
                     /codon_start=1
                     /gene="dnaA"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_10"
                     /old_locus_tag="nfa10"
                     /product="putative replication initiator protein"
                     /protein_id="BAD54843.1"
                     /transl_table=11
                     /translation="MDDEQNVLATVWPEVIAELTTGSADGSIPAVTRAQQAWLKLVKP
                     ITVAQGFALLSVPSSLAQEAIERDLREPILRSLGRRLGPQVEGLGVRIAAPATPTAER
                     AAANPRHARMTSRPERPRGERPVPGLPGQEAVDRPETLPRYSQAAESVPGYPARQDHS
                     RPGDYPPAAEYTPAAEYTPAAEYTPAAEYSPEPEYTPATDYPGADDYPTTVFRLPPGG
                     FAEPPGDGRPGGVPEISTPRRDGHGPRRDATPPGQEALFTPEPGDRPLRDTDRPLREP
                     AAGHDVRESDGPVERDDEPVVNIRDSWPTYFAKNQESTPAPANSSASLNAKYTFETFV
                     IGASNRFAHAAAVAIAEAPARAYNPLFVWGASGLGKTHLLHAAGHYAQRLFPGMRVKY
                     VSTEEFTNDFINSLRDDRKVAFKRRYRETDILLVDDIQFIEGKEGIQEEFFHTFNTLH
                     NANKQIVVSSDRPPKQLATLEERLRTRFEWGLITDVQPPELETRIAILRKKARMDRLD
                     VPHDVLELIASRVERNIRELEGALIRVTAFASLNGQPLDLSLAEVVLRDLMPDTATLE
                     INAATIMAVTAEYFNTTLEELTGPGKARPLAQARQIAMYLCRELTDLSLPKIGQAFGR
                     DHTTVMYAEKKVRKEMTERRRVYDQVQELTARIKQRSR"
     CDS             2846..4006
                     /codon_start=1
                     /gene="dnaN"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_20"
                     /old_locus_tag="nfa20"
                     /product="putative DNA polymerase III beta subunit"
                     /protein_id="BAD54844.1"
                     /transl_table=11
                     /translation="MKFRVAREDFAESVAWVARSLPSRPPVPVLGGVLLVANEDGLTV
                     SGFDYEVSAQMRVAAEVAGPGEVLVSGRLLADITKALSNKPVDVSVDGTRVLITCGSA
                     KFSLPTMPVEDYPQLPEVPQQTGELSVDVFAEAVGQVAVAAGRDDTLPMLTGIRVEIE
                     GSQVVLAATDRFRLAVRHIEWTPARPDIETAVLIPARTLSEAAKTLGASDAPVQLSLG
                     TGAGSDGLLGIVNAGRRTTTRLLDAEFPKFRQLLPKEHTSVATLAVAALTEAIKRVAL
                     VAERGAQVRLEFSTEGLLLSAGGDDAGRAEEWLEADFRGEPLTIAFNPGYLVDGLSAL
                     HADRVTFGFTTPSRPAVLLPASEEEPQTLDSGAFAALTGNYTYLLMPVRLPG"
     CDS             4063..5229
                     /codon_start=1
                     /gene="recF"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_30"
                     /old_locus_tag="nfa30"
                     /product="putative recombination and repair protein"
                     /protein_id="BAD54845.1"
                     /transl_table=11
                     /translation="MFVRALSLRDFRSWEHVELELSTGRTVFLGANGNGKTNLLEAVG
                     YLATLGSHRVSADAPLIRSGAQRARVGANVVNAGRELRIDVELNQGSANRAQINRSPV
                     RRTREILGILQTVLFAPEDLALVRGDPGERRRFLDELCTARLPRLAGVRADYDRVLRQ
                     RSALLKTAGRHARSTADLSTLDVWDGHLAGHAAVLVAQRLRLVHDLFPYLAEAYRSLA
                     PESRPAAIGYRSAYLPGEFLDPARAPRDDDAAALEEIILRELAAARRKELERGVCLVG
                     PHRDELELMLGDTPAKGFASHGESWSFALALRLASFDLLRSTSAEPVLLLDDVFAELD
                     RRRRTALAAVAADAEQVLITAAVPEDVPAELSATPIRVATAGEAGHRTSHIVTG"
     CDS             5676..6245
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_40"
                     /old_locus_tag="nfa40"
                     /product="hypothetical protein"
                     /protein_id="BAD54846.1"
                     /transl_table=11
                     /translation="MSEESDQTPGGAGTPQEPPLRGVDLARRALEEARAAARASGKSV
                     GQGRASPVRKLRAGGRRRSGWSGARPDDRDPQLLSQLATRIAKSRGWDGKVAEGTVFG
                     RWAGVVGEDIAAHATPVTLKDGVLSIAAESTAWATQLRLLQPQILAKINAAVGQGVVR
                     QLKITGPAAPSWRKGERHIKGRGPRDTYG"
     CDS             6336..7325
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_50"
                     /old_locus_tag="nfa50"
                     /product="putative hydrolase"
                     /protein_id="BAD54847.1"
                     /transl_table=11
                     /translation="MSSTPGSPTSRSAAAMTATRAESPFASGTVVRRGDVELAVFQCG
                     DPAAPPLLLIHGWPDTHLLWNEVAARLAGRFRVIAFDNRGAGASTVPAEVAAYRIEEL
                     AADVLAVLDAVVPDERVHILGHDWGSVIGWEVVSTPGAAERIASFTSLSGPNLDFLGA
                     YLRGPVSARRLRGALEQGVASAYTVAFQIPGLPVPVMRLLSRRWPRFLAFFDGLDAAA
                     VPAAPTLPADMINNLKLYRANIRARLRHPRPRPVEVPVQVLIATGDRAVRPVVHEEAE
                     RWVRDLTRTEIRARHWSPLSHPDEVAGRTADYIEAITARAGTGTARPGQSEPS"
     CDS             7529..9619
                     /codon_start=1
                     /gene="gyrB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_60"
                     /old_locus_tag="nfa60"
                     /product="putative DNA gyrase B subunit"
                     /protein_id="BAD54848.1"
                     /transl_table=11
                     /translation="MCCAIATRRSASKESYRPVAAKHSNESGSKSTNYGASSITVLEG
                     LEAVRKRPGMYIGSTGERGLHHLIWEVVDNSVDEAMAGYATRVDVTLLADGGVEVVDD
                     GRGIPVEMHAQGIPTVEVVMTQLHAGGKFDSESYAVSGGLHGVGISVVNALSSRVEVE
                     IDVDGYHWSQTYKEATPSKLVKGEPTDRTGTTVRFWADPEIFETTTYNFETVARRLQE
                     MAFLNKGLTITLTDERVSESDVTDEIVSETAEAPKHGEPTGEAASEHKVKTRTYHYPG
                     GLEDFVRHINRTKQAIHNSVVSFTGKGTGHELEVAMQWNSGYSESVHTFANTINTHEG
                     GTHEEGFRAALTTVVNKYAKDKKLLKEKDGNLTGDDIREGLAAIVSVKVAEPQFEGQT
                     KTKLGNTEVKSFVQRTCNEHLTHWFEANPADAKTIVQKAVSSAQARVAARKARELVRR
                     KSATDLGGLPGKLADCRSKDPSKSEIYIVEGDSAGGSAKSGRDSMYQAILPLRGKIIN
                     VEKARIDKVLKNNEVQSIITAFGTGIHDEFDISKLRYHKIVLMADADVDGQHISTLLL
                     TLLFRFMRPLVEHGHVYLAQPPLYKLKWQRSEPEFAYSDRERDGLLERGLAAGKKINK
                     DDGIQRYKGLGEMNPKELWETTMDPSVRVLRQVTLDDAAAADELFSVLMGEDVEARRS
                     FITRNAKDVRFLDV"
     CDS             9691..12201
                     /codon_start=1
                     /gene="gyrA"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_70"
                     /old_locus_tag="nfa70"
                     /product="putative DNA gyrase A subunit"
                     /protein_id="BAD54849.1"
                     /transl_table=11
                     /translation="MTDITLPPESAGDRVEPVDIQQEMQNSYIDYAMSVIVGRALPEV
                     RDGLKPVHRRILYAMYDNGYRPDRGYVKSARPVSDTMGNYHPHGDSAIYDTLVRMAQP
                     WAMRYPLVDGQGNFGSRGNDGAAAMRYTECRLTPLAMEMLREIDHETVDFIPNYDGKT
                     QEPVVLPSRVPNMLMNGSNGIAVGMATNIPPHNLTELAEAIYWALDNHDADEETTLAA
                     CMERIKGPDFPTAGLIVGTQGIHDAYTTGRGSIKMRGVVEIEEDNRGRTTIVITELPY
                     QVNTDNFINAIAEQVKDGKIAGIADIHDESSDRVGLRIVVTVKRDAVAKVVLNNLYKH
                     TQLQTSFGANMLSIVDGVPRTLRLDQMIRLYVNHQLDVIIRRTRYLLRKAEERAHILR
                     GLVKALDALDEVIALIRRSANTDTARTGLMELLDIDEIQATAILDMQLRRLSALERQK
                     IIDDLARIEAEIADYKDILDKPERQRAIVRDELAEIVEKYGDERRTQIVSADGDVADE
                     DLIAREDVVVTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVKHFFVTSTHDW
                     LLFFTNKGRVYRAKAYELPEANRTARGQHVANLLAFQPDEKIAQIIQIKTYEDAPYLV
                     LATKNGLVKKSRLSDFDSNRSGGIVAVNLRDNDELVGAVLCSADDDLLLVSAQGQSIR
                     FSATDEALRPMGRATSGVQGMRFNAEDELLSLNVVRPGTYLLVATSGGYAKRTAIEEY
                     TAQGRGGKGVLTIQFDARRGTLVGALIVDDDDELYAITSGGGVIRTAANQVRKAGRQT
                     KGVRLMNLGEGDTLLAIARNADEPDAVDGGDDTGSSQQ"
     CDS             12243..13412
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_80"
                     /old_locus_tag="nfa80"
                     /product="hypothetical protein"
                     /protein_id="BAD54850.1"
                     /transl_table=11
                     /translation="MTTPNQPNDGHQNNGVTERIAPSPIPPRPVPRPGSAESGPQGGG
                     RPGGQSPENPQRQGDFAPGAEQPGGPSDQETVRMGGAAGKPQGGQEPGADTAPGGQPQ
                     SGQGGPQNGQQQGGQAQGQQGGQPQGQQGGQPQGQQGGQAQGQERYQEGWSQLPQREP
                     QSNLYRPGQSPVAGRPPSGGGVGLNGGVSNARTTADLAAKAARKEAAMVKSVGIDGPT
                     RSIARPELIKDMPDLSEIRHPLPPSDKTSNTGAQQAVSPAVPVAVAAAVAGGEPLRAT
                     VQIRRIDPWSTLKISLVISVALFFVWMLAVGLLYIVLEGMGVWERLNNTFTDMVSQDS
                     GSAGLIDAGTVFGYAGVIGLINVVLFTALGTVGTFIYNQCCDLVGGIQVTLADPD"
     tRNA            13594..13670
                     /gene="ileT"
                     /inference="profile:tRNAscan-SE"
                     /locus_tag="NFA_80010"
                     /old_locus_tag="nfa80010"
                     /product="putative tRNA-Ile"
     tRNA            13821..13896
                     /gene="alaT"
                     /inference="profile:tRNAscan-SE"
                     /locus_tag="NFA_80020"
                     /old_locus_tag="nfa80020"
                     /product="putative tRNA-Ala"
     CDS             complement(13977..15173)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_90"
                     /old_locus_tag="nfa90"
                     /product="putative phage integrase"
                     /protein_id="BAD54851.1"
                     /transl_table=11
                     /translation="MPRERLRPGEWGKITTKPAGPGKFTASTYVRDSDGVRRGVERSG
                     PSREAAERNLKRHLQDRRAPIVDAAVNDRTTLAELFTVWIGTKDIAPQSIKNYRDTWK
                     VHGAKQIGALRIREFPTSRAEQHLQRVAAKAPSAARQLRIVLLGMFKLAVRYDVLDHN
                     PIREASRPTSKRKPVQVLSPEDFARVRAAIRDYCAGREGVGGPKPGRLLPAFVDVLIS
                     TGLRPNEVLGLRWHEVDLLATPPTVTVTGKLVPSGKVEGMPLHRQDYRKAGAPDHTVI
                     LPRLAVEALTTLLGESFPDGLADGPAADRPVFANRDGGWMDLHNLRRAFRAAMPEDLK
                     WVVPYTTRRTVATLLRNELGPAQAQAQLSHAQLSTTERYMQRQTHGPDARAALDKYAG
                     EGADGL"
     CDS             complement(15225..15644)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_100"
                     /old_locus_tag="nfa100"
                     /product="hypothetical protein"
                     /protein_id="BAD54852.1"
                     /transl_table=11
                     /translation="MRDAYPHIRISCREHLPPDLRAAWTTDGIYLDRALGQAARRCAL
                     THEIVHLERGPVPRNPVLAASEERIVSDIAARRLIPLRSLLDAFMWTRPTNHHDLADE
                     LWVDVPTLLIRLRGLRRREIDELNRAIDRRWPWHIEN"
     CDS             complement(15778..16776)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_110"
                     /old_locus_tag="nfa110"
                     /product="putative DNA-binding protein"
                     /protein_id="BAD54853.1"
                     /transl_table=11
                     /translation="MQSRQRGSEQAARWSGTVAERIGNAVRRRRGEMKMSAVQLSKRT
                     ADLGYPITRGAIAKIESNSRNGKLDIAELMVLAAALELPPILLIFPDRPFEVIEFLPN
                     REEDSIYAALWFTGEWLESRWSISAGDISRGDGAAPIILMRQFVASQRKATSAIVRLV
                     EYERKMDQAVFEHRRLYGHSKHADLGREEARRAMDQVHAAAIEIHRWQSEIDKLRVEV
                     SEASEAGAAALSGMQDLGIDVSPYSAGETGLELAQEMRNRGMTPRDYIKEIDDDGQLV
                     ERIVQRDIDRRATRPAEAMPAFDPSNLLAAMPEPEGDREPDDEFPVDPPNDDFEGR"
     CDS             16880..17077
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_120"
                     /old_locus_tag="nfa120"
                     /product="putative excision nuclease"
                     /protein_id="BAD54854.1"
                     /transl_table=11
                     /translation="MTELKAEPRLHPVPAVMSRLGVGRSKVFELIESGELRSVKIGRR
                     RLVSEASLIEFIEKADEAGRA"
     CDS             17098..18150
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_130"
                     /old_locus_tag="nfa130"
                     /product="hypothetical protein"
                     /protein_id="BAD54855.1"
                     /transl_table=11
                     /translation="MPAAPLGCRRSAVNYATTPSGPAKNSWTPPQTHPETSGRRRGMA
                     QPNLPVPSGADFTPVDLTTPDARLRRDALAARVDVLDKVGALRALPDDMHVTTEMVAE
                     FYEVPTGTVRALVLDNRAELETDGYRVVTRSAFEVSYPKQLTSSASRIALFPRRAVLR
                     VGMLLRDSAVARRVRDYLLDAEPVTPVMMPTGPELLAHAILEAQKMIAAKDAQIAQLD
                     GKLAAAAPKLEYLDRHVAENDDVVTIEAWGHLYGLTEPKAFELLRGKDIIYRHLVGKR
                     WSASKQRLVCEYEHLPYGDCIDWFSRRPQHDAPRHHNGQVRMTLYVKVFHSEDIARKA
                     GLVGQMTLPEDQEGQP"
     CDS             18147..18413
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_140"
                     /old_locus_tag="nfa140"
                     /product="hypothetical protein"
                     /protein_id="BAD54856.1"
                     /transl_table=11
                     /translation="MISLTFWAEPAVITTDEATITVGAGEVDGGRHDGAERVAVVIHT
                     RSADGNIIHGWAHLTAAQVAELIESLSGARAALALDTPTIGGVE"
     CDS             18410..18787
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_150"
                     /old_locus_tag="nfa150"
                     /product="hypothetical protein"
                     /protein_id="BAD54857.1"
                     /transl_table=11
                     /translation="MNTPKERFTIEDDPAEASELHHLAVPAAGCRSDSAVLAALDFSA
                     LCEHGNHKRGVLRPPAQFWCARRCGCPGFLLCEQCLSWERAAFRWVMEGCDGELAPQR
                     WLRCRHCPRRGGTFDDLIEVVTL"
     CDS             18787..19038
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_160"
                     /old_locus_tag="nfa160"
                     /product="hypothetical protein"
                     /protein_id="BAD54858.1"
                     /transl_table=11
                     /translation="MVRTSNIPIGADFPTAAEVGAAVLADMVTCGVTVPELADALRLP
                     IPAVQQRLTGAVDWLVPELITAARHLGVRASGWLEAGVR"
     CDS             19035..19460
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_170"
                     /old_locus_tag="nfa170"
                     /product="hypothetical protein"
                     /protein_id="BAD54859.1"
                     /transl_table=11
                     /translation="MTAPYTSVDALKYLARYVRRTVNWTVDCLAMKDLFCDEHVELEA
                     ICQMADDLDALVGPLVEAWDRYSDGRPVESSVEIAPGQTFTHLWHPDPARNQPGTVTG
                     RVLADPGVDHGTYEVRIIPPRTLSVVLHPPRPPLHVVRP"
     CDS             19483..19962
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_180"
                     /old_locus_tag="nfa180"
                     /product="hypothetical protein"
                     /protein_id="BAD54860.1"
                     /transl_table=11
                     /translation="MNTIDHENTTATLRRLFADHGLTNLTDSEILEIGIPYARIDDRE
                     FADQWAIEMAHTCHHRNELTAALPEDDLPPPEGFTHDGWMLRVGELAIERVWSHEIDT
                     GTQVGVWAEIVDVFTGSGPISRGHAAVGVNGAGEPLDVEQAARVAAALTRAAELVSR"
     CDS             20034..20546
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_190"
                     /old_locus_tag="nfa190"
                     /product="hypothetical protein"
                     /protein_id="BAD54861.1"
                     /transl_table=11
                     /translation="MSHDNSTSAATAMVTAALRVTLASPVGTSTRLGDRMSIGTLVIR
                     DDDGRVEAIPFRDIDAEDTHRLVSIAAAVAVTGRPDHPAWSYCGGVGWAALVIVPVPP
                     PPSEIRTGRADLARAMLDDLRTRPAREQRHVDFFVRIAHQNAIPDAEIARRLGLSEDA
                     VRACLSGAPR"
     CDS             20543..20686
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_200"
                     /old_locus_tag="nfa200"
                     /product="hypothetical protein"
                     /protein_id="BAD54862.1"
                     /transl_table=11
                     /translation="MTRPTDTPLATYPLGRGERGETPAEAAQRAAIEAQHEPLFEIIE
                     EDR"
     CDS             20686..21753
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_210"
                     /old_locus_tag="nfa210"
                     /product="hypothetical protein"
                     /protein_id="BAD54863.1"
                     /transl_table=11
                     /translation="MAWGRLDDKLHSHAKTMRIPREHRCAAMGLWTMATSWCNDHETD
                     GVLPAYMVEELAGTRDLAEWLCRVGKWAAVPDMSHRDETGRPITVPETELDRAKIDAA
                     EAFLVLNWDQYNFTAAQLSARREAEAERKRKWRESKKPKPEGSPADVPPGQAGQSEDV
                     PPMSPLNPNPNPSLSPNGDRERPRKRATRLPDGWMPSEDTIAWAKREHPNVDLRRAHE
                     KFTNHWLSKSGKDATKVDWNRTWRNWIINDDERAQSRTGTEGGPTRRQQKVAAAERFK
                     SNPNPDVIAWGTGGTPAAVSEQGSLPLLTAVPSPAPPPTPDRPSTGRTAPENTAPQTD
                     AAPHATQASARALGAVPGGLR"
     CDS             21750..22007
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_220"
                     /old_locus_tag="nfa220"
                     /product="hypothetical protein"
                     /protein_id="BAD54864.1"
                     /transl_table=11
                     /translation="MNQPAITGLTNDEIVTLLQIATGYDGREIDEVLITLWSEAARRR
                     RWTFTEAVNAVHEHFAEETTWIMPGHVTQLIRRERGRYWQE"
     CDS             22004..23305
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_230"
                     /old_locus_tag="nfa230"
                     /product="hypothetical protein"
                     /protein_id="BAD54865.1"
                     /transl_table=11
                     /translation="MSEEGYDLTAERALLGTAMSAPDQIRDVFLAVQPDDWYHHTTRE
                     LAGVITGMMRAGRPIDANTTMVEAQNRGLVPGRIPLDFALRCYEAAALPESAAVHAQR
                     IRELSAARKLSQIGLRIAQRMESAWSTGIDRMDVTAAIKQARQALDEAEQITADVAAE
                     PPMPMGKFLSIPDTHDWLVPGLLERMDRVVLTGAEGGGKSVLCSQIAATLAAGLHPFT
                     ANPLGSGTLHTRVLVIDCENSPTQARRRYRWITAMIDQRRRNHGLTPIDWNDTMSIEV
                     RPAGIDLLTGLDAAWLERQISAFAPDLVVLGPLYKLHHENPNEEKPAREIAWILDGLR
                     ERHGFALLTEAHAGKTTAGDGRRNMAPIGSSVWLRWPEFGFGMRRSDDDPGRGRAQKV
                     DVVSWRGSREERSWPSKLHHAAILPWMPADPDYYETIPRSA"
     CDS             23302..23601
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_240"
                     /old_locus_tag="nfa240"
                     /product="hypothetical protein"
                     /protein_id="BAD54866.1"
                     /transl_table=11
                     /translation="MNDTTPQPREQRAELAAIRDLLAEWRRLYAAATPGPFAVASDSG
                     VFANLQSLHRLAPGKDGWRQRVATNMLRTDAALYARMLNDLPALIAAVDALEADR"
     CDS             23598..23774
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_250"
                     /old_locus_tag="nfa250"
                     /product="hypothetical protein"
                     /protein_id="BAD54867.1"
                     /transl_table=11
                     /translation="MKNPIAVFTSVCGWRTWPWCVLDNIAHEWFQVPLDGDFWTCRRH
                     DTALGGTWPEDGER"
     CDS             23771..24016
                     /codon_start=1
                     /locus_tag="NFA_255"
                     /old_locus_tag="nfa255"
                     /product="hypothetical protein"
                     /protein_id="BAG32218.1"
                     /transl_table=11
                     /translation="MSEGHATGMTTVHVDFNDVARDGKVVALRDRADGPLAIGDLVTA
                     VDQFDGELATPAVVAEQDDDGRVLYLAPLAGNRPEED"
     CDS             24020..24352
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_260"
                     /old_locus_tag="nfa260"
                     /product="hypothetical protein"
                     /protein_id="BAD54868.1"
                     /transl_table=11
                     /translation="MPEIPEPDWSLVHEVADDTGSHIEPPPNPDWPPLWQLRWKAASI
                     RTRTGLNIDIDSYTSINGLTNARSESYGIAVYPVGHGAMSFHDAWTLLNGIESGAKAH
                     AALVEGRR"
     CDS             24349..25092
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_270"
                     /old_locus_tag="nfa270"
                     /product="hypothetical protein"
                     /protein_id="BAD54869.1"
                     /transl_table=11
                     /translation="MSAETDHLFLSRPEMSKLIDELRKLPRIVADLAVTIARLARVQV
                     AGHSISLGAAAQSRPPIHLDAWQAEQALHWHLATTVRIVCEERGMPYVPVGWLAPDFI
                     GPPRPGQQRMQPGHVPSTLELGRWLDRHVVSLAMTADAGALYLDLLAAVAECEAHIDL
                     PPDDLVQIDQRRVDAANNKILTAYQIEKVAAKLGDVGRGLTRDRVRYLVKRGLREAGR
                     DGETRFYRLGDVLAKHVQHGRRSKGGSAA"
     CDS             25089..25352
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_280"
                     /old_locus_tag="nfa280"
                     /product="hypothetical protein"
                     /protein_id="BAD54870.1"
                     /transl_table=11
                     /translation="MRIEESPEIEVNQSGFHAAMEALMMEDPHPKGYERSSPYGRLTR
                     ALYAYEWAKQEYPIEEREDGGWQQTLPKPGAAIEAVKAMEARE"
     CDS             25349..25648
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_290"
                     /old_locus_tag="nfa290"
                     /product="hypothetical protein"
                     /protein_id="BAD54871.1"
                     /transl_table=11
                     /translation="MNVGQLIQRLSAFPADMPVVLAARDEPAGDYEVMTVARQRMAHD
                     PTYDDLGERVWHYESDSLRRCDPAREVVFLDFEGRSAGVVDAVVTVAALETGGQA"
     CDS             25645..25902
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_300"
                     /old_locus_tag="nfa300"
                     /product="hypothetical protein"
                     /protein_id="BAD54872.1"
                     /transl_table=11
                     /translation="MNTPDWLHSMAAATIRDGYGVPSAPLGDGEFVSAAKACPHEGCD
                     WELPIEWRKGATVTRLRGTIETDRLCQEHREAHVVENWSRS"
     CDS             25899..26138
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_310"
                     /old_locus_tag="nfa310"
                     /product="hypothetical protein"
                     /protein_id="BAD54873.1"
                     /transl_table=11
                     /translation="MTAIERFVPAERWRAWDPASDWRQIGEWQEQPAAAALAEGTVVT
                     VDYPNGHRELWRVYRGQLVREPDFLEPQRAFGEPA"
     CDS             26237..26341
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_320"
                     /old_locus_tag="nfa320"
                     /product="hypothetical protein"
                     /protein_id="BAD54874.1"
                     /transl_table=11
                     /translation="MLSVLLDTGSAVLSAVAGAIDWGDVLAAALGAIF"
     CDS             26496..26720
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_330"
                     /old_locus_tag="nfa330"
                     /product="hypothetical protein"
                     /protein_id="BAD54875.1"
                     /transl_table=11
                     /translation="MVPVVAIIGYQVARRQGIGGPWFTDWDDGVIHATEEDAQAAADL
                     AQRTTGYPWELLPVYDEEPDPGPVIPPQDV"
     CDS             26717..26929
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_340"
                     /old_locus_tag="nfa340"
                     /product="hypothetical protein"
                     /protein_id="BAD54876.1"
                     /transl_table=11
                     /translation="MTAAVLAHVHCGDPIDTRYCHGCGGCRYTIPLTGLTQHGAHDLG
                     VIEACPDCDTAAELVARWRQKHPEER"
     CDS             26929..27309
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_350"
                     /old_locus_tag="nfa350"
                     /product="hypothetical protein"
                     /protein_id="BAD54877.1"
                     /transl_table=11
                     /translation="MPDIAKHVTVDLAQRKLYVNGERFPFHIVEGGIRVDGLAAEAGG
                     LATVTVTFFADDIEVVPAGPTPAAREEAQALLRETGKALLTLLGLDEAAVDRILGPLW
                     DDLELAAASWGVMADASQPVTRES"
     CDS             27306..27410
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_360"
                     /old_locus_tag="nfa360"
                     /product="hypothetical protein"
                     /protein_id="BAD54878.1"
                     /transl_table=11
                     /translation="MMDLTAILHALLCPMHDGPVLEAIPLRILMAVQW"
     CDS             27468..27794
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_370"
                     /old_locus_tag="nfa370"
                     /product="hypothetical protein"
                     /protein_id="BAD54879.1"
                     /transl_table=11
                     /translation="MPTRPPRVCPKCRQQAPSGQRCPCTPAWSGSAWGGGSTRRWRSM
                     RASKLKADPICQAPGCRALAVEVDHVTPLARGGARYDWSNLQSLCHDCHTAKTAQDAR
                     AGRSRG"
     CDS             27896..28384
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_380"
                     /old_locus_tag="nfa380"
                     /product="putative phage terminase small subunit"
                     /protein_id="BAD54880.1"
                     /transl_table=11
                     /translation="MGRTAAPAALRLIGGRSEGRDSGGRPVEQPPEFRRIPPKPPTWL
                     SREAKAEWKRVVPGLSRLELLKEEDRASLAVYCETWATYVAALADVRKNGLTCENVTI
                     YKDGTESRRTVKNPALVVAETAAAQLRGMAQEFGLTPAAEGKLAHLSAGRGSDDANNP
                     FG"
     CDS             28359..30107
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_390"
                     /old_locus_tag="nfa390"
                     /product="putative phage terminase large subunit"
                     /protein_id="BAD54881.1"
                     /transl_table=11
                     /translation="MTRTTRSAEVELPDSEELDRLKLSPEVAWYLVSRGIPLPDCPPR
                     WKTPEPREEPGARFDPDRVDKVLATFRALRHTKGRLAGRPLIPDSWQVAYILAPAFGW
                     VHLDEDFGIYVRIIRTLYVELPRKNGKSTLAGGIGIYLTAADGEEGAQVIAAATRLDQ
                     AQFVFAPIKLLAEKSPALRKHVTPYKAKIVHNRTASYFQPVANAGDAQHGADLHGGIV
                     DELHLHKTNELVEAIETGTGSRTQPLIVFITTADDSRKETPYDRKRGLVEQLARGVLK
                     DATTYGVIWAADENAEGFDPYSEEAQRAANPGFGISPTRAFLRQAAVKAQQSPADDAS
                     YRRLHLGIRTKQAVKYLDIEAWDRNASIVDEERLRGRACYGGLDLAATSDLTALAWAF
                     PDADRGGFDVLWRIWIPERGLRELDKRTAGGASVWAKRGYLTVTPGDVADYDFIRSTI
                     VTDSEKFDVREIAYDRWNSTQLVNDLTADGAPMVTMGQGYASMSAPTKELQRLVLLGT
                     EQAPMVRHGGNPAARWTVDNFAVAQDDAGNVKPSKANAGDKIDPVVALIMAIGRATEA
                     PAPKRSAYEDDGLMVV"
     CDS             30120..30401
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_400"
                     /old_locus_tag="nfa400"
                     /product="hypothetical protein"
                     /protein_id="BAD54882.1"
                     /transl_table=11
                     /translation="MDLVIALAAFVCGALLVAGWTWWREPRYVAHRRVVVNLRTGTAV
                     EGVITRTRGRILVVRDATVHSDGGSASPADGEIVLDRGNVDYIQALGRR"
     CDS             30405..31676
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_410"
                     /old_locus_tag="nfa410"
                     /product="putative phage portal protein"
                     /protein_id="BAD54883.1"
                     /transl_table=11
                     /translation="MPFVVNEGAIRSLSRPGTPTLPRVTIAEGLTLDYLTLWRKQPAV
                     RTCVTFLARNIAQLGLHVFERRGDTDRVRLTEHELAELIDKPNPWTTRYRHMNALVHD
                     LAIFDRAYWWKTKTDAGLGLVRLPPPLVTPKGENWLTPERFEVAGSKGKKEIPADEVV
                     YFRGYSGTDDFGTSPIEALRQALAEEHSGSRMREQVMRNGARISGYLQRPLEAPEWSG
                     DARERFRREWQAQYTGEGPQAGGTPILEDGMVFQAAAQTAKDLQYLEVRKLSREEVAS
                     AYFIPPPMIGILDHATFSNISEQHKMLYQDTLGPWLTMIAEEIALQLIPDIAAGDARI
                     YVEFNLREKLTGAFEQRAAQMYQAAGTAWMTVNEVRALDNLPPVEGGDELIRPLNVTQ
                     NGDQNPIPAEPEPDEPEPDDDTGDDPEESAA"
     CDS             31673..32464
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_420"
                     /old_locus_tag="nfa420"
                     /product="putative prohead protease"
                     /protein_id="BAD54884.1"
                     /transl_table=11
                     /translation="MNTKACAVKVKAGPDAGLAEGEFIAYASVFGNKDSYGDVVQPGA
                     FTDTLAAWAAKENPIPLLWGHNTADPDFNLGEVVEAIEDFHGLKVHGRLDMESPKSAQ
                     VYRLLKSGRVSQMSFAYSVIEGEWVEPVGEGKTYKDAYYSLKKLDLYEVSIVPIGANQ
                     ETEILAVKAAASALRAKAGRVLSAKNETTIRDVKTQLEEASQALDEVLAAVATDENTD
                     EQDQTSGKEPSPGKSAQTSAGKTTPNPVVSLASLDALAAEIECSA"
     CDS             32490..33800
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_430"
                     /old_locus_tag="nfa430"
                     /product="putative phage head"
                     /protein_id="BAD54885.1"
                     /transl_table=11
                     /translation="MMTKTKLADLQKAAQAEVKRAREVAEKAQGESREMTDDERGVYD
                     EAMRKGADLLEQIKVAKRDLEVLEAAKGLAAEIGEPAVEDVDAQGQLPVRERVKSLGL
                     QVVESTAFKAALAPFKGGHVPERTRFQTDPIGIKGLFVGGSDTSAGAFVVPEQTGIVE
                     MLGRRPLTIRNLVSVRRTGSDAVEYVEQTSHTNAAAVVPEATSAAAPTAPGTAGALVL
                     NPNGGYKPEGSWAFVRKTAVVKTIAEWVPATKRALADVAALEGLINDELRADVAEAEE
                     GQILNGDGSGENFTGINNWSGVQTQAFDTDLFTSVRKAITKARTVGRVNPNGIVVNPA
                     DAEAIDLAKDANERYYFGGPQAITQRTLWGLPVIESESQAAGEALVGDFAKAVLWDRE
                     ETTVTITDSHADFFIRNLVAILAEERLAFAVTRPAAFVKTDIAA"
     CDS             33803..34045
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_440"
                     /old_locus_tag="nfa440"
                     /product="hypothetical protein"
                     /protein_id="BAD54886.1"
                     /transl_table=11
                     /translation="MALISSRSAAPGRPPAKRRRNTMSLKRYEVEVNGHKTVLQLSDE
                     DAKDRGLTAADEVKARPAANKAARAANKGQGATEGQ"
     CDS             34046..34588
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_450"
                     /old_locus_tag="nfa450"
                     /product="hypothetical protein"
                     /protein_id="BAD54887.1"
                     /transl_table=11
                     /translation="MTTPLPSLLSLEAYNTLVAGTGIEQMRLAAIVRDIRDYCGWHIA
                     PAVEQTLVVDGSGATVQPLPTLRLNSITEVKENGHVLATDGFEWSHDGTLRRATPWTS
                     RLRGIEATVNHGHDAVPENIVSVILDAASAALSLEVGEGAAAGPETMGPFSFGASEGG
                     VTFTAAQRRVLDRYRIEKRA"
     CDS             34597..34890
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_460"
                     /old_locus_tag="nfa460"
                     /product="hypothetical protein"
                     /protein_id="BAD54888.1"
                     /transl_table=11
                     /translation="MIRHRGGGFDDNGDPIPYTDVDLRARAVAPGATAEYQDRGRNGQ
                     TVEMTVYFYPAVDLTGSDELTVRGERYLVQVEQWKSPRTRRTGTVALCSRGEG"
     CDS             34890..35141
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_470"
                     /old_locus_tag="nfa470"
                     /product="hypothetical protein"
                     /protein_id="BAD54889.1"
                     /transl_table=11
                     /translation="MVTSRVRLNNRTIANLLKSQGVADLVNRVAREVAAHAGEDADVD
                     EYTTDRGAASVAVPAEQQAIEGALTRAAAAASLEVRQRP"
     CDS             35138..35545
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_480"
                     /old_locus_tag="nfa480"
                     /product="hypothetical protein"
                     /protein_id="BAD54890.1"
                     /transl_table=11
                     /translation="MSKPHRLPPDPAAAIKAYLSAELPALVAAPAPTVGLVLPADWKL
                     TSPPAVVVFDDSGPTLWPVMVKPTIRVTVWSNGRTRARAIAGAALGLLLSQRVAGVAT
                     ITDPSQLLDARDSSTGGTLASFTVRAQSRTLPA"
     CDS             35579..36115
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_490"
                     /old_locus_tag="nfa490"
                     /product="hypothetical protein"
                     /protein_id="BAD54891.1"
                     /transl_table=11
                     /translation="MALDPDNVKIWEYARVFVSFAVDRPALPASIDADYGTDWEEVGI
                     LSGDDGITEDRASSESKHFGWGIGLIKVGDKNFELTRKFWVLEDNATTQKIVNPGSTA
                     TKILMPKHTYAWLGFETDSDLGDKERLTTTRRAKLKVPANNRTESDPTKWEVNVLLFA
                     NGLGEVFDRQAGVPTPTP"
     CDS             36200..36559
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_500"
                     /old_locus_tag="nfa500"
                     /product="hypothetical protein"
                     /protein_id="BAD54892.1"
                     /transl_table=11
                     /translation="MSRNRNRRPRPAGAPEPQDFKPKSPAEREAKGGDTVEVKFRGMT
                     FEVAADPAKWSYWQVTQWLPSNNFANACIGLLGPGQTAKIHMRYPDLTSVGALELFSE
                     LFMEIAKATGFGNTGNS"
     CDS             36562..36975
                     /codon_start=1
                     /locus_tag="NFA_505"
                     /old_locus_tag="nfa505"
                     /product="hypothetical protein"
                     /protein_id="BAG32219.1"
                     /transl_table=11
                     /translation="MLHLLDEHEDLVEAALRRYCGVRYTDRWRVDEQGQQRLTLREIW
                     VYLQEALPGDSAIVRHFNNGRARWGDQEYLLADVAGILAGKPHPARPKPQSLPVNPQE
                     KDRVDEIRAKRIAEKRAREAAAREQHEQEQGGEGS"
     CDS             36972..40532
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_510"
                     /old_locus_tag="nfa510"
                     /product="putative phage tail"
                     /protein_id="BAD54893.1"
                     /transl_table=11
                     /translation="MTSPGSGAEVIGYAALQIIPSMRGTAGMLDQQLGAPLQAAGRSA
                     GAAAGRAVAQGLDQAKAAVEAASARLAAARDKEADAAGKVRVAEAKLQELRARGNASA
                     SQLAAAEERLASAQRAADRAANARQQAVQGLSDARARLANHTDEATESESRFGAMMDA
                     ITGKLGPAEAKMLAAAAATAGLGAAMAAASEAISREKTVDVLAASLGATPELAAQYGA
                     AASSLYAQGFGENFGAVTEAIGVVQSGFAALGSEGEASLETVTGRALNFAEVFGTDVA
                     TNVQVASQLVTNGLAKDSTEAFDLMTAAFQRVPVAMRDELPEILNEYGTHFRGLGFSG
                     QQAFALLVDYAAQGKFALDKAGDALKEFSIRGSDMSTASQEAYKAIGLDAAAMSSAIA
                     AGGAEAQAALQQTAQGLLAIEDPAERANTAIALFGTPVEDLAVDQIPAFLQALTGGSQ
                     SMADFAGATDEMGATLADNASTKLEVFKRQIQEGLIGALTSSVDWVDRNRGVAIGLGV
                     ALGTLATALVAAKVAAAGYAVAQGVMAAATGAGTAAIAANSLALGAYTIATGVIRGAT
                     MAWSAVQWVLNAALSANPIGLVVVAIAALAAGLVYAWQNSETFRNIVIGAWEGIKVAA
                     QWTWDNVLRPIFDWIVGGYQKAWDVAKAAGEGIGAAWQWISDKATDAKDWVVNAFNSV
                     VDFVTGLPGRVRDAASGLWDGITDSFRSAINWLISAWNNFRLGFDFTIPVINKRITFE
                     VNTPDLPLLAGGGVAGRTADGRLWGPGTPTSDSILGIDALTGLPTALVSTREGVVKAS
                     AMDAGGAEIVAWLNAGWVPPIGLLRAMLPGLAGGGLVEAQEWVRGEAGKPYQYAGVGN
                     PSWDCSAIAGAVWAKATGRNPYQRYFTTESDFEAMGWLPGLGGPNDISIGIMRGGGGP
                     NSHMATTLGTLNVESSGTDGVEVGPGAQGAADFPLQFHWPLGGDPGGPGLAPELGTAP
                     GGGGFGGGGGTGGSGGSGGSGGGGGAGGGTSSRPAGTAVPVWVDNWPSNFGISSSPGT
                     GTTTAPSSTPGGPGVDEVYNAPSATAPGDAGAQPAEQAAHPLQGAPGLLGELADGPAP
                     WWMAATPEQAAANLGRQAGDLAAQTVQGAQDFFANNWKEMLQTGAALVGMGAAGGGRG
                     DTYNIIGPDPRQAAMAVDRVQRRRTMAMRRGGGNGGFGVR"
     CDS             40532..41428
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_520"
                     /old_locus_tag="nfa520"
                     /product="putative phage tail"
                     /protein_id="BAD54894.1"
                     /transl_table=11
                     /translation="MHPLLEIEATKVVYIGVSGRCWHLAGPGAGAEGVTMGEGPTGHL
                     FAPVSILVSEGARQDGASFLRYVRSKKEIDFIAHVGGDAIPLVIRSPRHWLAINDAWM
                     RDWSTRVPGTLAWFTRHQGWRFQQVRLDAAPTPTTGIDPLPNLHEAYQMSIVALDPLE
                     KHFDEWQVWKNASGLGEGVVRARNAADQPGWARYTMNGPGRFWIGDLGGGEEPRIVQT
                     PPILAGETLRIDTHPRRRTARVYSDANPSGRNVWGALAGRRWFASVPAWSSVEIPVRV
                     TDGGSTASTVRIDLTPRSSRPY"
     CDS             41428..43053
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_530"
                     /old_locus_tag="nfa530"
                     /product="putative phage tail"
                     /protein_id="BAD54895.1"
                     /transl_table=11
                     /translation="MWDHAYEARRMDRLERADEQARREQTCLIRYFDKFLEEVGEEGA
                     YSSIQCTWKRRGAGGLKMTIPRPDMVHFDHFFHNPDGDDATIPITVNIPGKRWDGFVT
                     RAALLRDEFGVETVDIEAIHCKQHHATTLMYPSPFAPIWAQWPRHMIGIGPLVTQWMV
                     YYACNLIRQQALGAPESWTDAPDWAKQDALWPIAIKPVDILHDTSPWRALIARMDPGD
                     SLFLPAAEGSGVMFDAQFFLPGEDEQPAPEYYWLERPTVVLSAENFDALTGPTGTLLD
                     GFLGWFEEWIDDTTPVRYPNFAAQSEYEAVYGNRGPLGTVRGFPWVWFLEGEYSGIGT
                     SEVAIHKPTATHVVVGGKSPGWVNAAIEFAIKQLLAWLGMLIGLPGLDALYRGQLDDV
                     FLAWAVYEDRERTRRAGPFAFKEIYITGSDKAYTLDGVMAGLGGLHQTRGYTSKKVSV
                     DPLGPYVFGRDYDLGHQIGFQVGADLLFTDYVDEATFTDDRTTAADLALVIGDGSDEE
                     DSLVKAWDQLGSLANAIKQLFTDVGADLDLIVI"
     CDS             43064..44125
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_540"
                     /old_locus_tag="nfa540"
                     /product="putative phage tail"
                     /protein_id="BAD54896.1"
                     /transl_table=11
                     /translation="MADVTFPARLIVTREVDDDGVPVLTATVIPADSAAGMPLPAGPR
                     GPAGPRGPMMPTFRKMGEIAGQAARPTGLGLDDRGKWWHRLDDDSMDVWDGTGWRNSP
                     GAVGPQGPPAPATTIAATTHHDARLTDPAATITGPGPDLALTVTAPAGLPGEQGPPGA
                     SGAISTAPDFDATTSPTQRGMFGWAPGARRWRPIAPPNGFGPWSFSQTDFVASVAQNI
                     EKLTIATLTMPVLPFRWRPLVWGMVSMYCQQGHNSDVEAYVRISSAEGAAVGMGSGAR
                     IDGMYVGTPIVPVFGDNDGTRALSPNSTYATIPADAESQLIVTLERIAGSTNSTAEIG
                     FSNGALSSLLVWAIPAGGA"
     CDS             44122..45204
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_550"
                     /old_locus_tag="nfa550"
                     /product="putative phage tail"
                     /protein_id="BAD54897.1"
                     /transl_table=11
                     /translation="MMTSIGEYFEGVRIRGIDEGIGRPGIVQSFVATPADGSLELPTG
                     PAGPAGDPGPAGYRIRWEGDIADDTALQALATTLREVHAGKAWRVRATNTLMIWNGRT
                     FDPHPDAFGAHGPQGEPNALTLGTVTTGAAGSDVQVTVTGDSPGQTVDLVLPRGVEGA
                     EGPAGSPGPITDAPDFDDAPALTDCMVPLWNAASELWVPTAYPGWRGPWTIRETQAWD
                     GGPGFAASQNNISTSPNLIATLNIPAQDTPWRPIVFGSVMVRTLVSNNDSNISLRARI
                     GGTGGQQVARGASFGANLDNPCRLTPHFAATFAPDSPVGVIAAGVPASIAITLEHGTI
                     TAANYNWSRTGAFVTAFAVPVTGLPA"
     CDS             45201..46256
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_560"
                     /old_locus_tag="nfa560"
                     /product="putative phage tail"
                     /protein_id="BAD54898.1"
                     /transl_table=11
                     /translation="MSEIVYEADVTVTMRAVDDGGVGLPYTVNPLDLVEGEALVEVRE
                     GAPGGPGPIGAASWPWQWMGDIADRPALDALGLGQAEKYRAWRVVAENAIYYWTGESF
                     IRFRNAFGAPGPAGPVNVLTASAVAGPPGSTAAAQLTGTAPTQHLELTLPRGPQGPIG
                     PPGQPGAISESADVGDMSGAVQDSVLAWRTTPGQWQPVPPPRLLGPWAVGGSQISGGS
                     QIAQSPKVLATMTIPAQPIAWRPLVLSGQVNMLIHVQSLNQSRTDIEVRLGSIDGDLL
                     AYGHGVPAVNKVAVLLRPCWFSAIGPNSTQGVIAANTTASLYIVARRVSGSRPYTIVS
                     GGSQMFIVGQPIGGVPA"
     CDS             46253..46891
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_570"
                     /old_locus_tag="nfa570"
                     /product="hypothetical protein"
                     /protein_id="BAD54899.1"
                     /transl_table=11
                     /translation="MTDIDDDRRQVVQEIITKHGREQQAKDAHDYQRTSVDGVETTAK
                     FQELMRQALAGKLPDLGEIPEADPEVAKLAAELVTLHLPEWRNPAGRSLAKPTVVTMP
                     LAPRVADYLVARGWVHDPSRERVRWIPTPGTSGGPHDPGMHITPDEHGQWPAPDPEAF
                     YDIDDIKVVEIDGGRWCAQHPRGIAFEADTKSEAYEGIVGRLRAKIKEARNA"
     CDS             46884..47696
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_580"
                     /old_locus_tag="nfa580"
                     /product="hypothetical protein"
                     /protein_id="BAD54900.1"
                     /transl_table=11
                     /translation="MPDPVWLPDVLRAAGLEVREYPGWRDRGHGDFGEIWGVIAHHTG
                     SNPPSNNPGHIAQHPQLGLASQLHLSRDGVYTVCGVGIAWHAGNGSYPGLPTNDANRV
                     TIGIEAENNGTEGWSPRQYTAYVKGVAAILRKLGKGAGNVIGHKEWAGAAQGKWDPGG
                     MDMNRFRADVQKAIGDPTSVRGEGTVWGEMFENFKKTKVSYATAIYYIDQKVNEVWEQ
                     VGRGWKQLGTNAKGEPLTLVDAVAEHKAHTAAELADIKASLSAVLEKLEGRS"
     CDS             47693..47908
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_590"
                     /old_locus_tag="nfa590"
                     /product="hypothetical protein"
                     /protein_id="BAD54901.1"
                     /transl_table=11
                     /translation="MNAITKALNSEPILTRMTPVLGLLAIYLIGKYVTDADLANLLLG
                     IATIVLGGGAMVTARAKVRPLAKEQIE"
     CDS             47905..48354
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_600"
                     /old_locus_tag="nfa600"
                     /product="hypothetical protein"
                     /protein_id="BAD54902.1"
                     /transl_table=11
                     /translation="MRRIRRWVDAETVRLPQAIVYCAYIVAGVQSLALGAPPNAVAQA
                     MGHEVALMWTALIIACPTLTLVGLWQRRRAFSLWLQLAGDSGVTCASAAYVVAVLQAT
                     WSERATFAAWSAAALAICGALITWRDARRIRQVSKRIQAFEEGCARE"
     CDS             48347..48694
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_610"
                     /old_locus_tag="nfa610"
                     /product="hypothetical protein"
                     /protein_id="BAD54903.1"
                     /transl_table=11
                     /translation="MNDIASLLTATGVGSALTALVAGIFGWRLRSANYAQIVSDMSRQ
                     VAEDLRKDNRELEQKVDTLQGSVETLRLRVIELTEALRGAIHRLDEYGHDTDPLRAVL
                     QGRINGTGGHGHG"
     CDS             48687..50108
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_620"
                     /old_locus_tag="nfa620"
                     /product="hypothetical protein"
                     /protein_id="BAD54904.1"
                     /transl_table=11
                     /translation="MADLPPLKYGKVVGRFLANTADGPDIDDMPEFRPMSGSVKFTAA
                     PDKILVYGSEPPATVVQLPDHYVASLDEFGYLTWRDERGIRLISPDAEVNPTGWTWTV
                     SFDLSFDGQPIALAPYAIEVPPYVPGPDPEDPDEGSTGLVDLTLVSPVPASRGEAVVR
                     GLSVVDVQLVGDALVFVLDNGDSLDPVTVPSIAESAANAAVAQQAAADADAARDDARA
                     AVDSFDLSIGTVTTAPTGSPASATVSGGPPAWTLDLTLPQGPEGPAGSNDWTEITGKP
                     ATFPPTIGPGPTAAVAGDDPRLSDARPPTAHSHPASQIYDASTVGQAVLTASTAAAAR
                     TALGVPADTDPRLSDPRTPAVGTVPYDIHIPVCGKNTTRAVGTGDFPWGIKLQRAVTI
                     KSITLRGNTAAASGNLVVELRKNGTPVAGTSTSVAAADQVTGGTPNTGTWAFAKGDVL
                     LPYITAVGTSPGLGLIVELEGLA"
     CDS             50108..50536
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_630"
                     /old_locus_tag="nfa630"
                     /product="hypothetical protein"
                     /protein_id="BAD54905.1"
                     /transl_table=11
                     /translation="MPCIVAAPPGGVAPAGMTRNAATPLSTTLAQIDGWVAEAGSVVT
                     GGNALIASGSGMGVITSSVPFTNSGINRTIDVEIRVNGVAVASVTGASVPGGGATINL
                     STPGPVAIPDGAQITYWARQSGGTLQVANSAAAYVRITPA"
     CDS             complement(50599..51117)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_640"
                     /old_locus_tag="nfa640"
                     /product="hypothetical protein"
                     /protein_id="BAD54906.1"
                     /transl_table=11
                     /translation="MARHSRRPWTHSAHAATVMRDQDRRPKGDCMTTQPPAAPPPGRR
                     RTNAIILGVVGAVLAVVLLIVIIGAVAGGDEDVPVYTVTRDQQTFTATVDFDDEADLR
                     AVFDDVREKNSDLPDGGYDVMINCSTGGTAEVPARLAWGRFAIGNLGAAQTGLEKGDS
                     ELKLMDGVRCPA"
     CDS             complement(51118..51306)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_650"
                     /old_locus_tag="nfa650"
                     /product="hypothetical protein"
                     /protein_id="BAD54907.1"
                     /transl_table=11
                     /translation="MSWIRDYCEQRSFILDEPHAAGLVKLHATCDPPCPRQRAAQAYL
                     DEIRRREDDQRNRPTAIS"
     CDS             complement(51303..51596)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_660"
                     /old_locus_tag="nfa660"
                     /product="hypothetical protein"
                     /protein_id="BAD54908.1"
                     /transl_table=11
                     /translation="MMMAVLLGSIAIAGAVWALLHLLDPPVRPEQPWSAADVIARVTG
                     ECHPEPSTLTAELAHAVLQARIECDIERCGAKWAAYWFLVDQGRIVPGRQVAR"
     CDS             complement(51593..51829)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_670"
                     /old_locus_tag="nfa670"
                     /product="hypothetical protein"
                     /protein_id="BAD54909.1"
                     /transl_table=11
                     /translation="MRGTSLTEAQRRVLAVLSHGGLLSIDQISRDAELTRLRARTIVS
                     ALRGRGLVAPGVGIGSGRYRITSSGLARARVRAA"
     CDS             51972..52580
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_680"
                     /old_locus_tag="nfa680"
                     /product="putative DNA-binding protein"
                     /protein_id="BAD54910.1"
                     /transl_table=11
                     /translation="MAADIGEIIRDRREALGLGQRELSERVGVTERQIGRYESGAQEP
                     AASTCRLLARALHLSFAQLFGEVPIGLDLSGQWYAAWETSRGGTPVIDRHGLVVSHAG
                     DHVVCTADGDYLWSGDLRIVDGSLMGTYRSTEAARQFRGSLYFTLADDTTAAVGRWTG
                     LWADGLLGSGWGAIARDEDRAGRLLDTLINHNGPVTTWPQEG"
     CDS             52585..52935
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_690"
                     /old_locus_tag="nfa690"
                     /product="hypothetical protein"
                     /protein_id="BAD54911.1"
                     /transl_table=11
                     /translation="MKLYSPFDQPGTIHRTEVPGGPRATWVQQGADLRVHFIDDPGSA
                     APARRWPNEPMPACPAGHLAFDPADYPTIDQAREMLPEYGRLWDAVTADARAARGVPN
                     SREHQQFFALPVRV"
     CDS             53250..54167
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_700"
                     /old_locus_tag="nfa700"
                     /product="hypothetical protein"
                     /protein_id="BAD54912.1"
                     /transl_table=11
                     /translation="MHTVFDHLLTEEPGGPLGSVTEAWERHRDVARRFTDTVDVAVAG
                     GFAADRLGYAFLSGYQAAVAALLPELPRDRPLALAATEEGGGHPAAIRTTATERADGW
                     SVSGTKTFATLGSLAGRLVVIASVGAGADGRNRLRAMLVDATAPGVHVTDRPALAFAP
                     EIPHATVTFTDTPATALPGDGYADVLKPFRTVEDIHVIAAAAGWLVRVAREAGWPPPV
                     RQRLLATVAALRGLGAARPDSPGVHVALGGVLDEFERLLGELAPRWDAVDESTRSRWE
                     RDRPLLSVAGRVRAQRLATAWRAVGEPGE"
     CDS             54706..55701
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_710"
                     /old_locus_tag="nfa710"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAD54913.1"
                     /transl_table=11
                     /translation="MPDAIVAEGLVKRYGKLVALDGLDLTVPEGTVTALLGPNGAGKT
                     TTVRVLTTLLVPDEGRATVAGIDVLRRPQALRSRIGASGQYAAVDEYLTGFENLEMVG
                     RLYHMGVKRSKERARELLERFRLTDAADRPVRGYSGGMRRRLDLAGALVANPPVLFLD
                     EPTTGLDPRARLDLWDVISELVAGGTTLLLTTQYMEEADRLADAIAVIDHGKVIARGT
                     ADELKTLVGGDRIELTVETADKLAVAEQVLKPLADGDIHLEPGLRRITVPVSNGSQAL
                     VDAIGLLTAGDVQIHDVGLRRPSLDDVFLTLTGREAEQFADDAESGLDTSEGSRR"
     CDS             55698..56555
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_720"
                     /old_locus_tag="nfa720"
                     /product="putative ABC transporter membrane protein"
                     /protein_id="BAD54914.1"
                     /transl_table=11
                     /translation="MTAGTTTFDTPADPGLGSRLGMVVSDTITVTKRNVIKIKRVPDV
                     LIFSTLSPIMFVLLFAYVFGTAIEVPGLEGGYREFLIAGIFAQTVVFGSSFTGASLAE
                     DMQKGIIDRFRSLPMAPSAVLVGRTVSDVVINLVSLVVMSVTGLLVGWRIRGSFLDAV
                     LAYVLLLLFAYAVSWIMAVVGLLVRSPEVFNNASFMVMFPLTFLANTFVPIEELPTVL
                     RVFAEWNPVSALTLATRELFGNTGALGPQSDAWSMRHPIATTLIWVVVILVVFVPLAL
                     RQYKRAVSR"
     CDS             56623..56856
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_730"
                     /old_locus_tag="nfa730"
                     /product="hypothetical protein"
                     /protein_id="BAD54915.1"
                     /transl_table=11
                     /translation="MRGGSGAGSGGNGRLLRTSQAAPPARPRRVAAMSRLRERADTCR
                     RPKVIRPLSHSRGNHAVTAGNRHPRPGWIAWRR"
     CDS             56856..57716
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_740"
                     /old_locus_tag="nfa740"
                     /product="putative membrane protein"
                     /protein_id="BAD54916.1"
                     /transl_table=11
                     /translation="MNDRPPTCVRHRDRATGLACTRCGRPACPECLRPAAVGQHCVDC
                     VREGSAGVRPVRTVAGAPVARSATPLVTYGLIAVNLVFFAITAVQARSIVDNFQSPLF
                     FRLALIPAYVADGEWLRVIGSGFLHWGPLHLALNMFALYIIGIQLEPVLGRWRLLAVY
                     LVALLGGSAGGMLLEPANTIGAGASGAVYGMFGAIAVVIFRLRLNPTQILVVIGINVF
                     LSLSLPGISLWVHLGGLLAGTLATLGVLFLPEWLGVRTSETARTVGWAAIAAVGVASV
                     AAIAVAAAML"
     CDS             complement(57836..58297)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_750"
                     /old_locus_tag="nfa750"
                     /product="hypothetical protein"
                     /protein_id="BAD54917.1"
                     /transl_table=11
                     /translation="MNPEPSASPSLSWATPAPALVAVGLGGAVLAVAAFFAGDAPSRL
                     LVGLAAAGLLGLAVLGARQRPRLEVRPGSPPVLVVRTFLGPTEYRPEQIIRARIVSYR
                     RLGRRSPMLEIDVRHHDGERLLIFGRWDLGTNPQDVFDALVVHRLAFLPKD"
     CDS             complement(58400..58663)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_760"
                     /old_locus_tag="nfa760"
                     /product="hypothetical protein"
                     /protein_id="BAD54918.1"
                     /transl_table=11
                     /translation="MPKSKVRKKTDYTINPASRTPVKVKAGPSPVWYVAIMLGFMLAG
                     LLWLLVYYLAAEQISWMNDLNAWNFLIGFGLMVVGLIMTMRWR"
     CDS             58811..59455
                     /codon_start=1
                     /gene="pabA"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_770"
                     /old_locus_tag="nfa770"
                     /product="putative para-aminobenzoate synthase"
                     /protein_id="BAD54919.1"
                     /transl_table=11
                     /translation="MRVLVVDNYDSFVFNLVQYLGQLGTDAVVWRNDDQHLADLDAVA
                     ADFDGILISPGPGTPDRAGASIDLVRACARTATPLLGVCLGHQAIGEAFGATVTRAPE
                     LLHGKTSSVFHVGAGVLAGLPDPFTATRYHSLTVLEDTLPAEIEVLGRTESGIVMAMR
                     HRELPIHGVQFHPESVLTQGGHRMLANWLGVCGSRPPEGLVEMLESEVAALVPQ"
     CDS             59452..60573
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_780"
                     /old_locus_tag="nfa780"
                     /product="putative reductase/deaminase"
                     /protein_id="BAD54920.1"
                     /transl_table=11
                     /translation="MSGRPYVLLSAAMSLDGHLDDVGPERLRLSDAADFDRVDRVRAE
                     SDAILVGAQTLRRDDPRLLVADQARRAARVAAGKPEHPLKVTVTATGRLDAGLRVWHQ
                     GGAKLVYTTAAGAAALGDTLTGLAEVVVLGETIDLGALLDDLGARGVERLMVEGGTRV
                     HTAFLAADLADELQLAVAPLLVGAAGAPRFVDPADFPDRRLTLAEVSRVGDMAVLRYL
                     LRPESAVERDRRFLRRAIELAHASPPSPTAFSVGAVIVADGAEIATGYSRETDPKVHA
                     EEAALNKLDPRDPRLSRATIYSTLEPCSQRATAGRPPCTDRILAAGIPRVVIAWREPS
                     TFVVNCVGVEKLREHGVDVVELPELAEAATAMNRHLDLS"
     CDS             complement(60578..61048)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_790"
                     /old_locus_tag="nfa790"
                     /product="hypothetical protein"
                     /protein_id="BAD54921.1"
                     /transl_table=11
                     /translation="MRMGSAPPEPTRTRRQLMTTARDIMKPGAQWISKQDTVERAAQL
                     MADLGVGSLVVADENERMCGIVTDRDIVVKCVAHGANPATTPAAELCEATPRWVAADA
                     DVEEVLDAMENHRVKRMPVIENKRLVGMISEADLARHLDDNQLSEFVTAVYGRP"
     CDS             complement(61091..62998)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_800"
                     /old_locus_tag="nfa800"
                     /product="putative serine/threonine protein kinase"
                     /protein_id="BAD54922.1"
                     /transl_table=11
                     /translation="MTTPKNLSARYELGEIIGFGGMSEVHKARDLRLSRDVAIKVLRA
                     DLARDPTFYLRFKREAQNAAALNHPAIVAVYDTGEAEIDGGPLPYIVMEYVDGETLRD
                     IVRGKGPLPPRRAMEIIADVCAALDFSHKHGIVHRDMKPANIMINRSGAVKVMDFGIA
                     RALADSSNPMTQTAAVIGTAQYLSPEQARGETVDARSDVYSVGCVLFEILTGEPPFTG
                     DSPVAVAYQHVREDPRLPSHVHHGVPRELDSVVLKAMSKNPANRYQTAAEMRADLIRV
                     LGGQKPSAPMVMTDEDRTTFMGADEPGPRTYRAVERDDDTAEQEPAEPNSGRRTAYLA
                     FGAAAVLAVAFALFWVLIGPGSKPDQVAVPDLSNKSAQQAQDTLQRLGFTVAIQQKPD
                     SKVAVGNVISTQPLGGSRIDKGSTVTVQVSSGPAQVQVPRLDGLSVQQAEQELNAVGL
                     RMDPNVERRESSAQDLDKVIGTEPGAGARVDVDQAIVVWVGKGPEKVRVPSVVGQDIS
                     VAQPNLVDSAGFKIDIEEVASSRPKGEVVATSPAGGSSADRGSTVTVQVSAGDEITMP
                     TLVGLTPSQAVERLRQSGWTGNAGQINQATTGTFEAGSVGRILQQQPQAGSSISKTAT
                     ITITVGTLGPP"
     CDS             complement(62995..64518)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_810"
                     /old_locus_tag="nfa810"
                     /product="putative serine/threonine protein kinase"
                     /protein_id="BAD54923.1"
                     /transl_table=11
                     /translation="MLTNGAMIADRYRLQRLIATGGMGQVWEALDTRLNRRVAVKVLK
                     AEFSADPTFRQRFRTEAQTTAQLNHSGIAGIYDYGETYDPSAGETSYLVMELVQGEPL
                     NAVLSRLGKLSVNQGLDMLEQTGRALEVAHAAGVVHRDVKPGNILVTPTGQVKITDFG
                     IAKAVDASPVTKTGMVMGTAQYIAPEQAVGEDATAASDVYSLGVVGYEALAGKRPFSG
                     DGAITVAMKHVRETPPPMPADVPANVRELIEITMGKDPQLRYASGGEFADAVAAVRAG
                     HRPPPPIGAAAAGPIAEDATHVLPPGPTVVLPAGQGEGPTVRYSRPAAAAVGAGAAPT
                     AAGAPATMMNEHGGATAVPPQGGKKPWTTTQKVLAGLSAAAVLLAGAVLWLLFGGDTD
                     PEPDRPPVTTTIAPQPPLPPTTQPTTTRFVPPPPPQTSEPEPTTTQPPTTTPEPTTAA
                     PTTTPEPTTTARPTRTQRPTTSRTLFPTFDLPFPEDSGARGPSGTVSAPTTSPQGQQ"
     CDS             complement(64556..66022)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_820"
                     /old_locus_tag="nfa820"
                     /product="putative penicillin-binding protein"
                     /protein_id="BAD54924.1"
                     /transl_table=11
                     /translation="MNTPLRRVAVAVMVMVVALLANATYVQVFKADDYRNDPRNTRVL
                     LDEYSRQRGQISAGGTVLASSVETEDRYKYLRTYPTDPQAYAPVTGYYTMQNGSGGLE
                     RFEDPLLNGSDSQLFGRRLIDLVSGRDPRGGNVLTTLNPVMQQVAYEQLTAKGYTGSV
                     VAIEPSTGKILTMVSTPSYDPNVLAGHDAAETTEALEALNSDPDKPMLNRAISQTYPP
                     GSTFKVVVTAAALANGVATPEDQFTAAPNITLPGTATTLENYNGSSCGPGPTASLTDA
                     FRLSCNTAFVELGQRVGAAALKDTAAAFGVGPHNGIPMPVAESTVGPIPDNAALGQSS
                     IGQRDVALTPLDNAVIAATIANGGVRMEPYLVDQRQGPDLSELSKTKPVSVGQAVSAQ
                     VASQLTGMMIASEANTAGGNRAGYTIASKTGTAEHGTDPRNTPPHAWYIAFAPAQNPK
                     IAIAVIVEDGGDRALAATGGSVAAPIARAVLDAGLQGG"
     CDS             complement(66019..67497)
                     /codon_start=1
                     /gene="ftsW2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_830"
                     /old_locus_tag="nfa830"
                     /product="putative cell division protein"
                     /protein_id="BAD54925.1"
                     /transl_table=11
                     /translation="MSAPAPPSAGAYPSPPGGFAPAPPPSTRRNVELLLLGFAALLTT
                     VSLFLVEASQEQSITWDIAKYGLAFLGLFAIAHLAVRRFAPFADPLLLPIVAVLNGLG
                     LVLIHRLDLGAEQNAVFNSAPIPSPDANQQILWTALGMVVFVAVLIVLRDYRTLARYA
                     YTLGLVGLVALMIPALLPSSLSEINGAKIWIRLPGFSVQPGEFAKILLIIFFASVLVA
                     KRDLFTTAGKHMLGMDFPRARDLGPILAVWVICIGVLVFEKDLGTSLLIFSTVLVMLY
                     IATERVGWLIIGVSLLAVGFVFAYQAFGHVRVRIDTWLDPFSDYNNTGYQISQSLFGL
                     ATGGLAGTGLGSGRPNQVPFAKTDFIVTTIGEELGLIGLTAVLILFLVLVVRGLRTAL
                     AVRDSFGKLLAAGLAFTLAIQVFVVVGGVTKLIPLTGLTTPFMSYGGSSLLSNYALLA
                     LLIKVSDAARAPAPVRKSGAAAPPIAEAPTELLRRSETRQPE"
     CDS             complement(67497..69026)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_840"
                     /old_locus_tag="nfa840"
                     /product="putative protein phosphatase"
                     /protein_id="BAD54926.1"
                     /transl_table=11
                     /translation="MTLVLRYAARSDRGLVRGNNEDSVYAGARLLALADGMGGHAAGE
                     VASQLMIAALAHLDDDEPGDDLLGKLDRAVREGNAAIADQVEEEPELDGMGTTLTAIL
                     FAGKKLGLAHIGDSRAYLLRGGELTQITRDDTFVQSLVDEGRITPEQAHTHPQRSLIM
                     RALTGNEIEPTLIMREARAGDRYLLCSDGLSDVVSDETIANTMREGSTDECADRLIEL
                     ALRSGGPDNVTVVVADVIDLDYGQSHPIVAGAASGQDDDTPPPNTAAGRAAAMRPPRA
                     TPPRRAAAAEPPPPAKSHKLRWILLAVALIGAVAVGLVVGYKMIRNNYYVGADDGRVV
                     ILRGLPGSLLGYSIHEVYTVGCVDRGGSLTTLAASDPLPSGCKELRVSDLEQTGRDKV
                     EAGLPPGSLDKAQEQMRVIAQQELLPPCPAKAATPAPGTTQPSAAPTGAPAAPAPGEP
                     VPAPAPTGEPAPPAGNPQPAPLPGGEPRAPETGTASPAVPTTTPAPSPQTAGENCRVT
                     D"
     CDS             complement(69023..69490)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_850"
                     /old_locus_tag="nfa850"
                     /product="hypothetical protein"
                     /protein_id="BAD54927.1"
                     /transl_table=11
                     /translation="MQGLILQLTRAGFLLLLWLFVWAVLRTLRSDIYAASGIRIQPRA
                     ARGSAVLPSLRRGQKGAKYLVVTQGSLAGTRITLGTQPVLIGRADDSTLVLTDDYAST
                     RHARLSPRGDDWYVEDLGSTNGTYLDRAKVTTAVRVPLGTPVRVGKTVIELRS"
     CDS             complement(69650..71080)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_860"
                     /old_locus_tag="nfa860"
                     /product="hypothetical protein"
                     /protein_id="BAD54928.1"
                     /transl_table=11
                     /translation="MGIVSRFERRLQGAVGDVFARVFGGSVVPQEVEAALQREAADNV
                     QDLGGGHLLAPNSYVITINSSDHQQLDADHDLTTRAFAKHLQDYIRDQGWQTYGEVHV
                     AFEASPTLHTGQFRASGRVDPDVGRRATPARSPEPTPPRPANPQPGAGPMTQNSGYDP
                     SREPAESDPRNRGYAPPPAGRPAAPQNGAYRDEYARGGAPYPAGSDYRAPESQQGYGD
                     YQNGYDYQQGAPGYGQPGYDQQGGYGRPGYGEPGYDQQGGQQGYSDQGYGQPGYGEPG
                     YGQQGAGYGQPGYDQPGYGQQPGYGDQGYAEPGYGQQGYGQPGYGQQGGRQGYAEPAY
                     GEPGYAEPGYGQDEQAGYGQGYAQQPGYGQQQPGYSAPAYGGAATGSGYSATLQLDDG
                     SGRTYQLREGSNIIGRGQDAHFRLPDTGVSRRHIEVRWDGQTAMLSDLGSTNGTLVNG
                     SPVQDWQLADGDVIRAGHSEILIRIV"
     tRNA            71317..71402
                     /gene="leuT"
                     /inference="profile:tRNAscan-SE"
                     /locus_tag="NFA_80030"
                     /old_locus_tag="nfa80030"
                     /product="putative tRNA-Leu"
     CDS             complement(71532..72164)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_870"
                     /old_locus_tag="nfa870"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD54929.1"
                     /transl_table=11
                     /translation="MTTSQRPRRYHHGDLRNALVRAAAELAETGGPEAVTVRAAARCV
                     GVTPTAAYRHFTNHEQLLRAAQEQAQRSLFAAMQEALALLPPDAAPVDRLAAVGRGYI
                     TFAQREPGLFRTAFCPNEENSGPQDWQAPAFQLLSSLLDELVEVGYTDPAQRPDAEYA
                     AWAAVHGMAGLIVDKAVRHLGTQEREAAIDRTLEVVRLGLATGPKATPGN"
     CDS             72253..74415
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_880"
                     /old_locus_tag="nfa880"
                     /product="putative membrane protein"
                     /protein_id="BAD54930.1"
                     /transl_table=11
                     /translation="MFDVLGGFIVRRARWILVASVLALVAGAALGVTAFGKMQSGGQD
                     DPGAESSLAATQLREKFGSGTDYLFLVRATGGSIDDDAAAAFGRDLTARLAADPRLAD
                     VVSYWDTGSPAMRAADGTAAVILAGNADPDTEDHSAASGIIADYRSAGPVAQVQVGGT
                     DPTFEAITEQIGKDLGLAEGIAVPLILALLVLAFGNVVAALLTLLTGGIAILGTFAEL
                     SVLGSLTDVSIYAVNLTTALGLGLAVDYGLLMVARFRERRAAGATTDEAVVGAVATAG
                     RTIVFSAATVVAALSSLVIFPQYFLRSFAYAGIGVVAISALAAVLTLPALLAVLGDRS
                     DAWHIRGVRGIRGDAAPFWAAVARTATRRPLLTGVPVVLILLLAAAPLLGVRFGTPDD
                     RVLPTTTEVRQVGDAMRTEFGGGEANALSVVIGAAVPAQPLADYAAQLSRVEHVTRVD
                     SAAGTFVAGRPVATSPADLRFARPDAQRLEVHTGLDRNSTEARELVDRVRAVPEPAGA
                     TALVGGQVAELRDSLSAIGSRLPIAVGWIVATTFVLLFLFTGSVVQPVRALLSNALSL
                     AATLGLMVFVFQDGHLSGLLGFTPAPLDVSMLLLLFCITFGLSMDYEVFVVSRIKEVH
                     DRGADTETAVIEGVARTGRLVTTAAALISISFLAFVSSDVRFIQFFGLGAGLAILIDA
                     TLVRGVLVPVAMRLLGPAAWFAPRPLRVVHRRFGLAEA"
     CDS             complement(75160..76203)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_890"
                     /old_locus_tag="nfa890"
                     /product="hypothetical protein"
                     /protein_id="BAD54931.1"
                     /transl_table=11
                     /translation="MDVDAYSYAHRRSWQRLDQLARQRRLTGAEADELVALYRRTSQQ
                     LARLQSHSPDPQLVAGLSAILTRARARVLGTRSDTWAQIGRFYTHTFPVAVYRAWPWW
                     AGVAAAFLLVSAWLAIWVQGSGRAREVLGIPDDNDYLTAPGGAFETYYTEHPGDAFAA
                     QVWTNNAWVSAIALFTGVLILPAVYLLFMNALNLGITAGLMAEAGRLEPFFGFLLPHG
                     TLELTAVFVAGGAGLQLGWTLIDPGGASRVAAVARQGRATAAIALGLVAVLFVSGLLE
                     GFVTPSGLPAPVRVGIGLLAEALFLGYVVGLGRRAVREQHDAEAGAIAALGTANVSSR
                     VNEQPTVSTPAPR"
     CDS             76248..77027
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_900"
                     /old_locus_tag="nfa900"
                     /product="hypothetical protein"
                     /protein_id="BAD54932.1"
                     /transl_table=11
                     /translation="MAEFTTGEAVALELPIARIPTRAAAFLIDLVVQIGLAVGLMAGI
                     GVLLLQTGADTAWVDTAVVLAMVSVLVGYPVACETLSRGRTLGKLVLGLRVLRTDGGP
                     IDFRHALTRGLAGAIVDFWILGGFGAIAVLTSLCSPTARRVGDVLAGTVVVHAEAALP
                     APALAVAPPWLIEWATRLDLSGIPEDLALAVRQYLTRLRTLTPQAQDGLGRELVAAVC
                     ARLGVPAPPNCPPVQILGAVVAERQRRALAPSAPGGLLRTA"
     CDS             complement(77294..78589)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_910"
                     /old_locus_tag="nfa910"
                     /product="hypothetical protein"
                     /protein_id="BAD54933.1"
                     /transl_table=11
                     /translation="MVVSGRLVALAALLALGVTVLLPSVTGVVLATLVLVAAVLADLA
                     AVARPRDLRLERPALTTVRLGRRTEVELTVVNSGSRTARGVLWDDWPAGAGVENRTHA
                     IDLAPNTKVRLRTALTPVRRGDRTAGPVTLRLFGPLGLAGVQTRHAVPARVRALPAFR
                     SEYLLRSKVQRLQHLEGRNVANTRGQGSEFDSFREYVAGDDVRAIDWRATARATDVLV
                     RTWRPERNRHVLMVLDSGRVGAGRVGAGTRLDAAIEAALLLGGLAAAAGDTVDLLAYD
                     RTVRTEVRGIAGNRLQPQLMHALAGLTPALADTDAAGLVRAVLERARRRCLVVLFTGL
                     DAAVVEQNLLPVLPVLTRRHRVLVVSVVDPEIAAAAATRDTLADLYTAAAAESALAER
                     DLVRESLRRKGVAVVSAAPDRLPGALADEYLELKQSGSL"
     CDS             complement(78592..79572)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_920"
                     /old_locus_tag="nfa920"
                     /product="putative regulator"
                     /protein_id="BAD54934.1"
                     /transl_table=11
                     /translation="MTTDITHAPTAQDAHAALTALRAEIGKAVVGNDNAIMYLVLALL
                     CRGHVLLEGVPGVAKTLLVRALATALDLEHARVQFTPDLMPGDVTGSQIYDPHSAEFT
                     FRQGPVFTNLLLADEINRTPPKTQSALLESMEERQVSVDGTPRPLPDPFVVIATQNPI
                     EQEGTYPLPEAQLDRFLFKVDIQLPGRDDEFRILQRHAAGFDPRDLAAAGLRPVAGAA
                     HIAAARNAVGGVTVSPEVLAYTVDLCRATRSAPAVQHGASTRGATALMAAARAFAWLT
                     GRGFTTPDDVKTVAVAVLRHRLQLRPEAELDGVTAEGLLTGLLHAVPVPV"
     CDS             complement(79569..80603)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_930"
                     /old_locus_tag="nfa930"
                     /product="hypothetical protein"
                     /protein_id="BAD54935.1"
                     /transl_table=11
                     /translation="MTEPDPIAPDTPKLGAAAEHRARAEEAAARRDFDRALRERFRAV
                     LRGMEQQGVLEPRRSRTADETVDDASTVLAPEITTELQPAARSFDEVVYGGRRATEDE
                     YRRLEYADRFSGSAPPPAAEPVEREVAETAPRGRRTLPALPALLRDPKFWAGLAALLV
                     LGLLLYAALNSCGAPTAPKPPPPEFPPPGDGGNGGDVDLPPVGPGEDSLFSRLPAPVA
                     FGGLQFLVAAVLLVWWRARRRGALVREPRPVEVAANELLTGQAALYRRSGDHDHVAAK
                     LRAATLRRIRPELGVAADGGADRMVAAVAARTGLDPGLVHDALFAPVPDAATLPVIAA
                     QLELIETEVR"
     CDS             complement(80600..81484)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_940"
                     /old_locus_tag="nfa940"
                     /product="hypothetical protein"
                     /protein_id="BAD54936.1"
                     /transl_table=11
                     /translation="MLPAADPAGVVGAGDDPVPGSPGPVVPIRPLTFRELLDLPFALI
                     QANPAALAALGGGAVLVAEVVVVLLTASVARLTDDADAAIAWTAVLTTLSCAWLVRVL
                     MRATVVPIALAAAFGGRTGVRAAVSRAGDLAGPVLLAHALFTLVGVGVSVLGILLITL
                     PFVVVWLGYLRGTQFPAPVVLFAEPTTHRQSVARAKLLTEGTRWRLTGLWLVQRTLFT
                     LLAVPLFGVMLFVSDITGTHRWPVIVLFTVTGLVLAAFGEIVESCARVVCYVDLRCRR
                     EGMDIVVPRGGQARGGSA"
     CDS             complement(81927..83579)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_950"
                     /old_locus_tag="nfa950"
                     /product="hypothetical protein"
                     /protein_id="BAD54937.1"
                     /transl_table=11
                     /translation="MSVTGAFTWLGGARPGAVDEPHERASYLLTGAAVALFALVTGGI
                     VTAAAARAWPLAAAIAVGAVLAAAALLVGRALATPRVGPMPDRFGVAGRATAAVLIGV
                     LVAEAATTLLFTAGVDRVLDEKAHAAAESAPAVRAARAGYERAVADRAALDRTIAEAK
                     AETDRALVTARCEYNPAPQCPPTRITGVPGDGPEHRTAQEMLAEARARLAAAEERVPG
                     LDARVAEAEKSTAAALSDAHTAGDRGVGARWAAMHDHTTDSMGALLPRLATLLACLLL
                     ALLPLLLRWWRGVTSVDRHAAARAVIDEADRDAEAAIAVTRANLRAATAELRAEQELT
                     AARLAAEADTAIDRERQRTRIIAAIGGLEIGITEPPRTPIRPAAGQPELPAAPVPRED
                     TAVPETPNLPARAADERPGGGLELPIIGTVPFTDTAARWIRPLVPGFVADAIDTATHP
                     LRTARQAFEEVEEITFTFRRTRKVTVDDSASSRSYPAADPWYAQRVAAAVVDVPVREA
                     AAAQPNPGRAALTTAEPTPALLDRDQSAVSQRQGPPALPPAH"
     CDS             84525..89171
                     /codon_start=1
                     /gene="gltB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_960"
                     /old_locus_tag="nfa960"
                     /product="putative glutamate synthase large subunit"
                     /protein_id="BAD54938.1"
                     /transl_table=11
                     /translation="MTQLPGHRSPGPIGLYDPANEHDACGVAFVVDMHGRRSRDIVDK
                     AITALLNLEHRGAAGAEPNSGDGAGILIQIPDRFFRAIVDFELPPEGSYASGIAFLPQ
                     ARREAARAAYGVEKIVKEEGLEVLGWREVPIDDSSLGALSRDAMPTFRQIFIASPRTG
                     AEQLSGMDLERRAYVIRKRVEHELGTQGAGEGATGRETVYFPSLSGQTFVYKGMFTTP
                     QLRAFYLDLQDDRVESALGIVHSRFSTNTFPSWPLAHPFRRVAHNGEINTVTGNENWM
                     RAREALLNSDVFGTDAAGKNRLEKIFPVCTPGASDTARFDEVLELLHLGGRSLPHAVL
                     MMIPEAWERHDSMDPQLRAFYEYHSMLMEPWDGPASVCFTDGTVVGAVLDRNGLRPSR
                     IWVTDDGLVVMASEVGVLDIDPAKVVRKARLQPGRMFLVDTSQGRIVDDHEIKTQLAA
                     EHPYQQWLDEGVTRLADLPDRPHVHMSHDRVLIRQQIFGYTTEELSLLISPMAKTGGE
                     ALGSMGTDTPIAVLSSRPRLLFDYFSQLFAQVTNPPLDAIREEVVTSLKRNLGSEADL
                     LHPGPESCKQIAIEQPILDNDELAKLVHINDDGSQPDLRSVVVRGLYPVKKGGKGLRK
                     ALQAINTQVSAAIEGGARIIVLSDRESNEKLAPIPSLLLTSSVHHHLVRERTRTKVGL
                     IVEAGDAREVHHMAMLVGFGAGAINPYMAFETIEDMLERGALDLGTGDLASDYRKAVA
                     NYIKAAGKGVLKVMSKMGISTLASYNGAQLFQVIGLSQELVDEYFTGLRSHLDGIGLD
                     EIADDVAARHRIAFLENRNERAHRELEVGGEYQWRREGEYHLFNPDTVFKLQHATRTG
                     QYSIFKEYTKLVDDQSERLASLRGLFKFKKGERAPIPIDEVEPASEIVKRFSTGAMSY
                     GSISAEAHETLAIAMNRLGGRSNSGEGGEHPARFEVEENGDWRRSAIKQVASGRFGVT
                     AHYLTNCTDIQIKMAQGAKPGEGGQLPAHKVYPWVAEVRHSTPGVGLISPPPHHDIYS
                     IEDLAQLIHDLKNANPQARIHVKLVAEPGVGTVAAGVSKAHADVVLISGHDGGTGASP
                     LTSLKHAGGPWELGLAETQQTLLLNGLRDRIVVQVDGQMKTGRDVMIAALLGAEEYGF
                     ATAPLVVSGCVMMRVCHLDTCPVGVATQNPVLRERFTGKPEFVENFFLFIAEEVRELL
                     AQLGFRTLDEAIGRVDLLDTSKAKQHWKASKLDLSPILDDIETAFMFQDRRCTKSQDH
                     GLDRALDQQLITEAREALERGKPVKIDTKITNVNRTVGTMLGHEVTKLYGGAGLPDDT
                     IDITFTGSAGNSFGAFVPAGITLRVQGDANDYVGKGLSGGHLVVRPAPNAPAEFVADQ
                     NIIAGNVILFGATSGKAFISGVVGERFAVRNSGATAVVEGVGDHGCEYMTGGRVVILG
                     ETGRNFGAGMSGGVAFVYDPNGTFAARVNPEQRDALEPLAGDDFTWLRDIIAEHRDKT
                     GSAVADRILSDWSQQVNHFVKVMPREYKKVLLAISEAEKSGKDVDEAIMEAARG"
     CDS             89216..90685
                     /codon_start=1
                     /gene="gltD"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_970"
                     /old_locus_tag="nfa970"
                     /product="putative glutamate synthase small subunit"
                     /protein_id="BAD54939.1"
                     /transl_table=11
                     /translation="MADPQGFLKHTKRELPDRRPVPLRLMDWKEVYEENFSHQTLQTQ
                     ASRCMDCGIPFCHNGCPLGNLIPEWNDLVYRDRWREAIDRLHATNNFPEFTGRLCPAP
                     CEASCVLGINQDPVTIKQVEVEIIENAFDEGWVAPVYPTRLTGKKVAVVGSGPAGLAA
                     AQQLTRAGHTVTVFERADRIGGLLRYGIPEFKMEKRFIDRRLAQMEAEGTIFKTGVNV
                     GVDITADELREQYDAIVLAGGATQARDLPIPGRELDGIHQAMEFLPWANRVQLGDPVT
                     DADGLPPIHAKGKKVVIIGGGDTGADCLGTSHRQGAASVHQFEIMPRPPAERAASTPW
                     PTYPLMYRVSSAHEEGGERVFSVNTERFVGKDGKVTGLEAHEVKMVNGRFEKVEGTDF
                     TLEADLVLLAMGFVGPEKGGLLTDLGVGYDQRGNVQRDKNWATNVPGVYVAGDMGRGQ
                     SLIVWAIAEGRAAAAAVDQFLEGETALPAPITPTMVAQR"
     CDS             90970..91869
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_980"
                     /old_locus_tag="nfa980"
                     /product="hypothetical protein"
                     /protein_id="BAD54940.1"
                     /transl_table=11
                     /translation="MRWKKVVAGLGASAAIASGLVFGGGATAVADDCPSLYVVAIPGT
                     WETGHEKQPQPGMLSGVTRGLPRNVDVDYVTYAATAFPWEGEVYGNSKKEAVSAARGL
                     IGAMAQRCGGTRMALVGYSQGADAAGDLAAEIGTGLGVVPPDRLAGVGLISDPRRSPT
                     DVQVGPPAPGAGASGPRPGGFGWVSDRVRTICAVDDLYCATAPDDFVTRFAGFLAQSS
                     DANPANIWRYQLEAGAIINDLMAHGGMPTLQAQLSESANQKRAKDLERFYRSQAHTVY
                     GSYSVGGGQTAISWMRNWIAGMA"
     CDS             complement(91884..92243)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_990"
                     /old_locus_tag="nfa990"
                     /product="hypothetical protein"
                     /protein_id="BAD54941.1"
                     /transl_table=11
                     /translation="MPPHRRGAHAEKGHPLTSQRFSLSRTSLRRGSARVALAGALALV
                     PLGALAATAAAEAPADDAVVVQEAAPQAADISRPFDRDRPGPGPDRIIFRDERDPRGD
                     GPVVLERRLLPPTGSAG"
     CDS             complement(92306..92983)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1000"
                     /old_locus_tag="nfa1000"
                     /product="hypothetical protein"
                     /protein_id="BAD54942.1"
                     /transl_table=11
                     /translation="MSAAPPEPDAHARFPVRHSERVQLILVRHAQPLRVVDAAGPADP
                     DLSEIGREQAERVPAALSHHHRITRVLSSPQARARQTAAPTAAKLGLPVEIVDDLAEY
                     DRDLPAYIPIEDAKLEFRDAYERIKAGHLPEQIDGPAFVRRVLAAVDTVVAGTEPEDT
                     VVAFAHGGVVNVLLQDVLGLARPLTFPIDYCSITRVLFSRTGRRSAATVNENGHVWDL
                     LPRNRDR"
     CDS             complement(93057..93521)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1010"
                     /old_locus_tag="nfa1010"
                     /product="hypothetical protein"
                     /protein_id="BAD54943.1"
                     /transl_table=11
                     /translation="MYLDLLTNTNLLDHAVWASPDTWGSSDTYTQAMEYAARRRRRGG
                     GGLIFGAICCVAVIAAIGVGIYLMTKRKKNNDQGGQAPYGQPGGQPPYGAPGGGQPYG
                     QGGESGGQTYGQSYGAPGGQPPYGAPGDQPPYGAPGDQPPSGPSGPPPTGKS"
     CDS             complement(93617..94165)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1020"
                     /old_locus_tag="nfa1020"
                     /product="hypothetical protein"
                     /protein_id="BAD54944.1"
                     /transl_table=11
                     /translation="MFPGGVNESPRAAITLETRPGGAETNEKRDGGFMYLDVLSGASV
                     LDHSVWASPDTLLASDTYAQAIEHLAKRRRNRGSGGGGGGRGGLIFGAVCCVLVIVAI
                     GVGIYLMTKRKKNNDQGGQAPYGRPGGQLPYGQAAYGQAPYGQTGEQPLYGQQPYGQP
                     PYGAPGGQPPYGGHGGQPPYGH"
     CDS             complement(94188..97373)
                     /codon_start=1
                     /gene="lysS2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1030"
                     /old_locus_tag="nfa1030"
                     /product="putative lysyl-tRNA synthetase"
                     /protein_id="BAD54945.1"
                     /transl_table=11
                     /translation="MACLLWSLSPALRFLTGPPRRFVDDYYFDAPDTNVMWALIVGLL
                     AGAIASRKRIAWWLLVGYLTLFAVANGLRFAAEQNINALVAMIVQVGVVGLLIAAWPE
                     FYTRVRRGAGWKALGVLVGGLAIGCLLGWGLVEVFPGSLPPGWQRPGWAVYRVTAAIL
                     VENEHFGGHPRPFVNVLLGLFGAIALLAAVLTLLRSQRAANAMTGLDESAIRGLLEHS
                     DVEDSLGYFATRRDKAVVFAPSGKAAVTYRVELGVCLASGDPVGVREAWPHAIDAWLR
                     LADRFGWTPAVMGASEEGATAYRRAGLSALRLGDEAVLDTRDFSLAGPELRQVRQAAN
                     RLRKQGVRVRIRRHREIPSAEFEQIMARADAWRDTETERGFSMALGRLGDPLDADCLL
                     VEAVAADDRVLGMLSLVPWGRTGVSLELMRRDPQGPNGVMELMISQLALNSEQFGITR
                     VSLNFAVFRSVFEEGGRIGAGPVLRLWRGVLLFFSRWWQLEALYRSNVKYQPDWVPRF
                     FLFEERRQLPRVAVASALAEGFLPRLGKDPDASAHTGAQSAVPDTLTGLHADGSPPDW
                     PKPDLLDSGPRRPEQVRVRMAKLDRMTAAGVDAYPVAYPPTHTVAAARRSPRGTTVRV
                     CGRLLRIRDYGGVVFALLRDWSDDIQLVIDRERVGAARSAEFGEYFDLGDLIEVSGQI
                     GRSRSGELSLLAADWRMLGKCLHPLPDKWKGLADPEARVRQRYVDMAINPETRDVLAK
                     RSAVVRSLRESLNSWGYLEVETPILQQVHGGANATPFTTHINAYDLDLYLRIAPELYL
                     KRLCVGGMEKVFELGRTFRNEGVDFSHNPEFTILEAYEAHSDYIRMMHTCRVLIQNAA
                     LAANGSMVAMRPGADGALEPVDISGDWPVKTVHGAVSAAVGTEITPRTGVAELRELCD
                     RVGVPYQHGWDEGQIVLEMYEHLVEARTEEPTFYVDFPTSVSPLTRAHRSTPGVTERW
                     DLVAWGVELGTAYSELTDPVEQRRRLTEQSVLAANGDPEAMELDEDFLQALEHAMPPT
                     GGLGMGVDRIVMLITGRSIRETLPFPLVKPR"
     CDS             97629..98126
                     /codon_start=1
                     /gene="menG"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1040"
                     /old_locus_tag="nfa1040"
                     /product="putative S-adenosylmethionine:2-
                     demethylmenaquinone methyltransferase"
                     /protein_id="BAD54946.1"
                     /transl_table=11
                     /translation="MPEPANTESTVVATADLADEIGPEIRSCDTQFIQFGGRAAFSGR
                     ITTIRCFQDNLLVKQTLGEPGEGKVLVVDGGASVHTALVGDIIAGRGVDNGWAGVIVN
                     GAVRDSAILRTLDIGIKALGTNPRKSTQTGSGERDVPVEFGGVTFVPGEMLYSDHDGI
                     VVRAE"
     CDS             complement(98138..98359)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1050"
                     /old_locus_tag="nfa1050"
                     /product="hypothetical protein"
                     /protein_id="BAD54947.1"
                     /transl_table=11
                     /translation="MSDPVDVPITDDLIKLGQFLKLANLIDSGSEAKTVIAAGLVRVN
                     DEVELRRGRQLQVGDVVILAGHKVRVAAA"
     CDS             complement(98408..98800)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1060"
                     /old_locus_tag="nfa1060"
                     /product="hypothetical protein"
                     /protein_id="BAD54948.1"
                     /transl_table=11
                     /translation="MLSGMSGRTCPSPAQRLAYIGGATLPPSMSEWVLADLTGPGATR
                     RYLTRILLPIIPVLSLLLLLPGPLWMGLAMMALLYLPLIYFTIALMYVYRRHRLLQHG
                     LDPALADADVRARGAAERLAYERKHGRA"
     CDS             complement(98813..99271)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1070"
                     /old_locus_tag="nfa1070"
                     /product="hypothetical protein"
                     /protein_id="BAD54949.1"
                     /transl_table=11
                     /translation="MTVVKIVGECAASAESAFRYVNDYRNLPRFLHGIQSFTPVGSRT
                     EGVGAVFDGTMKLGPATLHSRVEVVRWEEGAAIGIKSIKGFDLESTFLFHPRGEDRST
                     VDAIVDYRVPGGLAGKALGRTIEPFVKIAVKHTNDNLLRQIAEFHARGAA"
     CDS             complement(99268..99894)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1080"
                     /old_locus_tag="nfa1080"
                     /product="hypothetical protein"
                     /protein_id="BAD54950.1"
                     /transl_table=11
                     /translation="MDLSAALIGELARHAAELPQVRTHVADATTWPHDGYDVVQAVLG
                     VFFFPDMAAGTEHLISRARPGGRVGCTIWRRGSMVLAGKHLGNAITAITGTPVRKRPE
                     HPVDRIDDAEAFGSWLTERGLTDVTVVEHPLRLALAPELAWLIVTGSGFVGALADLDR
                     DQVAAVHRRYLDSLAAAGVTDIDATTLIGVGTRVAANSPRTRADTVAS"
     CDS             complement(99949..100878)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1090"
                     /old_locus_tag="nfa1090"
                     /product="hypothetical protein"
                     /protein_id="BAD54951.1"
                     /transl_table=11
                     /translation="MSAPTTGRDAAALLAVVPAGLLGVGLAWLLARPDPAPVAGVVRV
                     LADCAGATVLGLAALPRLHDRLRPPWLALAVLGGVWWVAEGAVLLFEAADVVGVPVGE
                     LDPRRFGTYLTGVSGGQIGVAVLVGTAVLTGYAALAYRRGDDPSPDLVLVFAAVALAL
                     RPVTGHMSQQPLGSILAAVHALAAGTWFGVLVALALVVRGRREWAATLPRYSALAVPL
                     VAVVGVTGIVNGLIRLGGLTALLDTGYGRILLAKATLLAVLLALGWWWRRDWVRRAAD
                     HRMDAAASLRRAVLEVAVMAVAFGLAAVLAVTA"
     CDS             complement(100889..101422)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1100"
                     /old_locus_tag="nfa1100"
                     /product="hypothetical protein"
                     /protein_id="BAD54952.1"
                     /transl_table=11
                     /translation="MTARLLRIVLTALLAVGLALTAGGVAAAHSSAVGSVPENGARVD
                     KGPERISVTFNEDLQPNFPSLTLVGPDGNLWSRGEPTVEGKTVSVAAGELGPAGEYTI
                     AFRVTSADGHPVSGTRTFTLTTPGTGTPGDRADAAAESANGEGGVPLWVFVLGAVALF
                     GAGLAVALFGFRGRGRG"
     CDS             complement(101419..102078)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1110"
                     /old_locus_tag="nfa1110"
                     /product="hypothetical protein"
                     /protein_id="BAD54953.1"
                     /transl_table=11
                     /translation="MRSSLSRACGTAVAAVGVVLLTGGTAAAHVTADAPGAAQGGYSV
                     VTFRVPTESETAATTALTVTLPNVRSARTEPLPGWTARVDRNDKSEAVSVTWTADPGN
                     PGVQPGQFQRFVVSIGPLPSAETVSFPAEQTYSDGRVVAWNQPPAADGSEPEHPAPTL
                     TLATAPGDTAADGHHVGTEAAHADDASDETARWLGGIGLALGLFAVALGLGTVIRGRR
                     A"
     CDS             complement(102115..102645)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1120"
                     /old_locus_tag="nfa1120"
                     /product="hypothetical protein"
                     /protein_id="BAD54954.1"
                     /transl_table=11
                     /translation="MSSGPSLGWPRGGLVGAVVGLLGVAAHGAAGGGYPDTAELALLL
                     MVSTAVGAAAVPRAQSAAAPVPVPVLLALGQFAAHVVLSGLSGHPAHGTAPTAVPSGW
                     MITAHVVATVACAVLLASAERLYRAASGTIRALFGVPRPPAPVAVLPVPAVGRRHYRS
                     VPKGVAAPRAPPVWSS"
     CDS             complement(102650..103282)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1130"
                     /old_locus_tag="nfa1130"
                     /product="hypothetical protein"
                     /protein_id="BAD54955.1"
                     /transl_table=11
                     /translation="MGLFTKRTRRPSRRAEAKALKHKAGLEAKLAAKNERKARRVEAR
                     TQRKVAKQQIATLKAEEKAAVKAAARAERDPFSAGQVKKYIGVARVLVPVLAPLAYRG
                     ATYLRGQLDTRRAQQLGIGVHQLADYSGHGAKLQARIANTEAALGRVEDNGEETRTFV
                     AATRDRLASLDTAVRTAEQMPAGRRRAVHASISHELSGIEADVLARLGVR"
     CDS             103400..105244
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1140"
                     /old_locus_tag="nfa1140"
                     /product="hypothetical protein"
                     /protein_id="BAD54956.1"
                     /transl_table=11
                     /translation="MAGRVSAVRGRVGGLDHTAYVHSGSGDRDGHDEDGSTGQRSAAT
                     AASAGYLDARALIGCRHRLHMDSAHPGALADVTEDAGVRQRREAAAAHRARVRDLLVA
                     AAPEQWVIVDPALRAADRAEATVRACAAGAQRIWGALLPQEPDTGRRGGVEILLRDAD
                     RGGYIPVIVVNHKVTDPRRPEPADFHPTTSDPFHWDPQPDPARKLRQQPRDQQRLAHL
                     YRMLQRHGLASPGLLGGVIGLQFDRILVHDVAPLLAEYDRRYADRIAVVRGQVPTVPA
                     KVPECRQCPWWTRGMGGPSCEQWLIQRRDVSLVAPGSRAEVLRAHGVTTIDELADWTG
                     PDPEDWQHGPFDEAVVTARAWLAGAPLVRRFEQVRVRRADVEVDVDLESYQEHGAYLW
                     GTLLDGQYRPFVTWDPLPTEDEGRSFGEFWTWLMTVRAQAHAAGKTFAAYCYSRTAED
                     KWLYESARRFAGRPGVPTVEQVRAFVDGPEWVDMFQAVTEQFICPNGKGLKKIAPVAG
                     FAWRDPEASGEASMSWYRLAVGYDAAPDLGQRTRLLEYNEDDVRATMTLREWMSPRVP
                     DPHCAALEVPSLADFARRSDLGGAAGAAAAAGPRPAAGSLGRGGTIAT"
     CDS             105241..107199
                     /codon_start=1
                     /gene="htpG"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1150"
                     /old_locus_tag="nfa1150"
                     /product="putative heat shock protein"
                     /protein_id="BAD54957.1"
                     /transl_table=11
                     /translation="MTEHVEQLEFQAETHQLLELMIHSVYSNKDTFLRELISNASDAL
                     DKLRLESFKDKDLHVDTADLHIELEVDKDNRILTVRDNGIGMSRAEVVDLIGTLAKSG
                     TAELRRKLSEAKSEAAAEELIGQFGIGFYSTFMVADKVTLTTRKAGETGGTRWESSAG
                     SSTYTIEDLAEAPQGTAVSLHLKPADEEDHLYDYTQEWKLREIVKKYSDFIAWPIRMQ
                     VERTVTEGEGEDKQEKTIVEEQTLNSRKALWTRPRGEVSDEEYKEFYKHVSHAWDEPL
                     EIIPLKAEGTFEYQALLFLPSQAPFDLFTREHKRGVQLYVKRVFIMDNCEELMPEYLR
                     FVKGVVDAQDLSLNVSREILQQDRQIQMIRKRLVKKVLATVKDLQQAEDQSKYQTFWR
                     EFGRVLKEGLLSDFDNRETILQVSSFASTHSDSELTTLAQYVERMPEGQDAIYYMTGE
                     SRQQVESSPHMEAFKAKGREVLILTDPVDEMWVGSVPEFDGKRFQSIAKGEVDLESEE
                     EKKASEALREQQDKEFADLLSWLGKTLEENIKEVRLTNRLTTSPACLVGDVFDFTPML
                     ERMYRASGQPVPVSKRILELNPTHPLVTGLRDAYDQRKQDADEGKVPELTETAELLYG
                     TAVLAEGGELKDPARFAHILTDRLTRTL"
     CDS             107596..108312
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1160"
                     /old_locus_tag="nfa1160"
                     /product="hypothetical protein"
                     /protein_id="BAD54958.1"
                     /transl_table=11
                     /translation="MITTIALSIGIVFLAELGDKSQLMALTFALRYRWWVVLGGIATA
                     SAGVHILSVAVGHFLGAALPTRAIALVAALTFLAVGLWTLREHLVGGEEDAPPAPRSS
                     RAPFLVVLSAFLLAELGDRTMFATAALATDNHWFGVWIGSTVGMVAADGLAIALGILL
                     GKHLPEHIIGIASGLLFLLFGGATLLSALAPALSAVAGLALAALLPAAAGAAMLIRKR
                     RRAAAGAGREPDPLAVPRPE"
     CDS             complement(108359..109012)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1170"
                     /old_locus_tag="nfa1170"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD54959.1"
                     /transl_table=11
                     /translation="MQRKAGSARQLPRGRHGLPREQVIASQRDRILDAMADAMAAEGY
                     VGTSVAAVLKRAGVSRETFYEQFRSKEDCFEAAYERAVERLVARIAAAAQRRADAPVG
                     RPDLERMERLLDAYIEGLAEDPAYARLYLVEVYAVGSKALAKRAQLQASFVELIAEVL
                     DARTDAQRFACVAFAAAVSAMVTARIAADDLDGLLRLREPLLDLVLRGGAVYGGAPG"
     CDS             109125..109892
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1180"
                     /old_locus_tag="nfa1180"
                     /product="putative short chain dehydrogenase"
                     /protein_id="BAD54960.1"
                     /transl_table=11
                     /translation="MEISGSAAIITGGASGLGAATAKRFAELGATVFGLDIPASIERA
                     GDNVPAGVTLIPADVTSNDEVAAAVAQVVESGAPLRIVVNCAGVGWAGRILSKNGPHD
                     LELFRTVITVNLLGTFNVMRLAADAIAKTDPVDEYGQRGVVINTASVAAFEGQIGQIA
                     YSASKGGVHGMTVPAARDLAQFGIRVNTIAPGIIDTPMLAGVTEEYRKGLEAGVPFPS
                     RLGRPDEYAQLSQYIVEHDYLNGETIRMDGALRMAPR"
     CDS             complement(109964..110782)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1190"
                     /old_locus_tag="nfa1190"
                     /product="hypothetical protein"
                     /protein_id="BAD54961.1"
                     /transl_table=11
                     /translation="MSAHPFAAPEPWDLVADGYAETTHALLEPFSARALELVAPGPYA
                     RVLDVAAGPGTLSLPAARQVAEVAAIDFSEEMVRLLTARARAEGIDNIRATVGDGQRL
                     PFTDDRFDAAFSMFGLMFFPDRRKGFGEMFRVLRPGGVAVVSSWAPVLESTLMRMVFA
                     ALRAADPSIQEPQPNYLNLENPEVFATEMREAGFAGVSIQRHTHSVAYADGADLLAQM
                     VRGSAPLTLLRREVGEREWERRAAIMRAHLDEHYRPNMPLTTTALLGIGHKPAA"
     CDS             complement(110919..111449)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1200"
                     /old_locus_tag="nfa1200"
                     /product="hypothetical protein"
                     /protein_id="BAD54962.1"
                     /transl_table=11
                     /translation="MTTSDTSIGITPFHSRGSLRGFVISGRWPDTTKEWAQVLVLAVR
                     VASLPGLLPTTTVFGVREELPDDPQPGTVGLVMAEGPVLGEEAVEPGRFAEHVPPALL
                     MLHPPSETRPSLPECAGAASGCVLLPGVPHLGLEHRAAWAEAESDGTVTSLVSRVGLD
                     PISDPDTAVLAMLLAA"
     CDS             complement(111687..112307)
                     /codon_start=1
                     /gene="sodF"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1210"
                     /old_locus_tag="nfa1210"
                     /product="putative superoxide dismutase"
                     /protein_id="BAD54963.1"
                     /transl_table=11
                     /translation="MAEYTLPDLDYDYSALEPHISGQINELHHSKHHAAYVAGANQAL
                     EKLEAARESGDHSAIFLYEKNLAFHLGGHVNHSIWWKNLSPNGGDKPVGELAAAIDDQ
                     FGSFDKFRAQFTAAANGLQGSGWAVLGYDTLGQKLLTFQLYDQQANVPLGIIPLLQVD
                     MWEHAFYLQYKNVKADYVTAFWNVVNWADVQDRFARAVNQGKGLVF"
     CDS             complement(112494..113105)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1220"
                     /old_locus_tag="nfa1220"
                     /product="hypothetical protein"
                     /protein_id="BAD54964.1"
                     /transl_table=11
                     /translation="MNRSRGSRDGFDAQGLNTALAEAACLGAEVDTDGARLCLDLSVL
                     TLAEDEAAPHERRVRLTFTGVSRIAASLRVHAWGDVPPQVLPLRLEELAEAIRSFGGA
                     RLHGWEYIDVDDSGWALWRELLSFDTTIDNRISPHVLEFSQEEGIDPRELDVRVWFDA
                     ITIHDPDGTEIPLAEFIACGTRWWQAHDAADPRTLQSGIVPQL"
     CDS             113609..113965
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1230"
                     /old_locus_tag="nfa1230"
                     /product="hypothetical protein"
                     /protein_id="BAD54965.1"
                     /transl_table=11
                     /translation="MTSSEIPSVQVDEVPGAFDTGRPEGAILLDVREDDEWQQGHAPG
                     AVHIPMADVPARTDELDYDAEVYVICRQGGRSIEVVKYLTHIGYEAVHVSGGMVAWQR
                     TGRPLVAEGDRQAKIY"
     CDS             113988..115079
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1240"
                     /old_locus_tag="nfa1240"
                     /product="hypothetical protein"
                     /protein_id="BAD54966.1"
                     /transl_table=11
                     /translation="MSTVVQPCARCGARWAVQSTPLHWCPRCRGVLLSPGPIDAPPQR
                     RNYRWVARKPDHRVRKPGGTGPAAATPTPRYREIPRWGLHDLPPPAPAAARSRLDDFA
                     SNTERLLILTAWLFGLAALAEVLRYLILLRNRTRLIHPFVLTLSDVFVWATGLAAVVF
                     ALGTAVALAGWLIRTRRATYASTGHADPRAPYAILLGCLVPVVNLLWPGVYLAELATA
                     TGDPRAERAVRIWWCAWVGNGVLVAAALLWRTADSLQAQADGVAFTALTDAVAAAVAV
                     LTLAVVRLFDGRDLRGRARMARRWVVATDPAVPVIEPVHPGGARREAEPAVAARDADD
                     AGVTEDRVTEDRQIAHGAEDRAQEEVVAK"
     CDS             115076..115843
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1250"
                     /old_locus_tag="nfa1250"
                     /product="putative glycerophosphoryl diester
                     phosphodiesterase"
                     /protein_id="BAD54967.1"
                     /transl_table=11
                     /translation="MSQGNRAPFVVAHRGASAALPEHTLAAYELALQEGADGVECDVR
                     LTRDGHLVCVHDRTVDRTSSGTGPVSEMTLAELKALDFGADGTPASVLTLSELIELVL
                     DWRSRPTKLFIETKHPVRYGALVENKVLAELQRYGIATPASADHSRAVVMSFAATAVW
                     RIRRAAPLLPTVLLGESSRYLGGGAATTVGATAVGPSVKTLREHPELVDKAAAAGRAT
                     YCWTVDEPADVRLCADLGVSWVATNHPGRTKALLAAA"
     CDS             115901..116821
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1260"
                     /old_locus_tag="nfa1260"
                     /product="hypothetical protein"
                     /protein_id="BAD54968.1"
                     /transl_table=11
                     /translation="MGKSKRNSPKPGGNRAQRLAERKAALEQAAQVVTRPFEGLAAEC
                     DLVALREFVPSATATLPLQPGVAPEREVVLGTVLPGAVAALVRAGEPPVGYVGAQVQF
                     QGADAGADLAAAILWTQSAEAGDSLTSVESIAGGPRLTDVIDPNASLDLTVHQDFDWW
                     VPEGVTPDPQVAATIEQAKQAIMPSARLDLGADVVGAAWWVDAGEKAHVRWVRPEDED
                     ALMLALARVHAAGGLHMGEGSRFAGSFRTHGLLVPVFDLDPERHPSEWVEPAREFGGR
                     LADALAVDTPLTADERRSRDGLRSRQVTLR"
     CDS             complement(117089..117637)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1270"
                     /old_locus_tag="nfa1270"
                     /product="putative ferritin family protein"
                     /protein_id="BAD54969.1"
                     /transl_table=11
                     /translation="MSSHPENPRSKFHSLLHDQIRHEFNAEHQYIAIAVWFDNADLPQ
                     LAKRFYRQAVEERNHALMIVQYFLDRDISVELSGIDAAKSHFETAREPIALALAQEKT
                     VTEQIIRLASTAREEGDYLGEQFMQWFLKEQVEEVANMTTLLNIADRAGSNLFDLEDF
                     VAREMSGPADASYAPSVAGGSV"
     CDS             complement(117709..118257)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1280"
                     /old_locus_tag="nfa1280"
                     /product="putative ferritin family protein"
                     /protein_id="BAD54970.1"
                     /transl_table=11
                     /translation="MSGSEVAEAFPALLNAQIRRGFTVAQQYLAGAVYFDVRRLPRLA
                     GHCYLRHEHHRGHALRMVQYLLDRDLPVRVGGLDGVQSDFDSEREAVALLLAAERAYT
                     DEVTALTAAARDSADYLGEQFMQWFLREQLDAVAGMTTLLSVLERRGGNLFDVEEFVA
                     RELKPGKGADPTAPKMAGAGHI"
     CDS             complement(118267..119598)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1290"
                     /old_locus_tag="nfa1290"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD54971.1"
                     /transl_table=11
                     /translation="MMNGDDPRNARTRRVPPPQGRPGMPHQRDPRAADPGHGAPGHRP
                     APPPRPVEPTKKLYRDAAPHQPLAYSQVPQEPPPRLRRTDYAPTQTPEPFEDPRAHRP
                     PRRHAPPPPPAAPPRRRDPAPRPPRPRRKRHPFRWFLIFLLVLVIGSVAGVIHLDGKL
                     TRIDALAGYADRVGDTPGTNWLLVGSDGRGGLTAEQEQELATGGEVGPERTDTIMLVH
                     IPRSGKTTLVSLPRDSYVSIPGHGRDKLNASFALGGPQLLVQTVEIATGLRIDHYAQI
                     GFAGFANVVDTLGGIEVCLPQAIDDPLAGIDLPAGCQELDGPQALGFVRTRATALADI
                     DRMNNQRLFMSALLEKATSASTLANPFTLWPLASDIARSLKVDEGDHLWDLGRLGWAM
                     RGDTVATTVPVGGFDDVSGSGNVVLWDKNRAGAFFEALADDRQIPDDLLTR"
     CDS             complement(119658..120449)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1300"
                     /old_locus_tag="nfa1300"
                     /product="hypothetical protein"
                     /protein_id="BAD54972.1"
                     /transl_table=11
                     /translation="MPAESPARREESEPTDRERSAIRLEIAIVLVVTFGLSGFGAALA
                     LLDSALSPEGVGGRTVALNASRSTNSLLDLLFQLVGVLRLAAWAALGLYLLSRSGIGP
                     KLIGLGRPRPRIDLPPGLVLAAVIGLPGLGLYLVAHAMGVSVTIVPSSLDEHWWRLPV
                     LLLSACANSVAEEVLVVGYLLTRLRQLGWSANSALLASALLRGSYHLYQGLGGGLGNL
                     VMGLIFGRYWQRTNKLWPLVIAHATIDAVAYLGYVALRGRVGWLP"
     CDS             complement(120519..121280)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1310"
                     /old_locus_tag="nfa1310"
                     /product="hypothetical protein"
                     /protein_id="BAD54973.1"
                     /transl_table=11
                     /translation="MPNPVLVPSTAERVRSACAHAEQAVLALPGIDPTPTSVHHLRQC
                     GDVVVAVPAGSVAAVLTANSGPGGAAAVLELTDHAPLPLREPVRALVWLRGAVRTVPQ
                     SAQRALAGEVAKEFPHPELLDVGHGATLLRLVIDTAVMADATGAESVRVEELRSAQPD
                     PFCQMESAWLQHLDADHPDILEQLARHLPPRLQTGAVHPLAIDRYGLTLRVEGHDGDH
                     DVRLPFTAPVDDVEALSRAVRALAGCPFLNGLRRI"
     CDS             121416..121841
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1320"
                     /old_locus_tag="nfa1320"
                     /product="hypothetical protein"
                     /protein_id="BAD54974.1"
                     /transl_table=11
                     /translation="MADAPTPAGNPPHEPVLVTLSTPARRSLVAGLVRPVTPRPEAPV
                     LHADGSDAEVADFLAAIAHAETGYLARTDSGPRALAVVAATAAALCGEDIRAALAAPD
                     LAFLTALKPPAIEAVRGVLLAVETEQPEAVRAALAVLEP"
     CDS             121927..122841
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1330"
                     /old_locus_tag="nfa1330"
                     /product="putative prephenate dehydratase"
                     /protein_id="BAD54975.1"
                     /transl_table=11
                     /translation="MPRIAYFGPTGTFTEMALAELESSGHFDGPVERVAAPSQPAALD
                     LIRSGAVEGAVVPIESSIEGSISATLDSLAIGPRLQIVAETELEVSFEILARPGTTLA
                     DVRTLAAFPVAAAQVRMWVERTLPQVRMYTSASNAAAAEDVVAGHAEAAVSTALAGQR
                     LGLVALASKVVDYEQAVTRFVLVRRPCVAPPATGADRTSIVLELPNVPGSLMRAFAEF
                     ATRGIDLTRIESRPTRTGLGTYRFYLDCVGHIDDAAVAEALKALHRTARIRFLGSWPA
                     TSATGTPPPSDEEAAQWLTQLRKGVADL"
     CDS             122838..123518
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1340"
                     /old_locus_tag="nfa1340"
                     /product="putative phosphoglycerate mutase"
                     /protein_id="BAD54976.1"
                     /transl_table=11
                     /translation="MTGAGSAGRLILVRHGETEGNVAKLLDTRVPGLPLTERGAAQAK
                     TFGSTLLTPPRVLFTSEALRARQTASFIEAATGVAASVLEGVHEVQAGDLEGLNDEEA
                     HRTFQRIYRAWHEGDLKVAVPGGESGADVLDRFLPVIEDLRQRFLDPDANTGDVLLVN
                     HGAAMRLVARTLTGVGPPFTTNNHLDNTETIELVPRLDGGWECVRWGRFVPPFGYEVS
                     PTADDPMG"
     CDS             complement(123579..124379)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1350"
                     /old_locus_tag="nfa1350"
                     /product="hypothetical protein"
                     /protein_id="BAD54977.1"
                     /transl_table=11
                     /translation="MLGGVTLALDEMQFLLEKLEFDELPVVLQAVGRYDNQADHDAAM
                     QVAENSLVERDLLIDGVVHRELEDRLRTLYRPHWVLALRLVVEGQVSRMCLAQGDDMA
                     VVALRGPQSYVVDEVDEDLPGPLVAALGSAEPLELESMNAQTELLAPIFGDAGDSAAT
                     ANRLAKVCQPARDVQTLASALVEIRSHTQISGVVYGDGIRDIADSHVAVFDTRGGRIV
                     LTASVADDGTKWTSISSGTTARLRTAIQDLIDSLPEREKFPPVVTEPI"
     CDS             complement(124409..125566)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1360"
                     /old_locus_tag="nfa1360"
                     /product="hypothetical protein"
                     /protein_id="BAD54978.1"
                     /transl_table=11
                     /translation="MTAGITGVFWLPRMAEANSIALNAGAHAVPISAAATAWGALTAA
                     WVDATATVTRVMAELGVGMQGVNGIAALSRLVGFTGWAEQQGVMAAAMGSKAAANATA
                     YTVASLAMPSLPEILATNAAVVASANPAGAVSGAFEAAELAKHAMDLRAALVMETYEA
                     ATTAVVTTPGEFHAPPPIADGAGTASPAQSAETSFQGDPVQTALATAASVVNNPAVVS
                     AATQAANVAGTVATSGVSTVGNLGASAIAAATGAAPAAPVAAAPAAVMGAGPAAGGAG
                     AAATRSATVGLGGSVNLQNGSLKLPEGWGSGLQSAAPAATPATEVVARVETAPARAAN
                     APGSPLLGRTQSAEDEETEHKAADYLRGDHFGDGRYAADGVIGADPAGTAR"
     CDS             complement(125607..125930)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1370"
                     /old_locus_tag="nfa1370"
                     /product="hypothetical protein"
                     /protein_id="BAD54979.1"
                     /transl_table=11
                     /translation="MVGHVSISPELILAAAAELDLLAERLAAAATLSGPATHVLPSGA
                     EEVSLLAAQHFNKAAATHDHSIAQGILELHHAANVLRMQLATHVAEDVVKAGVMNSVA
                     GTIGA"
     CDS             complement(126032..126382)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1380"
                     /old_locus_tag="nfa1380"
                     /product="hypothetical protein"
                     /protein_id="BAD54980.1"
                     /transl_table=11
                     /translation="MAVSMSEDRFEELVSDALDLIPPELTGAIDNVVVLIEPRDPDDP
                     HLLGLYRGIALTERDSHYGGALPDTVTIYRDAILEICADEAEVVEEVAVTVIHEIAHY
                     FGIDEERLHQLGWG"
     CDS             complement(126395..127549)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1390"
                     /old_locus_tag="nfa1390"
                     /product="hypothetical protein"
                     /protein_id="BAD54981.1"
                     /transl_table=11
                     /translation="MSSDDVSQDDVSQTPQQPRPGAGRPARARRSRAGSGNDSALARV
                     REVRLSAPKLRWGLLAAAAGAVVAALVTLFVTGFENEKGLEAHNPAAPAHTVLDKEFG
                     TASAGDCLTWSKPDRSDLMKVACDNRHLFEVAADIDMSRYPGVEFGPGSRFPDSLRLT
                     ELKEEHCVPAVQRYMNGKFDPRGRYVVGLMYPSPEGWKNGDRTLRCGLQFSASTGAPL
                     PTTGSAATQDQSKVFAAGTCLGINQNLPTDPVDCAQEHAVEIVSTVDLGTHFTGGPPA
                     KADQDKFVEEQCTTAVNDYLGSPDAIRNKTLTLFFDYVDARSWLAGSRKLDCMIGKGT
                     DREGFAPIIGSARGDILINGQAPVPPPNSGRSTPTPLPGAAPLPPQPQPR"
     CDS             127645..128907
                     /codon_start=1
                     /gene="serS"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1400"
                     /old_locus_tag="nfa1400"
                     /product="putative seryl-tRNA synthase"
                     /protein_id="BAD54982.1"
                     /transl_table=11
                     /translation="MIDLRLLREDPDAVRASQRARGEDPALVDALLEADAARRAAVAT
                     ADNLRAEQKAMSKQIGKAPKEERSALLARAQELSVKVKEAEAAQHAADADLDAAHRAL
                     SNVVLPAVPAGGEDDYVVLETVGTPPEFDFEPKDHLELGEALGLMDMERGAKVSGSRF
                     YFLTGHGALLQLGLLQLAAQKAVANGFTMMIPPVLVRPEVMAGTGFLGRHAAEVYHLA
                     DDDMYLVGTSEVPLAGYHADEILDLSAGPKRYAGWSSCFRREAGSYGKDTRGIIRVHQ
                     FDKVEMFVYTTPDQAEAEHERLLAWEREMLAAIEVPYRIIDVAAGDLGSSAARKFDCE
                     AWVPSQQTYRELTSTSNCTTFQARRLSVRYRDENGKPQIAATLNGTLATTRWIVAILE
                     NHQRADGSVRVPAALVPFVGTDVLRPPA"
     CDS             129005..130861
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1410"
                     /old_locus_tag="nfa1410"
                     /product="hypothetical protein"
                     /protein_id="BAD54983.1"
                     /transl_table=11
                     /translation="MSRLFSVRGIGARGDTRTRVRAASALATAMVMARTTGAFYVMGG
                     VLGLVITAVAPGDEGNRPLVGTAAAIALALGLTLLAWGPRLPHGIHHGYVAIATVLIT
                     IAVYAFPNTVGAISLAAFYVFIACDAALFFRWPQAAAHIAFAVVLCLWSLPTRDLPWW
                     SGIIPAGVTFGVGVVVGILTRMASEADIDVLTGLLNRRGFDRALNTAIEHATRSGQGL
                     ALVLVDLDRFQKINDHLGHRAGDAVLQRVADTWSKLLAPDQRLARYGGDAFALLLPNT
                     TEQAAILLTEQLRAAVTTGCSAGVTSWQPGESGSLLVSRADVGLYRAKQAGRNRTVLE
                     SSRQLPLAVELREAIDRGALDVHYQPIVSLTEGGGKAVGVEALLRWSSSAQPDVTTEG
                     LIRVAEEYDLIADLDELVLRRACADAARLQETFAQLDLTLNVNVSGLELAEAGYADRV
                     SDILSATGWPADQLVLEVTESELAAESQTAIANLHTLRERGVRIAIDDFGTGYSSLSR
                     LATLPSDILKVDQSFVAAIRSDSPAPPLLGVIAALSNALDLQVIAEGVETEYQAAVLT
                     ELGFALAQGYHYSDSHPVSELINDLNYGQGRVGSGQSERADTVASNGWVPLS"
     CDS             131018..132397
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1420"
                     /old_locus_tag="nfa1420"
                     /product="hypothetical protein"
                     /protein_id="BAD54984.1"
                     /transl_table=11
                     /translation="MLFKGSREFVPLYALYALLFADHGLTTAQISSLFALWSITSFVL
                     EVPSGAWADTVSRRGLLVLSGALVAAAFTVWTAAPSYLGFALGFVLWGVAGALESGTF
                     EALIYDDLAARERAGEYARVMGYARAAAEGAVVVAILAAAPLYALGGYGLVGWASVAI
                     ALAHTALACGLPSVPKAGSVAEIDAVPEPVVPGHPPVPGEPRAAERSVGERWVVPVAD
                     ADSGPPARAVAAGGDATTVAAGDGVAARYLRMLRAGVGETVRTPRIRRAVLLGSMLFG
                     ITAYDEYFALLAQAVGVSTAVVPVLIGVTVVGSMTGTLLAGRTSGWSGRGLAVMVAVG
                     GLLFVAGALVAGLAAGRPGWVYPLTAAGFIALGVGYGAVLNAEIVADARLQDAIEGPA
                     RATVTSVSGLLAEVVALAVFGLAALAATWLSMAVTLAVLGALMLGVAALTPSWLPRPA
                     ADQAAVDGR"
     CDS             132459..133406
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1430"
                     /old_locus_tag="nfa1430"
                     /product="hypothetical protein"
                     /protein_id="BAD54985.1"
                     /transl_table=11
                     /translation="MRLGLVFGFCIGAGVAVQARINGALGMRLHDGIAAATVSFGTGL
                     VVLAAAFAASGRLRAGLAAVRRALGEGQLRGWQLLGGLFGAFFVASQGLTVAAIGVTA
                     FTVAAVAGQLLSSLAVDRAGLAPSGRTPVTPRRAGGAVLAIGAVVLATSTRTDAGQAG
                     LALPESVREVPHPVLIALPALAGIGLAWQQAVNGRVGAVGGAGSAALVNFAVGFAVLL
                     GVEFVVVLTLRGLGAFPTEPWLYLGGVIGVAFIALAALTVRWIGVLLLGLTSVAGQLV
                     ASVALDTLVPAGPGLSPWSLLGCLLTLVAIALATGPNRA"
     CDS             133525..133839
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1440"
                     /old_locus_tag="nfa1440"
                     /product="putative transporter"
                     /protein_id="BAD54986.1"
                     /transl_table=11
                     /translation="MSWLLLVISGVLEAVWATALGRSEGFTRLVPSVVFFVALAGSMA
                     GLAWAMRDLPVGTAYAVWVGIGAVGTVAYAMATGTEPIAWTKILFLTMIIGGVVGLKM
                     VG"
     CDS             complement(133840..134451)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1450"
                     /old_locus_tag="nfa1450"
                     /product="putative transporter"
                     /protein_id="BAD54987.1"
                     /transl_table=11
                     /translation="MLTAAVAGFGAGLSLIVAIGAQNAFVLRQGVRGQAVLAVVGICA
                     ASDIVLIGLGVAGLGAVVAAWPGALTAVGLAGGVFLLGYGVLAARRALRPDAAALGDS
                     GAAAGSVRAAVVTSLALTWLNPHVYLDTVLLLGSIAADRGSLRWIFGLGAMLASTVWF
                     TGLGYGARLLSPVLARPAAWRVLDALVAVTMVAIGVSLLARTF"
     CDS             134534..135436
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1460"
                     /old_locus_tag="nfa1460"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD54988.1"
                     /transl_table=11
                     /translation="MIDLPLDQVRTLLAVVDTGTFDAAAAALHVTPSAVSQRIKALEQ
                     RTGRVLVLRTKPVRPTESGQVLVRFARQLAALERDTQRELGIAAGSDATYLPIAVNAD
                     SLATWFLPALTRVPQDPPICFDLHREDESHTAMLLREGRVMAAVTSAAEPVPGCTARP
                     LGAARYLPVASPAFAERHLRGEPGRRLPDAPVVVFDRRDELQDRFVRTLTAGRAAAGA
                     LRHHIPTSEGFCDAVTAGLGWGLIPEPQAAPLLRSGQLTTAVPGRWADVPLYWQQWKL
                     DVPALALVAETIATAAAESLHPWR"
     CDS             complement(135450..136985)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1470"
                     /old_locus_tag="nfa1470"
                     /product="hypothetical protein"
                     /protein_id="BAD54989.1"
                     /transl_table=11
                     /translation="MQITSVGHAGFHIRTAAGSILCDPWVNPAYFGSWFPFPDNTGLD
                     WDELGNCDFLYVSHLHRDHFDAKNLAEHVNKDATVLLPDYPVPDLRRELEKLGFHKFF
                     ETEDSVKHTVTGPGGDLDIMIIALRAPADGPIGDSGLVVSDGETTCFNMNDARPVDMD
                     VLHEAFGHIDIHLLQYSGAIWYPMVYDIPARTKSNFGKQKRQRGMDRARSYIEQVGAT
                     WVVPSAGPPVFLDPELRYLNDDRGDEGNIFPDQMVFLEQMRIHGNEGGILMIPGSVAD
                     VRGKELDLTHPFDPDRIYGDKAAYIEDMAQRMAPVLAAEKATWAHGEGSLLEPLKELF
                     EPIMAQSDLICDGIGYPVGLVLGEETVVLDFPKRVVRAPIEGEGRYRYGFRIAPELVR
                     TVLRDNEPDWVNTIFLSTRFQAWRIGGYNEFLYTFFKCLTDERIAYADGWFAEAHDDS
                     ASTEIAGWEIQRRCPHLKADLSKFGVVEGTTLTCNLHGWQWDLESGRCKTSKGHELRS
                     RKL"
     CDS             complement(137072..137995)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1480"
                     /old_locus_tag="nfa1480"
                     /product="hypothetical protein"
                     /protein_id="BAD54990.1"
                     /transl_table=11
                     /translation="MERARPHESARDRRASSRGRGAPGARALAAGAAVTAAVLLAGCD
                     SVSGIPGDEPVAAAEPVATEPVPSSATTAPAPPPTSTLPPPPADAPEVGAVPGVPEAA
                     TAVRRWAADLETDTIAELQDKCWTLPPGTVADMYAQPQTILAALARPGTATADTVTWK
                     SAAATVTVERAAITTGYACPRVYGPGETIGYDDADARHTVRRYLSRLVGEPLDPADTE
                     DAHPLLCAASPATWDPTGSGRKVPAPLAANPGKLTGVTAFDGDELTSQWLSAGYITVD
                     VPVTTAAGTTTTRTFTLAEGDEGYCLGDVTR"
     CDS             138114..138866
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1490"
                     /old_locus_tag="nfa1490"
                     /product="putative 1-acylglycerol-3-phosphate
                     O-acyltransferase"
                     /protein_id="BAD54991.1"
                     /transl_table=11
                     /translation="MEPVYRTIIGLARTVFFVQGLKFTVTGAEHIPARGGAVLAVNHT
                     GYMDFTYAGLPVRRVKRYIRFMAKKEVFDDKISGPIMRALKHIPVDRAAGADSYQAAV
                     DYLRRGELVGVYPEATISRSFEIKEFKSGAARMAIEADVPIIPIVIWGAQRVWTKGYP
                     KRLGRTNTPISIAVGEPIAPYEPAADLTAQLRSTMQRMLEEVQRDYEHEPGAYWVPAR
                     LGGSAPTLAEADAMDAAEAAERAAKRAATPED"
     CDS             138884..139624
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1500"
                     /old_locus_tag="nfa1500"
                     /product="putative 1-acylglycerol-3-phosphate
                     O-acyltransferase"
                     /protein_id="BAD54992.1"
                     /transl_table=11
                     /translation="MAREPVYDLLTGLVRTLFWAQGLRIDIEGQEHIPRVGGAVLAVN
                     HTAYLDFMEVGLVGRRSGRNVRYMMKAELERGIVGFLMKQCKAIGVDRSAGAESYAKA
                     VAALRAGELVVVYPEATISRSFELKEFKSGAARMALEADVPIIPIAIWGAQRIWTKDI
                     PKQLGRHRFPIHIRVGAPIPSAGSPAELTARLRAELGARLAAAQQNYPAPPGARWLPA
                     RLGGTAPTLEQAADLERAELEARRAKAR"
     tRNA            139692..139770
                     /gene="glyT"
                     /inference="profile:tRNAscan-SE"
                     /locus_tag="NFA_80040"
                     /old_locus_tag="nfa80040"
                     /product="putative tRNA-Gly"
     CDS             complement(139777..141558)
                     /codon_start=1
                     /gene="poxB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1510"
                     /old_locus_tag="nfa1510"
                     /product="putative pyruvate oxidase"
                     /protein_id="BAD54993.1"
                     /transl_table=11
                     /translation="MATQVADQVLARLREWGVDQVFGYPGDGINGLVAAFGRAGNTPR
                     FVQTRHEEMAAFAAVAYAKFGDRVGVCTATSGPGAIHLLNGLYDAKLDHVPVVAIVGQ
                     TARSAMGGSYQQEVDLQALFKDVASDYLVEVNVASQLPNALDRAMRTALTRRAPTALI
                     IPADLQEEDYEPPAHAFKQVPSSPPHDLTSTAVPPAEHLRRAAEVVNAGDKVAILIGQ
                     GARGAAAEVEQLAELTGAGVAKALLGKDVLSDELPYVTGSIGLLGTKASWELMQDCDT
                     LVIVGSNFPYSQFLPEFGQARAVQIDRDATLIGMRYPTEVDLVGDAKATLRELLPLVE
                     RKTDRAWRESITEQVRRSWEITEAQAMVDAEPVNPMRVVWELSRVLPENAVVTADSGS
                     STNWYARCLRMRGQMRGSLSGTLATMGCGVPYALGAKFAHPDRPVVALVGDGAMQMNG
                     QAELLTIARYRELWSDPRLVVCVFHNNDLNQVTWELRAMGGSPKFEESQALPDVSYAE
                     LARVMGLQAVEIRDPAELAPAWERALTADGPVLLDVHCDPEVPPIPPHAEYDMVKDLG
                     KSILQGDPNAWHLLVQGVKSKAKEFRR"
     CDS             141751..143037
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1520"
                     /old_locus_tag="nfa1520"
                     /product="hypothetical protein"
                     /protein_id="BAD54994.1"
                     /transl_table=11
                     /translation="MIGGRCRWIPAKWSAVAVRSDAFDADIGLAADAGWFEREPFVLL
                     VEDDPGDALLVEELVADAAPGLRLEWVRTVAEAAERLRVAVPDCVLLDLHLPDAQGLE
                     ALARIRARNDQVAVVVMTGLDQERAGLAALASGAQDYLVKGRVEPELFARAVRYAIQR
                     KQAERTSAALQASQMRAQENARLERGLLPTPLLGADAPVDVVARYRPGRAHSLLGGDF
                     YDVVQDADGTVHAIIGDVSGHGPDAAATGVALRLAWRTLVLSGVTGSRQLRLLEQVLL
                     AERTDRQTFATATSLLLDPATRRVRVRRAGHPGMLRYIDGEPHWVEVPGGAALGFLPG
                     RAEWPDEEIELPEHAGLMLFTDGLFEGKVGRDGARLGEGGLLEVARAVPATRPEIFVD
                     ELIGRVEDLAADAGGLDDDLAIIYLRWHAAHGSDHR"
     CDS             143034..144659
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1530"
                     /old_locus_tag="nfa1530"
                     /product="putative two-component system sensor kinase"
                     /protein_id="BAD54995.1"
                     /transl_table=11
                     /translation="MKNTDSPLVGRFTAQVWFQLVFALMILVVLLGAVAGAQVIGNTN
                     RVTDRLLEQTLPAAAEAYRLQSTLVNQETGLRGYAIAADPQFLEPYVEGRQEQERAVQ
                     RLRELLAGRPDLLADLDLIERTAQQWRTEYADPLAATASPGAARELAANTTVRAKAVF
                     DELRAAFTIQNERLAAAVAADNEALADARFLRNAVLVGMVAVFLLTGTVLTVLLRRLV
                     VHPLAALTQSSLRVANGDFDHHIDGHGPADVAQVAEAVEDMRRRIVTELGSSRSQGTL
                     LQQQKADLDLQAEELRRSNAELEQFAYVASHDLQEPLRKVASFCQLLEKRYGSQLDER
                     GKQYIDFAVDGAKRMQVLINDLLTFSRVGRVSEGAEPVRLDQPLDKALHNLSAMIEEN
                     DAEIERPEDLPEIVGEPTLLTMLWQNLIGNAIKFRRPEAAPVVRIESTRVSEADGVLF
                     SVSDNGIGVAAEFAEKVFVIFQRLHARDEYSGTGIGLAVCKKIVEYHGGRIWIDTDYT
                     GGTRICFTLRGAGLTPTTQTPTAVVESAEGANA"
     CDS             144656..145099
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1540"
                     /old_locus_tag="nfa1540"
                     /product="putative two-component system response
                     regulator"
                     /protein_id="BAD54996.1"
                     /transl_table=11
                     /translation="MTVPGQPIDILLVEDDPGDELMTREAFEDNKIGNTLHVAHDGQE
                     ALDFLYRQGEYAHAPRPDLILLDLNLPKYDGRQVLEKIKADPDLSHIPVVVLTTSAAE
                     EDILRSYRLHANAYVTKPVDLDQFVAAIKQIDEFFVQVVRLPRTR"
     CDS             complement(145118..145483)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1550"
                     /old_locus_tag="nfa1550"
                     /product="putative anti-anti-sigma factor"
                     /protein_id="BAD54997.1"
                     /transl_table=11
                     /translation="MSGEGASRVLDVQVRSENGTEIVTVHGEVDMASAPQLQAALEDA
                     QRGGNPLVVDMSDVGFLGSAGLSALLVVSEAAQPQRLRVVASDAVRRPIELTALDKLL
                     AVYDTLDAALAEGTGTSAN"
     CDS             145708..146145
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1560"
                     /old_locus_tag="nfa1560"
                     /product="putative anti-sigma factor"
                     /protein_id="BAD54998.1"
                     /transl_table=11
                     /translation="MGKGENVFPSSSTRTNTIGVRVPAVYEQLIMLRALAETVALIAD
                     FGIDEVADIRLALDEVATALLQDAVPGSELDCAFSYDETTMDITVSAVTVSETGPDQR
                     SFGWHIVSTLTDSVSTSTGPRDATAGGHPTVVQFRWSRGGADA"
     CDS             146138..146938
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1570"
                     /old_locus_tag="nfa1570"
                     /product="putative sigma factor"
                     /protein_id="BAD54999.1"
                     /transl_table=11
                     /translation="MREEVTGGSTRAAAGGYQDLEPHFVELRALAEDDPRRRALREEL
                     IERCLPLAEHIARKFSGRGENFEDLLQIARVGMVAAVDRFDPTQGAPFLGFAVPTIMG
                     EVRRHFRDHTWSVRVPRRLKELQATLNPAIETLTQRLGRMPKARELAEELGVDIAEVT
                     QALVARNAYQTSSIDGSSGDDGESSAPALADTLGAEDPEFGTVENYLAVKPLIAALPE
                     REQRVLVMRFFHSMSQEQIAQQIGCSQMQVSRILSRTLKSLREQALRD"
     CDS             146968..147519
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1580"
                     /old_locus_tag="nfa1580"
                     /product="hypothetical protein"
                     /protein_id="BAD55000.1"
                     /transl_table=11
                     /translation="MITAGNRHVAWSNGYGYRRARSVARSACRSVQTYREAAEVTTTR
                     PSGLESPASRLELDFPATPDQLAEVRHTMQRWLAQCPLDERQAYDVLLAVGEACTNAI
                     EHGHRGDGGTIRLRAVRDDTHLSITVADHGRWKAPDPSPDPMRGRGMAIIRALIPEVE
                     VTISGSGTTVDMRLPLAHGRPTG"
     CDS             147579..148289
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1590"
                     /old_locus_tag="nfa1590"
                     /product="putative transcription antitermination
                     regulator"
                     /protein_id="BAD55001.1"
                     /transl_table=11
                     /translation="MVIEGSRPSPQVIDALGSVIGTDSCSNAGEFRFHFADQRWEWSD
                     EVARMHGYEPGEVQPTTELLLSHKHPEDREQVESALSRVETGEPFCSRHRIVDTAGEV
                     HEVIVIGDYQTDEDGAVVGTTGYYIDLTDTIEGERKDVVDEVLPELVDARAPIEQAKG
                     VLTVVYGISADQAFSVLRWRSQETNVKLRELAAQLVRDARGLDANRAGLRTRFDHVLL
                     TVHERAGRPAGADGHRPR"
     CDS             complement(148317..150569)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1600"
                     /old_locus_tag="nfa1600"
                     /product="putative cation transporter"
                     /protein_id="BAD55002.1"
                     /transl_table=11
                     /translation="MTTALNQPVAGRIELEIGGMTCASCANRIEKKLNKLDGVTATVN
                     YATEKARVDFTGDIAPEDLIATVEAAGYTAALPAPATTGEPESARVEADPTAALRTRL
                     LVSAVLTVPVIAMAMVPALQFTNWQWLSLTLAAPVVVWGALPFHRAAWTNLRHGTATM
                     DTLVSMGTLAALGWSLYALFWGTAGTPGMTHPFELTIARTDGTGNIYLEAAAGVTTFI
                     LAGRYFEACSKRRAGAALRALLELGAKEVSVLRGGVEQRIPVEQLAVGDRFVVRPGEK
                     IATDGVVVEGSSAVDASMLTGESVPVEVGESDAVVGATVNVGGRLVVRATRIGSDTQL
                     AQIARLVEEAQTGKAQAQRLADRISGIFVPIVIALAVATLGFWLGTGGSVAAAFTAAV
                     AVLIIACPCALGLATPTALMVGTGRGAQLGVLIKGPEILESTRRVDTILLDKTGTVTT
                     GTMTLLDVHAAEGEDADRVLAVAGALEHSSEHPIARAIAEAARARGELAPVRDFANLA
                     GLGVQGTVDGHEVLVGRPRLLAERGHPMPSGLAEAVDAAEQRGGTAVAVGWDGAVRGV
                     LVVADAVKPTSAQAISQFKALGLTPVMVTGDNAAAARTVADQVGIDEVIAEVMPEEKV
                     AAVRRLQEQGRVVAMVGDGVNDAAALAQADLGLAMGTGTDVAIEASDLTLVRGDLRAA
                     VDAIRLSRRTLGTIKANLFWAFAYNVAAIPLAMAGLLNPMLAGAAMAFSSVFVVSNSL
                     RLRRFTATAS"
     CDS             complement(150608..151534)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1610"
                     /old_locus_tag="nfa1610"
                     /product="hypothetical protein"
                     /protein_id="BAD55003.1"
                     /transl_table=11
                     /translation="MNAATKFTGFAVGLAAIFGIALGVGALVGPTDSPPAEHAEHDTA
                     ADAPAADHLPGGLLVTDRGYTLELADPQVSAAPEVPLRLRILDASGAPVTRYTTSHDK
                     DLHLIVVRRDLTAFQHVHPVLGADGTWSVPLNLSRAGDYRVYADFVPAAGENLTLGAD
                     LRVAGGYDPQPLPAPAGTAVVGDYTVTLTGTVTAGAPSTVTLSVARDGQPVTDLQPYL
                     GAYGHLVALRSADLAYLHVHPEGHPGDGVTTPGPGITFAMTAPSPGDYRLFLDFQHEG
                     VVRTAEFTVTVPRDGATATAPAPAPHDDGHGH"
     CDS             complement(151587..152243)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1620"
                     /old_locus_tag="nfa1620"
                     /product="hypothetical protein"
                     /protein_id="BAD55004.1"
                     /transl_table=11
                     /translation="MTRSTVRRGMTLGDAFREFLRHPSPWMIATTLVCVLAARLAVGD
                     WQPTDALVPLVMVAVFPVFEWVVHVLVLHWRPKRLGRLTLDSELARKHREHHIDPREI
                     PLIFIPTRSLVIVLVALLLIAAFAFPRPGLGLTFLLTVTVLGLGYEWTHYLIHTDYKP
                     RRALYRAVWRNHRHHHYKNEHYWFTVTSSGTADRLFGTCPDPATVATSPTARNLHGAH
                     "
     CDS             complement(152240..153052)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1630"
                     /old_locus_tag="nfa1630"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55005.1"
                     /transl_table=11
                     /translation="MALQPVVKRSVSADVFEQIAAEVLSGERAPGSALPSERQLAEAL
                     GVSRPAVREALQRLAAAGLVAVRQGDTTTVLDYRRGAGLEILPRLLIRQGTLDPTVAR
                     SILEARLHNGPKVAELAAARAGDREALRHELNRCLDALARETEPVALQRHALAFWDHL
                     VDAADSIVFRLMNNMLRAAYEPALEALAPLMTAEVGNVAGYRAIAEAVLAADPPAATA
                     AARALLEPATTALIAALDAAAATSNTASATSNTAAGATPNTAGATPNTEEPS"
     CDS             complement(153152..153904)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1640"
                     /old_locus_tag="nfa1640"
                     /product="hypothetical protein"
                     /protein_id="BAD55006.1"
                     /transl_table=11
                     /translation="MSSGPGDRFRPLVYPGAVTVGALAVCAVLLPLADADQLAALATV
                     MLVIVGYSGVRAARALGVVSTGVPAGERLSARRVRQQHRLVSRSWLEIAAGDRRWWVP
                     VYFAPELVGLTVAEVHCAQAGSEGRSRLPFAGNRLSLREFETGAAGGAATGAVRLRVY
                     PSGRARTSEPPGRLIDNPVRAAPDADERARVAARVPRRLLLDAQPAVAAPVAALLWVY
                     LDGGGLPAFTGALVVGAAAAVWLTAVRGSDPS"
     CDS             complement(153901..155565)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1650"
                     /old_locus_tag="nfa1650"
                     /product="putative ABC transporter substrate-binding
                     protein"
                     /protein_id="BAD55007.1"
                     /transl_table=11
                     /translation="MRIRAATRIAAPVLALGMVLAACGGDSGQLTGENTIGASSDINP
                     REPGELRDGGNLRLALTSFPATFNTHHVDSDGGVSQVLAATLPGTLESDAAGELTVDH
                     DYFTDVQLTGTNPQQITYTINPAAVWSDGTPITWEDLRAQATALSGRDTAYQVAATQG
                     YSRIEKVERGVDDRQAIVTMAQHYAEWQGLFNPLYPKATNETPEAFENLDREAPRVSG
                     GPFMVTEIDRAQQRIVLSRNPRWWGETPKLETITYSVLDYTARLNALQNNELDSADVS
                     GLDEVQAASQTPGLVVRRAPALRFSHMTFNGAPGSILEDPRLRVAISKAIDRQAIASA
                     LLNGLVADPKPLNNHLYLEGQKGYQDNAQAVAYDPEQAAAELDALGWKLNGDVREKDG
                     RPLEIRNVMYQQQNWVQIAQIAQQNLAQVGVRLKIETYPGNGLFTDVIDPGNFDIANF
                     VWMKSIFPLGALPQIYAYDPANPLSNKGRIGSPELNDLIERTISELDPDKAIEMANEA
                     DRMIFELGFSLPLYQSAGIVAQREDLANWGAFGLQSADYTKVGFLK"
     CDS             complement(155588..157258)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1660"
                     /old_locus_tag="nfa1660"
                     /product="putative ABC transporter"
                     /protein_id="BAD55008.1"
                     /transl_table=11
                     /translation="MRIRSATARLVIGLLVCGLVGCSAADRSADGLSDALGTSSDINP
                     VPREQVREGGNLRLSVSAFPANWNTLSIDGNEGDIADIERPMMPRAFRIDAAGKLTVD
                     TDFFTDVALTNTNPQQVTYTINPKAVWSDGTPVTWADIAAQAAALSGRDTRYQIAMTN
                     GFDRVARVDRGVDDRQAVLTFERPYAEWRGQFAGNAALFPKSVTGDPDSFNSALVDAM
                     GPTAGPFRVQSTDRAQGRIVLERNPLWWGTPPKLDTITFSVLDSAARVAALQNDELDV
                     TPLTSIDEVLTVRESAGLEVRRAAGSRFRHLTFNGAPGSILADAGVRVAISKAIDRQA
                     IASALQNGLVEDPKPLNNHIFLQGQEGYRDNSLPFDPAAAERELDALGWRREGDVRVK
                     DGRRLVIRDVMYDDRTWVQIAQIIQRNLADIGVGMQIDTRPGAGFFTDVIQPGDFDAA
                     QFIFQGDAFPLSSIPQVYGYYPDDLQGNFGRIGSPELNELIERTLSELDPQRAIELAN
                     QVDRAVFEEGHSLPLFQWDGSYGVRADLANFGSPGLASYDYTAIGFVQ"
     CDS             complement(157269..159134)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1670"
                     /old_locus_tag="nfa1670"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAD55009.1"
                     /transl_table=11
                     /translation="MTDGRTTGEPLLEVAGLTVTFPSEEGRIEAVRGVDYTVAEGEVL
                     AIVGESGSGKSVSALAVMGLLPEQARISGSIRLRGRELLGLGDRQLSKLRGRSISMVF
                     QDPLSALTPVYRVGDQVAEALLAHGRMGRKEAAARAVELLELVGIPDAAVRAKAFPHE
                     FSGGMRQRVVIAMAIANDPALIICDEPTTALDVTVQKQILDLLRQARDITGAGVVMIT
                     HDMGIAATLADRVAVMYAGRVVETATAAELFAEPRMPYTVGLLGSIPRLDGPARAPLI
                     PIAGAPPAMHALPPGCSFAPRCPVAVDACRAAEPPLAPTGPARAAACIRTEELGSADL
                     FAAYRREVESAAAPAGPASAAEPPVVLRVTDLVKTFPITSGVILRRRTGEVRAVDGIG
                     FEVRAGRTLALVGESGSGKSTTLTQILDLVPPQGGRIEVLGHDVATLTRAQARQLRRK
                     MQIVFQDPTAALDPRLPISDVLAQPLRIDGRPRAEIARRVPELLELVGLRPEHAERYP
                     ADFSGGQKQRISIARALALDPELLVLDEPVSSLDVSIQAGVLNLLRELQDERGLSYLF
                     VSHDLSVVRNLAHDIAVMHRGRIVESGPAEQVLGDPRHPYTRALLDAVPMPALSR"
     CDS             complement(159131..160048)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1680"
                     /old_locus_tag="nfa1680"
                     /product="putative ABC transporter permease"
                     /protein_id="BAD55010.1"
                     /transl_table=11
                     /translation="MTEAEIIVAGAPESATGRRALVWRRFLRNKPAVVAAVVLLLLVL
                     ASFVLPHFLAFDYLDQDRTALRQPPSPRHPFGTDPIGHDVLAQTLRGAQKSLIIGFCV
                     AIFSTAIAAIAGSVAGLLGGWTDRAIMWLVDLLLVVPSTIVIMLFAPRVKGGGGIVLL
                     VVLLSAFGWMISARIVRGLTMSLREREFVRAARYMGAPTRTVIATHIMPNIASILIID
                     TTLTVGAAIMAETGLSFLGFGVQPPDVSLGTLIRDGTASALTYPWLFLFSGGFLITVV
                     LCANLIGDGLRDAFDPGAKGARKRKRGKA"
     CDS             complement(160068..161045)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1690"
                     /old_locus_tag="nfa1690"
                     /product="putative ABC transporter permease"
                     /protein_id="BAD55011.1"
                     /transl_table=11
                     /translation="MIGFLLRRAANYVVLLLLASFLTFAVAGLTFRPLDSLEQRNPRP
                     PQAVIDAKAEQLHLDEPIPQRYLTWVSGAVRGDFGTTLAGQPVSEELGRRIGVSLRLL
                     VIGSVLGTVLGVLIGAAGAIRQYRFSDYFTTIVSLVLLSTPIFLLATLLKYGALEINS
                     LTGQRIFLYTGETSAHRIEGLWPQLLDRLQHLVLPTLALALGGMAGYSRYQRNAMLDV
                     LQSDFIRTARAKGLTRGRALYKHGLRTALIPMATLFAYSLGGLITGATFTEKIFGWHG
                     VGEWLVDAVNAQDIYVVVTVTVFTGLVVLVSGLLSDIVYAILDPRVRVG"
     CDS             161226..162056
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1700"
                     /old_locus_tag="nfa1700"
                     /product="putative hydrolase"
                     /protein_id="BAD55012.1"
                     /transl_table=11
                     /translation="MTRLHLPKPKMVATDVDGTLIDHDERVSARTRAAVAALVADGVP
                     FVLATGRPPRWVDPVVEGLGYAPLCVCANGAVIYDSAADKILAGHVLDVATLEWLAEI
                     AEHALPGCGLAAERVGESAHDAATPQFVSSPEYEHAWLNPDDTAVARHEVVDAPAIKM
                     LIRLPGAHSGDMRNALAPLVGDRADITYSTDHGLVELSAPGVTKASGLRTVAQRLGVE
                     PDTLITFGDMPNDVPMLELAGHGVAMANAHAEAIAAANEVTTTNSEDGVARVLERWWG
                     "
     CDS             complement(162131..164383)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1710"
                     /old_locus_tag="nfa1710"
                     /product="hypothetical protein"
                     /protein_id="BAD55013.1"
                     /transl_table=11
                     /translation="MLVPQRKPKRSFVLPMVTTLAVAAPLAALTMSDSADVRSTNESA
                     LAAVPAQLAEVVLTQAPDITLPLRELTGLNLPDLRLSDLRKLPIPPSIHIPEGLPVPP
                     GIQLPTEIPLPRFDSGTPTTTPAPTPGAAPTTTAPAVPAPVPGQPVPAPATASPVPSP
                     ASTKFIADPGALPPGTTPDTPALAPGALPQELLDQVGAQVKELSQDTPFSMVALTAAD
                     LANTTAMVRARQPDGSWGPWYEAAALDTRRDDRTPAGPTNGTEPIYVGETTAVQILVT
                     RKPAATQPQTSSAAAQSGGIAAIAEDPAHTPDLTAVLIDPGRGPLDGALSDIATALPG
                     GGPNVITRAQWGADESINCQEPTYDDGLGGVTVHHTAGRNDYSKAESAGIVRAIYTYH
                     SQTLGWCDIGYNALVDKYGQIFEGRRGGLDRPVQGAHAGGFNENTSGVALMGNHESEA
                     PTDAAIDAIGRFIGWRTRIAGLDPKGYTTMYSEGTEFTPYAEGEEVRLPIVFAHRDVG
                     NTSCPGDAAYSMMDRIRDIAAGAPGSSGSEAPRRTQSDLAALAELTARLLSMVNDNLI
                     AKHYAATGGPEGPLGAAQSEPLPAAQGQQYAKFVNGYVYTSPQGQAVEVVGAILERFL
                     QLGADAGILGLPLSSPYPVPDGLRSDFQNGSLILNNLTGIVTTVWKTYNDTYQEEMRR
                     NEVAAPGQVPGAPADPQALPPAPGAAGPASPAPNPPADTAAPASPAPAPAPAPAPAPN
                     EPAAPAPVPA"
     CDS             164570..166066
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1720"
                     /old_locus_tag="nfa1720"
                     /product="hypothetical protein"
                     /protein_id="BAD55014.1"
                     /transl_table=11
                     /translation="MQRKRQLDDSDNAGLRRTRRRIRLRIRNRVGPPMVRLRPVLATG
                     GTVLLVGGALAYTKWPVDRAYEPLAGPGHGRGMSQVGAFDSAQEGWLAERILAHYYPG
                     ATLGTVPPTTLAVRLMDQDDAVLDAYADAGARVAGRTLEPGQVAHLTPLADGGANVVV
                     TLGCDGDVLWQTSTADPWIYPLDPNPGRPAEEHLTLCNGRAYRGSLGVATEDGAFRTV
                     NRVDVEDYLLGVVPAEVQANWADKGAGEALRAQAVAARSYALAEQRYPYAQTCDTTDC
                     QVYPGTEKEDPRTAAAVDSTAGQVLLRDGHILRSEYSAAPDGGAPADIQTFEVGPRPA
                     DLEVARPPADPRTRAAETPSAIDVEYERIGGANSTLGTPLGPEWGLPQNAGTYRLFTN
                     GVIIATPTLGAQVVDFTTLMELIPGTDGLDTLPTETVPTETVPSETVPSETAPSESVP
                     PGTVPPGGAPPVEALPRHPAGLPMPPLADPVVPADVPAPVPPPGAAPA"
     CDS             166166..166939
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1730"
                     /old_locus_tag="nfa1730"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55015.1"
                     /transl_table=11
                     /translation="MSSGTRTGEWSIQDLARAAGTTSRTLRHYGQLGLLPPSRIGANG
                     YRYYDQDSLLRLQRILLLRELGLGLPVIAEVLAGEQDTAAALRTHLDLLTQEQDRIRR
                     LIESVRTTLQKTERGEQLVAAEVFDGFDHSQYKDEVIERWGKDAYDRGDKWWRSLSEE
                     QKKEFGQTHLDIAADYGRAHAAGLPVDSDEVQAIAARHRDWIALGWQGKPVTADAFVN
                     LGEMYVADPRFAANYDVHGEGTAAYVRDAMKVYAEANLR"
     CDS             167050..167586
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1740"
                     /old_locus_tag="nfa1740"
                     /product="hypothetical protein"
                     /protein_id="BAD55016.1"
                     /transl_table=11
                     /translation="MSAPEVRAGSATTASVTATVSAGLAAVGAAANVLGLLILGASFV
                     SDPGRYDNSLAVATALGAALLAVALGYGALQMLRRADEGRWMVLLASGAWLAFAALGL
                     LAALTGYRSDYGIRWSAEGGTGVDIATATTGLPGVVTAFVHGDWLPCLVGSVVPLAIA
                     AVAAVPATARWFATAPTS"
     CDS             167608..168312
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1750"
                     /old_locus_tag="nfa1750"
                     /product="hypothetical protein"
                     /protein_id="BAD55017.1"
                     /transl_table=11
                     /translation="MYPPGHQPPWAAPQYGRPNNPPAPLPSGATARTAAVLAMVLAVL
                     AGTAAGFALHAAVELDNAGHGRAGAVARESVQWLWLLGWAQLIGAGMWFLGGAMLAAR
                     VNAGRVILIVVSFFGVIGSATGLAVGLGSGTPVAVGSGAVGLGLATLVLSLAAARSTM
                     RWVDAGRNRTSARYPGPAPAGPPPYGWRGPAHPSAAPGPVVPGWGAGTVHPPHPAHPQ
                     PGPGVPHGYGENPYPR"
     CDS             168440..169669
                     /codon_start=1
                     /gene="glf"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1760"
                     /old_locus_tag="nfa1760"
                     /product="putative UDP-galactopyranose mutase"
                     /protein_id="BAD55018.1"
                     /transl_table=11
                     /translation="MTVASSSGNSANVNAQFDLIVVGSGFFGLTIAERTANVLGKRVL
                     VLDRRHHIGGNAYSEPEPETGIEIHKYGAHLFHTSNKRVWDYVNQFTEFTGYQHRVFA
                     MHKGQAYQFPMGLGLISQFFGRYFTPDEARKLIAEQAAEIDTKDAQNLEEKAISLIGR
                     PLYEAFIRDYTAKQWQTDPKELPAGNITRLPVRYTFDNRYFNDTYEGLPKEGYTKWLE
                     NMAASELIEVRLNTDWFEVRAEIRAANPDAPVVYTGPLDRYFDYSEGELGWRTIDFET
                     EVVQTGDYQGTSVMNYNDADVPFTRIIEPRHFHPEREYYPNDKTVIMREYSRFAQTGD
                     EPYYPINTPEDRAKLLAYRERAKRETAEAKVLFGGRLGTYQYLDMHMAIGSALSMFDN
                     VLRPHLEAGAALVDEQD"
     CDS             169707..171641
                     /codon_start=1
                     /gene="glfT"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1770"
                     /old_locus_tag="nfa1770"
                     /product="putative galactofuranosyltransferase"
                     /protein_id="BAD55019.1"
                     /transl_table=11
                     /translation="MTQSIVEDMTTQTRATSLLQRIILPRPGEPLDVRTLYLEESATN
                     ARRAHAATRTSLSIGAESEVSFCTYFNALPASYWRRWTVLTSVVLRLELAGHGRVDVY
                     RSKADGSRIHVQGKEFSVPAGGESTTVEFETELAPFEDGGWIWFDITTDTAVTLLAGG
                     WYAPLEAPGEGSIAVGMPTFNRPTDAVKTLAALGADPLVLEKVAAVIIPDQGTRKVVD
                     EPGFAEAAAVLGDRLAIHDQPNLGGSGGYSRVMYEALKTTDAEYIVFMDDDIEIEPDS
                     ILRALAFARFAKSPVLVGGQMLNLQERSHLHVMGEVVDRSIFMWTAAPNVEYDHDFAK
                     YPLRDRDNSKLLHRRIDVDFNGWWTCVIPRQVAEQIGQPLPLFLKWDDVEYGLRAREA
                     GYPTVTLPGAAVWHMAWSDKDDAIDWQAYFHLRNRLVVAALHLPGEGRGMIVNTVKAT
                     LKHLLCLEYSTVAIQNLAIRDFLAGPDRLFQLLPSALGAVHALRKQYPDAVILPSSTE
                     LPLASHLDVGAVGEPANPVSKIGRLAKGIVHNLRPARPEHHETPQLNVPTLDARWFLL
                     SQVDGVTVTTADGRGVVYRKRDPRQAWGLFKEAMRLRKELAARFPELRERYRAAHPRL
                     TGAAAWENAFGIEQTGSERP"
     CDS             171638..172201
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1780"
                     /old_locus_tag="nfa1780"
                     /product="putative phosphatase"
                     /protein_id="BAD55020.1"
                     /transl_table=11
                     /translation="MNAVNPSLRDTGTRPPEVAVINAVQGSIGANPAVISAARGMSHF
                     GEHALGWVGIAAAGWLVDKPRRRQWAGVAVGAVGAHAASIVIKRVVRRPRPNDPSVQV
                     NVGTPSKLSFPSSHATSTTAAAVLLGRLTGLPLPAVLVPPMLLSRVVLGVHYPSDVLA
                     GSALGAASASVVLAAEKRRAARRARRR"
     CDS             172203..173210
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1790"
                     /old_locus_tag="nfa1790"
                     /product="putative polyprenyltransferase"
                     /protein_id="BAD55021.1"
                     /transl_table=11
                     /translation="MPSHVGDRAHRTAETVTAEEKALGEMSEEPTGADLAEAVVKGPP
                     KTLAGGLIKAVRPRQWVKNVLVLAAPLAAGPETVSDLTVLSHVAIAFVVFCMAASGIY
                     LVNDALDVEADRAHPTKRFRPIAAGVVPVNLAYALATVLLVGSVLVSFLASWNLAVVM
                     AVYIGIQLAYCLGLKHQAVLDICIVSSGFLLRAVAGGAAADISLSQWFLLIMAFGSLF
                     MAAGKRYAELQIALGTGAKIRKSLEYYTPTYLRFIWTLAATAVVVFYGLWAFEQDRDN
                     DTTWFAISMIPFTIAILRYAVDVDGGEAGEPEEIALGDRVLQFLAIAWIGAVGVAVYL
                     T"
     CDS             173218..175161
                     /codon_start=1
                     /gene="aftB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1800"
                     /old_locus_tag="nfa1800"
                     /product="putative terminal arabinosyltransferase"
                     /protein_id="BAD55022.1"
                     /transl_table=11
                     /translation="MVDTAERTEDEADRPAERARSASSSLRLSSATFVGGIVLTVVLF
                     AIGAWQRRWIADDGLIVLRTVRNLLAGNGPVFNMDERVETNTSAAWTYIVWFFSWLTQ
                     MRLEYVVLAVALTLSLIAMVFAMLGAARLWGGPRTALLLPAGVLVYIAVPPARDYATS
                     GLESGLVICWLAVLWWSLMRWARAERVRPGALAGLVFLAGLAPLIRPEMTLVGGLALV
                     MIFFAPMPQWRLGPVATRALIVAVAGLVPLGYQIWRMGYYGLPYPNTAVAKDAGGAKW
                     SQGFTYLWDLVGPYLLWLPLLILLAAAIVAVRGGGLPAWSPAGDGSEAPGGAGESRLL
                     RVRRWLRSPAAVVALVLVSGLLLTVYALRVGGDFMHGRMLLPQLFLLLLPVAVLPVRL
                     PVPRSVAGQRTLAAVLLAWAGAMGWALFAADTTAIKTGTKISESGIVDERVYYVLNTG
                     HDHPIRAEDYLDYPRMRAMVNNIAENPNGGLLLNSPSFMFWYVAPPPQPIPPGGAGHT
                     VFFLNLGMTSMNVPLEVRVIDQMGLAYPLAAHTDRLENGRIGHDKNLYPDWVIVDAGM
                     VDRKPWMPWYLDEKWVTQARVAMSCPQTQALLISSRDPLTFERFRHNLRNALDFAKYR
                     IDRVPKYEIQRCGLVDPFPQPPR"
     CDS             175393..176436
                     /codon_start=1
                     /gene="fbpA"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1810"
                     /old_locus_tag="nfa1810"
                     /product="putative mycolyltransferase"
                     /protein_id="BAD55023.1"
                     /transl_table=11
                     /translation="MRGRRARGWFQRALLLSMAVLMPLGVTVAGGGATASAAFNPDGF
                     DFWVDSDMGPIKSRIFRAADGNTNRVVYALDGMRARNDLSGWEIDTEVARELTKWNIN
                     VVMPVGGMSSFYADWNAPSTILGIGGGSSGSASGSSSGSGALQMFAGGPGKSTRYTWE
                     TFLTNNLRWALRDRLGFNPNRNGVFGLSMGGSAALTLAAYHPDQFSYAGSYSGYLNVS
                     APGMREALRVAMIDAGGYNIDAMAPPWGPQWLRMDPFVFAPRLKANNTRLWISAGSGL
                     PGPADGFNFGTVNAMGLEVLALANTRAFQVRMATLGANNVTYDFPAVGVHNWRYWETE
                     VYRMIPDLSANIG"
     CDS             176952..178013
                     /codon_start=1
                     /gene="fbpB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1820"
                     /old_locus_tag="nfa1820"
                     /product="putative mycolyltransferase"
                     /protein_id="BAD55024.1"
                     /transl_table=11
                     /translation="MRSLRWKRRPTRASGAKSWTRRAALAVATAVLVPLGVTVAGTGA
                     TASAAFDPAAFDFWVDSGMGPIKSRILRAADGNTNRVVYVLDGMRAPETLNGWEIETD
                     VPALLASWNINVVMPVGGMSSFYADWNAPSEFFGIPAGSGSSSGSGALNAFTGGPGKS
                     YRYQWETFLTNELRWALRDRLGFNPNRNGVFGLSMGGSAALTLAAYHPDQFSFAGSFS
                     GYLNISAPGMREAIRVAMLDAGGYNVDAMAPPWGPQWLRMDPFVFAPNLIRNGTRLWI
                     AAASGLPTSTDPPSFNTLNGMGLEALALANTRAFQVRMATLGGGNAVYSFPPFGIHAW
                     NNWRDEAVRMMPDLSANIG"
     CDS             178415..179452
                     /codon_start=1
                     /gene="fbpC"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1830"
                     /old_locus_tag="nfa1830"
                     /product="putative mycolyltransferase"
                     /protein_id="BAD55025.1"
                     /transl_table=11
                     /translation="MRFGRAAAPKRVKSGRRGEPRGWRHRILAVGAAALALPIAAGVA
                     APTAATAAPVHAPVLRAPAGGYEELMVPSVMGPIKVQVQWASRGGDAALYLLDGLRAR
                     DDRNAWSFETNAMEQFKNDNITLVMPVGGQSSFYTDWYAPSNTNGQKTTYKWETFLTQ
                     ELPNFLAGYGVSKTNNAVAGLSMGGSAALALAAYHRDQFKYAASYSGYLNISAPGMRE
                     AIRIAMLDAGRFNVDSMAAPWSPQWLRMDPFVFAPQLRGLPMYISAASGLPGQHDRPN
                     SPVGVFNTGNAMALEALSLVNTRAFQVRLKSLGIPAQFDFPATGTHSWKYWEGQLWNS
                     RQGILDALGAW"
     CDS             179594..181468
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1840"
                     /old_locus_tag="nfa1840"
                     /product="putative esterase"
                     /protein_id="BAD55026.1"
                     /transl_table=11
                     /translation="MAGVACGKPGLPSRRGGRAALGRFALIAAAMLVPIGVTVTPAVP
                     TAVAQPATTPASATVQQAIWLTDRRVALWVNSPSMGAPVQVQLLLARDWNAKPEARFP
                     LLIMLDGLRATDDESGWTKDAGAEEFFADKNVTVVLPVGGQSSFYADWMQPNNGRNYK
                     WETFLTKELPPLLESQWRATDVRGMQGLSMGGTAAMFLAGRNPGFVRYAASYSGFLTT
                     TTLGMPQAIQFAMRDAGGFDSAAMWGPPTSPEWEAHDPYLLADKLRGVSLYISSGSGT
                     TGPFDQASGIPGVSTNYAGTGLEILSRLTSQNFVTKLGELQIPATVNYRASGTHSWPY
                     WDFEMRQSWPQAAAALGVEPDKPACAAGGAIGALAAANGWLGDCLTGEYAVPGGLAQD
                     FHGGRVFYSAETGAHAVGGMIGGGYQAAGGPGGALGLPTGGERDLGDGRGRMQPFQHG
                     ALYWTPQTGAQVVRGAIFDEWGRQGFERGPAGYPTAPEVRTPNKDGAVQAFEGGPFYY
                     SPATGVFRVQGLILGKYAQLGYENSWLGFPAAEEAPLKDLGRFSRFEGGNIYWSPLSG
                     AWAVRNGPIMDAWQSAGFENGRLGYPISDEFPVDGGVQQNFQTGFIVVRDGKAEIHGI
                     "
     CDS             181571..182101
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1850"
                     /old_locus_tag="nfa1850"
                     /product="hypothetical protein"
                     /protein_id="BAD55027.1"
                     /transl_table=11
                     /translation="MHRIRGKVAGLALAIAATGLLAACGDDDSTASSTPTLTTGATAT
                     SAAAASSSPAEGAPQSQAPAPEAPPSETVAPERPQPVPTEAVPPADTSGLSEKDKAFI
                     AALEEKGVTPSSPDIALSIGSYVCQSVQAGASEQDLTTFVNAMAGADASFDPAKMPVE
                     QAGRIYIDTAKQTYCQ"
     CDS             182098..183075
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1860"
                     /old_locus_tag="nfa1860"
                     /product="hypothetical protein"
                     /protein_id="BAD55028.1"
                     /transl_table=11
                     /translation="MNARRGSRPRRSRPVGCLLFLVIAALLVAVIILLWFLLAGRLRL
                     PGPGPEPTRPPASQPASCPDVQLISVPGTWESNSNDDPRNPTANPLSLMLNVTGPLRE
                     QFPAERLDVYTVPYVAQFSNPVAIPPDGQQSYNNSRSEGTQRTIDALAERHRECPLTT
                     YVLAGFSQGAVIVGDVAAQIGEGKGPVPADLVLGVTLIADGRREAGPGQAIEVGATPP
                     GVGAEVALNGLKVPGITMTGPRPGFGALADRTYTICAPGDMICDSPRQALSPVNWIPS
                     VLSLVRAAGNPVHALYNTYVVDGNGTTATQWTVGWAAGLIESAPHPPHS"
     CDS             183241..184260
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1870"
                     /old_locus_tag="nfa1870"
                     /product="putative monooxygenase"
                     /protein_id="BAD55029.1"
                     /transl_table=11
                     /translation="MTQAAAPAGELTDLGTPLRPFRFAAAGEGNKQEGGARKFVQLAQ
                     QAEEYGYDTFVVPDHLGDQIGPIAALGALTQATEKIRLGTSVLANGFRHPVVLAKDLA
                     TIDVLSKGRLEVGIGAGWKQDEFLAAGLPYDSPGVRLAKLDETLTILDVLLRGQECTF
                     HGKYYQVEGVKGTPRPRQGPRPPLCTGGGGPKMLRLAAKHADIVSVVPMTTKNGKGLL
                     SGITLEKTIEKVNLVKEAAGDRFSEIELNWAISAIVITDDREKTAEMALSALDRGLHP
                     DLEVDTQLTVEDLLNSPYVAIGTFEEIAEQIKRVRKLTSMSYVGIYPTQMDAFAPVIP
                     LLRDE"
     CDS             184410..186368
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1880"
                     /old_locus_tag="nfa1880"
                     /product="putative acyl-CoA synthetase"
                     /protein_id="BAD55030.1"
                     /transl_table=11
                     /translation="MSPSCCVCLGGEEGMEETFDDYLDETGNIRIPEDHTLVDHVEKH
                     TRNDANTLAYRYIDYSRERDGEVHELTWQQFGVRLRAVAARLQQVTKRGDRVAILAPQ
                     GLDYVVSFFAAIYAGTISVPLFDPDEPGHTDRLHAVLGDCEPSAILTASSSAAGVRQF
                     FRSLPAAQRPRIIAVDAIPDSVGESWVRPDIKIDDIAYLQYTSGSTRVPAGVEITHRA
                     VGTNLLQMVDAIKLDWNSRGVTWLPLFHDMGLLTVILPAVGGKYITIMSPSAFVRRPY
                     RWIKELAAVSDGAGTFAAAPNFAFEHAAARGLPKNGESLDLSNVIGLINGSEPVTTSS
                     MKKFNEAFAPYGLPKTAIKPCYGMAEATLFVSATKAEDEAKVTYVDRNELNAGRMVKV
                     DPSAENAIAQVSCGYVALSQWAVIVDPATVESDGGGRELPDGHVGEIWLHGNNMGIGY
                     WNRPDETQKTFRNKVTQRLAEGSHAEGAAEDADWMRTGDYGVYFEGELYITGRVKDLV
                     IVDGRNHYPQDLEYSAQEASKALRPGFIAAFSVPANQLPAEVFEQGSHSGLKFDPDDA
                     SEQLVIVAERGPGAGKADPGPIADAVRAAISQRHGVTVRDVLLVPAGSIPRTSSGKIA
                     RRACKTAYLEGTLRGGYTQQAFPDAPEE"
     CDS             186481..191694
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1890"
                     /old_locus_tag="nfa1890"
                     /product="putative polyketide synthase"
                     /protein_id="BAD55031.1"
                     /transl_table=11
                     /translation="MADNEGTPDQTTEDATTDAAATPAAEGAVGEAAVGDGPRTDMSV
                     AEVREWLRRWVADATGQPLENITVDRPMEEFGLASRDALALGGDIEELTGVVLTATVV
                     YQHPTIASLAEVIVHGEPEVPETADDEAFYTAGYTPGEAHDIAIVGLSTRLPGAGDTP
                     ESTWEFLINGGDAIRELPEGRWAEFMSDPNVAKMIEESNTLGGYLDQEVVKGFDAEFF
                     AMSPIEVERVDPQQRLMMELTWEALEHARIPASELRGESVGMFVGSSTQDFQLIAALG
                     LGDRDPNLPISAEAYALLGASTGIIANRVSYFFDFRGPSVTVDTACSSTLVAVHQAVR
                     ALRDGEADLALAGGVNMILAPVATLGFEKNGAVAKNGRIKAFSSDADGMVRSEGAGLV
                     VLKRLADAERDGDRILAVIKGTAVNNDGRSNGLFAPNPDAQADVLRRAYRDAGINPAT
                     VDYIEAHGTGTLIGDPIEADALGRVVGRGRDADKPALLGSAKTNFGHLESGAGVPSLA
                     KVVMAFQHNVIPPNINFAGPNPYIPFEQARLKVVDEPTQFPRYSGVATVGISGFGFGG
                     ANAHVVLQEYTPPTKAAVAAPDTDTETETTDVIAAATAITAEAGDVVAEATEITAEAA
                     ADAAEWSAERTEPLPVILCVSGYLPSRRRRAATELADWLESEAGRDVPLADVARSLAK
                     RSHWRSRGVVLAKTHEEAVAGLRAIAAGKPGTGVFTADAPAAQGPIWVLSGFGAQHRK
                     MGKQLYLENAIFRRTVDEVDELVQDEAGYSVREMILDDAQDYNVGTSQVGIFTIQIGL
                     AALLRAHGAEPEAVVGHSMGEVAGAYIAGGLTLEDAVRVICARSRLMGEGEQMISDDD
                     VRNMALVELSAAEVEAMLTDYPDVEVAVYAAPTNTVIGGPYEQVQAIVAKVEEAGKFA
                     RVLQTRGAGHTSQMDPLLGELAAELAGIEPTRLRAGLYSTVHKEKYYRPGHDPVHDED
                     YWVTNMRHSVYFTNAVKLAVDSGHTTFLELAPNSVALMQVLGTTFAAGLHDAQLIPTL
                     KRKEDESAGVISALAQLYVHGHAVDLSSLLPAGDYADIPRTTFVRKEFWPAARMATGS
                     GTGRVPGAHVALPDGRHVWEVQASAVTDPAELVRAAAAQVLADVTVGASLAHGAVPAA
                     GTLTTTLTPHPGGASVQVHAKEDAQFRLIFDAVVTSGAPLPTPAVAAPSTATAAAPAA
                     EPEVLEQAGDRWDPNGSQTIEERLALIVAESMGYAVEDLPMEIPLMELGLDSLMAMRI
                     KNRVEYEFDIPQLQIQAVRDANLTEVGKVLRYAIEHRDQVAAIAEKQAAGEEITVDAD
                     FVTAARAAMEAGEDPVAALETAVGSQDSGTADAPAEPAPVDQEAAAFGEALAAVDEDD
                     VPPRDAAERLTYATWAIVTGKSAGGIFNTLPILEEEVAEKLAARLSERIKAEVTVDDV
                     LDCETIEQLADIVRERQDSGAEIDGFVRPLRPRPEGSDAVPVFVFHPSGGNTLVYEPL
                     LKRLPAHTPMYGFERVDGDIEQRAKQYIPELRRIQGDGPFVLYGWSLGAVFALQVAQL
                     LRAEGADVRVVGLIDLAIPTRDEDNSPEERVRRIERYQAFARKTYGIDAELDRAQLEE
                     LAAASDEEQFKMISDLIKISGAKIPGGVLEHQRTSWIESRHLARTTPSRYDGDVVLYL
                     ADRYHDGMIELEPRFAERKPNGGWDEYLPHLQVVHIPGDHLQIVDEPRIAKIGADLTA
                     KLVAMEAKGDK"
     CDS             191691..193235
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1900"
                     /old_locus_tag="nfa1900"
                     /product="putative acyl-CoA carboxylase beta subunit"
                     /protein_id="BAD55032.1"
                     /transl_table=11
                     /translation="MSTTAEKLADLRKRLELAQEPAGEAGVAKRAKKGIPSARDRINM
                     LLDPGTFVEIGALVRKPGDPAALYGDGVVTGHGLVDGRPVAVFSHDQTVYGGSVGEMF
                     GRKVAYIMEYAAKVGCPVVGINDSGGARVQEAVTSLAWYAELGRRQEPLSGLVPQVSM
                     ILGKCAGGAVYAPINTDVVVATEEAYMFVTGPKVIREVTGEDVSLEELGGAQSQAEYG
                     NIHHVAKDEKAAFQWVRDYLSFLPTSCQELPPVVNPGLEPEITDSDRELDSIVPDSDN
                     AGYDMHEILLRIFDDGDFHEIGATAGRNIITGFARVDGRSVGVVANQPLVYAGALDAR
                     ASDKAAHFVRLCDAFEIPLVFVVDTPGFLPGVEQEKIGVIKRGGRFLFSFVEATVPKV
                     TVVIRKSYGGGYAVMGSKQLGADVNLAWPTARIAVMGAESAVSLIGGKQLAAAPEDQR
                     AAMRQQMIDFYNATVATPWVAAERGYIDAVIEPSATRLELRRALHLLRDKKLARNPRK
                     HHLLPL"
     CDS             complement(193469..193966)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1910"
                     /old_locus_tag="nfa1910"
                     /product="putative peptidyl-prolyl cis-trans isomerase"
                     /protein_id="BAD55033.1"
                     /transl_table=11
                     /translation="MTKVNLETNFGPIVLELDDAKAPETVRNFVDYVNSGHYNGTIFH
                     RVIPGFMIQGGGFEPGMRQKGTKAPIQNEAANGLKNDKYTVAMARTNDPHSATAQFFI
                     NVADNAFLNHTAPSPSGWGYAVFGQVVDGTDVVDKIAGVSTGSAGMHQDVPVDDVIIT
                     SASLA"
     CDS             194138..197380
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1920"
                     /old_locus_tag="nfa1920"
                     /product="putative arabinosyltransferase"
                     /protein_id="BAD55034.1"
                     /transl_table=11
                     /translation="MVGALGALLALATPFLPVKQTVAVLNWPQGGTLQNVQAPLMAQV
                     PIDLAASIPCSAVDALPAQGGMLLATAPPQGDRAALEAMFVRVSENSVDVVNRNAVVA
                     SAERARMGECSAIRIASDNARTTAVFEGMQREIERPVQGGAPGQTELVRVPVEGTMPG
                     DFRPQVVGVFSDLEGAVPAGLSFDMTVDTRFSSSPTWIKLTAMLAAVLCTIIALAALA
                     RLDGSDGRGHRRFLPANWFKPTWADGAVLGTLVLWHFIGANTSDDGYILNMVRVAPEA
                     GYMANYFRWYGVPEAPFGWYYYVIQVFAEVSTASPWVRLPALFCAILCWMVISREVVP
                     RLGRGVRTSKVALWTGGLVFLAFWLPFDNGLRSEPIVALGALLTWVSIERAIATGRLL
                     PAAVAVLIAAFTLAAAPTGLMCVAALLAGTRPLVRIVVRRHREHGTLPLLAPIAAAGL
                     LVLTVVYSDQTFAGIQEANRVRQATGPNLAWYEDYLRYYYLFVETVDGSLSRRFAFLV
                     MLLCLFTTMLVLLRRRRVPGIASAPTWRLMGIVFGTIFFMMFNPTKWTHHFGAYAGIA
                     GSLAAVTAVAVSASALRARKNRAIFLAGLLFVLAIAFSGINGYWYVSSFGVPWFDKQI
                     SLRGYQSNTLMLVLFGVALALVAWFTLREDYTAPQPSAKTVRGRRIRKFAAIPLTVVA
                     ALMVALEVLSLAKGAVSQYPAYSLARSNVDALRGNMCGLANDVLVEPDPNDGQLTPII
                     DPNEPPANGDPLAGANPVGFDPNGVPDDLSADSVEVKPGTGNTSTQSVGAAFAEGENA
                     GTGGGQGARGVNGSTVALPFGLDPATTPVMGSYQAGVQQPAHLVSSWYALPQRSADRP
                     LIVISAAGRVLSFDDTGAMKYGQELKVEYGKRGPDGTVTKQGEYLPRDIGPFPSWRNL
                     RVPLDELAPDADAVRIVANDPILIGDQWLAFTPPRMPTLQSLDDYLGSRQPILLDWAV
                     GLQFPCQRPFFHENGVAEVPRYRVLPDRPLAVSSTNTWQAQEFGGPLGFAQMLARSTT
                     IPTYLKDDWARDWGSLERYDQYDQSAVPAELSTTTTTRHGLWSPGAMRVS"
     CDS             complement(197789..201034)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1930"
                     /old_locus_tag="nfa1930"
                     /product="putative arabinosyltransferase"
                     /protein_id="BAD55035.1"
                     /transl_table=11
                     /translation="MRPDRTTRAFTRYRLIALVSGLLGFVLALLSPLLPVRQDRATLD
                     WPQPDTASVTAPLVSYVPLRLDASLPCSVLGSGAPTLLSTIPVASGQATSKGLVVSVA
                     DGTLTLLQRDVPLLSAPVAEIASCAEIRVEATDAATTAEFVGVSRADGTPFRNSVTRD
                     IRPQMVGVFTDLDAGQLGGARVHADIDSRFSSTPSPLKLAVMIAAAVFTVIALVALHL
                     LDTSDGRRARRFLPAHWWRFGPADGAVLGTLVLWHIIGANTSDDGYILNMARASERSG
                     YMANYYRWFAVPEAPFGWSYEVLAWMAKVSAASPWMRLPTLLAGILCWLVISREVLPR
                     LGARVRRNKVALWTAGLVFLAFWLPYDNGLRPEPLIAAGALLTWCSIERAIATGRLLP
                     AAIAVLIAGFSLAAGPTGLICVAALIAGSRPVLQIIVKRARGGGGRGAGVFRYLSLLA
                     PGLAAGTLVLIVVFADQTLSTVLEATRVRTLVGPNVAWFDERTRWDSLLMLAPDGSLA
                     RRFGVLLMLLCLLVSVLQVLRKGRIPGTSRGPSVRILGIVFASLLLMMFTPTKWTHHF
                     GVYAGLAGSLAALAAVAVGTAAIRSPRNRALFAAAVLFLLAITFTGSNGWWYVSSYGV
                     PWWDKAPLIAGKGLSTLFLGLTGAALLVAVWFHYREPYRRPRPGNGFDRVASAPLTIA
                     AALLVLFEIASLAKGAVGQYPAYSIAKSNIESLRGNPCALADEVLVETNTADSLLQPY
                     DAAPADGLAGEVTAFTPDGVARDLTADAEETASGGANTVDTGGENKTTNTTGAGTGGG
                     TTAEAGINGSSVALPFGLDPARTPVLGSYQEDEQRQAALTTHWYRLDQNADDLRADPA
                     YRVLAITAAGRIKSVDADGVETYGQELRVEYGVREADGSVRVLGSVLPLDIGPAPSWR
                     TLRVPLDRLPGEVNAVRLVAIDNDITQRQWLAVTPPRLPRLATLNSVVGSTDPVLLDW
                     HVGLAFPCQRPFDHHDGVAEAPRWRILPDRVGSDASNAWQDDIGGGPLGWTELLLKAE
                     TVPTYLDHDWGRDWGSLERFTPYDPAAEPATIGVRVVTRPGTADDPPIRAR"
     CDS             complement(201106..202938)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1940"
                     /old_locus_tag="nfa1940"
                     /product="hypothetical protein"
                     /protein_id="BAD55036.1"
                     /transl_table=11
                     /translation="MAPTRETAEPTTIVRGRPPRIRTAWRPATAARALVPERGDLLVG
                     LIYLALAAAVLSGQWRDTSGGYLIKSGQDQTMWEWFFAVTAHSLAHLENPLGTTLQNF
                     PAGVNMMANTAMFGVGVPLAPITLLFGPTVTFVLVLTLGLATTAYAWYRLFAAELVRS
                     RAAAALGGLFCGFAPGMISHANAHPNFVVLALLPVIAGLVIRLARVTVAEGGGVRWRS
                     AVALGLLVAGQIALGEEPLLIFALAFTVFAVVYHARAPRAGLRAARAIAPTVAVAAGI
                     TLALTAVPLWWQFFGPQSYRSIDHGPMGNDLKAMVQFPSESLGGLLAPGQPVAINPTE
                     QNAYFGWPLLLLVGVIVALLWRDRVVRAAAAVIAVFGLLSLGASATLGKRDTGIALPW
                     RWAEHVPLLNTVLESRLALAAVPAIAILLALVAERAVASWRTSLTDWKPLAWFAAVAA
                     ALVPLTPTVLPVTEREPTPRFFTEQTVRAFTGDGSVVLVPPPRPADARALRWQSDADF
                     VFPLAGGYFVGPTGADKKGVYGPPRRPTTDLLVRAQDTGSVPPIGAAEQAAARADLRY
                     WRADVLVLPATKNADVLAETVTRLLGAGPVPVADVRVWDVRGLR"
     CDS             complement(203132..205234)
                     /codon_start=1
                     /gene="aftA"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1950"
                     /old_locus_tag="nfa1950"
                     /product="putative arabinofuranosyltransferase"
                     /protein_id="BAD55037.1"
                     /transl_table=11
                     /translation="MPEGNADQEPEVGAPMTTSDRGRLRPLVRQVGGGVGEAIAAALV
                     AVVVAAVGLVAFSLVEWPAFNSSHVTRALTTVGQVVAAALLVAAIVLVRRRRAPRLAA
                     LLSWAGIAAFVTVTLGMPLAATKLYLFGVSVDQEFRTEYLTRLTDSPALRDMTYADIP
                     PFYPAGWFWVGGRVADVLGMSGWEAFKPYAIGSLAVAAVLALVLWTRLIRTDWAIAVT
                     AASTAVALAFASPEAYSAVIVLLLPPALVLAWGALHRPVSDGLVADDSAVAEPPATTA
                     ERAAVPEQAGSAVPASAGGWGAVVGTGLFLGLAATFYTLYLGVAAFAVTLMGLLAAFL
                     AVRAAKQTRRPRRGTAVVATGPVWRAALPPLVRLLVIAVIAALIAAVVWTPVLVEMLR
                     STTPRSGTALHYLPRAGAELPLPMLEFSLLGALCLIGTIWLVVRASSSRRAQALGVGV
                     LAIYLWTLLSMLVTAAGTTLLSFRLEAPLLALLATAGAFGFVEGARAAYQAFNEPERF
                     RVAVAVVAVLGALAFAQDIPHVLAPEITTAYTDTDGDGERADKRPPGAASYYREIDAA
                     LREQTGRPRDETVVLTADTTFLAFYPYFGFQALTSHYANPLADFAGRAALIRQWSELD
                     SPAALRAALAESPWRAPDAFLFRRSGETYTLRLAEDVYPNDPNVRRYTVSFPAALFDD
                     PAFTSTDIGPFTLVTVRD"
     CDS             complement(205393..206172)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1960"
                     /old_locus_tag="nfa1960"
                     /product="putative short chain dehydrogenase"
                     /protein_id="BAD55038.1"
                     /transl_table=11
                     /translation="MINAVGNPQAILLLGGTSEIGLAICAEYLKKAPARVILATLPGD
                     PLRADAVAQMEAAGASEVEVIDFDALDTDSHPKVIDAAWARGDVDVAIVAFGLLGEAE
                     ELWRNQRKAVQIAEINYTAAVSVGVLVGEKMQAQGYGRIIAMSSAAGERVRRSNFVYG
                     STKAGLDGFYLGLGEALRPFGPRVLVVRPGQVRTRTTIEHWKATGAKEAPFTVDKEEV
                     AALAVSASDKGKELIWAPGVFRYVMMVLRHIPRPIFRRLPI"
     CDS             complement(206189..207670)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1970"
                     /old_locus_tag="nfa1970"
                     /product="putative oxidoreductase"
                     /protein_id="BAD55039.1"
                     /transl_table=11
                     /translation="MSTKAPTTTTTTGVDETAGSTDGATGRTEAYQLPTRTRSLTGWG
                     RTAPTSAEVLSTSDPEVIAKAVAMVAEDNDGKPAHLRRGVIARGLGRSYGDNAQNAGG
                     LVVDMTALNRIHRIDADSRLVDVDAGVTLDQLMKAALPFGLWVPVLPGTRQVTVGGAI
                     GSDIHGKNHHSAGSFGNHVRSMELLTADGTVHHITPKRNAKLFWATVGGCGLTGIILR
                     ATIEMTPTETAYFIADGDVTAGLDETIAFHSDGSEDNYTYSSAWFDAMSPMPKLGRAV
                     ISRGSLAKLDELPKKLRKNPLDFTGKTFLTFPDLFPNGLLNKQTFALATEVWYRKGTT
                     YRRKPQNLTAFYHPLDMLGEWNRAYGSRGFLQYQFVVPPEAVEEFKQILIDVQRSGHY
                     SFLNVFKYFGQGNQAPLSFPMPGWNVCLDFPIKPGLNEFVTELDSRVLEFGGRLYTGK
                     DSRTTAETFHKMYPRIDEWIKVRRSVDPTGVFMSDMARRLELQ"
     CDS             207772..208236
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1980"
                     /old_locus_tag="nfa1980"
                     /product="hypothetical protein"
                     /protein_id="BAD55040.1"
                     /transl_table=11
                     /translation="MHAEPPLPPTAELPLVDERLADADGAVDLKTQIIRFTVTGGFSA
                     IVDFGLYVFLLKVVGLPVPVAKSIGFVAGTTTAYLINRRWTFQAPPSRARFLAVVALY
                     ATTFAVQVGINQLMVHLLGEDPVPVAVAFVVAQGTATVINFVVQRLVIFKID"
     CDS             complement(208260..208907)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_1990"
                     /old_locus_tag="nfa1990"
                     /product="hypothetical protein"
                     /protein_id="BAD55041.1"
                     /transl_table=11
                     /translation="MTGNQIGSDGEHVLQERYGTVDRAERFYGDQVLDRLNPAMVEFV
                     RRMDMAFIATADKNGECDNSFRAGPPGFLHVVDDRTIAYPEYRGNGVMASLGNISENP
                     HIGILLIDFVHDLIGLHINGSARIVEDHALRCSVPDLPAARVRGRQAERWVVVEVEEA
                     YIHCRKHIPHLVPADREQRDWGTDNVRAKGGDYFGVKASSGVASSGIEPAAVLSR"
     CDS             complement(209104..211302)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2000"
                     /old_locus_tag="nfa2000"
                     /product="putative oxidoreductase"
                     /protein_id="BAD55042.1"
                     /transl_table=11
                     /translation="MGTMAQITDSARKLLRTCPLCEAVCGLEITLDAADHVVSVRGDK
                     LDPFSKGFLCPKGASLGKLDEDPERVTEPMIRDRATGAWRTAGWDEAFDYIAERFPAI
                     TAEYGNQAVGMYVGNPNAHTVAGALYLPVLIRALGTKNLFSASTADQMPKQVAAGLMF
                     GDPLTVPVPDLDRTDYLLMLGANPLESNGSLCTAPDFPGRLAALRKRGGRFVVVDPRA
                     TRTAERADEHLFIRPGTDVFLLFGLVHTLFAENLTEVRVAVNGLDEVRAAAAEFTPEV
                     VAAHTGVPAETVVRLARELAAAPTAAVYARIGTCTAEFGTLTQWLVDVLNVLTGNLDS
                     PGGAMFATAAATGIVRSKPFRTGRWRSRVRGLGEAMGELPVATLADEILTPGEGQIRA
                     MVTVAGNPALSAPGAARLDAALAGLDFMLSVDRYLNETTRHADVILPPPRTVQSPHYD
                     FALLQFAVRNYARYSRPLVPLGDRPSEAAVLARLGAALTGRPHNGTGDQDPVAAVDEL
                     VIAGMLHKAGIPDRRDELIGANSTEQRIDLMLRLGPYGEWNGGTLNLQVLLDNPHGLD
                     LGPLTPRLPGALRTASGAVELAPEPLLDDLARLRARMADEAPEFVLIGRRHLRSNNSW
                     LHNVPALVGGTNRCTLQINPADVDRLGLGDQAVVKSAAGTLTVPLEPTDTIMPGVVSL
                     PHGWGHGAGTQSVARANAGVNANVLTDDSIVDTPSGNAVFNGVPVTLLPV"
     CDS             complement(211468..212007)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2010"
                     /old_locus_tag="nfa2010"
                     /product="hypothetical protein"
                     /protein_id="BAD55043.1"
                     /transl_table=11
                     /translation="MNAGPPEHPGMEKTVRTTFPTSVSAADMDAAAQDYIQRGWTVAE
                     TANGLCLITDENVSAIEIGGELAGEVRRFLRANNLTGPVIEVPGAERREIHLVTGVRK
                     AAMALDALREAGATVYTDGAGVPLPPSKLSAGSASWGVAPREARWVPPVVAIAAAVRS
                     AASGKRAQLTGAQLTSVAC"
     CDS             212262..212894
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2020"
                     /old_locus_tag="nfa2020"
                     /product="hypothetical protein"
                     /protein_id="BAD55044.1"
                     /transl_table=11
                     /translation="MAEDANRGDSTSTDPNAAGSDAAAPNAAGTDAAARRGTAEYVPE
                     SRWLAWKAAALRRLAGGVRDEEPAEPFRSGRDFRRWSADAAAALLDVQFHRRATRTLL
                     PLAYILGLIFACAVPIALTVLLWQVSIVLGVLAALVAIPLGLTIAAAVRLMLEFLVNA
                     SRLATRVEHISDLADDLFQALSDVAEPVNQLSEDVRAVQFWRFRGRNPRK"
     CDS             213032..213916
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2030"
                     /old_locus_tag="nfa2030"
                     /product="putative DNA-binding protein"
                     /protein_id="BAD55045.1"
                     /transl_table=11
                     /translation="MALPQVTTGSTMPRRRLGRHLRDLRTRAKMTTRAAARHLEWSEA
                     KIWRIETGQTSLRSLDVEAMCKIYGAPDEVVAPLAALAKETKARGWWTAYSDVIGEGF
                     DIYIGLEEAARQLAGYENELVPGLLQTEAYARALLGAAHPDATATEIDRRVALRTRRQ
                     ALLTRPGAPLRLDVVVAEAVLHKRIGGRAVAAEQLAHLRRMCELPTVRLRVVPAASDY
                     HAGMATSRFAILEFPLGDVAQPEPPVVYVEAFTGPVYLDKDAEIERYRRAFASIAAVA
                     VDARAPLDEAVAVLNRRS"
     CDS             complement(213932..214336)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2040"
                     /old_locus_tag="nfa2040"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55046.1"
                     /transl_table=11
                     /translation="MSKSTVDTARRPSASSALVGQWRDLLDRHAAVSCALEKALQNEH
                     GIGLSEFETLDRLVDAACGKYRMSDLAGDIHLSQSALSRAVARLERDGLVERSMCEED
                     RRAIFVRMTDKGRAVYEAAMPTHRTVLADTWH"
     CDS             214422..215885
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2050"
                     /old_locus_tag="nfa2050"
                     /product="putative transporter"
                     /protein_id="BAD55047.1"
                     /transl_table=11
                     /translation="MTSPATLSAAAAPALDPTKWPVRLWGMLITLCVVLFLDGLDVSM
                     IGVALPSIGAELDMSTSTLQWLVSGYVLGYGGLLLLGGRTADLLGRRKVFLIALAVFA
                     LASLAGGLVSSGPLLILTRFVKGLAAAFTAPTGLSIITTTFAEGPARNKALSIYTVFG
                     AGGYSSGLLFGGLMTGMGWRWTFLLPVPIALAALAAAWVLVPKDEPAEEGGHDLLGAA
                     LSTAAMLLLVYTVVTAPEVGWNSARTVGSFAAVAVLFAAFLAVERRVAHPLVRLGILR
                     KTTLVRASLAIVAVAGSYFSWQFIVTLYLQDTLGWSPLRLALALLPVGLLVALSAVFS
                     DKLVDRFGTGPIIGVTMTVMAVGYLLFLRLDTHPSYLTMILPAVLLIGIGWIGFPAIN
                     IQATSGIDDDEQGLAAGVLQTAMQVGGAVMLAVTTAVISSGGHGSGEPQQMLDAYRPG
                     LTFAAGIAVVGALVALSAFAPALRRRRAAEPEVELVG"
     CDS             complement(215949..216497)
                     /codon_start=1
                     /gene="rfbC"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2060"
                     /old_locus_tag="nfa2060"
                     /product="putative dTDP-6-deoxy-4-ketoglucose epimerase"
                     /protein_id="BAD55048.1"
                     /transl_table=11
                     /translation="MEIRELSIPGAWVVTPRVFHDERGSFAEAFKASEFEKATGRPMD
                     LRQVNCSVSAAGVLRGIHYTENPPGQAKYVTCVRGAFLDVVVDLRRGSPTYGRWDSVL
                     LDDVDRRSVFVSEGLGHAILSLEDDSTVTYLCSLEYTPELDGEIDAFDPTLAIEWPRT
                     GRDGRPLTYLRSPKDTAAPPFS"
     CDS             complement(216499..217371)
                     /codon_start=1
                     /gene="rfbA"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2070"
                     /old_locus_tag="nfa2070"
                     /product="putative glucose-1-phosphate
                     thymidyltransferase"
                     /protein_id="BAD55049.1"
                     /transl_table=11
                     /translation="MRGIILAGGTGSRLHPITRGVSKQLVPVYDKPMIYYPLSTLMLA
                     GIRDVLVITTPEDAQAFRRLLGDGSQFGIAISYVVQPEPDGLARAFVLGADHIGSDCA
                     ALVLGDNIFHGPGLGTSLERFDGISGGAVFAYWVSDPTAYGVVEFAEGKAISIEEKPK
                     VPRSNYAIPGLYFYDNDVVEIARGLRPSARGEYEITDINRAYLEQGRLQVEVLARGTA
                     WLDTGTFDSLLDAANYVRTIEERQGLKIGVPEEVAWRMGFIDDEGLRAVAEPLVRSGY
                     GSYLLDLLERGRDW"
     CDS             217475..218572
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2080"
                     /old_locus_tag="nfa2080"
                     /product="putative esterase"
                     /protein_id="BAD55050.1"
                     /transl_table=11
                     /translation="MLRRSLLRGLLKCKCVRCRRRHSLVRHRAVRPGRCGGAAARRCA
                     MVVLNPEGPSAQARLLTAACRGVVRPVLRAAPITRATIPVGALAIDGLARLRPHPRGI
                     EREQVTMPGFAMEIIRPAGAARAMRHGALLYLHGGGFAVCGLETHRPVAASLARRTGL
                     PVVNVAYRQLPVRSITESIDDCLAAYRWLLRHGAEPDRIVFAGDSAGGYLTFATALRA
                     LECGLPAPAGLVGLSPLLDLDYAAKRDYVNVARDPYIPLSALAAVVRLGAEREGRLDP
                     LLSPVNGALAHLPPVLLVAAEDEVLRFDAELMAARLDAAGVPNSVELWRGQVHAFMSI
                     APGLPESRAALGRVARFVRGRLADSQRARTA"
     CDS             complement(218818..219531)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2090"
                     /old_locus_tag="nfa2090"
                     /product="hypothetical protein"
                     /protein_id="BAD55051.1"
                     /transl_table=11
                     /translation="MLMRKFAATSALLIAALGVTAGTVNAAPAAPAESGAINFTAQST
                     DTQSIISIDSGSLVVEDNALKIKAADGTTVAGAPLTFRVDEFEFPIAAEISDRTATLT
                     PQLDVDKAVYKPVALPFEDKAPWKSEYDRELAAFNRLKDTIGMGATIGTLVGGLGGAA
                     VGCVLGGIAGATVASATIVGLFGPFIPAAAIGCLGGILAVGALGTLAGQILVTAPVAI
                     GAAIQYFTTINQPFVPPAK"
     CDS             219808..220830
                     /codon_start=1
                     /gene="rfbB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2100"
                     /old_locus_tag="nfa2100"
                     /product="putative dTDP-glucose-4,6-dehydratase"
                     /protein_id="BAD55052.1"
                     /transl_table=11
                     /translation="MRLLVTGGAGFIGANFVQQTVAERPDATVTVLDALTYAGNRASL
                     APVADRIDFVHGDIADLDLVDELVSGVDAVVHFAAESHNDNSLAEPWPFVQTNIVGTY
                     SLLQAVRRHDVRYHHVSTDEVYGDLTAEQPPFTETTAYNPSSPYSATKASSDLLVRAW
                     TRSFGVRATISNCSNNYGPYQHVEKFIPRQITNLIDGVRPRLYGAGHQIRDWIHVHDH
                     NRAVWDILERGRIGQTYLIGANGELDNKSVVRMLLEAFGRDPDDFDHVTDRPGHDQRY
                     AIDATLLRTELGWTPRYADFRAGLAATIDWYRANESWWRPMKAATERAYAAAGEQTLT
                     QVPGTD"
     CDS             complement(220843..222606)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2110"
                     /old_locus_tag="nfa2110"
                     /product="hypothetical protein"
                     /protein_id="BAD55053.1"
                     /transl_table=11
                     /translation="MTTSADRNTATDSGDSESDTTSDTTSGTTSGTTSTVTGRDRSES
                     GADSATTTDPTITDPATVESATADTTSTHAARTTVETTGAATEPAGRTAPIRAFARRA
                     HRRFGGATLAFALLATLFGAVFAVITPPFWGHDEITQFGRAYQVAHGGFLPTEIEDDR
                     GVAYGGVIPPGIDDLMGYAFHDYQENPEEPGAMVADPGAYERLRSADIGTELRPIWFT
                     NTAAYSPVAYVPAAVGIRVAEAVGLDVGGVVLLTRLAGLLGYLVVAGFALYALRAHRI
                     QWLAFTVAVLPIAIFQAGTVTADTMTNALALLVSALLVKGLFLGRDLTRAETVALLAA
                     TLLLPLSKPTYVLLAMLVVLIPVRRFAFFGGVAATGFDWRRLIPWVFAGTGAVAFAIW
                     MKIAAPTGDGMSLMRPRHQWYTVKPDEQLGEILGDPFRFLGVFRDSIVYRDQRWFTQF
                     FGELGFAYIDVPALAVLGCLLALAVSLGIGDRMDAAAATTRRTLLVALTVAASVAMIY
                     VTLYMSFTPVGFYIIDGVQGRYFVPLALTGCAVLLRWMPWRLTDAQGRTPTWGPGLTV
                     AAATTVALVATVVKYHSIVWG"
     CDS             complement(222603..223607)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2120"
                     /old_locus_tag="nfa2120"
                     /product="putative glycosyltransferase"
                     /protein_id="BAD55054.1"
                     /transl_table=11
                     /translation="MTRVDSTDLRIAAVVPCHNEEASVAKVVTDLQAAVPGIVVYVYD
                     NLSTDRTAERAREAGAIVRHEHTKGKGNVVRRAFADIEADVYLMIDGDDTYEASAAPL
                     MIKTLLEGPYDHVLGVRKQDEGASAYRAGHETGNKVLNGVVGKVFGENVEDMLSGFRV
                     FSRRFVKSFPAVSREFEIETELTVHSLHLRVPQTSVPVGFRDRPAGSESKLRTYHDGF
                     KILALIIGLARHERPVAFYGLFGSLAWLLSVVLTVPIVIEFTRTHEVPRFPTLFLGFT
                     LLLLGSLAWTAGLILDGIRRSRHEASRLVYLRYSAVGADEPADGQVRERGLRGDGTAR
                     "
     CDS             223622..224230
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2130"
                     /old_locus_tag="nfa2130"
                     /product="hypothetical protein"
                     /protein_id="BAD55055.1"
                     /transl_table=11
                     /translation="MKGTPGRVHRWGTVAEVSYPEHPAAPAEKLAAASVPAPGDVRAP
                     LSATLLGLLRKGGGPFLVVGVIGFLVDAGTYNLLVFWIDGGVMRHAPLPAKIISIALA
                     TVVTYFGNKWWTFGHKQSGNPVREYLLYALFNAIAIGLQLGCLGFSRYVLDLASPLAD
                     NISGTLIGQAVAMIFRYWAYDTFVFTGAAEAEAEQQAEATGR"
     CDS             224332..226242
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2140"
                     /old_locus_tag="nfa2140"
                     /product="putative glycosyltransferase"
                     /protein_id="BAD55056.1"
                     /transl_table=11
                     /translation="MDQSATQAVTESNDHRIAAAAPAALRVDHRAPDRLVLQRGIFTG
                     PSAKVSDELYAVVKGKAARERQTLRLEKGATAHTNTYFGRFAASYWQRWTTVTEVTAT
                     MTLEVGKRARVRLVASDIAGHRRIIDTLTTAESGTVVLSAPLDQYVDGGALWLEFDAD
                     GGELGIAELVWTAPAPERVRPVAIAICTFNRAADCAETVAALAADPTVLAAIDAVYVV
                     DQGTDLVADRPRFREVEPAFGDKLRYIRQPNLGGAGGFTRGLYEVSAVNEHADVILMD
                     DDILCEPETVLRLNAFANLTVEPTLVGAQMLFLLNPDYLNVGAEEVHLHELRHGQKVP
                     KALRNTSMLKKNQERRVDAGYNAWWTCLIPAEVVAKIGLPIPIFFQWDDVEYGLRARE
                     HGFVTVTLPNAAVWHADFYWKDYDDWARYFSTRNSLIVGAMHTDLDGKAITKQFFRTI
                     AEHLVAMQYGLVHTTLQGIEDFLEGPKVLRDGGVAALAAARAQRADYPETIKHPAANP
                     PVPSAEIQVRRAGGEPSRALLVLVKRAVNQWFGRTQHGLIGVTREDAHWWHVSLFDHV
                     VVTDASQSGVRVRRRDKARARALLLRTVRVLRRLRRELPALQEQYRAAMPELTSRANW
                     ERLYGIGAGERS"
     CDS             complement(226246..227091)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2150"
                     /old_locus_tag="nfa2150"
                     /product="putative short chain dehydrogenase"
                     /protein_id="BAD55057.1"
                     /transl_table=11
                     /translation="MTENKPLAGKTMIMSGGSRGIGLEIAKRAAADGAAITLIAKTDQ
                     PHPKLPGTIHTAAAELEAAGGQVLPFVGDIRSDESVQQAVDATVARFGGIDLVVNNAS
                     AIDLSPTDALPMKKYDLMQDINCRGSFLLSKLCLPHLRESARAGRNPHILTLSPPLNL
                     DPKWAGASLGYTIAKYGMSLTTLGLAEELKNDGIGVNSLWPRTTIATAAVRNLLGGEE
                     MVSTSRTPDIYADAAYLVLTADAAKTTGNFFIDDEVLAAHGITDLDKYRVVPGDGPLT
                     TDLFL"
     CDS             complement(227260..228306)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2160"
                     /old_locus_tag="nfa2160"
                     /product="hypothetical protein"
                     /protein_id="BAD55058.1"
                     /transl_table=11
                     /translation="MVDHDLLVPYGWTEPVAARYAALIDPDCVPARVVRMDRSECDVV
                     TPTGPARARCPRADSEVSGLCTGDWVSVDARGEVRALLPRHTAIVRSAASGRSEGQVL
                     AANVDTVLICTAADGDVDLGRIERMLALVWESGAQPVVVLTKADAAEHVPLDEVRAIA
                     PGATVLAVSASAEIGLDVLTAVLDGTVALLGPSGAGKSTLANALLGREVFATNEVRAA
                     DKKGRHTTVHRELRPLPGGGTLIDTPGLRGVGLWDAAEGIGRTFSDIEELAARCRFSD
                     CAHEAEPGCAVREAIEAGVLTARRLASYRKLAKENAWMAARTDKRLQAERDRAWRGIV
                     KEQRRRYRERDNRR"
     CDS             complement(228541..229488)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2170"
                     /old_locus_tag="nfa2170"
                     /product="putative glycosyltransferase"
                     /protein_id="BAD55059.1"
                     /transl_table=11
                     /translation="MSGQGPEETRERPEPAGTGPDARIVAVVVTHKRRELLAESLKVL
                     TSQSRPVDHLIVVDNGNEAEVAELVDQQPVETTYLGSAHNLGGAGGFALGILHALTIG
                     ADWVWLADDDGRPEGPDVLSTLLDCAARHGLAEVSPVVCDIDEPDRLAFPLRRGVVWR
                     RLRSELGEEDFLPGIASLFNGALISAAAVDVIGVPDLRLFVRGDEVEVHRRLVRSGLP
                     FGTCLQTAYLHPNGAAEFKPILGGRMHTQYPDDPVKRYFTYRNRGYLMSQPGMRKLLP
                     QEWIRFSWFFLVTRRDPAGLREWFHLRSLGRHEQFGKPD"
     CDS             complement(229485..230336)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2180"
                     /old_locus_tag="nfa2180"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAD55060.1"
                     /transl_table=11
                     /translation="MSRVSIDTHQAWVEFPIFDAKSRSLKKAFLGKAGGAIGRNQSDV
                     VVVEALRDINLSLREGDRIGLVGHNGAGKSTLLRLLSGIYEPSRGSARIRGRVAPVFD
                     LGVGMDPEISGYENIIIRGLFLGQTRKQMMSKIDEIADFTELGEYLHMPLRTYSTGMR
                     VRLAMGVVTSIDPEILLLDEGIGAVDAEFMKKARLRLQELVARSGILVFASHSNEFLA
                     QLCDSALWIDHGQIRLRGGIEEVVRAYEGPDAGNHVATVLREMAAERAGRAEGSADER
                     ELEQNAT"
     CDS             complement(230346..231230)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2190"
                     /old_locus_tag="nfa2190"
                     /product="putative ABC transporter membrane protein"
                     /protein_id="BAD55061.1"
                     /transl_table=11
                     /translation="MRSAEETPVNTATHVPSEPIVSDSQTFRRAFRDMRDGFGQRELW
                     LSLGWQDIKQRYRRSVLGPFWITIATGVQAAAMGILYATLLGQPLREYLPYVTVGLIV
                     WNVISASILEGSDVFIANEGLIKQLPSALSVHVYRLVWRQMLFFAHNLVIYLVLLAAF
                     GVWENLGWSSLLALPAIGLIFLNSMWVSIVFGIFSTRYRDIAPILGSMTLMLFVLTPV
                     MWTTKTLEDQIGTGSERARLVEIIPTFHYLEIVRAPLLGEPQALRHWVIVGAITVVGW
                     IVAVFAMKQYRSRVPYWV"
     CDS             complement(231398..232012)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2200"
                     /old_locus_tag="nfa2200"
                     /product="hypothetical protein"
                     /protein_id="BAD55062.1"
                     /transl_table=11
                     /translation="MMGVMTHSEETPDSIVVVGPDGRPLVVPAEAGNHRTAPADAEDA
                     AKGEADEREEQGESLADMVEQPAKVMRIGTMIKQLLEEVRAAPLDDASRSRLKEIHRS
                     SVRELEQGLAPELRAELERLTLPFTDEAVPSDAELRVAQAQLVGWLEGLFHGIQTALF
                     AQQMAARAQLEQMRQGALPAGVQIADPRVARGDQHHTGGSGQYL"
     CDS             232296..233498
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2210"
                     /old_locus_tag="nfa2210"
                     /product="hypothetical protein"
                     /protein_id="BAD55063.1"
                     /transl_table=11
                     /translation="MTYDVARVRGLIPSLGDGWIHLDPQAGMLVPDVVSRAVSTGFRT
                     ASFSHLGRNNAARRSAAILDAAREAVADLVGGDPAGVVLGPDRAVLLAWLAESLSSRL
                     GLGTGIVLSRLDDEANVAPWLRIANRYGAHVRWAEVEIETCEMPSWQFEELIGPTARL
                     VALTAASPIVGSAPAVRVAADRVHEVGGLLVADAFGAAPYALIDIDELNADVVALSAP
                     AWGGPQIGALVFRDPAFLDRIPSMSLNPYAKGAERLEVGGHQYTLLAGLTSSIDFLAG
                     LDDRARGTRRERLEISITSLQDYHDQLFEHLMDTLDKIPNLTVIGRASTRIPTVSFTI
                     AGMQAEKVAATLADARISTLSGVHGGSRLLDALGVNDEGGAVTVGLAPYTTRFEIDQL
                     GRALAALD"
     CDS             complement(233508..234512)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2220"
                     /old_locus_tag="nfa2220"
                     /product="putative quinone oxidoreductase"
                     /protein_id="BAD55064.1"
                     /transl_table=11
                     /translation="MRAIELNGFGGPEVLVWGKAADPVPGHGEVLIDVVAAGVNRADL
                     LQRQGNYPPPAGASDILGLECSGVVAEVGEGVREWQVGDRVCALLSGGGYAERVVVPA
                     TQVLPVPEGMDLAAAAGLPEVAATVWSNLVMTAGLHAGQLVLIHGGGSGIGTHAIQVA
                     RQRGARVAVTAGSAEKLERCRELGADVLINYREQDFVEVVRAQESGAGAAGADIILDN
                     MGAAYLGRNVAALAPHGHLVIIGMQGGVTGELNVGALLGKWGSVHATNVRNRPATGTG
                     SKAEIIAEVRRHLWPLVADGAVVPVIHAEFDIADAAQAHRVLDSSRAFGKVVLRVREE
                     "
     CDS             234630..235805
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2230"
                     /old_locus_tag="nfa2230"
                     /product="putative dehydrogenase"
                     /protein_id="BAD55065.1"
                     /transl_table=11
                     /translation="MSSFIDFQNEIYLAGLGGRIPELPMTPEGLEERAREVLGASEFA
                     YVAGSASSGRTAAANRAAFDRYRIVPRMLRGATGPGNRDLSTEVLGTRLAAPVLTAPI
                     GVLELMRPGGEVTVAEVTKELGIGSVLSTASSSTIEEVGAAAGDWWYQLYWPADHDLA
                     RSFVERAERAGAKAIMVTVDTPSLGWRPQDLELAHLPFLVGKGIANYLSDPVFRAKLP
                     SPPEESEDAMRIAILTWVGLFGNHTLRPADIARLREWTDLPIAVKGILHPDDARAVID
                     AGADGVVVSNHGGRQVDNSIAALDALPAVVSAIGDRADVLFDSGIRTGSDVLVALSLG
                     AKAVLFGRPYAYGLGIAGRAGVHHALRLLLADFDSAMGLCGCTSAAALDRSLIATPH"
     CDS             235854..236348
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2240"
                     /old_locus_tag="nfa2240"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55066.1"
                     /transl_table=11
                     /translation="MPIPPSDAAPATEPRWLSPAEQRAWRAYMDGHQRLMATLNRQLL
                     RDSDLSFAEYRILVLLSEAPEHALRMSELADGVLSSRSRLTHQIRRMEAQGLVRRASC
                     PDDGRGVLAELTEAGMRKLESAAPGHVEAVRRDFIDLLTPEELAAVHRVFARVDDTIG
                     AREE"
     tRNA            236369..236456
                     /gene="serT"
                     /inference="profile:tRNAscan-SE"
                     /locus_tag="NFA_80050"
                     /old_locus_tag="nfa80050"
                     /product="putative tRNA-Ser"
     CDS             236523..237590
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2250"
                     /old_locus_tag="nfa2250"
                     /product="putative transporter"
                     /protein_id="BAD55067.1"
                     /transl_table=11
                     /translation="MTSRGCDMRSVLGMVAAVVALHVIGWGTLLLFVVPGHHVVQGAV
                     FGVGLGVTAYTLGMRHAFDADHIAAIDNITRKLTAEHPGRTVHSVGFWFALGHSSVVF
                     ALVALLAFGVRALARNLEDDGSALQQWTGLWGTSVSGLFLIAIGLLNLVSLLAIWRVF
                     RRMRRGEYDEARLERALDDRGLLNRILAPVVRLVRAPWHMYPVGLLFGLGFDTVTEVG
                     LLVIAGGAAATDLPWYSILVLPVLFSAGMTLFDSLDGSFMTHAYDWAFAQPVRKIYYN
                     LVVTGLSVAVALLIGGQEIISIFVERLDIESGLIAWIGHLDIGELGYIVVGLFVATWA
                     VAYAVWRLGRLDQRWSDRLVR"
     CDS             237608..238399
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2260"
                     /old_locus_tag="nfa2260"
                     /product="hypothetical protein"
                     /protein_id="BAD55068.1"
                     /transl_table=11
                     /translation="MRIAIAQLPARTNEDRALPIENALVVMDGATSHHPGIPPASEYV
                     DALGAALAQHLIPDAELPPALADAIRDTARELGLAPGRSPSSTVAIVRIAVETVSVLL
                     LGDTTVIVGRTDGSHEIHTDDRLGALGIPQAAEYRRRLAHGSGYDDVHRRLLRELQER
                     QREQRNRPGGYWIAEADPSAAAHAIRLDIPRNSVSWLVAATDGAREPIQSLGIPWTDI
                     AQQSADELGALLRTCHSWEAETDPDGRILPRSKRHDDKTLAVVRL"
     CDS             complement(238494..239282)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2270"
                     /old_locus_tag="nfa2270"
                     /product="putative acetyltransferase"
                     /protein_id="BAD55069.1"
                     /transl_table=11
                     /translation="MFPTWRMAYVRAAIQQGPWRTVARGLASWIATVGGPAVVLGLAL
                     TVVSGSTAGELIGLWVVLVVGVLLVAGGLWAWQVSGLVDKETRARYLVLREVESARLL
                     LRPPVPRDAVALAATIDAEMLAANGWTERQARAMVKAVRAGHPTPGLLVFEARSDGAL
                     VGGGGVHPRVDDPSSQTLGWWIGPRHRRAGYAGEAVAALVAAIHDAGFATVEIGTAET
                     NLAVQRICDRIGATETGRREHALPNGSVVPGIWYEHRQVTADQP"
     tRNA            complement(239471..239546)
                     /gene="argT"
                     /inference="profile:tRNAscan-SE"
                     /locus_tag="NFA_80060"
                     /old_locus_tag="nfa80060"
                     /product="putative tRNA-Arg"
     tRNA            complement(239578..239670)
                     /gene="serU"
                     /inference="profile:tRNAscan-SE"
                     /locus_tag="NFA_80070"
                     /old_locus_tag="nfa80070"
                     /product="putative tRNA-Ser"
     CDS             complement(239762..240535)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2280"
                     /old_locus_tag="nfa2280"
                     /product="hypothetical protein"
                     /protein_id="BAD55070.1"
                     /transl_table=11
                     /translation="MRVIHAQGQYLAKIGPAPYAGFMSGIYDDVAQLRGGAEDEERSG
                     AGASVPVTVIEPEGHARGGIVVLHESREFTGSLLEFMRALSNEGWTVVAPNLFHRGEE
                     AGQEVFGQDLFDDFDACFDWLTRRGVFPDCIGVLGFDHAGTAAFLVATNRPIGAAVSV
                     AAPGITEPLTDQAEALVQAAPELQAPWLGLYGADDPETPPDDVEKLRDATARASVASL
                     VVTYPGLRHRADDPSDDDDQNVLIDSQTRIFDWFDSNLR"
     CDS             240598..241674
                     /codon_start=1
                     /gene="hisC2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2290"
                     /old_locus_tag="nfa2290"
                     /product="putative histidinol-phosphate aminotransferase"
                     /protein_id="BAD55071.1"
                     /transl_table=11
                     /translation="MSARIRPDLSSIPAYTPGRSNPGAVKLASNETTLPPLPAAAKAI
                     AEAAELAHRYPDNQSGELRAALAEFLGVRVENVAIGCGSVALCQELVQITCSSPRDEV
                     LFAWRSFEAYPIITQVGNATAVQVPLSPDYAHDLDALAAAVTEHTRLIFVCNPNNPTG
                     TAHGRAALERFLDAVPAHVLVVLDEAYYEYMRLTPQDRPDGVEVGRNRPNVVVLRTFS
                     KAYGLAGLRVGYAVGDPEVITALMKVHIPFSVNRVAQAAAIASLEARHELLERTEAVI
                     VERERLREALLAAGYDVPPSETNFVWLPLGAHSAEFGEASAAAGVLVRPYGTDGVRVT
                     VGDPHENEMFLRFAADPAVVARFR"
     CDS             complement(241779..242507)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2300"
                     /old_locus_tag="nfa2300"
                     /product="hypothetical protein"
                     /protein_id="BAD55072.1"
                     /transl_table=11
                     /translation="MTSDAHDLTPRTTLDQVAASTARLLETVRDLTDADLTAASPLPG
                     WTRGHVVTHLARNADSLVNLLIWARTGVEIAQYPSTFLRDFDIDAGAPRPAEQQVLDL
                     EAAVTRFTALADSAPPDAWGAVVRTRQGRPIAAAEIAWMRLLEVEIHHVDLGVDYTPD
                     DWPNTFVARALPGVATDLAKAVSPDTEAFDLQATDTPFTATLGTGAPVHTVAGTSAHL
                     LAWLLGRSTGESLSGPLPELPAWR"
     CDS             complement(242535..242927)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2310"
                     /old_locus_tag="nfa2310"
                     /product="putative endoribonuclease"
                     /protein_id="BAD55073.1"
                     /transl_table=11
                     /translation="MSQRVNISSASEFEDVVGYSRAVRIGDHIAVSGTTAAGPGGTAI
                     GGDDIGAQAREALRRIGIALTEAGASLADVVRTRIFVTDIARWPEVAAAHAEVFGDIR
                     PAASMYEVRALITPALLVEIEADAVVTG"
     CDS             complement(242969..243625)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2320"
                     /old_locus_tag="nfa2320"
                     /product="hypothetical protein"
                     /protein_id="BAD55074.1"
                     /transl_table=11
                     /translation="MTSRRLAAVLAVVIAVAGLSYSAWVLQFVLPVHADPVHSFLSEL
                     DAEGKPYRTVFAAGDVLTGALLIPAGLAGLLLFPRRPLTTLGWAALTVFGAATIADAL
                     IPLRDCAPGEPGCGGPRELFPQLHQPHALTSTLAVTAIAVAVAAFSLAAFRYRRWRVL
                     REFGIAAFLAGAVATVWMLVADRLPGEYALGIAQRIQVGAMSVWLLTLAAAVLVEARE
                     "
     CDS             complement(243762..244232)
                     /codon_start=1
                     /gene="vsr"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2330"
                     /old_locus_tag="nfa2330"
                     /product="putative DNA mismatch endonuclease"
                     /protein_id="BAD55075.1"
                     /transl_table=11
                     /translation="MIATDPATSARMSRQRRTGTAPELALRRELHRRGLRYFVDRAPL
                     RGQRRRADVVFPRRKLAVYVDGCFWHRCPQHATDPKNNGRWWADKLAGNVARDRATDE
                     ALRAAGWQVVRVWEHEDPIAAADRVQAALSAEPAPGPTSAGRARPHDSTPPSPR"
     CDS             complement(244229..245377)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2340"
                     /old_locus_tag="nfa2340"
                     /product="putative DNA cytosine methyltransferase"
                     /protein_id="BAD55076.1"
                     /transl_table=11
                     /translation="MTGGRMVGLFAGIGGLELGLAAHGWTCELLCEIDPGAQAVLGAR
                     FPDTDLHADITALRAVPAGTELVAAGFPCQDLSQAGRTAGITGLRSGLVDEVFRLVRR
                     KRGPRWLLIENVPFMLQLGRGAAMRHITTALEDLGYTWAYRVVDARAFGLPQRRQRVL
                     MLASRTEDPRPVLFGEDAGEAVVGDPDRDPCGFYWTEGVRGLGWAVNAVPTLKGGSGL
                     GIASPPAVRLPSGEIVTPGIVDGERLQGFAADWTAPAVTVPGIRQGHRWKLVGNAVSV
                     RMADWVGARLAAPLEPIPHDVPLAPGTPWPSAAWGRAGSAYRVPVSTWPVRAPYEDLK
                     NFLTDSRLLSARATAGFLRRASRGSLRFPDGFLEDVASHLDRMGGWAA"
     CDS             245577..246146
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2350"
                     /old_locus_tag="nfa2350"
                     /product="hypothetical protein"
                     /protein_id="BAD55077.1"
                     /transl_table=11
                     /translation="MAPRWPAILTWRAHNASRMESVRVTLNGNRIRAAGRMIGGDCDE
                     HPAFSASYDLVTDENGVTKRLSLRTTTAAGERHASIARDEEDYWLVDAGNSHVRSTFG
                     GALDVDVVLSPFFNTLPIRRFGLQHAVDEVVVPVVYVRLPDLLVQEASLTYSSGADGI
                     SVLSPVSSATVTVDPDGFLLDYPGLAERI"
     CDS             complement(246165..247115)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2360"
                     /old_locus_tag="nfa2360"
                     /product="putative prephenate dehydrogenase"
                     /protein_id="BAD55078.1"
                     /transl_table=11
                     /translation="MTGDANAPVCVLGTGLIGGSLLRAARAAGYPAFGYNRSSAGVLA
                     ARGDGFDVADDLPAVLRRAAREDALIVVAVPMPAVDHLLADIATFAPECVLTDVVSVK
                     GPVAEAVARHGLSARYVGGHPMAGTAESGWAATDPELFRGAVWAVGVDEGTRAEPWRR
                     VVRLALACGSTVVPVTAAEHDRAVARISHLPHVLAEALAVAGAAGGPLALGLAAGSFR
                     DGTRVAGTAPDLVRAICEPNAAALLDVLEETLTVLGAARDSLRADGTLGELVDAGHDG
                     HTDYRTVRRWEITDVRPGEHDWLARLREAGLRGGVLTALD"
     CDS             247174..247713
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2370"
                     /old_locus_tag="nfa2370"
                     /product="hypothetical protein"
                     /protein_id="BAD55079.1"
                     /transl_table=11
                     /translation="MAAQRSGTNRATSEDYDDVEGFAVAVVREEGKWRCSPLSRAALT
                     DLSAAEHELKALRSSGAVFGLLDVDDEFFIVLRPAPSGTRMLVSDATAAIDYDIAADV
                     LDALNIEIPDIDPDELDDIEPWEEGDLGVLADLGLPEPVLSVILAETDLYPDEQLGMI
                     AQRLGFANELSAVLDKLPR"
     CDS             247724..248203
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2380"
                     /old_locus_tag="nfa2380"
                     /product="putative cytidine/deoxycytidylate deaminase"
                     /protein_id="BAD55080.1"
                     /transl_table=11
                     /translation="MTAPLGPGPLAADEAMIRVAIEAAAAADPRDVPVGAVVFDAQGR
                     ELARAANAREASGDPTAHAEILALRRAAQVHGDGWRLAGATLAVTLEPCTMCAGALVL
                     ARVDRLVFGAWEPKTGAVGSLWDVVRDRRLNHRPEVRGGVLETECAALLDTFFRTHR"
     tRNA            248250..248343
                     /gene="serV"
                     /inference="profile:tRNAscan-SE"
                     /locus_tag="NFA_80080"
                     /old_locus_tag="nfa80080"
                     /product="putative tRNA-Ser"
     CDS             complement(248379..249563)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2390"
                     /old_locus_tag="nfa2390"
                     /product="putative phage integrase"
                     /protein_id="BAD55081.1"
                     /transl_table=11
                     /translation="MKVHAMATIEPYETQSGRRYRVRYRKPGGKQTDKRGFRRKIDAE
                     RFAATVEVSKMSGEYVAPSLGRITVGELAPKWLERKQVDVAESNYRTLESAWRTHVQP
                     RWGTVAVADVELDAVETWIADLGRTVTDPNEPEKVIRKGSGATTIIRAYGVLAGILDT
                     AVKSKRLRVNPARGVENLPKKVGKRHVYLTADDVQRLAAESGAERRALVLTLAYCGIR
                     WGEAVALRVGDIDFLRRRLTVADNAVQLGVDHAVGHTKSRKVRAVPVPQFVLDELSVQ
                     CRGRDRKALVFGDGVNYLPRPKSSGGWFAGAVKRARVQAITPHDLRHTCASLAVSANV
                     NVLALARMLGHADASVTLRVYADLFDSDLDRAAAAIHAAYSPPECGQNVGTSARDHGA
                     PA"
     CDS             249806..250054
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2400"
                     /old_locus_tag="nfa2400"
                     /product="hypothetical protein"
                     /protein_id="BAD55082.1"
                     /transl_table=11
                     /translation="MSNVAGDTPSAAARAIRSSVSTRRSPFSMRPSPSTGIGRPVASR
                     RRATSANVRFCCSRKRFTFSATVLPVGPSSFFFPAIPA"
     CDS             250159..250365
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2410"
                     /old_locus_tag="nfa2410"
                     /product="hypothetical protein"
                     /protein_id="BAD55083.1"
                     /transl_table=11
                     /translation="MDEMTDRRPLAEPKEIADFLGTSPAQLAQYRYLGKGPRFVKVGS
                     RVRYRWADVEAWVEQNTRLSTGAA"
     CDS             250365..250829
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2420"
                     /old_locus_tag="nfa2420"
                     /product="hypothetical protein"
                     /protein_id="BAD55084.1"
                     /transl_table=11
                     /translation="MADPRQESGPGAGPTAHRAKNPATPKRQGHAMNGITPTPEPVNE
                     LSVAQAQNAITAARPCPSWCDTPGGHADEAPADRSCWSEDRGLALNIMPWHRGLPIVI
                     ETGAMRPVGETESVVTLLFKNGPEELSGRLTAWEARRLAADLLHFANLTKEK"
     CDS             250829..251113
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2430"
                     /old_locus_tag="nfa2430"
                     /product="hypothetical protein"
                     /protein_id="BAD55085.1"
                     /transl_table=11
                     /translation="MRSPAISAALEDWKRGYSPTEFARRHFRGSFRNELEAELAHLLL
                     RLESADELQAAELARQFAERVARLDAQLRRNLSGDRHPGDDQAAPIRRTA"
     CDS             251117..251461
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2440"
                     /old_locus_tag="nfa2440"
                     /product="hypothetical protein"
                     /protein_id="BAD55086.1"
                     /transl_table=11
                     /translation="MTSERPTVLPRDMVGRSGRTHPMPDPIFITTPDGSLVGAMSAEQ
                     LRADAERLMLELAAAASAGDTTAVAKVAASWRQRLDPEHLGTVALTAAARMAVEMVAP
                     MLAQLTKRRGEQ"
     CDS             251458..252912
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2450"
                     /old_locus_tag="nfa2450"
                     /product="hypothetical protein"
                     /protein_id="BAD55087.1"
                     /transl_table=11
                     /translation="MTDTSAEEAPTGGLRGSCPRHPVLDPACLDCKVWYAERVHWLRE
                     EMAALSADLGPDEYAPPPEEYEPRSGRRLVVTRGSEVRTRRVRWVDPDWMPAGSLVLL
                     AGREGLGKSTIAAEKSARVTRGELEGEWYGQPRNVLYLHTEDARDFTVAPRLRAAGAD
                     MDRVLFVDVHTELTNTGTLILPADILGLDQLVVDEEVSFIVLDAATSAMSSELSGKDD
                     RQVRQFLEPLAQLAARRDCVVLGLCHFGKRDGADTGKLILGSIAWSQVARSVLSVAKD
                     EDSGNLVVTNTKANLAPRTRSMEAVIESATVPTDDGVAEVGVLRWIGESDRDARDLLA
                     GEADDDTNERTAAEAWLEDYLTEHGQTPAKTVKAEARKQGYSDATVKRAAKSIRVHYE
                     IAGFPRTSVWSLKSAQSDQRTPMHEPTEPTEPTGRDQRKRGEPIGEQTQSAQAHVYEP
                     TADPTATPPVVHTPGRKPGQWLGSGKPVASAGAN"
     CDS             252912..253298
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2460"
                     /old_locus_tag="nfa2460"
                     /product="hypothetical protein"
                     /protein_id="BAD55088.1"
                     /transl_table=11
                     /translation="MSRTAATVVPPTTVAVRLRVEELHGARYCASELVRRFNDSGRPV
                     PDWLRRLDSRLDLEIQTLMSDDGQQSSTDEPDSELVGTAEAAKILGLSARQVRRLAAD
                     LDGQRMGRELIFRRAAVTEYAAARKE"
     CDS             253303..253680
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2470"
                     /old_locus_tag="nfa2470"
                     /product="hypothetical protein"
                     /protein_id="BAD55089.1"
                     /transl_table=11
                     /translation="MANECAPLFRPGREITVSATANITGKTFVDVSANRGADGLIRVA
                     TATAGTRPLGVASADIANGGIGAILRGGVISITAGATITAGTEVEVGTNGKAIALASG
                     EAVGYAVEDGASNNPVQIALYGA"
     CDS             253692..253877
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2480"
                     /old_locus_tag="nfa2480"
                     /product="hypothetical protein"
                     /protein_id="BAD55090.1"
                     /transl_table=11
                     /translation="MTDQEQAAADIASAYVAKLTPEQFASFVAATREPGESTPPPVLG
                     KLPEQRPEDAYPTGWAV"
     CDS             253903..254679
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2490"
                     /old_locus_tag="nfa2490"
                     /product="hypothetical protein"
                     /protein_id="BAD55091.1"
                     /transl_table=11
                     /translation="MNRNFLICRNFVSNATALGAKVPAKLQGILDAGEATLQWMPADS
                     LNALQNAIVEGKFTAETASGYLDAELNRTERQPGDVQSKAQDYLARTFTVTLRNGAAD
                     QIIDSLRPAFEKARDGFDTASEWITPSTTAEQVLAAGPDAAAAWSALAEHRRTLDNLY
                     SLATTLYHDFQLVPRHPFMLTGTEPIAAFFVGPSVDLRIADQALEPLRSNGRRGGRWT
                     GLRALTQLQWNTATEARRIADAQQESIAAAERRHYAATHS"
     CDS             254679..254963
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2500"
                     /old_locus_tag="nfa2500"
                     /product="hypothetical protein"
                     /protein_id="BAD55092.1"
                     /transl_table=11
                     /translation="MAWSREPGRYRGVSTATAERIRRRDHRTCQQCGQPGSQVDHRIN
                     VAAGGTDDDSNLWVLCDSCHATKTSRESAAGRAKVSRWREPEQHPGRVVR"
     CDS             254982..255254
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2510"
                     /old_locus_tag="nfa2510"
                     /product="hypothetical protein"
                     /protein_id="BAD55093.1"
                     /transl_table=11
                     /translation="MAHPSLPGGRRAWHLRPCVRIAPVFSAAAAQIAGLNGIPVRANV
                     TADRSMLTGLLSEPVLLNVGALGLGTLVPRVHDHWCAAAQGRAIAR"
     CDS             255289..255879
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2520"
                     /old_locus_tag="nfa2520"
                     /product="hypothetical protein"
                     /protein_id="BAD55094.1"
                     /transl_table=11
                     /translation="MPVSDPDAPDERPAEPEPMRVKVRAWTARVELNVPEVARQEMDE
                     HRLAVLRGDDVDPLDGHRMLTRLKVAAALSILDAREFVTEEDWQLAGTVIRVSDRTRA
                     EVKRAVAERAREAARARAEARAEEAGVIADRADERIRRRARAAVLRYLDRHSTATRKD
                     LRGNMRNDLRGELDATLDDLLAENVITSTGGVYALA"
     CDS             complement(255976..256410)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2530"
                     /old_locus_tag="nfa2530"
                     /product="hypothetical protein"
                     /protein_id="BAD55095.1"
                     /transl_table=11
                     /translation="MRNRLTCVVSLVSLVSHITGQVSDPCLFEPFLTGHCVALGPGRP
                     PCRAIGVHAIGSRERSERVSALGARIFRDFHRTVHGVQQSGRSGHSRAMHGPVAPLAQ
                     LCSWANWPVAFALVSSSWASWASWAMHRPDWPGAVVVARLCG"
     CDS             256557..256847
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2540"
                     /old_locus_tag="nfa2540"
                     /product="hypothetical protein"
                     /protein_id="BAD55096.1"
                     /transl_table=11
                     /translation="MSWPKVRELAADLADARLVGAACAGRAPLFDAEVPGEDDNGRRY
                     RLDAAAQVCESCPVLAECNAVARELGRLAVGVWAGRGRHLPAPVGRPRDGAA"
     CDS             257031..258200
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2550"
                     /old_locus_tag="nfa2550"
                     /product="putative phage head"
                     /protein_id="BAD55097.1"
                     /transl_table=11
                     /translation="MLEQVELEMAEQVELEMAEQVELEMAGRDMTGDEQRAFDEAMTK
                     GRGLLDRIKSGKRDLEVLEAAKGLASEIGRPNDPNAPSGKHLSLTGAAVKAMARQIAD
                     RMAPANSTGRKALLPAGATVTDVPMVAESPIALGRPALSLLDALTLRSQPPKYKYLRQ
                     NTRTNNAAPVAQGATKPTSVLGLAEIDAELRVIAHMSEPIPKYWLEDSDALELFVADE
                     LLFGLRQAIEAQVIAGDGTGENMTGLVNVSGGQAQAFATDLLTTTRSAVTRLETAGHT
                     AGLFVLSPADWEALELARTDTAGQLELGGPVDRAARKLWGVPVAVALGLPAKTGLLLD
                     LTAVALSTDEAGIETKWSENVSDDFSKNQIRARVEGRFELDVFQPLGIAKIATAE"
     CDS             complement(258880..259839)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2560"
                     /old_locus_tag="nfa2560"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55098.1"
                     /transl_table=11
                     /translation="MTGELLRELRCAAGIGLRRMAAQTHYTPSYLSLVETGRRPVTEG
                     VLDRYRAVLSDPVLDGVDVHRLGATVADPSGAGAAGVADLSVILGKTRHLEDTVGAAA
                     VTPLVRGMDSTARELARYRSGGTAAAGLASAVARYRGWLEHDTGQPRVADRVLTDAAR
                     LAEYADDQSQLAHALSFRAYTARHMGDLRRALDLTDAALGVTRAHPILAVYDRYQRAE
                     LLALDDDTGAAARALAVADRAAEEAERFDLPTFGYWYTPGFWGLERGVVLAAMGRHAD
                     AVREAEQGHAALPAEHQSAGWARSMLEQVEPGMAEQVELEMAD"
     CDS             complement(260281..260589)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2570"
                     /old_locus_tag="nfa2570"
                     /product="hypothetical protein"
                     /protein_id="BAD55099.1"
                     /transl_table=11
                     /translation="MRFTTRTTGLLAAPPPILVRAAARMHRAGTQARHARQGPRRTMI
                     GVRLTDEQIEQLDWRANSEGLVTKAGEPNRSELIRIMIAYAEQNMPADWRPEGWRYVG
                     "
     CDS             complement(260589..261851)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2580"
                     /old_locus_tag="nfa2580"
                     /product="putative DNA-binding protein"
                     /protein_id="BAD55100.1"
                     /transl_table=11
                     /translation="MRLHEASGTGGGIQRSGKRSGRSGWQAEYMSADTGRLIRQLRVA
                     KGWSQGRLASELSKLSGCTMTREYISRHWESGKTEPSAFWLRHLAAALDCPQELLEAD
                     VNRRRFLSHLAATSIAPAVASDLLSQGFSTRLHASGPTVEEWEATLARYGTDYMSQGA
                     ATIQQRLAADLVVLQQQLDSPRMWAIAARLMTLFAKTYPGSDGNKAIAWYRMAAEAAD
                     RSEDIDIRVWVRGRAAIALGYEGAALPVAHTFADQALAISERSSLGRLNSLWGKAHAA
                     VLEGDVRTARELVDEGRREFDRSYSEEQTSDYAVPWWRVNVFLSLLAARLGDEKLAVQ
                     AQEDARAELPAQLPRFATHLAMHRGLMLVRAGDRQQGVALARAALDALPPEKHSLTLR
                     MLMSEIAGVGNPGSARRFTTDPRLDRTT"
     CDS             261978..262271
                     /codon_start=1
                     /locus_tag="NFA_2585"
                     /old_locus_tag="nfa2585"
                     /product="hypothetical protein"
                     /protein_id="BAG32220.1"
                     /transl_table=11
                     /translation="MFAFAWIDPLSPTPEWDLAQVRRLARRLGYELYRPDHPSVLGLA
                     EQVTAAGAEVVLLPSSAHVDAVTLDRVLAVADVECAAPRVSFARWSSLGGVRR"
     CDS             complement(262950..265241)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2590"
                     /old_locus_tag="nfa2590"
                     /product="putative membrane protein"
                     /protein_id="BAD55101.1"
                     /transl_table=11
                     /translation="MSVFLYRWGKFAFRRKWIVLPVWLALFLILGGLGAQLREPMTDD
                     FSLPNLPSERATEILDKHFPGMSEAFAFDAVTGTYVIGAPEGQRLTDPANREAITAMI
                     GRLEQLDIVDHAEPIVDPITATEQMGCLIPDPDPAECGSAPLNVLNQTAPATVAYFSV
                     PFTIAEFADITAQDRAAAYGVADAARQAGLTVEMSGSIAIEEGGPSGKAEMIGMAVAF
                     VVMIVAFGAIVAAFVPIVTAVVGLGAATSLIFLGTSVVSIPTFTTFLASMIGIALSID
                     YALFIVSRYKHELAVQDSPEEAAGTALGTAGSAVVFAGLTVIIALAGLSIVGVRFLTF
                     MGLGGAVAAAFAVLVALTLMPALLGALGRFLFTPKLPLVAQHDPEDDTVVTNGMRVAK
                     LIGRAPALTLLLSVVVLGLLAAPAVNLDLGLPGEDSMAKTTTVRKAYELRTAGFGEGS
                     NGVLQVAVDLSGVPEDRRAEALTALRDKLASYPDMDYVSRPTPSADGQGALINGVPTA
                     GPNDQRTKDLVRDARADEAALNEEFGMEYGVTGTTAIYADIDHVLLGKIVPYMAIVAG
                     AAFVLLILVFRSILVPLTGALGFLLSMAATFGATVLIFQEGRFGLIDDPHPIVSFLPI
                     MLIGLVFGLAMDYQVFLVTRIREEYVHGAEPRTAMINGYHHGARVVTAAAVIMISVFG
                     SFLLETDATAKSMGFALAAGVLLDAFFVRMLLIPSLLALLGDKAWWMPRWLDRIVPDI
                     DVEGAKLYALRAPAADKERAPVS"
     CDS             complement(265454..267748)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2600"
                     /old_locus_tag="nfa2600"
                     /product="putative membrane protein"
                     /protein_id="BAD55102.1"
                     /transl_table=11
                     /translation="MSVYLYRFGKFAFRRKWIVLPAWLVLLVVVSGLGAQLGKPMSND
                     FSMPSLPSERANEILDKHFPGASEAFQLDAVTGTYVIAAPEGQQLTDPANRDAVKALV
                     DRLDQLDIVDHSKPVTDPITAAEAMGCLANPDPATCSGAPLNVLSADDPNSVAVISVP
                     FTIPGFADITDEDRQKATAVADAARAAGLTVEMSGSIAQENVQPGGKSEMIGMIVALF
                     VMIIGFGAVVAAFVPIITALVGVGAASSVVMLGTSVIEIPSFTSFLTLMIGIALSIDY
                     ALFIVSRYKHELAVQDSPEEAAGIALGTAGSAVVFAGLTVIIALAGLSIVGVQFLTFM
                     GLGGAIAAAFAVITAVTLMPALLGAFGRFLFKPKLPLVAKHDPEDDSVVTNGMRFGKL
                     IGKAPWVALVLSVVALGALAAPALNLNLGLPGEDSMPPETTVRKAYELRTEGFGEGSN
                     GVLNIVADLSAVPAEQRQEAVNALRDRLASYPEMDYVTAPQFSQDGAGVMLDGVPKAG
                     PNNQATKDLVREARDAESELKDRYGMEYGVTGATAIYADIDHVLLSKIAPYLAIVAGA
                     AFLLLILVFRSILVPLTAALGFLLSMAATFGATVLIFQEGALGLIEDPHPLVSFLPIM
                     LIGLVFGLAMDYQVFLVTRMREEFVHGKSPKEAVVSGYHHGARVVTAAAIIMISVFAS
                     FILESDVTVKSFGFALAAGVLFDAFVVRMVVIPSLLVIMGKWSWWIPKWLDRVLPDID
                     VEGTKLRAIQNGSAEQPKEPVGVA"
     CDS             267953..268546
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2610"
                     /old_locus_tag="nfa2610"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55103.1"
                     /transl_table=11
                     /translation="MAQPHAPESVIAGSGTKMAIRDAAVRLFTSKGFEQTSLREVADA
                     VGITKASLYYHYPSKLDLLLAIVDPIVDHLRSVVDGLESVPHDPNNVRRVLGDYLRGM
                     IRHRDAGTLCVRDTAAIFNAMADRYPDVMNANRLLAEWLAGPRPTDENRVRASAALEV
                     LGVALLSEEFVPGVSDELLEATLLDAATAVLAAGATG"
     CDS             268642..269172
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2620"
                     /old_locus_tag="nfa2620"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55104.1"
                     /transl_table=11
                     /translation="MHITAKVDYAVRTLLEIARLTPAEITPATAGCVAEPGVRPDAGV
                     AAPAKVKAETIAAAQQIPPKVLETVLSDLRRAELVTSRRGPDGGYRLARPAAQISVAD
                     VIRAIEGPLASVRGQRPEDVRYEGMAEPLQRVWIALRVNIRAVLENVSIEQIAADRLP
                     EFVDALTADPGAWARR"
     CDS             269248..270984
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2630"
                     /old_locus_tag="nfa2630"
                     /product="putative ABC transporter"
                     /protein_id="BAD55105.1"
                     /transl_table=11
                     /translation="MLIRLLRTYLSPYRAQLAGVVALQLVSVIAMLYLPSLNADLIDN
                     GVTKGDIDYIWHTGLWMLAVTAVQIVASASSVFLGAQAAMSAGRDLRAALVHRVGTFS
                     AREVGLFGAPSLITRNTNDVQQVQLLVVMSVTVLVMAPIMCVGGIIMALREDLKLSWL
                     LLIAVPALALAMGLVVARLVPGFREMQARIDVVNRVLREQITGIRVVRAFVRERQETW
                     RFGLANTDLTEASLRVGRLMALMFPVVMLISNVTTVAVIWFGGHLIDDGELQIGSLTA
                     MLSYIMQILMAVMMASFLAMMAPRAAVSADRIGAVLTTESSVVPPEFPKPFAGDPGRV
                     EFAAAEFAFPGAEKPVLRGIRFTVEPGTTTAIVGSTGAGKTTLLNLIPRLIDVTAGAV
                     YVGGTDVRELDMELLREQIGLVPQKAYLFSGTVASNLRYGRPDATDEELWRALEIAQA
                     ADFVRDMPQGLETPVAQGGTTVSGGQRQRLAIARALVRRPRVYLFDDSFSALDVATDA
                     RLREALRPETRDASVIIVAQRVSTIRDADQIIVLEDGEMAGIGTHEQLLRDCAEYQEI
                     VASQLSAQEEVR"
     CDS             270981..272900
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2640"
                     /old_locus_tag="nfa2640"
                     /product="putative ABC transporter"
                     /protein_id="BAD55106.1"
                     /transl_table=11
                     /translation="MRPGGPVPGAPDAKPKSFKPSLKRLLGRLAPERFYVWCIVVLAI
                     VSVVLNTLGPYLLGKATNIVFDGVVGKNLEQMRGLSKEEAVERLRDSGNDTLADMLSA
                     MNVVPGVGVDFTAVGRVLLVVLALYLAAALFSWLQAYLLNIVINRTVKRLRSDIEDKI
                     HRLPLRYFDSQPRGDVLSRVTNDVDNVSQSLQQTMSQLLMSVFSVLGILIMMFWISPL
                     LAVIALLTVPAAIVVTAQIAKRSKPHFVNQWKYTGLVNAQVEEAYTGHEVITAFGRNR
                     EVGEEFDQRNDKLYESSFKAQFISGLIMPSIMFLGNVNFVLVALVGGLRVATGQLSLG
                     EVQAFIQYSRQFSQPLTQIGTMVNLLQSGVASAERIFEILDAEEQSPDPQLPDVRPLD
                     RGRVEFEAVSFRYEPDKPVIERLSLVAEPGHVVAIVGPTGAGKTTLVNLLMRFYELDA
                     GTITIDGVDITRMSRDALRSRIGMVLQDTWLFRGTIRENIAYGNPNASEEEILAAARA
                     AYVDRFVHALPDGYDTMIDEEGSGVSAGEKQLITIARAFLAKPSILILDEATSSVDTR
                     TELLVQQATAALRRDRTSFVIAHRLSTIRDADLIVVMEAGRIVEHGTHQRLLEERGAY
                     YRLYNAQFAAAAAEA"
     CDS             272952..274211
                     /codon_start=1
                     /gene="tgt"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2650"
                     /old_locus_tag="nfa2650"
                     /product="putative tRNA-guanine transglycosylase"
                     /protein_id="BAD55107.1"
                     /transl_table=11
                     /translation="MRTVVAAETSSGFSFTVGTRLDGGRHGRTGVIRTPHGEIATPAF
                     VPVGTKATVKAVLPETMRELGAQALLANAYHLYLQPGADIVDEAGGLGAFMNWPGPTF
                     TDSGGFQVMSLGVGFKKVLAMESVGVANDDVIAAGKERLATVDDDGVTFRSHLDGSTH
                     RFTPEVSMGIQHRLGADVMFAFDELTTLLNTRGYQEKSLQRTHEWAQRCIDEHERLTA
                     ARTHRPYQALFAVIQGAQYEDLRRKACRDLEAIRGAAGTAFDGYGIGGALEKHNLGTI
                     VGWCSDELPEEKPRHMLGISEPEDLFVAVENGADTFDCVNPSRVARNAAIYRGDGRFN
                     INTSRYRRDFTPIDEDCDCYTCANYTRAYLHHLFKAKEMLAATLCTIHNERFTVRLVD
                     RIRASIDGGYFDEFKAETLGRWQGGRR"
     CDS             complement(274230..275012)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2660"
                     /old_locus_tag="nfa2660"
                     /product="hypothetical protein"
                     /protein_id="BAD55108.1"
                     /transl_table=11
                     /translation="MGPVSHSNRTEEYEGSGRPASDQVAFAQVARGYYPLIVALFTAT
                     LIISNICATKGVEFFGDRSVTLGPLQILPIVTDGAFFLFPLAYVLGDVLSEVYGFRAT
                     RRAIYYGFGALLLTVLCFAVALELPAAGFYENQEALRSVIGPVPRLVIAGLAGYFVGQ
                     MLNSATLVLIKERTKEKHLWARLIGSTVVGEFADTLIFCSIAAGAIGIETWEQFVNYV
                     VVGFLWKTLCEVLVMPITYRVIGLLKKHEPTYAPVAGDPLRS"
     CDS             275042..275578
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2670"
                     /old_locus_tag="nfa2670"
                     /product="hypothetical protein"
                     /protein_id="BAD55109.1"
                     /transl_table=11
                     /translation="MTNPGDSDEWWKQYGGEGVSPDSGASSSVPQYPTSGPSGYPSAP
                     QYPQQPPQYQQPQYQPPQPQYPQSSGPSYPQQPGYGYPQAGGYQPYGAPPSGGLNGMA
                     LASMIVSIAGVASCCFIVPSIVGLVLGVVAMNQMKTSGDYNGKGMAQAGIWVGAAGAV
                     LGIVYWVLNIAIGFSAGM"
     CDS             complement(275643..276362)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2680"
                     /old_locus_tag="nfa2680"
                     /product="hypothetical protein"
                     /protein_id="BAD55110.1"
                     /transl_table=11
                     /translation="MTSGGYDPNQNPQGGQPYGQPYPQGGQPYGQQPFGKDPYGQQPP
                     QYGQQPQYGEQPPYGQQPQYGQQPQYGEQQPYPQNPYGQQAYGGYGDPGLGGAQPGDL
                     GSRIGARVIDHIIVSIPALIFSFVFANSSTGIGTQLVVSALLAFVPIGYFVLMETTQG
                     FTLGKKLLGLRVLAPGGAPKIDPATSFKRNLYVITNLIPCVGWLVSIGLAIYIMITIE
                     QDPNKQGWHDKFAGGTQVVKG"
     CDS             complement(276415..277350)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2690"
                     /old_locus_tag="nfa2690"
                     /product="putative aminoacyl-tRNA synthetase"
                     /protein_id="BAD55111.1"
                     /transl_table=11
                     /translation="MADVQAPTIGGAGRYAPSPSGDLHLGNLRTALLAWLFARASGRR
                     FLLRVEDLDRVRPGAQQRQLADLRAIGLDWDGPVVCQSQRRTRYEAAITRLREAGLTY
                     ECYCTRREIQQAATAPHGPLGAYPGTCRDLSDADRAERRAQGRPAALRLRAERTDFEI
                     VDQLHGRYRGPVDDVVLRRGDGLPAYNLAVVVDDAAQGVDQVVRGDDLLPSTPRQAYL
                     ATLLGLPVPAYAHVPLVLNKDGQRLAKRDGAVTLADQQRAGKSPEQVLALLTDSLGLP
                     PRPPRELLADFDPARLPREPWILTDNGLLQPSECP"
     CDS             complement(277343..277927)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2700"
                     /old_locus_tag="nfa2700"
                     /product="hypothetical protein"
                     /protein_id="BAD55112.1"
                     /transl_table=11
                     /translation="MIDAHGRRPRHRLARPGRTTWIMDVMVERPRDEAGRARNPRPRD
                     RLGRPLPLGSTGVPRIPDDLELPPEQSLSYAQQLLDDGLAFNAHEVLEAAWKNGPFAE
                     KMLWQGLAQYAVGITHIQRGNAKGARTLLTRAIGRLEAYLRGDSSQPPRADYPYGVDG
                     RGLIEHGRALLAALDAGTELTAADLAPRLCTYHG"
     CDS             278579..280021
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2710"
                     /old_locus_tag="nfa2710"
                     /product="hypothetical protein"
                     /protein_id="BAD55113.1"
                     /transl_table=11
                     /translation="MNQAAVNRVAPQDAIMFWLSRRSRNDLFLLYSFADRGRPTAELR
                     AALLTRARRIPDLAVRLREVPGDLNYPAWVPCAVLDSQIVEHRGAADWPGLESAVGEL
                     LGTGVDAAERPWRVHLFRGVGGAPGPAPDGETATVVVLQISHALADGRRAAAIARELF
                     GAGEDPAAGARWREGHPGAAQADRPGASGGTASPPAAPAPWAGDVVPAVLGALLLPVH
                     IVRTVFRGYRAFRAQRALAESTAAGAVPPPTPGFAPNPLNPAAVPTAHAVRMLVFAAA
                     ELRVPGRTVTVVVLTAVSVALSEYLAAQGHPVERLGAQVPMGSARNGKRLPRNNYRNL
                     SIDLAVDEPELSARADRIAAALRAGRERAGHPLTSAQDLVTAVTPAVFLHRDVRRWPL
                     DLVPDSIAGHTVVSSVDRGPADLHFGGPVRFTAGFPAIGSVMHLTHGVHGLGETVTVS
                     IHADPAAVGDLDGYAAHLRAAVTGVVAALR"
     CDS             complement(280150..280797)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2720"
                     /old_locus_tag="nfa2720"
                     /product="hypothetical protein"
                     /protein_id="BAD55114.1"
                     /transl_table=11
                     /translation="MTQWLPVLSSLIVAGAALIGFAVNNRTNRRAIEAADERHRETLE
                     EARRGMELAHTAGERREHDKWRHEAVVAAVSSVLETSNSVRQQLWSCHRWEVDDNFEL
                     ERVGADIHEALWGCNGTINRLRLLASPKIPNQCEDLLSTLGAARNITLQYLKLQLDDE
                     ATSEEFTEINSLWEKAIRKAIEQERAVVNATRAELGIERLEDVAKPARQPVLDTA"
     CDS             280956..281888
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2730"
                     /old_locus_tag="nfa2730"
                     /product="putative acyltransferase"
                     /protein_id="BAD55115.1"
                     /transl_table=11
                     /translation="MTRQHQPENGPAHTAAARGWDLAYAAGWRLVRALPERWAMWLFL
                     AAADRAARDGGPAQLRRNLARVLAVAPDRVPDDLVRASLRSYARYWCEAFRLPSMDPV
                     RLAERIENSATGLDHIHDAVAGGRGVILALPHSGNWDLAGVWLVQRVGTPTVVAERLA
                     PESLFRRFVRFRERLGFEIIPLTGGATAPFEQLAVRLRQGRVVGLLGERDLTATGVPV
                     SFFGEPARMPAGPARLAIDTGAPLLPVHCWFTPDGWGFSVGAPLDTGGGVQPTTQALA
                     DHFAAGIAAHPADWHMLQPLWTADRRRREHRPGT"
     tRNA            complement(281943..282033)
                     /gene="serW"
                     /inference="profile:tRNAscan-SE"
                     /locus_tag="NFA_80090"
                     /old_locus_tag="nfa80090"
                     /product="putative tRNA-Ser"
     ncRNA           282143..282231
                     /gene="crn"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_70200"
                     /ncRNA_class="scRNA"
                     /old_locus_tag="nfa70200"
                     /product="putative small cytoplasmic RNA"
     CDS             282453..283742
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2740"
                     /old_locus_tag="nfa2740"
                     /product="hypothetical protein"
                     /protein_id="BAD55116.1"
                     /transl_table=11
                     /translation="MPRQTQIGLMSRDELVSEHETQSANYAKLKTEKLTLDLTRGKPS
                     PEQLDLSAALLSLPGDGDYRDGTGTDCRNYGGLHGLPELRAIFGELLNIPVDNLLAGN
                     NASLELMHDVITYAMLYGTNDSERRWADEPVLKFLCPAPGYDRHFAITEALGIEMIPV
                     PMLHDGPDTHKIAELLAADPAIKGLWAVPNYSNPTGVVFSEEVVRELVSMPAAAPDFR
                     LFWDNAYAVHPLTDTAAPVYDVLGMAAEAGHPNRPIVFASTSKITFAGAGVSFLGGST
                     ANLEWYLGHAAKKSIGPDKINQLRHLRFFGDADGVRAHMQKHRAILEPKFALVRRILE
                     DRLGASKVASWTEPKGGYFISLDVLEGTASRVIALAKDAGIALTAAGSAFPYRKDPED
                     KNIRIAPSFPKLPELEKAMDGLATCVLLAATEKLLEK"
     CDS             complement(283748..284185)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2750"
                     /old_locus_tag="nfa2750"
                     /product="hypothetical protein"
                     /protein_id="BAD55117.1"
                     /transl_table=11
                     /translation="MQVDVRTEIVIDRPPSTVAAYAADPANVPRWYANIHEVRWVSEP
                     PLRTGSQLEFAAQFLGRRLVYTYEVTEYVPGSLLVMRTARGPFPMETSYTWEPTAAGT
                     RMTLRNRGEPAGFSRVLAPVLESAVRRANRADLARLKAELEAE"
     CDS             complement(284199..285047)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2760"
                     /old_locus_tag="nfa2760"
                     /product="hypothetical protein"
                     /protein_id="BAD55118.1"
                     /transl_table=11
                     /translation="MSSTTATPMDGHVRMDSYGLRPDRFDSAGQDQLVDVRDLQAALP
                     GIQRLRTWAHQALAVRPGERAVDIGSGTGSEVFAFARAVGPTGEAVGVEPDPNLLAAA
                     ERRAGEQGVSAKFHSGDAYGIPFGADYFDAVLSERVFQHLTAPARAASEIARVLRPGG
                     RTVVMDVDWDTAIIHPGDRRVVRQVVETLISATTNPLSGRRLPGLLTQAGLVIDEIGS
                     HALIQDRAVGPGSLVDRISAMAVARGAISEKERDELLAGLERGARTGDIHLSVTMFAV
                     LAHKPS"
     CDS             285207..286199
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2770"
                     /old_locus_tag="nfa2770"
                     /product="hypothetical protein"
                     /protein_id="BAD55119.1"
                     /transl_table=11
                     /translation="MKFPHVALGRARLSGAACVVTLRYRLRPLTAQLGVVAVSAVALV
                     GVLPTLTAPAQAGPLAPMLEAPGRDQRPLDLAHAPNARDIGGYPVRGGGKVRFGVVYR
                     ADALAELDGAEQQRLVDLGVQQVIDFRSPTEVAQAPDKLPAAIRRTEYPVYDANNDLY
                     VLMSRLIAGGPQAQREALGDGKGVQYMSDYYRWLVTDASARGQFAAALRDIAGAPGAV
                     LYHCTAGKDRTGWMTAILFSVLGVPDGQIYQDFLASNANLAAGNKALLDNLVAQGLVE
                     DPELWEPILGVQREFLDAAFDQVRRSYGSMDEFLTAGLGLDTATLDALRSALVG"
     CDS             complement(286408..286860)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2780"
                     /old_locus_tag="nfa2780"
                     /product="hypothetical protein"
                     /protein_id="BAD55120.1"
                     /transl_table=11
                     /translation="MAVNWTLTVDSRDAPVLADFWAAALGYQVEDPSPLIEQLLAAGH
                     LPPDQVAEHRGGKIFRGYAAIRHPDDPFDPVSGIGRGRRLLFQDVPEHKSVKNRMHPD
                     LDAGPEGRDAMVERLEGLGAERVREVDMGPAGHWWVMQDPEGNEFCVA"
     CDS             286941..287522
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2790"
                     /old_locus_tag="nfa2790"
                     /product="hypothetical protein"
                     /protein_id="BAD55121.1"
                     /transl_table=11
                     /translation="MTVTLCLAQEPEADKLLSEDPFALLTGMLLDQQYPLEHAFRGPR
                     KIAERMDGFDIRRIAEADPQEFEELCATPPAIHRYGRSMARRTQDLARYVLEHYDGDT
                     TRIWSEGDPDGATVLRRLEDLPGYGKQKARIFLALLGKQLGVRPKGWEKAAGDYAEPN
                     SRRSAADITDGQSLLEVRAFKKQTKAQAKAAAG"
     CDS             287633..288349
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2800"
                     /old_locus_tag="nfa2800"
                     /product="hypothetical protein"
                     /protein_id="BAD55122.1"
                     /transl_table=11
                     /translation="MRKSKLAVIAALVSIATGVAAGTAGAAPEAPAPEAVNFTAQSTD
                     TQSIITTDAGSLVVEDEVFKIKASDGTVLAGTPLRFRIDDFEFPIAADISGRTATLTP
                     QFDREHAVYKPVALPFEDKAPWKSEYDREVAAWTRLTNTISMGATIGTLVGGLGGAAV
                     GCVLGGIAGATVASATIVGLFGPFIPAAAIGCLGGIIAVGALGTVAGQLLVTAPVAIA
                     AAIQYFTTINQPFNAPAPAK"
     CDS             288707..289972
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2810"
                     /old_locus_tag="nfa2810"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55123.1"
                     /transl_table=11
                     /translation="MSIPTLERSVARVAPARVRTPRPVLPPELRISDNPAAAVLRAAT
                     GGPVSRDNAARTTGLSIATVNRQVSALLAAGLLRERPDLTTPGAVGRPRVPFEVDHDS
                     YLTLGIHIGAAATKIVAADLRGRIIGGLAIATPQTGQDFATTTIARSAKAFLRRWHRR
                     RALWAGVAIGGRVDPVSGSVDHPALGWQGAQLGAVLAEVLELPISVAPHVEAMAASEL
                     LLPTPQPDRAHERGAGLFFYVRETAGVAVTLDGRVHTPSNGPGSIAHLPTGSDVVCAC
                     GRTGCLEATVGDRALVARAVGRGIIPAHNGTGGSTIADLHRAAAEGSTAAHELLVERA
                     TILGNAVALVSDMLNPDRVILGGQAFTGYRPGVAHVAKAFRSASALPPTDIRISGFGG
                     KVQEFAAVVASLSALYADPLAAMRRLAVD"
     CDS             complement(289995..291611)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2820"
                     /old_locus_tag="nfa2820"
                     /product="hypothetical protein"
                     /protein_id="BAD55124.1"
                     /transl_table=11
                     /translation="MLTFRGAAASALLLAAAASVAAAPVAQAQPAPAGVVITADLVLD
                     REGVLRVEETVSVPEGAEFRMSLPLRLQVEPDVERRFRVTDVETGGVGSATTADDRFT
                     LVAPPGESTFRYAVHNTVGDAPSSQVFHWLGVVDTDIAAISAALVAPSYELAIVDCTL
                     GPPGNTRPCADVRTEAIGVLHLEQTDLRKGDAIDLTVQLPPGTVPANADVIDHSGPGP
                     FSLSGPVLAAFGALLALLAGLAALVWRARRDNAAATTGSEVFDPLAREDGQVRFTAPD
                     GVLPGEAGLLLDEHVDPVDIAATVVDLAVRRYLWVTQIADNDWRITRVNAPDDQLRDY
                     EKAVYTALLPDGVDAVTMGELRGRVQAGPVRAAMIADAVARGAFVDRSRPGPAVWLGG
                     ALVVAGLAATVGLAVTAGYALVGVAILLAGVALVLLPKYLPARTAAGSRIAGRVRALQ
                     RGLDATRPEQIPPTDQETVFSRALPYTVVGGRADNWVRAFRQLNPAADAQPGLYWFGG
                     YERDRDLHRFAAHFPYFITALEGLFSETSH"
     CDS             291941..292864
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2830"
                     /old_locus_tag="nfa2830"
                     /product="hypothetical protein"
                     /protein_id="BAD55125.1"
                     /transl_table=11
                     /translation="MPPPMPYGPPGRAPMPPRKRGGGRVLALLLVVAVVIVGGLVRAA
                     IRFDGSEHRATGPDPSFTYTPDGSPGVSETATNPLLTDPDATLLPADCDYAPWGTQVD
                     TARRFFESAAACLEDAWQPVLAQVNLPFTPPALNVSATTAGISTPCTGSTTNFAAFYC
                     PANKTIYLPISQLQTDLFKDNWVIYLSVFAHEYGHHVQAMSGILRKANSERVDAGTRS
                     ERGLELSRRIELQAQCFDGMYLGSAQDGGALTTAQIGLAVRDAGGRGDGPTDSPDHGS
                     PDNSGAWFELGVEHNRTAQCNTFSAPAAAVG"
     CDS             292915..295392
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2840"
                     /old_locus_tag="nfa2840"
                     /product="putative DNA polymerase III gamma subunit"
                     /protein_id="BAD55126.1"
                     /transl_table=11
                     /translation="MALYRKYRPATFAEVVGQEHVTEPLSTALDTGRINHAYLFSGPR
                     GCGKTSSARILARSLNCEQGPTSTPCGVCASCVALAPGGPGNLDVIELDAASHGGVDD
                     TRELRDRAFYAPAESRYRVFIVDEAHMVTTAGFNALLKIVEEPPAHLIFIFATTEPDK
                     VLPTIRSRTHHYPFRLLPPATMRGLLGRICEQEHVTVEEAVYPLVIRAGGGSPRDSLS
                     VLDQLLAGAGPEGVTYHRAVALLGVTDVALIDDAVQALADDDGAALFGTVDRVMEAGH
                     DPRRFAVDLLERFRDLILLRAVPDAVERGLVAGPEDVLDRMREQAERIGPATLTRYAE
                     LLHEGLGEMRGATAPRLLLEVVCARMLLPAVSDAESATLQRLERLERGMAGGVFTPPT
                     APHPSGEAGPAVPRPGNEPPRRRGAEALAALKQSKAMDDEGAAGSPRRAAQAAASAET
                     GSDPVGRAPASTGGAAPAGERQPGDAEPNPQTGAGTVEPGPEAAAAPISARAPQRAEA
                     VDVRRSDAANIASDVAGEPARASDDRSPDAAEVRAPGDGDSGATSRPEVGRAIPAHPN
                     GAADRVPESAGAQSDPSDHRLAEPASAVRDDELLRAVEGAWADIRAKVREYSATMQAM
                     LSGASVARIEGSAIVFAHPSPVLAGRLSEPRNIDAVRAAVRAVLGHDHEIRWESGAAV
                     KPAPAANRGKAGGAPANRGGQARGQGAARFSRPSQAGGAAAAEAAGRAKRSAPGGDDD
                     IPPPDYPDLPDDPGPGDYPPPDPAQTDGADGGYPPAAVPGPLTAEEEQEMLAEAARPV
                     APEDRRDPDEVALELLRAELGATRLDG"
     CDS             295650..296864
                     /codon_start=1
                     /gene="fadA"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2850"
                     /old_locus_tag="nfa2850"
                     /product="putative acyl-CoA thiolase"
                     /protein_id="BAD55127.1"
                     /transl_table=11
                     /translation="MTTEAYIYEAIRTPRGRGKKNGSLHSVKPIDLTVGLIQELRSRF
                     PNLDEDRISDVILGVVAPVGDQGADIARTAVTVAGLPDTVGGFQLNRFCASGLEAVNL
                     AAQKVRSGFDDLVIAGGVESMSRVPMGSDGGAWALDPATNYDTYFVPQGVSADLIATI
                     EGFSREDVDAYAVRSQELAAKATTGGYFAKSIVPVKDQNGLVVLDRDEHMRPGTTLED
                     LAKLQPSFAMIGEMGGFDAVALQKYHFVEKINHVHHGGNSSGIVDGAALVLVGSEEAG
                     KASGLTPRARVVATATSGADSTIMLTGPTPAAKKVLAKAGLTLDDIDLVEINEAFASV
                     VLKFQKDLNIPDEKLNVNGGAIAMGHPLGATGAMITGTMVDELERRNGRYALITLCIG
                     GGMGVATIIERV"
     CDS             296904..299054
                     /codon_start=1
                     /gene="fadB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2860"
                     /old_locus_tag="nfa2860"
                     /product="putative 3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="BAD55128.1"
                     /transl_table=11
                     /translation="MSETNMIGWEKDSDGIVVLTMDDPNQGANTMNELYKKSMTATVD
                     RLEAEKDDITGVVLTSAKKTFFAGGDLKNMMKVGPDDAQALMAELTEIKSALRRLEQL
                     GKPVVAAINGAALGGGLEIALATHHRIAADVPGSQIGLPEVTLGLLPAGGGIIRTVRM
                     LGLQNALMQVLLQGQRNKPAKAKEIGLVDELVGSIEELVPAAKAWIKANPDAGVQPWD
                     KKGFKIPGGTPASPGFAANLPAFPANLRKQLKGANMPAPRAIMAAAVEGSQVDIDNAS
                     LIESRYFVHLLTGPVAKNMIQAFFFDLQAINNGGSRPKDVPKREIKKVGVLGAGMMGA
                     GIAYVSAKAGYEVVLKDVSLEAAERGKGYSEKIEAKALSRGKTTEEKSKALLDRIKPT
                     ADAADFAGVDFVIEAVFENTELKHKVFQEIEDIVTPDALLGSNTSTLPITGLATGVKR
                     QEDFIGIHFFSPVDKMPLVEIIKGEKTSDEALARVYDYTLAIKKTPIVVNDSRGFFTS
                     RVIGTFVNEAIAMLGEGIEPATIEQAGSQAGYPAPPLQLSDELNMKLMLKIAKETEEA
                     IKAGDTKLGTERHPAIDVIEWMVGEGRPGRLEKAGFYEYDENGKRLGLWQGLREHFKT
                     TAGFDVPLQDLIDRMLFAEAIETQKCFDEGVLETTADANIGSIFGIGFPAWTGGVHQF
                     IVGYPGGQEAFVARADELAEKYGQRFQVPASLRK"
     CDS             299431..302868
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2870"
                     /old_locus_tag="nfa2870"
                     /product="putative serine/threonine protein kinase"
                     /protein_id="BAD55129.1"
                     /transl_table=11
                     /translation="MEIGRGGFGVVYRCLQTALERVVAVKVLPPDMDAESRERFLREE
                     QAMGRLSGHPNIVDILQVDVTASGLPFIVMPYCTHGSLEQLIHEQGPLGWADTLRVGV
                     KLAGAIESAHRAQILHRDVKPGNVLLSSYGEPQLTDFGIARIPGGFRTSSSMITGSPA
                     FTAPEVLKGEEPTVRSDVYGLGATLFALLTGHAAFERQAGEKVVAQFLRITTQPVPDL
                     REQDIPAPVAEAIERAMSPDPQQRPESAFEFGEMLRAAQRALGQLPDEMALLDTAVLL
                     DDLGEVRATEPHPSIRTQFSTRARPSVTARRSWPLTLRPNVSQHPPGATSTTPPPTAA
                     TKFRPPTPARAPVPRPRLLEVLRAGGRRRLALIHAPAGFGKSTVAAQWRAELTDQGVP
                     VAWIGLDHDDDNEVWFLAHLLQAIHRVRPAIGAGLDQALEERPADAVAFVISTLIDEV
                     HAGGETIVVVIEDWHRITDPGAHRAMAALLDNGCHHLRFVVTSRDQSGLPVNSMRVHD
                     ELVEIGSAQLRLTRAETGQILVERNGFELTDKQVEQIHRVTDGWPAAVQLVSLALRGN
                     PDPQRLISALPEGGHGIREYLAENVLDTLEPRMLDFLTAISVTERVNASLAAALSEDS
                     EAELLLAQAEQRELFLRRIEHDPEWYRMQPLFAEHLRARLERTDAAKLRALHRKASRW
                     YAEHQFLRKSVDHALAATDLKLALDLVEGGGMDLIDGSRLATLLGTVSKLPVQQVTSR
                     SKLLMAVARANVNLQQSGAARSALGKLTNMLPGGSGEDETNRQRCEAAVLAAADAVTR
                     DQTDGVLDQVADCLDNPDDLPAWTVSTAANVVSYVRLCTFDFDGARQIQEWAQPYHEK
                     SKDPLGTVFGLCAQGAAAYEQLDIPGANDYFERAWEVAHSRAGPRSHGVRVASAMLGE
                     LKYRAGDLATADRLLDESHQLVTRVGTVDFLLATFVTGARVKAVRGDLATAAARLEEG
                     ERIAREYELPRLGAHVRAERLRLGLPVEPATESGPGPGLRRATGVAALIAEAEETAAV
                     RAMLAARPSHTDDAPVRRARALYGRTTEQGRPRAELDTALLLAETLAASGWVGEATAM
                     LVPAAQVCARLGWPRPLLDAGPRVVAILRVLRGELHLSPENADETRLPTHFLDEVLG"
     CDS             complement(302879..304195)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2880"
                     /old_locus_tag="nfa2880"
                     /product="putative cyclopropane fatty acid synthase"
                     /protein_id="BAD55130.1"
                     /transl_table=11
                     /translation="MTTFKDRSDVFADLGTKLSIAEIFETLIDGEVPIRLTAYDGSST
                     GPADSRYSLDIRTPRGINYLATAPGDLGMARAYISGDMTAGGVHPGDPYEALKALQNM
                     RFRRPSALALVTIARSLGWERLKPVAPPPQETLPRWRRIAFEGLRHTKGRDAEAIHHH
                     YDVSNTFYEYVLGPSMTYTCAVYGDENWTLEQAQENKYRLIFDKLRLKEGDRLLDIGC
                     GWGGMVRYAARRGVRVIGATLSAEQADWAQKKIAEEGLGDLAEVRHCDYRDVPETDFD
                     AVSSIGLTEHIGVHNYPFYFGYIKSKLRDGGLFLNHCITRPDNTRSTKAGDFIDRYVF
                     PDGELIGSGRIISDIQNVGLEVLHEENLREHYALTLHEWCKNLVANWDACVAEVGEGT
                     AKVWGLYMAGSRLGFQRNVVQLHQVLGVKLPADGDWTVPLRPWWQP"
     CDS             complement(304192..305649)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2890"
                     /old_locus_tag="nfa2890"
                     /product="hypothetical protein"
                     /protein_id="BAD55131.1"
                     /transl_table=11
                     /translation="MAVSLGKAGHTPAARESGYAAHRAGVDRLLASYRAIPPEATVRL
                     AKKTSNLFRARAANPAPGLDVSGLTRVIAVDPEARTADVAGMTTYEDLVATTLPYGLA
                     PLVVPQLKTITLGGAVTGLGIESTSFRNGLPHESVLEMDVLTGAGEILTVTPDGEHAD
                     LFRGFPNSYGTLGYTVRLKIELEPVPPYVALRHVRFHDLRELEAAIAAVVEDRSYDGE
                     RVDYLDGVVFTATESYLTLGRQTDEPGPVSDYTGMDIYYRSIQHDSPHPKRDRLTVHD
                     YLWRWDTDWFWCSRAFGTQNPKIRRFWPKRYRRSSFYWKLVALDHKYHIGDKIEARKG
                     NPPRERVVQDIEVPVERTADFVSWFLREIPIEPIWLCPLRLRAEGPAVSGAGAAGTRA
                     WPLYPLERDRTYVNVGFWSAVPTVPGQPEGAANRAIERTVTEFDGHKSLYSDSYYDKD
                     EFAALYGGDSYTELKKRYDPDQRLLDLYSKAVQRK"
     CDS             305840..306274
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2900"
                     /old_locus_tag="nfa2900"
                     /product="hypothetical protein"
                     /protein_id="BAD55132.1"
                     /transl_table=11
                     /translation="MGQVSASSSITVAADPKRALEAIADYETVRPRILSAHYRDYKVV
                     EGGKGAGTVAEWTLQATQKRARNVRAVVSVSDSIVTERDANSSLVNTWTVTPEGAGAR
                     VTLRTAWQGAGGVSGIFEGIFAPLGLKKIQAEVLENLKRELG"
     CDS             complement(306293..306640)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2910"
                     /old_locus_tag="nfa2910"
                     /product="hypothetical protein"
                     /protein_id="BAD55133.1"
                     /transl_table=11
                     /translation="MSLSIAAVTFDCTDAAKLAGFWSELLDRPVDPEANQYFASIGRG
                     SGGQALMFIQVPDRTPGKNVIHLDLHADDRQAQVDRALALGAEHRGEFDEYGVRWTTL
                     ADPEGNLFDIAAE"
     CDS             complement(306668..307483)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2920"
                     /old_locus_tag="nfa2920"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55134.1"
                     /transl_table=11
                     /translation="MTATVTIGEFARLSHLSVKTLRYYHDIGLLAPAEVDRDTGYRRY
                     GTDQVDRAHLIRRLRELDMPLPEIRAVLAASDTAARDATLRAHLARMEAELRRTAQVV
                     ASLRALLTPADPLPVEYRELPAVRALALREVVTKDDIDLWCAAAFPRLYAALAGVGVA
                     PAGPAGATYALEFFAEDAGEVTAFVPVDPALALEPPHGLTMLDLPARHVAIAVHRGPF
                     EDFDRTYGALGSHVAEHDRALPEPVREIYLVGPGDTPDPENYRTEVCWPVSRS"
     CDS             complement(307542..308120)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2930"
                     /old_locus_tag="nfa2930"
                     /product="hypothetical protein"
                     /protein_id="BAD55135.1"
                     /transl_table=11
                     /translation="MSANRLLFRGVLALALSLPALFLGAANAAADADVRTVAADYGGG
                     CVLYPDNKAATLDSLRLRCSPEQQDAIFRDAPAGAVPTGVTNGWVVRPVYVQGIAPAF
                     WVGKTFYTGPDGGFLMNRVTGAGLEAWRADVYRAPSLMDGEEAWALNYNPSPTPPLYD
                     EIREVTPGVWLGYSWWRGFFQTTLLLTFALAN"
     CDS             308250..308582
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2940"
                     /old_locus_tag="nfa2940"
                     /product="hypothetical protein"
                     /protein_id="BAD55136.1"
                     /transl_table=11
                     /translation="MQPGGQFDMQQLLAQAQQMQEAVMQAQAEIAATEVEGQAGGGLV
                     KATIKATGEVQALTIDPKVVDPEDVEGLQDLVIGAINDAMARAQQLAAERLGPLAGGG
                     SMPGLPGF"
     CDS             308598..309206
                     /codon_start=1
                     /gene="recR"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2950"
                     /old_locus_tag="nfa2950"
                     /product="putative recombination and repair protein"
                     /protein_id="BAD55137.1"
                     /transl_table=11
                     /translation="MYEGPVQDLIDELGKLPGVGPKSAQRIAFHLLQVEPPEIDRLQA
                     ALQKVRDGVQFCVVCGTVSDGELCRICADPRRDRTMICVVEEPKDVQAIERTREFRGR
                     YHVLGGALDPLSGVGPDQLRIRELLARIGNQDDGVDVAEVIIATDPNTEGEATATYLV
                     RMLRDFPGLTVTRLASGLPMGGDLEFADELTLGRALSGRRAL"
     CDS             complement(309323..310948)
                     /codon_start=1
                     /gene="recQ"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2960"
                     /old_locus_tag="nfa2960"
                     /product="putative ATP-dependent DNA helicase"
                     /protein_id="BAD55138.1"
                     /transl_table=11
                     /translation="MTTAARLRRIAEQTFGLPHLYDEQLRAMELVLAGHDVLAVLPSG
                     GGKSAIYQVPALLLDGPTVVVSPLIALQHDQMEGIEETDAPPAVALNSAQRGRARREA
                     WAALRRGDARYVFLSPEQLAKPEVVDALAELGVALFAVDEAHCISAWGHDFRPDYLRL
                     GEVRERLGGPRVIALTATAAAPVRRDIVERLGMRDHREVVTSFDRPNLFLAAHRFTSE
                     ADKHAAALARVGELAAENRCGLVYTASRSGADRFARDLAGTGVRTARYHAGMKAADRE
                     RVHQDFLADTVDVVVATSAFGMGIDKPGVRFVVHASVPDSLDSYYQQIGRAGRDGEPA
                     RAELYYRPEDLSLQRFLTTNKPPADTLEAVARALARHPLPPRRLAEAVDAPPARRTRA
                     INLLEQIGALTTTADGRLGFTTDLTPDEAADQAHRAADAHETLIRSRLDMLRGYAETT
                     DCRRRFLLEYFGERLPQRCGNCDTCAAGTAERRTGEAADFPADARVTHPEWGAGVVLS
                     AHEDHLTVLFDDYGYKTLSLTQVRERDLLTRID"
     CDS             complement(311039..312523)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2970"
                     /old_locus_tag="nfa2970"
                     /product="hypothetical protein"
                     /protein_id="BAD55139.1"
                     /transl_table=11
                     /translation="MTDRPAHDAADRAREQRHSLVLALKGAQLSMEELWLESFALSGT
                     LGFPQINAYVRGGDSLPALDRDILAQVVNEHLDRRSSTKRATYSRTLRESEPTGGPLS
                     ALVELLEGAHGAPPERLPALAAAAGRALGVHIEMYLIDYGQRRLLRADEPGGDSGYDI
                     GTTLPGRAFRFVQTLPSYAPDLPRLWMPLLDGNERVGVLDIQVADPEDLADPRLRAQC
                     GWVSKLIGHLVSVMTGYGDGLERVRLRAARSPNAELIWSMLPPLTAVVDGFVIAGVVE
                     PRHDLNGDAFDYALSGTTAQLIVLDAVGHDAQSGLIAATALAAYRSVRRAGHGLFEQA
                     RVIDEAIATQFGNSKFATAVLAELDLGTGRLRYINAGHPEPMIMRGGKMVKPLPGGRR
                     MPLGLGSGDLTVGEEVLQPQDWLLLYTDGITEARDPDGAFFGETRLFDFLRREAASGH
                     PPPETARRLINAVLTHQRGTLQDDATVLLARWTVPAVADPVSRR"
     CDS             complement(312539..313309)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2980"
                     /old_locus_tag="nfa2980"
                     /product="hypothetical protein"
                     /protein_id="BAD55140.1"
                     /transl_table=11
                     /translation="MAPESRSAPVTGTIADAVQAQPAVDQLVAAFARMSGFFLTAGTA
                     GTALKLITSLATEMVAPTSGAGISMLDGSGARMTAAATGEVVEEADSLQYQLGAGPCL
                     TAWADRVVVRVDDFGTDQRWPEWSRRAARLGLASSLSAPLVAGTQALGAIKIYGARPG
                     ICGQREEHLLSMFSSQAAMLLAHMRAADDAERVSGLIAESLRGRDVINLAKGIIMARD
                     RVDERGAFLILASTARNQNVPVRRVAERVAMSTVPRRR"
     CDS             complement(313404..314051)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_2990"
                     /old_locus_tag="nfa2990"
                     /product="hypothetical protein"
                     /protein_id="BAD55141.1"
                     /transl_table=11
                     /translation="MNYDHVLLPSGAATTLSEVDAYLTAQQGLPQSAAVAAMAGQINE
                     RNAALPEEDAFLADNAEVGGGPTGDVLHVACPYDAIGHVRALLFELATPRGYAVYDPQ
                     LAWLLDPAGHVPVTVTHGGAGEFPYLTEALVRQWVPELADPNPYLIVERAPHHYIQTY
                     RGGAEEFTVEYRDGGPDRHFGITLTTPAEVSALIWSWTSGDHAAVAAQPWARVEF"
     CDS             complement(314135..314338)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3000"
                     /old_locus_tag="nfa3000"
                     /product="hypothetical protein"
                     /protein_id="BAD55142.1"
                     /transl_table=11
                     /translation="MRTPGCRSCDTAVDHCHGTLIVHVSRVEECTEPDCVDLDHARHT
                     FVVDCGDIAGGCACAATEVRRTA"
     CDS             complement(314572..315282)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3010"
                     /old_locus_tag="nfa3010"
                     /product="putative cobyric acid synthase"
                     /protein_id="BAD55143.1"
                     /transl_table=11
                     /translation="MGESTVRIGLVLPDVMGTYGDGGNALVLRQRLRMRGYDAEIVEI
                     NLTDPVPESLDIYTLGGAEDSAQRLATRHLCRYPGLQQAAAKGAPVLAICAAIQVLGN
                     WYETSSGERVEGVGLIDVTTAPQDKRAIGEVVTAPTVPGLTEPLTGFENHRGGTTLGP
                     DATGLARVTRGVGNGVGDGREGVVQGSVIGTYMHGPALARNPELADLLLCRALGVDSL
                     PPLDLPEVTQLRRERLRA"
     CDS             complement(315297..316535)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3020"
                     /old_locus_tag="nfa3020"
                     /product="hypothetical protein"
                     /protein_id="BAD55144.1"
                     /transl_table=11
                     /translation="MADFSIRGRIALRAAAAASWASRRAGRGNGSMIGGLIALKIDPT
                     IMTQLGRGRRTVLITGTNGKSTTTRMTTAALGTLGAVATQADGANMDAGIVAALSRHP
                     GVALAAIEVDELHLPHVSDALEPAAVVLLNLSRDQLDRVGEINMIERRLRAGLAKHPD
                     TVVVANCDDVLMTSIAYDHPNVVWVAAGSGWAMDATSCPRSGEPIVWEGTHWRSTGAD
                     FERPQPDWWLEGEELVGPDGTRYPLHLALPGRANRGNAAQAVAAAVALGAEPAKAVVA
                     TGTVREIAGRYKTVQVGPHSARLLLAKNPAGWQEALSMIDHSASGLVIAVNGQVPDGE
                     DLSWLWDVRFEHFEDVQVVAAGERATDLAVRLTYAGVAHTTVPDPLRAIASCPPGQVE
                     VLANYTAFRDLNRDLEARRA"
     CDS             complement(316600..317265)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3030"
                     /old_locus_tag="nfa3030"
                     /product="hypothetical protein"
                     /protein_id="BAD55145.1"
                     /transl_table=11
                     /translation="MVRRRARCFNRTVTSTEITDPADLRALLGEVAPRVANKDRTALH
                     PRDREWIATSPFLVMSTCDAEGRCDASPKGDPAGFVHVLDDHTLAIPERPGNRRADGY
                     RNILSNPHVGLLFLIPGRPETLRINGRARLVRDAPYFDAMVVRGHRPVLAVEVAIEQI
                     FFHCAKAFLRSHLWQPDQWPEDRLPSAACLVKEVQSGVTETLAELEEYYSPANYERKL
                     YQS"
     CDS             complement(317269..318969)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3040"
                     /old_locus_tag="nfa3040"
                     /product="putative oxidoreductase"
                     /protein_id="BAD55146.1"
                     /transl_table=11
                     /translation="MGAMTAGAAWGAGPALAAPAGKRVAVLGGGVAGLTAAHELAERG
                     FEVTVYERRALGGKARSIPVPGTAAGGRPELPGEHGFRFFPGFYQHIPDTMRRIPFGA
                     NPDGVWNNLVAVPEARFARRDGDDFRVGLDLTAPPDPSAPGFAETLGAALATALKVSA
                     AEGLFFANRLMVFNTSCDARRFGQWEHMAWLDFVRGHERSHEFRTLLSRTLTSIMVAA
                     KDSLASVRTIGNMGEQFLGNPLGIGNDGALDRVLNGPTNLAWIDPWTQRLRALGVRFA
                     LGSEVRGLEVRDRRVTGARIVDETGAARTVEADHFVVALAAEQARALWSPEVLAVRPE
                     LEGMHRLVVDWMTGIQFYLRRTTDISPGHTAYIDSPWSLTSIGQNHLWARKLTEFGDG
                     SVQDCLSVDISDWHTPGILYGKPAMECTHEEIAREVWAQLRAHLNDREELLRDADLHS
                     WFLDPAIVWQADTGRNTNADPLLINTAGSWELRPEPHGDLENLYLAGDYVRTNVDLAT
                     MEGANESARAAVNALLDVTGSDAPRCRMYTLHRAAELEPLRRIDEDRYRAGLPNALDV
                     "
     CDS             complement(319071..320129)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3050"
                     /old_locus_tag="nfa3050"
                     /product="hypothetical protein"
                     /protein_id="BAD55147.1"
                     /transl_table=11
                     /translation="MGRVTFRDRLLGLTVVLLWGLNFLAIRAGLDHFPPLFFAALRFV
                     VPAVPVLLFVPRPRVPLRWLLLYGTGFGVLQFAFLFTAMREGMPTGLASLVLQSSAPF
                     TVVLGALLLRERLAPRQLLGLAIATGGITVIGADRLEQAALLPLLLTLAAGLGWAFGN
                     IGSRLAVASGPGVDPLHLTLWMTVVPPIPLFALSALTEGPGAGVRALAELASPTGPAA
                     LAGLAYIVVLGTVAGSGLWTYLMSRYPAGAVAPLSLLVPVVGIAAAWLVLDETPSGTE
                     LAGAVVVIAGAFLTTVGGRGTASTSAGIDEAPRGVPGRGSVPDDARRAGDVPATGVCA
                     SGTAAGSAGNAPGVIPTV"
     CDS             320212..321123
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3060"
                     /old_locus_tag="nfa3060"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55148.1"
                     /transl_table=11
                     /translation="MAGPSMSLDRLRVLRAFADRGTIAATAAALSMTPSAVSQQLKVL
                     AKEAGVPLLEPDGRRIRLTDAGQALVVRADEVLAAMDRAAAEMAHYRESPRGRVRVAL
                     FPSGAALLLPLVLPALADSEIDVVARDEDVPPSAVPPLLADYDIVLTHRDERSGPLAG
                     PRVSTRFLMREPIDVVVPPGHRLARQRAVAPAELAEESWLSVRGGFPVDDVLESIATV
                     TGVQPRIAQRLNDFRAIEALVAAGYGVALMPRFAVTHPEVVVLRLSGVRAARSYDLVT
                     RPHAERRPAVATVLAAFAEAARRITAE"
     CDS             complement(321127..322704)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3070"
                     /old_locus_tag="nfa3070"
                     /product="hypothetical protein"
                     /protein_id="BAD55149.1"
                     /transl_table=11
                     /translation="MDTAEPSASSKAQDEHDPTDTAAEPGEQAESATAARTPEAGEPA
                     PEPAAAGFAPPGFGPEGAGPAPDQFAPYGSGQFAQAGAPHPGGFAPPPPPQPGPPSAP
                     YSEYRQEIGPDGMVRRVPQDGAEGVGPQSSTGEQPSYSWAPPPPPTAPMPPQQPPMYQ
                     QPGGAPDPGQPWPGGPQQYGQPPQQFGQPQPQFGQPPQPQYGQPHMPPGHSVNDLNLL
                     KRARRAPRSGWRRAVHKASGGIINPGESAADIVYRDLVERVNQPVRGDYRIAILSLKG
                     GVGKTTTTVGLGSTFASLRGDRVIAIDANPDLGTLAHRVPRQTRSTVRNLLEDQHISR
                     YSDVRAHTSQAPSRLEVLASEQDPAVSEAFSEADYRKAIGILQSFYNIILTDCGTGLM
                     HSAMAGVLDMASSLVLVTSPAIDGARSASATLDWLEHHGYGKLVERTVVVVNASRRGA
                     STVDLDQLRKLFLDRTRAVQVVPFDDHLAEGAEIDLELVSKPTRRALLELAAMVADDF
                     GYVGAQQYQQPGPMDRR"
     CDS             complement(322994..324787)
                     /codon_start=1
                     /gene="leuA"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3080"
                     /old_locus_tag="nfa3080"
                     /product="putative 2-isopropylmalate synthase"
                     /protein_id="BAD55150.1"
                     /transl_table=11
                     /translation="MSPADAYVSGSRHITAPSKPAPADQPAWNAQKNSSMPAYRYRPF
                     AEEVEPVTLPDRTWPDKVIDRAPGWCAVDLRDGNQALIDPMSPARKRRMFDLLVRMGY
                     KEIEVGFPSASQTDYDFVREIIEDNAIPDDVTIQVLTQCRPELIERTFEACAGAANVI
                     VHFYNSTSILQRRVVFRADREQVKKIATDAAKLCLEVEKRYPDTNWRYEYSPESYTGT
                     ELEYAREVCDAVSEIIAPTPEKPLIINLPATVEMATPNVYADSIEWMSRNLARRESIV
                     LSLHPHNDRGTAVAAAELGYQAGADRIEGCLFGNGERTGNVCLVTLGMNMFSRGIDPQ
                     IDFSDIDEIRRTVEYCNQLPVHERHPYGGDLVYTAFSGSHQDAINKGLDAMKAAADAQ
                     NADVSDIVWEVPYLPIDPKDVGRTYEAVIRVNSQSGKGGVAYIMKTDHGLVLPRRLQI
                     EFSQVVQKITDGEGGEVTPKEMWDVFHEEYLAPIRPLERIRQKVTAAETDGGVDSITA
                     VVKVDGVEQEITGQGNGPLAAFVDAIATVGYDVRVLDYSEHAMSAGDDAQAAAYVECA
                     IGDKVVWGVGIATSITTASLRAVVSAVNRAH"
     CDS             325052..325819
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3090"
                     /old_locus_tag="nfa3090"
                     /product="hypothetical protein"
                     /protein_id="BAD55151.1"
                     /transl_table=11
                     /translation="MTWLEHLAILGAGVAAGGINTVVGSGTLITFPVLLAFGLPPVTA
                     NVSNTIGLVPGSLSGAIGYRRELSGQRTRLLQLGSASLLGGITGAVLLLVLPSDAFDA
                     IVPVLIVLALILVVVQPRLSAWVKKRREAATGEAPAHGGPVLWVAVYATGIYGGYFGA
                     AQGVLLLGLLGVLVHEDIQRLNGVKNVLALLVNGVAAVIFIVVAEVNWTVVALIAAGA
                     IVGGQLGAGVGRRLPPNVLRAVIVVVGSIAVVRLLAA"
     CDS             325852..327567
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3100"
                     /old_locus_tag="nfa3100"
                     /product="putative hydrolase"
                     /protein_id="BAD55152.1"
                     /transl_table=11
                     /translation="MTTGPGVAAQDVHVGRWRIALVVVAMLPLAAGCAGAVQQQTALG
                     QLAAQADAAATPRLDWTDCAEQQLAGYECAAARVPLDYARPDGETIELALVRQRAGDP
                     QRRLGTLFAAAGGPGNSGLDWARGGPMFPGEISRRFDVVTFDQRGVGASAPVRCFADA
                     AEQERFWSTMVLPPADAEQQLAAERAARAYAEGCARHSGALLPHLTTVDAARDLDLLR
                     RAVGEDRLTFTGGSYATYLGQVYGALFGERVRALHLTSVIDPAVYGGDTRAEIAGTAA
                     GTAEVFEEFLRLCAQGGRPECAFAEGGERSELVGESGPGAAEKAGSSGTERPSVTLTT
                     AAGPAEADVERLRARDAALLERLRTGPITVGTGEQAVRVGYAEVVQAHALLLYDPRQG
                     WPALAGLLAELDRGPHGDPAPVRQALAGGATPLDFLDSFTAITCADATLPRDPARWPA
                     LAQETPAATPDFDDFWLYMRQPCAAWPTPEQDARHVAGPWTLISDKPALLVNNRYDPA
                     TPLEFARRAQQELVNARLVVVEGGYGHEPGGECVRSLRERYLIDLQLPAPGATCTADR
                     APFAS"
     CDS             327692..329278
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3110"
                     /old_locus_tag="nfa3110"
                     /product="putative cholesterol oxidase"
                     /protein_id="BAD55153.1"
                     /transl_table=11
                     /translation="MAALFAGAGSLLGGRPAAADPVWNGLFREWVPEIFAPLPDPPEH
                     SPALVVGSGFGAAVTALRLAEAGVATTVLERGSRWPNDPWREIFTGDDLPDGRGFWHR
                     TSFTGVTKVPMHFASFGGVLDCTEYPGIDVWRAAAVGGGSVIFTGAMIAPQRKLFDEV
                     FRGSVDYDELDRVYYPRVRQMLRLSTMPADIYHSAPFTHSRAWDEQVRKAGYEPQPND
                     SIFTWDILRGELAGATRPSATVARSNLGNSNGAKFDLNQNYLKYAQDTGKAAVFPGHR
                     VDAIAQESGGRYAVTVTKLAPTGDVLATRTLTCDRLFLGAGSIGTSELLVRAQATGAL
                     PNLNEHVGDGWGTNGDVVLARGASSLTGLGQGVPSASRIYDETDAPVTLESWYIPGIP
                     VETGALASLGMVLDPTRTRFGYNAADGRVGLSWDRVNRDQVVAAARTVDQRIAERAGS
                     LVGYGPIGYDANALFTAHPLGGAVLGKATDGYGRVHGHPGLYVMDGAAIPGSTATVNP
                     SLTITALAERNIERIIRDGR"
     CDS             329383..330240
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3120"
                     /old_locus_tag="nfa3120"
                     /product="hypothetical protein"
                     /protein_id="BAD55154.1"
                     /transl_table=11
                     /translation="MVASTAGSDLEPAPESETYPRKPPALWTDFVMLALAVVSVALVV
                     WISFFEVSGHTYRVVVTIDYAICAVFAAEFLWRWRRAGWPWTFPLVYWYEVLGMIPVT
                     SPLFRGFRLLRIVVILVRLARVADRVFGDRVTAAVVNRFVRTIVEVIKRPMTIAVLDE
                     VAHVLRTGHYTRNIAAALEENRAEMDEMILELIKKDPQAGKVRYIPFHDEIIRLIADT
                     TFRIVFQVLADPRTDELVSDMIRENVEQIRGAVRDGVRVRPSAYGPTPHHETVRYHLD
                     KRATAPDQP"
     CDS             complement(330244..331455)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3130"
                     /old_locus_tag="nfa3130"
                     /product="hypothetical protein"
                     /protein_id="BAD55155.1"
                     /transl_table=11
                     /translation="MIGSKRARFQPVTEGASVTQLELFFDLVIVFAFTMVTDLASEET
                     TAKNMLRALLVLAVMWWVWISYSWVGNVVRADEGLSRVAMFVAMGAAFIAALTIPEAF
                     HDMPGGWFGPLVFAIAYLVARLVHLWVFWLASAEDAQLRGQVARWGLGSITIGTTLLV
                     IAAMTHGVVQMALWLAAIVGDMLWTMVAGDDWRLNSAKHFAERYGLIIIVALGESIVS
                     IGIGVAGLPISWPITVAAMLGLAVSGLLWWAYFDVASIAVEHELKTADGQRQIQIARN
                     CYTYWHFPMIVGIIALSLGLKKVLYYVGDQSDHTLHDALYGIPLFALYGGVVLYLVAL
                     TGFKYYATREFSTQRVLTAVVLLALIPLAAALPALISLGLLAAVLMCLIGWEMVRFAE
                     PRDQIRHANGA"
     CDS             complement(331555..332010)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3140"
                     /old_locus_tag="nfa3140"
                     /product="hypothetical protein"
                     /protein_id="BAD55156.1"
                     /transl_table=11
                     /translation="MRTKTDIRFTVDAGPAHVLDVLAAIELLPEWSMYRDARVATRYE
                     NGRPRRVYVTADVLGSSDLQVLEYEWTDNRSSWQVVDSSRGIGGGGWFEVAEDPAGTR
                     VWYHTELQSGLPLPGLLMKRTVQRWHETVAQNFVEFAESYPENEKFPSL"
     CDS             complement(332255..332827)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3150"
                     /old_locus_tag="nfa3150"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55157.1"
                     /transl_table=11
                     /translation="MRTNPERRAALLDGAIEVLAEEGARGLTFRAVDKRAGVPAGTAS
                     NYFGNRDDLLTQVGSRFYERLQPSAEVMAQVSAGPRTRENIVSLMTETVARVSGFRTG
                     FLAMLELRLEATRRPELRAVLTDRVRADLEFNVRNHLESGQPGDAETVELLYLALNWL
                     ILEHLTLPDIFDADRSAHLIETAVARLINS"
     CDS             332898..333470
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3160"
                     /old_locus_tag="nfa3160"
                     /product="hypothetical protein"
                     /protein_id="BAD55158.1"
                     /transl_table=11
                     /translation="MPKLVYYVGVSLDGYIAGPNGEIDFMPLGADFLDWMRADYPETL
                     PAHARPHFGLDVDAPNRRFGSMIMGRATYEPGLAVGVASPYPHLTQYVVSTTLDSAPA
                     PDVRVVRDPRALVRELKASDGPDIWLAGGGRLAATLRDEIDEMVVKHYPVVAGDGIPM
                     FSGAFGPTRFTPVRRQGFANGTEVAVYRPA"
     CDS             complement(333467..333925)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3170"
                     /old_locus_tag="nfa3170"
                     /product="hypothetical protein"
                     /protein_id="BAD55159.1"
                     /transl_table=11
                     /translation="MIDSRAVADTRCRDEHGAMESIVIDVHTGRTEVVHDLTPQCAKF
                     VADLGDGLLHVFVPHATAGIAIMELGARSDDDLLAALRDLLPADDRWRHAHGSRGHGR
                     SHVMPAMIAPYATVPVLDGELALGTWQSIALVDLNIDNPDRQVRLSFLAG"
     CDS             334035..335300
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3180"
                     /old_locus_tag="nfa3180"
                     /product="putative aspartokinase"
                     /protein_id="BAD55160.1"
                     /transl_table=11
                     /translation="MALVVQKYGGSSVASAERIRRVAERIVETKKQGHDVVVVCSAMG
                     DTTDELLDLAEQVAPAPPAREMDMLLTAGERISNALVAMAIHSLGAQARSFTGSQAGV
                     ITTGAHGNAKIIDVTPSRLREALDEGTIVLVAGFQGVSQDSKDVTTLGRGGSDTTAVA
                     LAAALEADVCEIYTDVDGVFTADPRIVSDAQRLEQVSYEEMLEMAACGSKVLMLRCVE
                     YARRYNVPVHVRSSYTDKPGTYVYGSMEDIPLEKAILTGVAHDRSEAKVTVVGLPDEP
                     GYAAKVFRAVADAEINIDMVLQNISKVETGKTDITFTLPKTEGARAVEMLTKRQGEIG
                     FSQVLYDDHIGKVSLVGAGMKSHPGVTATFCEALADAGINIDLISTSEIRISVLVKDT
                     ELDDAVQVLHRAFDLGGDEVAVVHAGTGR"
     CDS             335304..336338
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3190"
                     /old_locus_tag="nfa3190"
                     /product="putative aspartate-semialdehyde dehydrogenase"
                     /protein_id="BAD55161.1"
                     /transl_table=11
                     /translation="MGVRVGVVGATGQVGAVMRKLLEERNFPADEVRFFASARSAGKK
                     LPWRGGEIVVEDTETADPTGLDIALFSAGATMSRVQAPRFAAAGVTVIDNSSAWRKDP
                     EVPLVVSEVNPEQTRNLVKGIIANPNCTTMAAMPVLKPLHDAAGLQRLIVSSYQAVSG
                     SGLAGVEELASQVRAVVDDAEKLVHDGGAVEFPAPNKYVAPIAFDVIPLAGSLVDDGS
                     GETDEDQKLRNESRKILGLPDLAVSGTCVRVPVFTGHSLSINAEFAEPLSVERAEELL
                     GKAPGVKLVDVPTPLQAAGIDESLVGRIRQDPGVPDGRGLALFVSGDNLRKGAALNTI
                     QIAEVLLSQR"
     CDS             336391..336633
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3200"
                     /old_locus_tag="nfa3200"
                     /product="hypothetical protein"
                     /protein_id="BAD55162.1"
                     /transl_table=11
                     /translation="MSGVGILRRCHQGVQMRKILARITAVAAFTGVVSLGSTGSASAI
                     TEEQCVNEGGGIVIYEMDGTKTCLGGFYTGQQILFS"
     CDS             336645..336983
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3210"
                     /old_locus_tag="nfa3210"
                     /product="hypothetical protein"
                     /protein_id="BAD55163.1"
                     /transl_table=11
                     /translation="MSTSNETQASITGAAPALIRALRRAAEIAEANDRGWFGIEDVLA
                     VLLDDDRSLLGAHAARQGLTEQFEEIRRLARSLVPGAVGGPSTPAGPAGVDFTISGPD
                     AAELEAFVRA"
     CDS             337038..337952
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3220"
                     /old_locus_tag="nfa3220"
                     /product="putative branched-chain amino acid
                     aminotransferase"
                     /protein_id="BAD55164.1"
                     /transl_table=11
                     /translation="MANPHPQVFFGDRLVAAQDAQVGVASAAVLYGLSVYTVFPVHVD
                     GARRTAFRLDDHFRRLEESCKIIGIDRFAHEWDFSRFTAAVRALIAANAPREDVFVRA
                     TVHVVESIPGTRVRGCEIRMSMFVYDAVPIVPQDGMRLKSSPWRRIPDNAIPSRAKVN
                     GAYVNSVLAKQDAIDSGYDDCIFLDGNGHVCELSAANIFLVRGGTLITPDVSCDILDG
                     INRRTILTLAAEDGIPVQERTVDLTELYIADEVFVTGTSAGAAPVLEVDGRVVADGAP
                     GPVSQALRKRHAAALRTDEVHGWVTELD"
     CDS             complement(337956..339275)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3230"
                     /old_locus_tag="nfa3230"
                     /product="hypothetical protein"
                     /protein_id="BAD55165.1"
                     /transl_table=11
                     /translation="MAAVTLVAGALAGAAQAAPDPGYAECAVTSGRTPQRAAPEAAGF
                     DSGRLDEALRFAAERNRFNVQVFRHNCLVGEGPNNAHTGHVPWNIWSSTKSVVSLLAG
                     MAAERGLLDLHAPIDRYLPAGLGDAEHRSITVEDLLTETSGMRVGVLTEGITGVIPID
                     PHSAVQALGVPLANPPGTVFSYSQRNVDLLAYVIELALGEPLQQFAQRELFDPLGIAR
                     EDYYWARDRAGNTYGYAHLMLPPDDFAKLGLLVADDGRWGAQQIVPADYLRQARTPSP
                     ANRCYGYLFWLGPGCAEIPAFLPSGVYAMAGLGLQNVFVLPELDLVVVWTGAFGNVSA
                     HGVQGIVQNTGELPWEFFRKLFAAMHEPPVPDPGPYVEPPLRTDPSRYVDNSLLLAVF
                     GVGPAAYPGCNVFSCLNYELAAPFADAPPGCYVLACLGPDPRTPGIR"
     CDS             complement(339382..340629)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3240"
                     /old_locus_tag="nfa3240"
                     /product="putative transporter"
                     /protein_id="BAD55166.1"
                     /transl_table=11
                     /translation="MTSADPGNALHRRLGLTDSVVIGLGSMVGAGIFAALAPAAAAAG
                     SWLLLALGVAALLAYCNAMSSARLAARYPVSGGTYVYGRERLGPFWGYLAGWGFVVGK
                     TASCAAMALTVGHYAWPEHARWVAVATVVAITAVNYTGVQKSALATRIIVGAVLTVLV
                     VVVVVAFSGSHSAAAPMPGRIGPGDVLQAAGLLFFAFAGYARIATLGEEVREPHRTIP
                     RAIRLALGLALAVYALVAVAALLTLGSQGLATAVDPLARVVAAAGAGWLTPLVRAGAV
                     LAAAGSLLALILGVSRTTLAMARDGHLPSPLATVHPRFGVPHRAELAVGAVVAVVAAT
                     ADLRSAIGFSSFTVLVYYLVANLSAGTLGAGEGRPARWIPVVGAAGCVIVGFALPIGS
                     VLAGLAVLALGAGWYAVRSARLA"
     CDS             340796..341227
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3250"
                     /old_locus_tag="nfa3250"
                     /product="putative ferric uptake regulator"
                     /protein_id="BAD55167.1"
                     /transl_table=11
                     /translation="MHTETAEPRDRLRAAGLRVTAPRLAVLKAVSAHPHADADTIAAE
                     VRAALGSVSTQGIYDVLHACVGAGLLRRIEPAGSPARYETRTGDNHHHLVCRRCGAVA
                     DVDCAVGAAPCLEPSETHGYAVDEAEVVFWGLCPDCRAAQD"
     CDS             complement(341517..341849)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3260"
                     /old_locus_tag="nfa3260"
                     /product="hypothetical protein"
                     /protein_id="BAD55168.1"
                     /transl_table=11
                     /translation="MERLLVPARDEALRPGSGRRASTFTPWAGRLPLVNRPARMVGLV
                     RVGVVTVGSGGCAASSGKSRRRCVVRPAGRSPLVDRPGRPRRRRATCHPSKRQVVRRV
                     PPRWWLVW"
     CDS             341914..342789
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3270"
                     /old_locus_tag="nfa3270"
                     /product="putative oxidoreductase"
                     /protein_id="BAD55169.1"
                     /transl_table=11
                     /translation="MSTNVASRPADAAGTFRLGGDLPVNRLGYGAMQLTGPGVWGDPR
                     DPEEAVRVLRRAVELGVNFIDTADSYGPFVSEQLIRTALHPYPDDLVIATKAGLTRSG
                     PGDWRPVGRPEYLRQQAELSLRHLGVDRIDLYQLHRIDPQVPLADQLGELVALQQEGK
                     IRHIGVSQVSVEQLQQAREIAEIVSVQNLYNLANRTDEAVLDYAERENIAFIPWFPIA
                     TGELARPGGPLDAIATRHGATPAQLALAWLLRRSPVMLPIPGTSSVAHVEENTAAAQI
                     TLSDSEFEELSAAAE"
     CDS             complement(342863..343192)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3280"
                     /old_locus_tag="nfa3280"
                     /product="hypothetical protein"
                     /protein_id="BAD55170.1"
                     /transl_table=11
                     /translation="MADDTARPQALPWNLLGATDATDGWRLVTNPDPRLRKEWDYEPG
                     CGCGYYAVLFNPVRLGPFRLVVVGGDRVPRLHKDDVTIDEGKALAEEWVTRLRLADGR
                     ARRSPGP"
     CDS             complement(343193..343408)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3290"
                     /old_locus_tag="nfa3290"
                     /product="hypothetical protein"
                     /protein_id="BAD55171.1"
                     /transl_table=11
                     /translation="MSSDESTASRTGRGSRPRLFVRDDAESGTVVPSIDEQLYDTLAR
                     YLIARDIQGFGGGRVMLYRDGTTGERP"
     CDS             complement(343421..343645)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3300"
                     /old_locus_tag="nfa3300"
                     /product="hypothetical protein"
                     /protein_id="BAD55172.1"
                     /transl_table=11
                     /translation="MFGVLCRLAGVNGLVALRYPAGARLLRARCDRLHPVSRVTAGQA
                     SDVVRSATSHPAVTISLIHAEPTLLIKIAS"
     CDS             complement(343892..344200)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3310"
                     /old_locus_tag="nfa3310"
                     /product="hypothetical protein"
                     /protein_id="BAD55173.1"
                     /transl_table=11
                     /translation="MCLVEVRSGPKGAIRVAIHVSTSAMWGDATPHRARSVGCGRWVV
                     SYLHGRTLTGEQAVGALQLAEQIVPLTVMARGLGLTLGEVAHLAAWGDPSRLSRLPAE
                     "
     CDS             344246..345175
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3320"
                     /old_locus_tag="nfa3320"
                     /product="putative DNA-binding protein"
                     /protein_id="BAD55174.1"
                     /transl_table=11
                     /translation="MRDARLPSTVWTVYSDGGEGSGMASPTVAGWELSVRIRRQAADR
                     AVTASQMARWLSVSPQYFSQIMQGKGTFTEEKLVLLLDRLEFEPDERDDLLALRGIAK
                     MRNPYAEYSALYDDALLQLFGLEAGADAIRSFEIAVVPGLLQTEDYIRAIMRSTVADA
                     RPTEVEQRVRVRLRRQQFLTGPAGGRLRAIVGQSALMYEVGGPEVHGAQLRHLLELPG
                     KLGEAVELRVVPFEAGGTLASLNSATFHLLDFASPRLPTVAWLETALTGRVEEDPREV
                     ERLQYIDEQLQRIALDPADSHALIQELASRYRT"
     CDS             345177..345524
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3330"
                     /old_locus_tag="nfa3330"
                     /product="hypothetical protein"
                     /protein_id="BAD55175.1"
                     /transl_table=11
                     /translation="MSTRFYKSSYSGANNSCVEVAHRSDGVLIQDSKYTGNRSSQPRI
                     RVARSEWPSVLDLAVSRRSGRVGDLTVDVASDGSSILTGPSEAGDKVTLHYTPTEWDA
                     FAKGVVDGEFDLR"
     CDS             complement(345662..346174)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3340"
                     /old_locus_tag="nfa3340"
                     /product="hypothetical protein"
                     /protein_id="BAD55176.1"
                     /transl_table=11
                     /translation="MNPNRFRHFVRRPRMPSAMGRQPPPGDNRRTAITLCARLIQVSD
                     FTRDTYHYGDKLVYEGVDETALTTNALWQAVTGAPGEGWIEEVHVVDRSPAQAQYKVE
                     REAHYAQKRERAAKSKIEPASGKQIDYLRALIAKTGPDRLDAEFADAIAGTAIAPRAE
                     TKVPTKPYNA"
     CDS             346649..346801
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3350"
                     /old_locus_tag="nfa3350"
                     /product="hypothetical protein"
                     /protein_id="BAD55177.1"
                     /transl_table=11
                     /translation="MPVSRLADNGVPPHMIAVVIRHGNVARTYRHKTRKTGGRHAVGR
                     SMRDNE"
     tRNA            complement(346909..346985)
                     /gene="proT"
                     /inference="profile:tRNAscan-SE"
                     /locus_tag="NFA_80100"
                     /old_locus_tag="nfa80100"
                     /product="putative tRNA-Pro"
     CDS             complement(347046..347939)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3360"
                     /old_locus_tag="nfa3360"
                     /product="hypothetical protein"
                     /protein_id="BAD55178.1"
                     /transl_table=11
                     /translation="MGRVACRERTSVEEGTTVHGGFDRDMGDTATRTTPIPPQGLSAP
                     PGHHDDMAVARELYRPSSGGHRWIGLGMAVLAVLGGTAVAVLADGSDAAEADDATGMV
                     SALTPSTRTRTTEQPVISAPAVVPGYRAVVAPDSDAAYDVPADWTIAPPDRSGGFGKP
                     PNTIGGKGYASEGKDYCPGSTRTVAFLTGSPTTDTTAAALEVGARAARIAYLADPTPT
                     APEPLHSLDGTQHGTFAETRGLIRDPAPGCAPTFSIYTFATPADTGSLVMVIAADTGV
                     PKAVDPDTAKRIFTSIRPYKP"
     CDS             complement(348028..348987)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3370"
                     /old_locus_tag="nfa3370"
                     /product="hypothetical protein"
                     /protein_id="BAD55179.1"
                     /transl_table=11
                     /translation="MSVISTSAVRRTALGATGAAVAGIGYASLIERNAFVLREATMPV
                     LPPGSSSLRVLHISDLHMMPGQKLKQQWLRELDRLEPDLVVNTGDNLSHQKAVPAVVQ
                     ALGGLLARPGLFVFGSNDYFAPVPKNPLKYFKTDHRRVHGAPLPWKDLRAAFTERGWM
                     DLTHVRRDLEVAGIRIASAGVDDPHLRRDRYDTIAGAPNPLAELSIGLTHSPEPRVLD
                     RFAEDGYDLVLAGHTHGGQLVLPGYGALVTNCGIDKSRVKGPSRWGEHTRLHVSAGIG
                     TSPWAPYRFCCRPEATLLTLVAAPPKRPLAESNEGLSTSSVAG"
     CDS             349088..349630
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3380"
                     /old_locus_tag="nfa3380"
                     /product="hypothetical protein"
                     /protein_id="BAD55180.1"
                     /transl_table=11
                     /translation="MPGRDGPGGTAEMWWGGTGGPTTVRPMSELKERLRADMTAAMKA
                     KDTLRLATLRMLLAAIQNAEVAGAQARELSDAEVIAVLQKEAKKRNESAEVYTQAGRG
                     ELAANEHAEARIIDEYLPTQLSEAEVADLADTAIAQVAEQLGERPGMRQMGQVMKIAT
                     QLAQGKADGSRISAAVKARL"
     CDS             complement(349637..352009)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3390"
                     /old_locus_tag="nfa3390"
                     /product="putative penicillin-binding protein"
                     /protein_id="BAD55181.1"
                     /transl_table=11
                     /translation="MSNVPITHTLAKLAGSCALAAVLVAGLLFPLAGGFGFVSNRAAD
                     AVDNVSAELVEGTVPAVSTMVDAAGNPIAWLYEQRRFEVPSDRISNDMKLAIISIEDR
                     RFAEHDGVDWQGTVRAFLTNTTSGEVQQGASTLDQQYVKNFQLLVVAKTDAERRAAIE
                     TTPARKIREIRMALTLDKELTKDEILTRYLNLVPFGNSSYGIQDAAQTYFGIDAADLN
                     VPQAAMLAGMVQSSSKLNPYTNPQGVLDRRNTVLDTMIQNIPGRAEEFRKAKQEPLGV
                     LPEPKGLPRGCIAANDRGFFCDYALQYLAEAGISREQIDKGGFLIRTTLDPAVQDSVK
                     RAINDHAKPDLDHIAEVMSVVAPGQDSHPVLAMASSRTYGLNQDANETVQPQPFSMVG
                     DGAGSVFKIFTTAAAMEKGLGINSQLDVPARFDAQGMGNGGARGCPPATYCVENAGRY
                     KSPMSVTEALATSPNTAFVKLIQAVGVTPTVDMAVRLGMRSFTKPGTSGHGNQSLADM
                     IKDQNLGSFTLGPVAINPLELSNVAATLASGGRWCPPSPIKEVIDRYGKPVPLTQQAC
                     EQVVEPGLANTLANAMSKDDTSGTAAGAAQAMGWGGLPMAGKTGTTESHRSSAFLGFT
                     NSLAGAVYVYGDSPTPGEICSFPLRNCGSGDLFGGNEPARTWFSAVKGVVGNFPPPAL
                     PPLDDKYVRGANNAQVPDVVGMSQSEATTALVSAGFQVSAVNGSGPPPKGSVMSMAPN
                     GSAIPGSVITIYISDGTQRQAPSPAAPAPAPNLPAPPPLPNIPLPPWWPR"
     CDS             352377..352700
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3400"
                     /old_locus_tag="nfa3400"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55182.1"
                     /transl_table=11
                     /translation="MHMTTPIARLDVEQAEARIAWVSQARCKEVDPDQLFVRGAAQRK
                     AATICRHCPVLMQCGADALDNRVEFGVWGGMTERQRRALLKQHPEVTSWADFFQAQRQ
                     HQVAM"
     CDS             complement(352829..353941)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3410"
                     /old_locus_tag="nfa3410"
                     /product="hypothetical protein"
                     /protein_id="BAD55183.1"
                     /transl_table=11
                     /translation="MNTLDVSGIIADPTARVVVCCGSGGVGKTTTAAAIALRAAELGR
                     KVVVLTIDPARRLAQSLGVAELDNAPQRVILGPEAKGELHAMMLNMRRTFDEMVLEHT
                     TREKAEQIFANPIYQTVASSFGGTQEYMAMEKLGQLVSRREWDLIVVDTPPSRNALDF
                     LDAPKRLGTFLNGKMIRLIMAPGRGVGRFVTGAMSLAMRGVSTIVGGQMLKDASNFLQ
                     SLESLFGGFQDRADRTYAMLAKPGTHFLVVAAPEPDALREASFFVDRLSSEGMPLAGL
                     VLNRTHPVLSSLPGDHALTAADRLAEDDPLTAAVLRIHAERVATAKRERHLLVRFTGA
                     HPRVPIAPVTALPFEVSDLTALRAVADQLTGAPAPM"
     CDS             complement(353938..354957)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3420"
                     /old_locus_tag="nfa3420"
                     /product="hypothetical protein"
                     /protein_id="BAD55184.1"
                     /transl_table=11
                     /translation="MPVSAESGLDKGWPKRAEQARLHYVSGKGGTGKSTVAAALALAL
                     AAGGRRVLLVEVESRQSIAQLFDLPPLPPTETRIATADGGGEVVALALDIEHAFLEYL
                     DMFYNLGFAGRAMRRMGAIEFVTTIAPGLRDVILTGKIKECVVRVDQAGKPVYDEVVV
                     DAPPTGRIASFLDVTKAMAEIAKGGPIASQAEGVSRLLHSDQTMIHLVTLLEALPVQE
                     TADAVAELTANDLRIGTVIVNRAGEGYLPADVRDRAAAGDLDRAAIRAGLERAGIRLD
                     EADVEGLITETVEHSTRLQAQDTSATELNEVGVSQLYLPALTDGIDLGALYELAEHLS
                     AQGVR"
     CDS             355070..355225
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3430"
                     /old_locus_tag="nfa3430"
                     /product="hypothetical protein"
                     /protein_id="BAD55185.1"
                     /transl_table=11
                     /translation="MTTWEYATVPLLTHATKQILDQWGADGWELVTVLPGPTGEQHVA
                     YLKRPKQ"
     CDS             355235..355705
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3440"
                     /old_locus_tag="nfa3440"
                     /product="hypothetical protein"
                     /protein_id="BAD55186.1"
                     /transl_table=11
                     /translation="MESATRWRENLDRLGVTLPAVAAPVAAYIPAIRTGSLVYTSGQL
                     PFVDGELSAVGKVGAEVSLETAKEAARLCALNALAAVHDLISLDEVTRIVKVVGFVAS
                     APGFTDQPIVVNGASELLGEVFGEAGVHARSAVGVAELPKNAPVEVELVVEVRG"
     CDS             355749..356549
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3450"
                     /old_locus_tag="nfa3450"
                     /product="putative hydrolase"
                     /protein_id="BAD55187.1"
                     /transl_table=11
                     /translation="MRAMTLTHPAYGRVRQVTPTAAVLLADNPGQMTLDGTNTWLLRA
                     PGATEYVVVDPGPKDKKHTEAILAATDGRIALTLITHHHHDHTGGIDRLVKLTGAPVT
                     AADPGYLHGWDTPLADDAVLEAAGLRIRTLATPGHTSDSVSFVLDDAVITGDTILGSG
                     TTVLESRSGALADYLDSLDRLLAEGSGKALLPAHGPDHADLAPVAQYYVKHRHERLDQ
                     VRAALRELGADAGAMAVVRKVYADVDKRLWPAARSSVQAQLDYLRSRG"
     CDS             complement(356617..357291)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3460"
                     /old_locus_tag="nfa3460"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55188.1"
                     /transl_table=11
                     /translation="MDEALARAGIFQGVEPTAVAALAKQLQPVDFPRGHVIFNEGEPG
                     DRLYIITSGKVKIGRRSPDGRENLLTIMGPSDMFGELSIFDPGPRTSTATTVTEVRAV
                     TMDRDALKSWIDQRPEIAEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKALLQLAQR
                     FGTQEAGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWLRLEGKSVLISDSER
                     LARRAR"
     CDS             357439..357588
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3470"
                     /old_locus_tag="nfa3470"
                     /product="hypothetical protein"
                     /protein_id="BAD55189.1"
                     /transl_table=11
                     /translation="MGAAPRRGQLARATSSSPSRARRLRILAAAAGRPSSVSSFTSAL
                     LALSR"
     CDS             357795..358637
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3480"
                     /old_locus_tag="nfa3480"
                     /product="putative endonuclease III"
                     /protein_id="BAD55190.1"
                     /transl_table=11
                     /translation="MRVSPSSAVESGSSSAGAGSAAPSAGAAESAEPKRKTRSRQAET
                     KLGLVRRARRMNRTLARAFPDAHCELDFTTPLELAVATILSAQCTDERVNMTTPALFA
                     RYPDARAYAEANRTELEEYIRPTGFYRNKTSSLIGLGQALVEKYDGEVPHTLEELVQL
                     PGIGRKTANVILGNAFDVPGITVDTHFGRLVRRWGWTTEEDPVKVEHAVGELIERKDW
                     TMLSHRVIFHGRRVCHSRRPACGACVLAKDCPSCGLGPVEPEAAAKLVKGPEREHLLG
                     MVGL"
     CDS             358634..359263
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3490"
                     /old_locus_tag="nfa3490"
                     /product="hypothetical protein"
                     /protein_id="BAD55191.1"
                     /transl_table=11
                     /translation="MSRVPVWVRLALAGLITVVALAVALWPRDAGEPATGSGAPTGGA
                     VSAQLRADAALAPCPGPAPGAVGAGPLAGLTPTCLADGAPVDLAAALAGKPALLNLWA
                     YWCGPCAEELPHLREYVSRVGDRVTVLTVHSDPEEAKALSRLTGLDVHLPGVLDPDAR
                     VRAAVGAPAVLPISVLVRPDGSVAEVVVRTFTGVDDIAATVQRALGVPM"
     CDS             359450..360169
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3500"
                     /old_locus_tag="nfa3500"
                     /product="hypothetical protein"
                     /protein_id="BAD55192.1"
                     /transl_table=11
                     /translation="MTLEIPADTPAWLRRAVEPGALDPVDSLSKARAVRRLMTLTAEP
                     RQAAVLVLFGGSPEPDPGAPGGLPADADVLLTQRAATMRQHRGQVAFPGGATDPGDRD
                     PVDTALREATEETGLLRAGVQPVATLPKLFVPPSRFDVTPVVAYWREPSEVRVVDPAE
                     TERVVRVPMAELLDPANRFLVRSSFGYQSPAFQVDGMLVWGLTGGILAGLISGAGWEI
                     EWDRTDVRDLEEALAAVGMSL"
     CDS             360166..361359
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3510"
                     /old_locus_tag="nfa3510"
                     /product="putative protease"
                     /protein_id="BAD55193.1"
                     /transl_table=11
                     /translation="MSSSVWLDVVVVVLALAAAASGWRQGAVASALAFLGVVLGAVAG
                     ILIAPHILVHVDEGRTRVLTGVLLIVVLVIVGEVAGMVLGRAARSGMRHPFTRSVDSI
                     VGAALQAVAVLVIAWLLALPLATSSQPAIASAINGSRVLADVNEVAPNWLRKVPNEFS
                     RLLNTSGLPDVIGPFGRAPIAAVEPPDPSVLASPVAASLQQSVLRIRGVAPSCQRALE
                     GSGFVIAPERVMTNAHVVAGTTSVSVDTARGPLEASVVLFDPSKDIAVLAVPGLTAPV
                     IPQASAAARSGDSAIVLGYPGGGPYTASAARVRETLDLTGPTIYRNGTVEREVYTVRG
                     LVRAGNSGGPLVDTQGQVLGVVFGAAVTDDDTGYVLTLSEVRTELEAAPGATLPVDTG
                     GCVLS"
     CDS             complement(361363..362295)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3520"
                     /old_locus_tag="nfa3520"
                     /product="putative hydrolase"
                     /protein_id="BAD55194.1"
                     /transl_table=11
                     /translation="MSPTPPDPSTVRYDGPWTHRDVHANGIRFHVVEAAPERTDAPLV
                     VLLHGFADFWWSWRHQLTGLADLGYRAVAVDLRGYGDSDKPPRGYDGWTLAGDVAGLI
                     RALGHTEAVLVGHAEGGLVCWATAVLHPRLVRAIALVSSPHPAALKAAVLTDARQRRA
                     WLPAFLRCQLPRLPEHRLTTADGFEVERMLRRRVGAQWAGTSEFVDTARRMRTAIRIP
                     GAAHCALEYQRWAFRSQWRPDGRRFMATMRDPIDIPVLSLRGEHDNYLLRPTFHRGHR
                     WAPHRRLVTVPEAGHFAHQENPDVVTTELAKFLA"
     CDS             complement(362300..362806)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3530"
                     /old_locus_tag="nfa3530"
                     /product="hypothetical protein"
                     /protein_id="BAD55195.1"
                     /transl_table=11
                     /translation="MSFTQGGNGNDARSGSTVSSIPLTDANPPGSASFGALVRDAAEQ
                     MSTLVRAEVELAKAEVTGEIKKGLQGSVFFILALTVLLFSTFFFFFFLGELLDVWLAR
                     WAAFLIVFLLMIAATAVLGFLGYRRVKKLRAPEKTIDSLKQARTVLPSGFGQAAHEDH
                     LVLEKRTN"
     CDS             complement(362840..364090)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3540"
                     /old_locus_tag="nfa3540"
                     /product="putative sodium/proton antiporter"
                     /protein_id="BAD55196.1"
                     /transl_table=11
                     /translation="MITRVRSELTRYLRTETVGGAILLVAAAIALLWVNSPWGDSYLR
                     MTETVLAIEPLHLELTLADWTKDGLLAVFFFVAGLELKRELVVGELADPKRAALPIIA
                     AVGGVVTPALIAAVIGHGAPGMDKGWAIPVATDIAFALGVLALTGSRIPATARVFLLS
                     LAVVDDLLAIILIAVLFTVGVSLLWLLAAAACMAGWWLAQRRRLRTPLVYVPLALVTW
                     YALHEAGVHPTLAGVALGLLTRVRPDPDEEWAPAARLEHLIQPVSAGICVPLFALFAA
                     GVPLNATVFGELFTDRLALAVMLGLLLGKTIGIFGISWVAIRFGLATRPSGLGYRDMF
                     ALSVLGAIGFTVSLLVAELALPDGDTVELAKAAVLITSLAASLAGSALLLRRGRVHQA
                     RQDALELQPDEGDASDPSEGGSLR"
     CDS             complement(364256..366208)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3550"
                     /old_locus_tag="nfa3550"
                     /product="putative acetyl-CoA synthetase"
                     /protein_id="BAD55197.1"
                     /transl_table=11
                     /translation="MTETTADHRESYPPSPEFVAGANADGSLYERAQADRLGFWAEQA
                     RRLYWHTPFTEVLDWSQAPVARWFADGRLNVAYNCLDRHVLDGHGDQPAILWEGEPGD
                     TRTLTYAQLLTEVSKTANYLTELGLNTGDRVAIYLPMIPEAIIAMLACARLGLPHSVV
                     FAGFSPAALRQRVDDAAARLIITSDGQYRRGTPTPLKTAVDEALTEPGHTVEHVLIVN
                     RCNLDIPLTPGRDLWWHDTIAHAPTQHTAQPLPAEHPLFILYTSGTTGKPKGILHTSG
                     GYLTQAAYTHHYVFDHKPGHDIYWCTADIGWVTGHSYIVYGPLANRATQILYEGTPNT
                     PDEHRHFHIIEKYGVTIYYTAPTLIRTFMKWGRHIPDAHNLTSLRLLGSVGEPINPEA
                     WRWYRHVIGRDTTPIVDTWWQTETGAIMISPLPGITHTKPGAAMTPLPGISAQVVDDD
                     ANPVTPGETEANGYLVLDQPWPAMLRGIWGDPDRYRDTYWNRYHTHGWYFAGDGAKID
                     TDGALWVLGRVDDVMNVSGHRISTAEVESALVAHPAVAEAAVVGATDPTTGQGIVAFV
                     ITNTTTNPHTTPDQLITDLKTQVAQEISPIARPRDIHIVPELPKTRSGKIMRRLLRDI
                     AEGRPLGDTSTLVDPTVFEAIRAEKA"
     CDS             366345..367091
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3560"
                     /old_locus_tag="nfa3560"
                     /product="hypothetical protein"
                     /protein_id="BAD55198.1"
                     /transl_table=11
                     /translation="MSDPLQPLVDLPGVRDAADRARDALAAVHRHRANLRGWPTTAAE
                     AAVRAARSSAAIEGGSTEIPADGRVADPILAGSLRVGQALDGDALRNLTAVWQRAPLQ
                     ALARLHLLAAADLVEDEQSLGRPRTDPGVAQRLDLLVQTLQATHAPAPVIAAVVHGEL
                     LALRPFGSGDGIVARAASRLVTVASGLDPHSLGVPEVFWLRRRQAYLDAAAAFATGDP
                     SGVGGWVILCCGALEDGAREATSIADAAAS"
     CDS             complement(367515..368381)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3570"
                     /old_locus_tag="nfa3570"
                     /product="hypothetical protein"
                     /protein_id="BAD55199.1"
                     /transl_table=11
                     /translation="MTTEDDQPADSGRGAPGAHTANRTTGGARVAAFFDLDKTVIAKS
                     STYVFSKPFYAQGLLNRRTVLESSYAHFLYLLSGADHDQMERMREHLTKMVAGWDVEQ
                     VKSIVAETLHELVDPLIYAEAADLIADHKIRGHDVVIVSASGEEIVAPIAAALGVAHT
                     AATRLVVEDGKYTGEVEFYCYGEGKVTAIEKLAASEGYDLARCYAYSDSITDLPMLGA
                     VGHPTAVNPDRALRREALARGWPVLAFSNPVSLWSRFQSPSSTTVAATAAVGLSAVLA
                     GAISYRLLRKRR"
     CDS             368741..369850
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3580"
                     /old_locus_tag="nfa3580"
                     /product="hypothetical protein"
                     /protein_id="BAD55200.1"
                     /transl_table=11
                     /translation="MDIDLADLPPVRPALALIRDVRLREEVRRVAAAAERELVEAEPP
                     VGRHSWAGAPLVILDTASALECAAADHQRRMGVVLVTEGEPGLAAWQAAAAVGAERVI
                     ALPGAAVGLIEKFAEHGEPRAGGGVVVAVVGACGGAGASVLAGVTALRAAAVGFRRHT
                     LLVDGAPLGGGLDLLLGLESAPGLRWSDLVVEDGRVAAGALHEALPTAGSGLVVLSCG
                     RAGAGRLPGRIGPAAAHAVLEAGRAAGDLVICDVSGERGPAAEQMLDSADLVVLVVPA
                     RLRAAAAAEAVSAYVGTRNPNQGLIVRGPAPGGLRGQEIAEILDLPLLAAVRAQPDLP
                     GRLERGGLRLPRRGPLVTAADAVLAVLDAPAGTAR"
     CDS             369847..371034
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3590"
                     /old_locus_tag="nfa3590"
                     /product="hypothetical protein"
                     /protein_id="BAD55201.1"
                     /transl_table=11
                     /translation="MSALVTAELLERVRQRLAGQSGEPDPAQLAAAIRAEAGGVLGDT
                     DLLRALRLLQTELTGAGLLEPLLHDPRVADVLVTAPDAVWVDRGRGLEKTAITFPDEA
                     AVRRLAQRLALSAGRRLDDAQPWVDGKLAGPGSTLGESFGVRLHAVLAPIAHDGTCLS
                     LRVLRPATQGLDALAASGAVPASAKTLLEKIVRARLALLVVGGTGAGKTTLLSGLLAT
                     VDPAERIVCVEDAAELAPPHPHVVRLVARTANVEGVGEVTVRDLVRQALRMRPDRIVV
                     GEVRGAEVVDLLTALNTGHDGGAGTVHANSPREVPARLEALAALGGMTRAALHSQLAA
                     AVQVVLHVQRGADGSRGLREIGLLEPAHDGRVHIVAAWRADGGPAPAAPRLAELFAER
                     SIR"
     CDS             371031..371816
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3600"
                     /old_locus_tag="nfa3600"
                     /product="hypothetical protein"
                     /protein_id="BAD55202.1"
                     /transl_table=11
                     /translation="MSGALVSLAVALLVAPGPAARRRFAGMYGSPRPVPWQRAVRPVG
                     VGAAAGAVLWTGVGPLIAAAVLFGTFTVRHRRSRRDREQSAECGRLLDALEAVIGELR
                     VGAHPSAAAEVAARESAGAAARAFAVSAARGRLGGSGADGLRDEQSMIGAELARIADA
                     WQVAERHGLALAELLTAARVDLAGRIRFRARSAAAMAGARATASVLSGLPLLGLGLGQ
                     LMGADPLRILFTTSAGDILLPLGTALACAGLLWTDAITRKALV"
     CDS             371820..372428
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3610"
                     /old_locus_tag="nfa3610"
                     /product="hypothetical protein"
                     /protein_id="BAD55203.1"
                     /transl_table=11
                     /translation="MFQPSASVWVLLAGALLCWPVRAGLDTRLAALYAPAPPPPTRTV
                     GPADPLVVASVFDLLAACLRAGLPMASAARAAAPGSPGELGAALLRAADLLALGADAT
                     DAWERAAREAAGRPGGAEIESLARMARRSARSGSSLAAAVAELAEQHRATVEDAAAAR
                     AERAGVLISGPLGLCFLPAFLCLGIVPVVVGLAGRVLDGGLL"
     CDS             372425..374674
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3620"
                     /old_locus_tag="nfa3620"
                     /product="hypothetical protein"
                     /protein_id="BAD55204.1"
                     /transl_table=11
                     /translation="MTGGPSPATGCGGPSNVPARTNRRGEQKGMSVQITNPTGGVPRR
                     LGSLLMVRRSHASPVPPTAADGEANPPAPTASAVCSPPAAAGVPSFASEESGSAESVG
                     RSDVQAQPVVLGTSPASTDHGCGGEFSTTADLRRAVSSERVGVEGGCGVGRVRAEGGC
                     ADVLGEARPSAERHALLRPAPPAENRTGRSRSGRGIAVPRSVIRGGQAQVRSAVKGLV
                     HWWGARAESSARVPAQLHAVPQISLPVPLRANHRFDSDAATVWALRRLRTAVPAPGAT
                     SRLPREARRMKSTWGFQRVRVRPSTPPPNPAAPGCQAPPSAPVPPARWAPQARPRGLR
                     LAGLLRLLRARALSPSVTRSSTPGRLIRPPHRPVEVPAPVPEPTPASPTDSTAARLVP
                     SPMPMPIPMPERNPETASDVPSVPPSAPSAVGEPSMSPHGTHPHSPCRAASTRPPETR
                     APLPPPPASSAGSSVPEAGTTPCRTALGPSFTQALHHAASAARRTRLAAPAPAVAPAA
                     VGGGLPSVSALATTPEVAAPATTPGVSAPPTTPGVSAPATTPEVLAPATAPEVAAPAT
                     TPGVLAPATTPEVALDGVMTARPSIGVQTDPSLAAPDPVPLAMALDADCAEADTRTSL
                     GYQPTTVAPPHSATTAAPAATTPAASAEAVARGPEPESDQGDEIASAVSRSSLRSVVD
                     RTENGVWRLRTRLLHAAVADDGMSTAEYAIGTIAAAAFGAVLYGVVTGDSIVDALTKI
                     IDKALNTSV"
     CDS             375261..375782
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3630"
                     /old_locus_tag="nfa3630"
                     /product="hypothetical protein"
                     /protein_id="BAD55205.1"
                     /transl_table=11
                     /translation="MAGTVERAVGGEMGLSGKGWVMCQGVWVDDDHAVRSVADRGSGP
                     LADDAVGPVGGREARRCGRRVVGDECGAVTVEAAIALAAIMVVVVVCVGALLAASTQV
                     RCVDAAREAARLEARGDPVDARAAAERVAPPGADIAIRRDGDFVVAVVSARAPLLPLR
                     LRGEAVAAREPGQ"
     CDS             375786..376148
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3640"
                     /old_locus_tag="nfa3640"
                     /product="hypothetical protein"
                     /protein_id="BAD55206.1"
                     /transl_table=11
                     /translation="MSGRGGEEGGATVFACVALVGLIAVTLLIAQVGTVVVARHRVQA
                     AADLGALAGAGALQAGADEACAAAEAVVRRMGALVSECEVMRWDVTVSVERIVRMGAV
                     GARTVRASARAGPAEQED"
     CDS             complement(376432..378822)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3650"
                     /old_locus_tag="nfa3650"
                     /product="putative ATP-dependent RNA helicase"
                     /protein_id="BAD55207.1"
                     /transl_table=11
                     /translation="MWDAAGADPALGYGRSLLNRVQRGGPDRRLTHAVDLPARPAETT
                     EWPAWVHPDVIAALDTYGIGAPWTHQTRTAELAAGGQHVVVSTGTASGKSLGYQLPVL
                     TALREDPRATALYLAPTKALGADQLRALGELTHEGPLREVHPATYDGDTPAEIRQWVR
                     DNARWIFTNPDMLHVGMLRSHQRWARVFRRLRYVVVDECHAYRGVFGSHVALVLRRLR
                     RVAAHYGADPVFVLCSATTADPAAAASRLIGAPCVAVTEDGSPRGARTVALWEPPLTA
                     ATGENGAPVRRSATIEAARIMADLVVEGARTLTFVRSRRSAELAAREARGLLGEVDPR
                     LAERVAAYRAGYLAEDRRELEAALSDGRLLGAATTNALELGVDIAGLDAVVISGFPGT
                     VASFWQQAGRAGRRSQGSLVLLVATDDPLDTYLVHHPDALLDKPVEATITDPTNPYVL
                     GPQLLCAAAELPLTDAEAEELGATRVLADLAAQGRIRRRVAPRTGAGRWHITAHTHPH
                     DDVDVRGGIGAPVAIVDGETGRLLGTADAGRAPATLHPGAVHLHQGETFVVDELDLTD
                     GVAFVHAGDPGWTTSARKLTSLTVESVLAERHHGGVTSAFAQVCVTSQVIGYLRTLPT
                     GEVMDLVELDLPAQTLPTKAVFYTVTPDLLAEAGIDARRIPGALHAAEHAAIGLLPLV
                     ATCDRWDIGGVSTAEHPDTGLPTVFVYDGQPGGAGFAERGFAQLRRWLAATLAAIESC
                     RCATGCPSCVQSPKCGNGNNPLDKDGAARLLRAVLGALDRTSAAAVGAGQGADLTP"
     CDS             379275..379481
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3660"
                     /old_locus_tag="nfa3660"
                     /product="putative cold shock protein"
                     /protein_id="BAD55208.1"
                     /transl_table=11
                     /translation="MAQGTVKWFNAEKGFGFIAPEDGSADVFVHYSEIQGSGFRTLEE
                     NQKVEFEVGQGTKGPQATGVRALS"
     CDS             379850..382780
                     /codon_start=1
                     /gene="topA"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3670"
                     /old_locus_tag="nfa3670"
                     /product="putative DNA topoisomerase I"
                     /protein_id="BAD55209.1"
                     /transl_table=11
                     /translation="MYSPVATRDRGAADQGRPLRRLVIVESPTKARKIAPYLGRNYTV
                     EASVGHIRDLPRGAADVPAKYKGQPWARLGVDVDNDFEPIYVVSPDKKAKVTELKSLL
                     ADADELYLATDPDREGEAIAWHLLETLKPKVPVRRMVFHEITEPAIRAAAADTRELDP
                     DLVDAQETRRILDRLYGYEVSPVLWKKVMPKLSAGRVQSVATRVIVQRERERMAFRSA
                     EYWDIAAKLDAGADEQSDAANPRTFGARLVNVDGARVASGRDFGPDGQLKSASGVVVL
                     DEARARRLAEALDGVDLAVTSAESKPYSRKPYPPFMTSTLQQEAGRKLRFTSERTMRV
                     AQRLYENGYITYMRTDSTTLSESAIAAARSQATQLYGAEYVHPSPRQYNRKVKNAQEA
                     HEAIRPAGDTFATPGQLHSRLDNDEFRLYELIWQRTVASQMADARGTTLTLRITGVAG
                     TGEECVFSASGRTITFPGFLKAYVESVDEEAGGQSDDAESRLPALEEGQNVTAVELNP
                     DGHSTNPPARYTEASLIKALEELGIGRPSTYSSIIKTILDRGYVYKRGSALVPSWVAF
                     AVVGLLEAYFGRLVDFDFTAAMEDDLDAIASGRERRGNWLSSFYFGGDSGVEGSVARS
                     GGLKKMVGEQLDDIDAREVNSIKLFTDAEGRDVVVRVGRYGPYLERLVTDPDDPDGDP
                     ISQRANLPDDLPPDELTPEVAEKLFATPQEGRSLGVDPATGHEIVAKEGRFGPYVTEI
                     LPEPATEEGAKKTAAKKTAPKPRTGSLFKSMDLASITLDDALKLLSLPRVVGTDPATG
                     EEITAQNGRYGPYLKKGTDSRSLASEDQIFTITLDEALKIYAEPKRRGGQSASAAPLR
                     ELGTDPVSGKPMVIKDGRFGPYVTDGETNASLRKGDEVESITDERAAELLADRRARGP
                     VKKTAKKAAKKTAAKKTTATKTAATKTAATKTTAKKTTAKKTTAAKKTAAKKAPAKST
                     AENS"
     CDS             382796..384028
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3680"
                     /old_locus_tag="nfa3680"
                     /product="putative DNA polymerase III delta' subunit"
                     /protein_id="BAD55210.1"
                     /transl_table=11
                     /translation="MSEPAVRVSDVAGVFDRLVGQDAVESELTAAAVAARAGSVEGAM
                     THSWLFTGPPGSGRSVAALCFAAALQCTDPGTPGCGRCHACTTTMAGTHGDVRRVVPE
                     GLSISTKEMREIVQIASRRPSTGRWQVVVIEDADRLTEAAGNVLLKVVEEPPERTVFL
                     LCAPSVDPEDISVTLRSRCRHVHLVTPSVAAIATVLRERDGLDAKTAEWAASVSGGHV
                     GRARRLATDAHARERRQRALALAAAAARPGAAYAAADELVKAADDEAKEMSAERDERE
                     REELATALGAGGTGKGAASATRGSAGVLKELERRQKSRATRTGRDALDRALIDVAGLY
                     RDALAVRFAAHDADAVTLTHPDMTEQIHDLADRVPPEGLLRSIDAVLACREALDLNVK
                     PRFAVAAMVATLIAAQSG"
     tRNA            384086..384164
                     /gene="thrT"
                     /inference="profile:tRNAscan-SE"
                     /locus_tag="NFA_80110"
                     /old_locus_tag="nfa80110"
                     /product="putative tRNA-Thr"
     CDS             complement(384454..385005)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3690"
                     /old_locus_tag="nfa3690"
                     /product="hypothetical protein"
                     /protein_id="BAD55211.1"
                     /transl_table=11
                     /translation="MRKLVYGFSVSLDGYINDRAGAIDWTEPDDELHQFHNDRFREIE
                     ISLHGRRLYELMAEYWPHVPADAPPIEREFGRLWTEKPKVVFSRTVPEVHWNSTLIST
                     NAAEEVGRLKAAGDGVIEVGGATLAASLIPHGLVDEYQMFVSPVVLGGGTPYFPVLDT
                     RLRLRLAETRHFKTAVLLRYVTE"
     CDS             complement(385052..385411)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3700"
                     /old_locus_tag="nfa3700"
                     /product="hypothetical protein"
                     /protein_id="BAD55212.1"
                     /transl_table=11
                     /translation="MPAGKITPMSTTGDDVRAYALSLPETTEEFAWQMPIFRVARSLF
                     LTLPDDETSMAVRCPVIDRDELVAAEPAKFWIAPHEANNAWVRVRLAALDDHDELRAI
                     VLDSWKLAAPKRLLDGA"
     CDS             385516..386340
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3710"
                     /old_locus_tag="nfa3710"
                     /product="hypothetical protein"
                     /protein_id="BAD55213.1"
                     /transl_table=11
                     /translation="MTKNNTSTWTCTVAVDDTALAVTDTGGAGLPVVYLNGQFATQGY
                     WRKVIADLGPEFRHITYDERARGKSRRSADYSFEAAVRDVDAVLAARGVARALLVGWS
                     YGAVVAAHWAQRNPDRTVGAVLVDGAFPYDWLDDAMERRITTLFKRLNLVMPLLRPTG
                     LTPRMNAAQMAASNIELGKLSRERELGPVLDDIRVPVRYVVASGTSFGSRGDEQERIR
                     SGLDAVCGRNPHIRVSAKVAGNHGALLRKDFRAISAAVRETAHPGGPSSVASTMSR"
     CDS             386493..386885
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3720"
                     /old_locus_tag="nfa3720"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55214.1"
                     /transl_table=11
                     /translation="MNHSTEEGELVLEDGKPLFLQIAEMIENSIIDGSLAEEAQAPSS
                     NELAAFHRINPATAAKGLNQLVSEGILYKKRGIGMFVTAGARNALRMRRRERFAQQYI
                     DPLIAEADKLGMGIDELKAMLDQREGSR"
     CDS             386882..387793
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3730"
                     /old_locus_tag="nfa3730"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAD55215.1"
                     /transl_table=11
                     /translation="MSATYLDPAVLDTETVASVRGVGMRFGSVTALDDVSFELRANTI
                     YGLLGRNGAGKTTLMQVLTGQQFQTAGEVSVFGATPHENAAVLRDVTFIRESQPYPAD
                     YKVKHVLDVARHLLPHWDEDFAQRLLRDFDLPLGRRVKKLSRGMTSALGVIIGLASRA
                     PLTLFDEPYLGLDAVARQLFYDRLLADYAENPRTVVLSTHLIDEVADLLEHVIVIDRG
                     RVVADAAADQLRESAITVAGPVGEVDRFVAGRPELRREALGNQARVLVRTTDHDADVA
                     RAGALGLRLEPVSLQQLIVETATTQEQ"
     CDS             387790..388485
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3740"
                     /old_locus_tag="nfa3740"
                     /product="putative ABC transporter permease"
                     /protein_id="BAD55216.1"
                     /transl_table=11
                     /translation="MMIARVLSVARIHAVSWPLLFAWPLGVLTAAFAIPWVIFALVDT
                     EDRNMTGSVYSILGIALAFYLVAMTQSLPFALGLGVTRRDYFLATLLVALTQIVGFGV
                     LLWGLSAAEQATDGWGVNMVMFGIPAEFTDNRLVQLGTFLAVLALIAAAGLLMGAIQQ
                     RWRVTGLYTLGAVVLVLGGLAAILVTWQRWWPEVGHWFTDSPRAVPMVLLPAVLAAVC
                     LGGAWALVRRATA"
     CDS             complement(388541..389632)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3750"
                     /old_locus_tag="nfa3750"
                     /product="putative hydrolase"
                     /protein_id="BAD55217.1"
                     /transl_table=11
                     /translation="MTADTKECAMLVTSMKTLAGVRSTEPLTAAYRAALRSRTYATAS
                     LNKPAAPVEIVPVTTVDGARLRVHAYGPADGEVIVLIHGWSCCIEYWHPQINALADRY
                     RVICYDQRGHGESTLGRVAPCADTLADDLATVLDATLPRGRRAVLVGHSMGGITLQAW
                     AARYPEQVPDRAAAVVLANTASKDIRFETDLLPLLNKPLAVANRPLTVFGRGVRMPMV
                     LAETLLTAPVPLPGGPMSPLVTAVLKSRVMTRNATADQAAFALGIVRSCRPLTRGLHA
                     AALADMDLGDAAKNLTVPTTVIAGLHDHLLPERMNRTIVEALKSSGSLADYQVWPTGH
                     LSNVEAADRFNAELAKIAASAYRPQADAV"
     CDS             389785..390345
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3760"
                     /old_locus_tag="nfa3760"
                     /product="hypothetical protein"
                     /protein_id="BAD55218.1"
                     /transl_table=11
                     /translation="MGYPAAIPIAADRYRVESTAATLGALAPVAAARLPWVLVDTPVD
                     HQAPRPVQRGGLRALGLPMLTAAAGAGALVLLHVRDPHVEGSYGECPVYALFGVYCPG
                     CGGMRAVHNLTDGRVLDSLHSNLLALPLIVAFFWFVADWSVRAWRGQKPRVPAIDRSV
                     MWALFALFAVYAVLRNTPWGTWLTPV"
     CDS             390393..390581
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3770"
                     /old_locus_tag="nfa3770"
                     /product="hypothetical protein"
                     /protein_id="BAD55219.1"
                     /transl_table=11
                     /translation="MTDSLKKRVREKLLRQLGEDGPPDAEHDDPRQISVETDLDALDS
                     VTEDDPLVEELAERYLVF"
     CDS             complement(390628..392013)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3780"
                     /old_locus_tag="nfa3780"
                     /product="putative peptidase"
                     /protein_id="BAD55220.1"
                     /transl_table=11
                     /translation="MRSADGREVLMGDKFYDEPIDDYLPQNGNRGYRVSRYELDLVYK
                     VAGNRLSGRAEITAVTTAVRPRFAFDLAQSLSVAKVFVNGAKVARYTHRNGKLVLTPQ
                     QKIPAGGVLAVVVQYAGAPKPVRGPWGEVGWEELTEGALVASQPNGAASWFPCDDHPS
                     SKASYRISITTDSPYHALANGTLVRKQTKASQTTWVYEQPEPMSSYLATIQIGPYRRH
                     RIGSEQSPVPMYAVLPARLRAAFDTDFARQQRMMEVFTDLFGPYPFAGYTVVVTDDDL
                     EIPIEAQGISIFGANHCDGRRGSERLVAHELAHQWFGNSLTLRRWRDIWLHEGFACYA
                     EWIWSEAAGGPSADQLARAARHNLSREPQDLVLADPGPALMFDDRVYKRGALTLHALR
                     IELGDRAFFDLLREWTGRYRHACVDTEEFTDLAGHYSQVPLRPLWDSWLRETALPPLP
                     PHGGQAVTVPR"
     CDS             complement(392050..395991)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3790"
                     /old_locus_tag="nfa3790"
                     /product="putative non-ribosomal peptide synthetase"
                     /protein_id="BAD55221.1"
                     /transl_table=11
                     /translation="MTLQPQVDAAADGNRAPGASPDPLYRSVAAPEPRTLVDILDATV
                     AAHPDAPALDDGEVVLSYAELRAEIAERVAELVAAGVRPGDRVGVRMPSGDHRLYVTI
                     LAVLYAGAAYVPVDADDPDERAALVFGEARVRVVATGAGIEAAEQAGTDGRPPAAGPS
                     PADDAWIIFTSGSTGTPKGVAVTHRSAAAFVDAEARMFLRDNPIGPGDRVLAGLSVAF
                     DASCEEMWLAWRHGACLVPAPRALVRTGADLGPWLVRREITVVSTVPTLAATWPPEAL
                     EAVRLLIFGGEAVPPELAERVAGGDDAGREVWNTYGPTEATVVACAAPLTGEGPIRIG
                     LPLDGWDLAVVDAQGNPVGEGESGELVIGGVGLARYLDPAKDAEKYAPATALGWERAY
                     RSGDLVRKERAGLIFLGRADDQIKLGGRRIELGEIDNALQHLPGVTAAAAAIRTTKAG
                     NKILVGYLTGPGADYDLRAARESLAEHLPAPLVPRLALVDELPTRTSGKVDRDALPWP
                     LPETGRADAEDGLSETGRWVAGLWDAILGAEVTGPDADFFDLGGGSLAAAQLVTALRE
                     RHPGIAVADLYDHPRLGALVDFLEQSAPAARVEPRTVVPTPRRAQLTQVLATLPLTTL
                     TGLQWFTWLAIVGNIAAWSGSLPWLPRLSWWWALPAFVLFITPPGRMALCVAGARILL
                     RGVRPGSYPRGGSVHLRLWAAVRLSEASGAENLSGAPWMVPFARALGARIGKGVDLHT
                     LPPVTGMLELGAGCSVEPEVDLSGYWIDGDLVHIGPIEVGAGAVVGSRSILLPGSRIG
                     KNAVIAPGSAVSGRVKADQEWAGSPAVKVGKARHRWPDHTPARARHWVAVFAITSVAL
                     AALPIVGLAAGAAWLAWCVRDTTTLGAGLTGAFAALPPAVLIALGVYAAATIVLVRLF
                     SLGLTEGYHPVRSRVGWQAWATERLLDGARTFLFPLYASLLTPLWLRLLGAKVGKHVE
                     ASTVLLLPKFTTVADGAFLADDTMIAGYELGGGWLRIGEAKVGKRAFLGNSGMTAPGR
                     RVPKNGLVAVLSAAPSKAKAGSSWVGSPPVRLRRAAESGDTRRTFDPPPSLKLARAAV
                     ETCRLLPVLVTFGIGLGVLFAMAWLAQTVGHPAAALLSGVVLLVAGAVACGSAVAAKW
                     LLVGRIRAEEHPLWSSFVWRNEVSDTFVETVAAPWFARAATGTPVLNLWLRALGARIG
                     RGVWCESYWLPEADLVTLGDGATVERGCVVQTHLFHDRIMAMDTVVLEPGATLGPHCV
                     ALPAARIGAGATVGPASLVMRGDAVPASTSWWGNPIAPWPRPHPTPTVAER"
     CDS             complement(396166..396882)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3800"
                     /old_locus_tag="nfa3800"
                     /product="putative translocator"
                     /protein_id="BAD55222.1"
                     /transl_table=11
                     /translation="MADPAPRCQPRSPAHRNRVAGARGVRSHRQVTPSLLLSFVGLCV
                     LLSLTPGPDSFLVLRFSIVDARPGIAAAIGSALGGIAWAVVVAAGVATLLEQSATAYR
                     ALKVIGGIYLVYLGIRALLDHRKQRGTAAEPPAADRHAPTVRSAFTAGVVSCLFNPKV
                     GLFYLAVLPQFLTEVTFANTLALGAIECLVAAVEMVLLALLAARAVALLRTPRVRDRL
                     EQASAAILTALGVGTVASAS"
     CDS             397033..398370
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3810"
                     /old_locus_tag="nfa3810"
                     /product="putative aminotransferase"
                     /protein_id="BAD55223.1"
                     /transl_table=11
                     /translation="MNRRDDVMTAVVDQTCAAFARVSGDDLRVPLVQGGTTTYANFDL
                     AASAPALATVADRIQHLLPYYASVHRGAGYASRISTECYEAARGSVARFLDAGDDQVV
                     VFTRNTTDSLNLLAGCVPGETVVLDIEHHANFLPWTTHGRRVVRAADTIEETLRRLVA
                     ELCARPAALLAVTGASNVTGEVLPLRRLAEIAHQCGARLLVDAAQLAPHRRISLRDTG
                     IDYLACSGHKLYAPFGAGVLVGRRDWLDAAEPYLAGGGAVREVGVSDVAWAPAPQRHE
                     GGSPNVLGAAAIAAACDALGAVDAEALVAHERQLTERLRAGLAAVPGCRVLRVFADSS
                     DCVGIVAFTLDGYEPGHVAAYLSAEHGIGVRDGRFCAHPLLARLGVAAALRASVGVST
                     TSEQVDRLVGAVARLVERGTAWNYACTGGLWSPSPETRPLGGDSAGGAAPCLR"
     CDS             complement(398432..398983)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3820"
                     /old_locus_tag="nfa3820"
                     /product="putative flavin-dependent oxidoreductase"
                     /protein_id="BAD55224.1"
                     /transl_table=11
                     /translation="MSEAPRPETGIRIPDDLSGITAEQYRASMRHYPAGVTVVTLDSP
                     AGPVGFTATSFASLSLEPPLVSFNIAHTSSSLTAMLAADSVVIHFLGEHQRHIAQRFS
                     RTAAERFADHSLWTTLETGEPVLHGTPIWVRAAVHQLIPIGDHTFVVGLVTRVHDDTD
                     ESPSAAPLLYYNGRYHRPTALDG"
     CDS             399203..400024
                     /codon_start=1
                     /gene="echA1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3830"
                     /old_locus_tag="nfa3830"
                     /product="putative enoyl-CoA hydratase/isomerase family
                     protein"
                     /protein_id="BAD55225.1"
                     /transl_table=11
                     /translation="MTDWQAFTVEISDHVAQVTLTGPGKGNAMGPDFWRELPEIFAGL
                     DADPQVRAVVITGSGKHFSYGLDLPAMSGTFGPLMADRALAAPRTDFLKEIRRLQASI
                     NSVAECSKPVIAAVSGWCIGGGVDLIAAADIRLASADAQFSVREAKVAIVADVGSLQR
                     LPGIIGEGHLRELAYTGKDIDAARAEKIGLVNDVYPDQQAVLAAAHALAREIAANPPL
                     VVQGVKDVLEQRRVNDIAEGLRYVSAWNAAFLPSEDLTEAIQAVFEKRAPEFKGR"
     CDS             400235..400489
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3840"
                     /old_locus_tag="nfa3840"
                     /product="hypothetical protein"
                     /protein_id="BAD55226.1"
                     /transl_table=11
                     /translation="MRIKSLIAAGLLATAAVAGVSTAATASAAAPIETTYQAAYYGGT
                     YIGTYATLEACRADGISPSTGGYYWECIENWDGWDLYIYY"
     CDS             complement(400569..401060)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3850"
                     /old_locus_tag="nfa3850"
                     /product="putative inorganic pyrophosphatase"
                     /protein_id="BAD55227.1"
                     /transl_table=11
                     /translation="MEFDVTIEIPKGSRNKYEVDHETGRVRLDRFLYTSMVYPADYGF
                     IENTLGEDGDPLDALVLLPDSVFPGVIVEARPVAMYKMEDEAGGDAKVLCVPAGDPRW
                     DHIQDLADVPEFELAAIKHFFERYKDLEPGKYVKGSEWVGRAEAEAEVEASFKRLQDK
                     GGH"
     CDS             401254..402681
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3860"
                     /old_locus_tag="nfa3860"
                     /product="putative penicillin binding protein"
                     /protein_id="BAD55228.1"
                     /transl_table=11
                     /translation="MAARRRRRLWIGATAAATALLLAVAAVLLVVRPWTPEFRHGGLT
                     VAAPPAPVKAFPRVTPATEAPAPSPAGVSTALAAAVTNPDLGAFTGIVTDAESGVTLW
                     SADPGRPMIPSSTAKILTAAAALLALPADRRVATEVVVGSAPGELVLVGGGDPTLTAQ
                     PDGKGYYPNAARLSDLVDQIKASGRAVDTIVVDTSAFSGPTMARGWDPIDVPEGSIAP
                     IEPVMIDGGRLSPLVEYSPRTTEPALDAGRALATALGLDPARVRAGTAAPDAAEVAAV
                     HSAPLRDRLRDMMVHSDNVLAETIGREIALATGHEPSFTGAVAAVRATLEKAGFDVSG
                     MDMHDTSGLSVDDRLPARLLDKVIATAAQPTGTALARPAGTKAEPESDRLAATLAPLL
                     DQLPVAGATGSLAERYVTRNREGAGWVRAKTGTLTVASALVGYVLDRDGRVLTFALMS
                     NDRPPEVSRPALDAIAGTLRNCGCS"
     CDS             402695..403801
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3870"
                     /old_locus_tag="nfa3870"
                     /product="hypothetical protein"
                     /protein_id="BAD55229.1"
                     /transl_table=11
                     /translation="MFEGADETDTAAGTTESPRRSGLSGAVDWRLAARTGAALVPAGP
                     RTSRYSAEQVVAELAASSIRAEGPVREVSGLLDDQPVPEARIVDRPGWISAAADSMST
                     LTGTGAQADTGFKGRLAGKPAGVQAGAMLAFLSTAILGQYDPFTGPDGTLLLVAPNIM
                     AVERALGVSPTDFRFWVCLHEVTHRVQFSSAPWLADYMRSNVDVLGEVGEEPLAEMLS
                     RLVAEVRERRRGGVPDDPANRGVIGLLRATQAPPQREALDRLLMLGTLLEGHADHVMD
                     AVGPAVIPTVAQIRAAFDKRRQRPANPIQRILRALLGVDAKVAQYVRGKAFVDHVVGR
                     VGMASFNTVWTDAETLPRTDEIEDPDRWIARVLN"
     CDS             403843..404799
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3880"
                     /old_locus_tag="nfa3880"
                     /product="hypothetical protein"
                     /protein_id="BAD55230.1"
                     /transl_table=11
                     /translation="MLRHAVRGWLAEHLPGAAPAVAVALSGGADSLALTAAAVVEAAT
                     VDALVVDHGLQPGSDAVAVAAAAQARTLGCRSARVLRVRVGSDGGLEAAAREARYAAL
                     GSARAGLPVLLGHTLDDQAETVLLGLARGSGARSIRGMAAYTPPWGRPLLGVRRADTR
                     RLCADLGLTPHEDPHNRSAEFTRVRLRTEVLPLLEDVLGGGVAEALARTGRQLREDGA
                     VLDALAADLASAAADAGDLRIETLATAPAALRRRAVRAWLLDSGAKAPTDRQLRAIDA
                     LVTAWRGQGGVAVGGGTPGMRLVAARERGRLTLRRQARSPAR"
     CDS             404836..405393
                     /codon_start=1
                     /gene="hpt"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3890"
                     /old_locus_tag="nfa3890"
                     /product="putative hypoxanthine phosphoribosyltransferase"
                     /protein_id="BAD55231.1"
                     /transl_table=11
                     /translation="MYGDDIASVLITEEQIAAKTKELAELIAKRYPAGAPEGDLLLVG
                     VLKGAIFFMTDLAKALPIPTQMEFMAVSSYGSSTSSSGVVRIMKDLDKDIAGRNVLIV
                     EDIIDSGLTLSWLKRNLSTRNPASLEVVTLLRKPDALRTQVEVAHVGFDIPNEFVVGY
                     GLDYAERYRDLPYIGTLDPKVYGGA"
     CDS             complement(405447..407696)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3900"
                     /old_locus_tag="nfa3900"
                     /product="putative serine/threonine protein kinase"
                     /protein_id="BAD55232.1"
                     /transl_table=11
                     /translation="MTQPVADAVARFTARWRESLRTGAEPPRPADFVPRAAHARRAVL
                     LALVRADIRARAAHPGLVKDIDDYRAEFPELSDTSALIDLLAVATRSAADLTRTGAAR
                     TDHTSAASTDGRTAPATPLDDIEGTETACAARPGRTHTASRTPIPSATNGTARPGDRI
                     DDFDLLAELGEGASGRVFLARQISMQRLVTLRLTRGTELPHAMAELDHPHIVRVYDQR
                     LPGGAEGLVYMQYLPGGTAEHLLAARRSHGPTGGGLLLRAVDTAMEAKGEIPPSDSPI
                     RARLAGLGWPETVAWIGRGLATALDYAARHGTLHRAVKPANVVFTAEGVPKLADFAAD
                     PAGIDTGAALRYRAPEELAALGRGPRNDPQPSTDPVGEPGHAAPEVGARADIYALGLL
                     LWELLTGRCPFDDEGLPPEQMLAHRRRGLPDSATAALPAGCPTALVRVLRTCLDPDPA
                     RRWPDGAVLAQQLDLCLDERARELVDPPPGSPRRRLVRWRVPLIAAAITVPNVLASLY
                     NIDHSRKLITGRLTERTQELFATSTVVTNLLFFTMAAALLTYWSRRIITVPRGLRAGV
                     TYPPGELARARRDAILLGDRAVLVAFGFWMISAASYPLGVTAAGDRLAPHAFAHFLAS
                     HAVCGAIALAYPFFLVNFYVVRCLYPMLLGHSAVGTDDGALLRGLQRRCVGYLLIAAS
                     IPLLAVAGVTLLPVEDVARIIVVVRVLCLGSIVMFVASYLLFRAIERDLSALARVARP
                     GLAPLTTRA"
     CDS             complement(407693..410626)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3910"
                     /old_locus_tag="nfa3910"
                     /product="putative serine/threonine protein kinase"
                     /protein_id="BAD55233.1"
                     /transl_table=11
                     /translation="MSAESERSLPPGRIPDRRAGGRLLGAEPGAVRAFTAAWAALDDL
                     PTTDRAARAPRIAEYLPDARTLRVEALVELIRVDLRHRWLRPAGSLPDRRKRLDDYCA
                     EFPELDRDELPAGLIYEEFVVRRHSGERLDPRDCLREYPVQAPALRELLNADDLDQST
                     RRARPDELGEASAPDTTLSATAPAASAAPDSAAAPDSGWDDDITVLAPGQPATPPADD
                     TTRRGPAPDPRHAPPPPDTTVAAPDPRTATTRIASGADQPGPTDDITLLPHTGGAADT
                     PATEPTPDDRTRPAEPDATQAAALAALDATVAAEHAVNPATAPARTSDMDATAAATRA
                     APDATGTEATGTATAIGVDGDDRLDPLDRIRVGQRVDDFDLLTGLGSGAFARVFLARQ
                     RSMQRLVAVKISADHGTEAQTLAQLDHDYIVRVFDQRLMDSQRGTGESARRLRLLYMQ
                     FLPGGTLLGVLRWVRATPPAERSGKLLLDAVDAAMEEKGEIRPTDSSVRAEIAGLSWP
                     ETVAWLGRRLAEALAYASSHGVLHRDVKPANVLLTAEAVPKLADFNISFSRNVEGTSP
                     VAYFGGSLAYMSPEQLEACHPGWERSAADLDTRADIFSLGVVLWELLTGAKPFDDSTA
                     GAGRRGDDTTLEAMLERRSLGVDPAALDRVPPDCPAALRRVLLTCLEPDRERRWAGGD
                     VLAKQLDLCLDQRARELVDPKPGSWRLRLRPWIVPVLLVAIGLPNLLASLYNIQHNQT
                     LIVARMTEDAQRTFLIITGVVNSVFFPLGFVVVAYMSRYVLSVPRGLRRGRRYDPETL
                     RRARCDALLLGERAVAIPFSLWVLAGLTFPLALQLSTGGITASAVIHFLASLVVCGAI
                     AASYPFFLATFYIVRCIYPIFLRHGEISADDAVRLRALDRRCNGYLAIAASVPLLAVA
                     GVTFLPPGDIPQVIVAVRVLCVGGIVAFVASYLLFRALEADLQALERVVSPDSARGPD
                     PEPPS"
     CDS             complement(410813..411709)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3920"
                     /old_locus_tag="nfa3920"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55234.1"
                     /transl_table=11
                     /translation="MDPHLRDLRYFVAVAEELHFTNAAQRLHIAQPTLSRQIRQLERQ
                     LDVVLFDRNQRSVALTVAGKELLEGARKILELWEVTNVSLQEAGEVLRVGIQSALGRG
                     LLNDLESASGYRLALHAASWNDPSSGLAGRQADLALVWLPLPDSNRYRWQVLRTEPRW
                     VLLPENHPLAGQDVIDFADLMDEPFIALPAEAGAMRDFWLGNDGRGGRAPKIGAEAAT
                     PEDKLEAVSLGLGVCLLAENNVPMYRWPGLTARPVGGLAPCELAVAWRADDTRPTILE
                     FAGRAMEGGFATLQQQHQPVAS"
     CDS             complement(412153..413769)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3930"
                     /old_locus_tag="nfa3930"
                     /product="putative aldehyde dehydrogenase"
                     /protein_id="BAD55235.1"
                     /transl_table=11
                     /translation="MTNTESAPKQATKAQAATPVEPAPSAPGPDVIEVRNPGTGELVG
                     TVPAQGADEVATTVRKLREHQAAWEALGPDGRKEWLLKMQDWIIDNTELLADVLQSET
                     AKARGDALIDPAFGADLIGYYARRAAKFLADEHPSPHSPLARVKKLTVAYRPYPVVGV
                     ITPWNFPLAMPIMDVFPALAAGASVVLKPSEVTPLSALELARGWAEIGAPPVFAVVTG
                     AGATGAAVIDNVDYVQFTGSTATGRKIAAACVERMIPYSLELGGKDPAIVLADADLER
                     AANGIAFGGMFNAGQVCISVERVYVEAPVYDEFVAKLTEKVRALRQGLDDRSIKHDLG
                     ALANENQVRIVQRHVEEAVAAGAKVLTGGKRTGQGTFFEPTVLVDVDQSMSCITEETF
                     GPTLPVVKVADEDEAIRFANDSIYGLSASVWTGDKERGERIARQLDAGAVNINDVFAN
                     LFSFALPMGGWGLSGVGARWGGAAGVRKYCRQKAITKPILPTQERELFWYPYKLPNLL
                     AAVGTMRLAGARGLRRINIPALLTLKRNSE"
     CDS             413910..415205
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3940"
                     /old_locus_tag="nfa3940"
                     /product="hypothetical protein"
                     /protein_id="BAD55236.1"
                     /transl_table=11
                     /translation="MTQAGESGAVEPNSVVVRDWLADYVSETMRAETLEQVVRRLDTA
                     IVARVPELSDRDMSRDLAASTRAHARTVLAGLTSDTFEFTLPAEAHAFARTIARRGFD
                     LRVLLRTYHAGMEAVLDYMNDAVGQREVPAEIERAVMLRMFDRTTKWISLSVELLTDT
                     YMEERERVLRAALNRRTETVHALLAGEELDADQASVRLGYRLGLHHLAFVLWTDRIEP
                     GGDAEVTGLLDRVAARVAAELGTNRLLTVASGASGMWAWAGLDDAAHAADLAAPGRIE
                     QVLDGQIEAPVRIAFGVPGARVAGFRDGHREAMAARQVAERGGGRRVVAYRDVEIAYL
                     AGVDQHAMWGLIRRELGALAGTDPATVRLRDTLHVYLSRQRSPEATAKALGVHKNTVR
                     YRLQRIEELLGHPVEHRALALETALTCLAAYGSGQAVSP"
     CDS             complement(415195..415458)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3950"
                     /old_locus_tag="nfa3950"
                     /product="hypothetical protein"
                     /protein_id="BAD55237.1"
                     /transl_table=11
                     /translation="MCSDITRLRGLEPAATEQEIYAAALQYVRKVGGVSGLSTTTKAA
                     VDKAVATIAAATTTLLAELPDHPAADGVEPPLRRNRVREVVTD"
     CDS             415600..416436
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3960"
                     /old_locus_tag="nfa3960"
                     /product="hypothetical protein"
                     /protein_id="BAD55238.1"
                     /transl_table=11
                     /translation="MPARGIPTLTTFPYEELDKREPDHWSGAAISDDELRALALGGFY
                     STRWDAFHDALLLGPEREHPLGDRRELAIDTLTGAWGITDGTEAQASMEQLLDGMHAP
                     LYALVHPLVTASINASERDRFGERADRHRAFLRQVASFRGMDNPESLVRDYDIWSQAI
                     KIGFTEHLARPLPSDIHAWDLARVVAVARMSFTAGYIEADVAWGYLMRALPLAQRKYR
                     NWRQFGDAYLTGWTYWQACEDLAELKNGGVDRRMELLRLWTRPTSPWRRIELNGPKKA
                     DD"
     CDS             complement(416438..417331)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3970"
                     /old_locus_tag="nfa3970"
                     /product="hypothetical protein"
                     /protein_id="BAD55239.1"
                     /transl_table=11
                     /translation="MLRPGGEGDEGERVLDVPIGDLLKVRLSRRADDAVVIEIYLRYP
                     TPVLTGVPADRTPLPVLIAEHDVPAASRIVERINDQILTAQRVDIAAPDLDPPAPVWT
                     ADGPTRGDVDRAVSRMTRHEEAADAVAALHHYVLGDEYVLETAVATARPPAGTGTGLL
                     AATTGRVLFVALGPDESYAYELPVTAVLWAHWSETAPTAPGEIGADRGRSCVEVHDGN
                     RTLCFTGVDRADMERVAFAVNFAVRREAVDGATGPADPGVAQLYAEWELLVERHSLGM
                     VDDVQFQRYGRGILRSLPDAG"
     CDS             417704..420094
                     /codon_start=1
                     /gene="ftsH"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3980"
                     /old_locus_tag="nfa3980"
                     /product="putative cell division protein"
                     /protein_id="BAD55240.1"
                     /transl_table=11
                     /translation="MNRKTVFRTLAIVSGILLVIYAFSYFGDDTRGWQSVDTSVALAQ
                     LQDKGNIENVQIDDREQQLRIDLKNGNDATKGADRIIAKYPGGSETSAKIFDAVQSSG
                     APYNTVVKQDSWLAQILLFVLPMVILLGLFLFVMARMQGGGRGGMMGFGKSKAKQLSK
                     DMPKTTFADVAGADEAVEELYEIKDFLQNPVRYQALGAKIPKGVLLYGPPGTGKTLLA
                     RAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQAKQNSPCIIFVDEIDAVGRQR
                     GAGLGGGHDEREQTLNQLLVEMDGFGDRTGIILIAATNRPDILDPALLRPGRFDRQIP
                     VGNPDLAGRRAILRVHSQGKPISPDADLDGLAKRTVGMSGADLANVINEAALLTAREN
                     GAVITGEALEESVDRVIGGPRRKSRIISEHEKKITAYHEGGHTLAAWAMPDIEPVYKV
                     TILARGRTGGHAMTVPEDDKGLMTRSEMIARLVMAMGGRAAEELVFHEPTTGASSDID
                     QATKIARAMVTEYGMSARLGAVRYGQEQGDPFLGRSMGMASDYSHEVAREIDEEVRNL
                     IEAAHTEAWAILNEYRDVLDDLATALLERETLHRKDLEQILASVTKRPRITAFNDFGE
                     RIPSDKPPVKTPGELAAERGEPWPPEQPAEPAVPVAAQQQREPVPANGYPQQGYQAQP
                     QYAYPHQQGGGYPSPHAPTQAYPRQGGTHGSRPDYGAPAGWSAPGWPPRDEAPQQPGA
                     QPGYGGWGRPAEQPQPGGFQPWGDPQHSGRGEDPAHPGSRGEDDDNRDWDGPNGRN"
     CDS             420166..420852
                     /codon_start=1
                     /gene="folE"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_3990"
                     /old_locus_tag="nfa3990"
                     /product="putative GTP cyclohydrolase I"
                     /protein_id="BAD55241.1"
                     /transl_table=11
                     /translation="MSANHNAVDQVPNGLDRAAFDDDAQPAVAEPPLHALATGRPFDQ
                     PRAEAAIRELLIAVGEDPDRPGLIDTPARVARAYREMFAGLYVEPDRVLDTTFDEGHQ
                     ELVLVRDIPMYSTCEHHLVSFHGVAHVGYIPGPAGRVTGLSKLARLVDLYAKRPQVQE
                     RLTSQIADAVMRKLEPRGAIVVVEAEHLCMAMRGIRKPGASTTTSAVRGLLQTNAASR
                     AEALDLILRK"
     CDS             420849..421739
                     /codon_start=1
                     /gene="folP"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4000"
                     /old_locus_tag="nfa4000"
                     /product="putative dihydropteroate synthase"
                     /protein_id="BAD55242.1"
                     /transl_table=11
                     /translation="MREAAVSATNVTARGGRRCVVMGVVNVTSDSFSDGGRYLDPDRA
                     IAHGVELYEAGADIIDVGGESTRPGAVRVDPATEAARVTPVIQGLVAAGVPTSVDTMR
                     AAVAEAALAAGVSVINDVSGGRADADMVKVVAEADVPWILMHWRAAADYRHTGPADHY
                     EDVVAEVRTELDAQVELAVRSGVDPGRLILDPGLGFAKNAAHNWALLAALPEFVEAGL
                     PVLIGASRKRFLGALLADANGPRPPDGREVATATVSALAALYGAWGVRVHDVRSSLDA
                     IAVVDAWQRAQPPKVRGAVG"
     CDS             421736..422164
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4010"
                     /old_locus_tag="nfa4010"
                     /product="putative dihydroneopterin aldolase"
                     /protein_id="BAD55243.1"
                     /transl_table=11
                     /translation="MTEQTAPAARSGEPADHSRAELDRIELRGLRVFGRHGVFEHERR
                     DGQEFVVDLTVWVDFTVAAASDDLAATVDYGALAERAVRIVAGPPRNLIETVVSEIAD
                     DVMADPRIQRAEVVVHKPAAPIPHTFADVRVVTTRTREPR"
     CDS             422161..422706
                     /codon_start=1
                     /gene="folK"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4020"
                     /old_locus_tag="nfa4020"
                     /product="putative 2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="BAD55244.1"
                     /transl_table=11
                     /translation="MSRAVLSIGSNLGDRLGYLRSVVDAVADRLVAVSSVYTTAPWGG
                     VEQDDFLNAILVVDDPDRGCRDWLALGQRLERAAHRTRAVRWGARTLDVDVIWCADAD
                     GPVVSADPELTVPHPRAHERAFVLIPWLEAEPHARLAVGDVERSVRDWLAALDPAERD
                     GVRRTDLSLRASAVPGEGLPS"
     CDS             422703..423176
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4030"
                     /old_locus_tag="nfa4030"
                     /product="hypothetical protein"
                     /protein_id="BAD55245.1"
                     /transl_table=11
                     /translation="MKLKPTKALDLVANVLIAALLAWAATRFAYGSLPPISVFAGASL
                     YPVAALEVVLAFVIRARVRNEEVGTGRKLHPITAARAVALAKASVQVGSIAAGIWLGF
                     LCWVFPQRGTLTAAAADAPGAIVGLSAGVALVAAALWLEYCCRAPDDPTDETATT"
     CDS             423248..424894
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4040"
                     /old_locus_tag="nfa4040"
                     /product="hypothetical protein"
                     /protein_id="BAD55246.1"
                     /transl_table=11
                     /translation="MASPSRSSTSRPRRDHAGRFFIGTLILLGLVASVFLIFSNSVHM
                     IRVGMVAALWAAAIGAMAATKYRKDAAVDKAKVRDLQTVYELQLEREITARREYELGV
                     EARVREEVGADAAELAALRAELSVLRQSLQRLFDGDLPMDRPALRAEAMRVPELPGTA
                     AAPANGSSANAGTGQAARNPLTPVFVPEHPAPPAFASPDDDPVTAETSVVPADDEPAP
                     PDAPARLRPPTWPHPFETVRDREVGTWADAYAADDPASSDGDAAAGAATRPAGGSPAS
                     SGRSSAAGSDPTSAGASKAATGANASATGSNPAASGSNPAAGSSTAAAGSSTAAARTG
                     TSGKTSSAAGSATISGANPAAPGSGAAPTGPGVAAGSGATGSGTAAGSGVATGPGRAT
                     GTDVAADPGVPAASGGATGSGVAAASGATEPSAAVGSSTALGATAAGADPSAAGPSAP
                     VAGSGTAADSPTAGAHPSTAPAAAGAPPGSPDAPVPDEQQPSRTPAAETPSPRPTTPT
                     IGTSSRRRRREEGGGSGDGQRRLSVAEIMANLASEQQQRP"
     CDS             425098..425976
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4050"
                     /old_locus_tag="nfa4050"
                     /product="hypothetical protein"
                     /protein_id="BAD55247.1"
                     /transl_table=11
                     /translation="MGIVSAGRVGSALGAALERAGHVVFGVAAISDASKHRARTRLPD
                     SEILPVEQVAARSELLLLAVPDAELPGLVRGLATATVVRPGTIVAHTSGANGVGVLAP
                     LAERGALPLAIHPAMTFTGHDEDLSRLGNACFGITAADDVGYAIAQSLVIEMGGEPVR
                     VAEENRTLYHAALAHGSNHLVTLVLDAVQALREALAGPGLLGQQTVDDQPGGLAERLL
                     APLASAALDNALRRGQSALTGPVARGDADAVAAHLAALAAADPRVAEGYRALSLRTAQ
                     RADTNPALIDLLEGRR"
     CDS             425973..426929
                     /codon_start=1
                     /gene="panC"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4060"
                     /old_locus_tag="nfa4060"
                     /product="putative pantothenate synthetase"
                     /protein_id="BAD55248.1"
                     /transl_table=11
                     /translation="MIDPTLRGAYRPGQLTVHHDPAVLGSVAKALRGVGRTVALVPTM
                     GALHQGHLQIVRQAKRTNQVVIVSIFVNPLQFGAGEDLDKYPRTLDADVELLRAEGVE
                     LVFAPNAEQMYPDGPRTTVHPGPLGAELEGASRPTHFAGMLTVVAKLLQIARPHQAFF
                     GEKDYQQLTLIRQMVRDLNFDVRIVAVPTVRESDGLALSSRNRYLDAAQRETALALSA
                     ALSAGAHAGGLGAEGVLAAARAVLDATPGLDLDYLELRSSTLGPAPASGNARLLVAAK
                     VGTTRLIDNIAVTLGAPIDGHPNLDSQPEPAGTDPALLPPAR"
     CDS             426946..427365
                     /codon_start=1
                     /gene="panD"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4070"
                     /old_locus_tag="nfa4070"
                     /product="putative aspartate 1-decarboxylase"
                     /protein_id="BAD55249.1"
                     /transl_table=11
                     /translation="MLRTMMKSKIHRATVTHADLHYVGSVTVDQDLLDAADLLEGEQV
                     CIVDIDNGARLETYVIAGERGSGVIGINGAAAHLVHPGDLVILIAYGMMNEQEIAEYD
                     PKVVFVDERNRPVELGSDPAHAPEGSGLTSPRSLTFA"
     CDS             427394..428188
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4080"
                     /old_locus_tag="nfa4080"
                     /product="hypothetical protein"
                     /protein_id="BAD55250.1"
                     /transl_table=11
                     /translation="MLLTIDVRNTSIELGLFAGSGTHARLERHWRIHTNPLLTADELA
                     MQLRGLIGGPLEQVIGVAALSTVPPVLRELRTMLARYWSHVPHVVVEPGVRTGIPLLV
                     DNPKEIGADRIVNALAAHQRFGGPAIVVDFGTATTVDLVSAKGEFLGGVIAPGVAISG
                     EALIEKAGLRRVELARPRSVVGKNTVEAIQSGAVFGFAGLVDGLIDRIRDEFDAFAGD
                     DVTVVATGISAPLIVPESETIDQHEPHLTLTGLLRVYERNQQRRRT"
     CDS             428447..429004
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4090"
                     /old_locus_tag="nfa4090"
                     /product="hypothetical protein"
                     /protein_id="BAD55251.1"
                     /transl_table=11
                     /translation="MLTPDDARLERAVAPALPTRLRPADLLRLTDEGAEDVLDGRYDH
                     LLPAGGAWPTEERWATRLRADDEVDVWLISWTPAKTTELHDHAGSLGALTVLSGALSE
                     LRWTGTELRARTLSAGDQAAFPIGWVHEVMRAPAAIEPVTAEPTLSVHAYSPPLTAMS
                     YYEITGQGTLRRTRTVLTDEPEGDI"
     CDS             429004..429435
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4100"
                     /old_locus_tag="nfa4100"
                     /product="hypothetical protein"
                     /protein_id="BAD55252.1"
                     /transl_table=11
                     /translation="MSHLTIDRMLELARAGLRRIYAWELPEALARGALLVDIRPQAQR
                     DREGTLPGALVIERNVLEWRLDPSSSARLALATDHDVEWIVVCSEGYTSSLAAASLQQ
                     LGLHRATDLVGGYQALKAAGLLTVASRTPHFAREVASLAAL"
     CDS             429563..431029
                     /codon_start=1
                     /gene="lysS"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4110"
                     /old_locus_tag="nfa4110"
                     /product="putative lysyl-tRNA synthetase"
                     /protein_id="BAD55253.1"
                     /transl_table=11
                     /translation="MRIRREKRERLLEAGTEAYPVVVPRTHSLAEIRAAHPDLAPDTQ
                     TGQQVGVAGRVIFLRNTGKLCFATLQEGDGTKLQAMISLNGVGADALAAWKADVDLGD
                     FVFVHGEVIASRTGELSVMADSWSMAAKSLRPLPVAHKEMNEESRVRQRYVDLIVRPE
                     ARQMARTRVAVVRALRNALERRGFLEVETPMLQTLHGGAAARPFVTHSNALDMDLYLR
                     IAPELFLKRCVVGGLEKVFEINRNFRNEGADSTHSPEFAMLETYEAYGTYDDSATMIR
                     ELIQEVAQEALGTQVVTLADGTEYDLRGEWATVEMYPSLSAALGEPVTPETTVEELRA
                     IAARVGLEIPEEKGYGHGKLVEELWEHQYGDKLYAPTFVRDFPVETSPLTRQHRSKPG
                     VTEKWDLYVRGFELATGYSELVDPVIQRERFVDQARLAAQGDDEAMVLDEDFLAAMEH
                     GMPPTTGTGMGIDRLLMALTGLGIRETILFPIVRPVAR"
     CDS             431142..431504
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4120"
                     /old_locus_tag="nfa4120"
                     /product="putative LSR2 protein"
                     /protein_id="BAD55254.1"
                     /transl_table=11
                     /translation="MAKKVTVSLIDDVDGESIADETIEFAIDGVSYEIDLSAANAAKL
                     RDGLEQWVSNARRVSGRRRAKAATTGASATPKSRVSIDREQSAAIREWARRNGHKVSA
                     RGRISADITEAYNKAAKG"
     CDS             431689..432312
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4130"
                     /old_locus_tag="nfa4130"
                     /product="hypothetical protein"
                     /protein_id="BAD55255.1"
                     /transl_table=11
                     /translation="MTGFVGSLLRYTDDAGRQQEFELTPERQRITIGRSPQADLSLSW
                     DAEVSRLHAAVEYLGAHWTIVDDGLSRNGTFVNGERLVGRHRLQPGDRIRVGSSLVSF
                     HEFGTPAEDITRVATGSIPTLRSLTETQRAVLVALCRPYKNGAGFATPASNQQIADEL
                     FLSVDAIKTHLRALFAKFGVENLPQNQKRVRLAALAMQSGIISDRDL"
     CDS             432513..433061
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4140"
                     /old_locus_tag="nfa4140"
                     /product="putative membrane protein"
                     /protein_id="BAD55256.1"
                     /transl_table=11
                     /translation="MVALRIAALVAAVLTTGLIAGVFYAYAISVMPALAGTDDRTIVE
                     VMQKVNVAILNPWFLVPFVGTVACTVLAAALHLGGAQRTTLVWILVALVLDIAAFAVT
                     AGLNVPLNERLAAAGDPAAIVDPAAVRAGFEAAWVRYNIGRAVLHTLAFLVLCGALVS
                     AGAARAEAAPVTHSAGAVSAGV"
     CDS             433460..436015
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4150"
                     /old_locus_tag="nfa4150"
                     /product="putative Clp protease"
                     /protein_id="BAD55257.1"
                     /transl_table=11
                     /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGV
                     AAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNY
                     IGTEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKEPVESGARGETG
                     TPSTSLVLDQFGRNLTQAALEGKLDPVIGRSKEIERVMQVLSRRTKNNPVLIGEPGVG
                     KTAVVEGLAQAIVNGEVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTR
                     GDIILFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAA
                     LERRFQPVQVGEPTVEHTINILKGLRDRYEAHHRVSITDGALVAAATLADRYINDRFL
                     PDKAIDLIDEAGARMRIRRMTAPPDLREFDDKIADARREKESAIDAQDFEKAARLRDK
                     EKQLVAKRAEREKQWRSGDLDVVAEVDDEQIAEVLANWTGIPVFKLTEEETTRLLRME
                     DELHKRIIGQEDAVKAVSKAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELSKALANF
                     LFGDDDALIQIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEI
                     EKAHQEIYNTLLQVLEDGRLTDGQGRTVDFKNTVLIFTSNLGTQDISKAVGLGFSQSN
                     NEGSNYERMKLKVNDELKKHFRPEFLNRIDDVIVFHQLTNEQIVEMVDLMIGRVATQL
                     KNKDMAIELTPTAKNLLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFGEIGPGQTI
                     LVDVEGWDGEGSGEDAKFTFTGKAKLTKAPTEEKPEVVLTGAAEGPSEAAAGE"
     CDS             complement(436086..436397)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4160"
                     /old_locus_tag="nfa4160"
                     /product="putative DNA-binding protein"
                     /protein_id="BAD55258.1"
                     /transl_table=11
                     /translation="MKEHQEQQEFASVFDALADTPAESENLKVRSQLMRAIRDRIDEF
                     GWSQRVAATNLGVTQPRISDLKNGKMSRFSVDTLVNLAAKVGLTVEVRIVDTRTVDAP
                     A"
     CDS             complement(436394..436606)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4170"
                     /old_locus_tag="nfa4170"
                     /product="hypothetical protein"
                     /protein_id="BAD55259.1"
                     /transl_table=11
                     /translation="MHSVGKGVREIRVAEDDGWFRVFYVADLGDVVYILHGFQKKSNQ
                     TPKRAVETGINRYRLAVAESQQRVQR"
     CDS             complement(436832..437494)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4180"
                     /old_locus_tag="nfa4180"
                     /product="putative two-component system response
                     regulator"
                     /protein_id="BAD55260.1"
                     /transl_table=11
                     /translation="MSIRVLVADDQALVRGGFVALLAAQEGIEVVGEADDGEQAVRLT
                     RELRPDVVLMDIRMPVLDGLAATRTIAADPALTDVRVVVLTTFELDEYVFEAMRAGAT
                     GFLVKHTEPADLVRAVRVVAAGDALLSPGVTRRLITEFAAHAKQPPPAALAELTDRER
                     EVMALVAEGLTNAEIGARLYLSPATARTHVSRILTKLGARDRTQLVVLAYESGLVRPG
                     WS"
     CDS             complement(437491..438696)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4190"
                     /old_locus_tag="nfa4190"
                     /product="putative two-component system sensor kinase"
                     /protein_id="BAD55261.1"
                     /transl_table=11
                     /translation="MSTAAITRIGRDWGLALVVAVAQIGLSRPANLNQTGVRALDLLG
                     YLLLVAGPIALVFRRRAPLPVLAVTLAACAGYLLGGYGYGPVFLALVVAFLTAATRGS
                     RWWTYPLLPIGYLAFVWPLPVLLGEAVNGWQLVGIGAWLAVLGSIAEGVRQRRAAVEA
                     RAQRAEAARRDAEAQRRRRASEERLSIARELHDVLAHSLSLINVQSSVALALFDAEPE
                     QARSALAAIKTASKDSLAEVHTLLETIRAGAPLGPPEPAPGIGDPDALVRPARDAGLA
                     VRVTVRGEPRPLPSVIDVAAARIVREALTNVVRHAPGAAAEVCVRYGPASVEITVDNT
                     RPLRTAARSGGGSGIAGMRERAHALGGTVTAGPRPDGGFRVAALLPVAPRETPAATGE
                     SAHPEREGR"
     CDS             438808..439707
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4200"
                     /old_locus_tag="nfa4200"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAD55262.1"
                     /transl_table=11
                     /translation="MTNSIVVTSGLTKRYGEHTAVDDVGMRVAAGEVYGFLGPNGAGK
                     TTTLRMLAGLIRPSAGTATVLGGAPGDPAVLRRIGVLIEGPGFYPYLSGRENLRVLAR
                     YRGLGRAEVDEALDRVGLTARGGDRFRTYSLGMKQRLGVGAALLGRPNLLILDEPTNG
                     LDPAGMAEMRALIAGLAGEGHTVLLSSHLLSEVQEICDRVGVIANGRLVTESTVAELR
                     GGAALFVRAEPWETALSAVRGIAGTVRRAGEGIRIDAPADAAPDVARAVVAAGADLLE
                     LRVDEKSLEEVFFEITGTEGALR"
     CDS             439704..440552
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4210"
                     /old_locus_tag="nfa4210"
                     /product="hypothetical protein"
                     /protein_id="BAD55263.1"
                     /transl_table=11
                     /translation="MNELTTAVRAELARLGRWPVFWIVLGTWVVLNLVFAYLFNYLAY
                     RSGEQSAMADAQPKEVLLQQMLPAAVPEVFTQGMAMFGGALMLILGALAVGSGYGWGT
                     WKTVFTQGPSRVTVAGSALVALALVTVALVVAVFVIDTGTAALIATTESQSLALPDAG
                     RILSGIAYGTAILGMWTLAGAFLGAVARGPALATGLGLVWVLVVENLLRGTAGILGPL
                     RALTDRLPGTAAGSLAGTLRTVDGPATPGVLDILSRGESLVLLAVYALLFAGATVWLM
                     RRRDLA"
     CDS             complement(440640..442139)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4220"
                     /old_locus_tag="nfa4220"
                     /product="putative two-component system sensor kinase"
                     /protein_id="BAD55264.1"
                     /transl_table=11
                     /translation="MTPPGIANRDSIVRDCAIALIVAMIQVAGGRAANVGQTGVRSLD
                     VLGCVLLLAGPIALVFRQVEPLPVLVLALAACGIYLALDYGYGPVFLAPAVAFLTAAV
                     SGSRWWTYPFVPASFVIFVWPVPALLGRGPGVAVVCAAAGWLVVLVAAAEAVRVRRAM
                     ARLREERFDAARRAEAAQRERFACEERLTAARELHDVLAHSLSLINVQSSVALELFER
                     KPMQARSALAAIKKASKDSLDEVHALLPTIRRGPFAGPLADDKTADPDRPRRPGKRGG
                     VSGRLGLPVDRTRHDREPRRDPRRTPAEPAPGPRAPEPGLADLDALVQRARATGLTVQ
                     IKVVGDPVELPEAIDTAAAGIVQESLTNVIRHAVGATATVTVRYTAESVDITVDNGRP
                     AGPQTRSPGAGNGIIGMRERAHALGGALTAGPRPSGGYRVAARLPVRVAPTPPTAAGN
                     GGGAPDPSGADRPVERVASSPEPEAPGGNGHPLETDNSPLPAEARAPES"
     CDS             442210..442668
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4230"
                     /old_locus_tag="nfa4230"
                     /product="hypothetical protein"
                     /protein_id="BAD55265.1"
                     /transl_table=11
                     /translation="MVDQSTRLPDLSARPHELSVERVMTAPASLLYAALTRGFDIWLA
                     APDSVRMRPEVGEPFYFETEFEGKRNPHYGRFLRLTPDREVEFTWVTAATEGAETVVR
                     VELVKQPRGIRLRLAHAGFASAAVRDLHQQVWPRMLEQLDERISGEPNRA"
     CDS             442758..443198
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4240"
                     /old_locus_tag="nfa4240"
                     /product="putative osmotically inducible protein"
                     /protein_id="BAD55266.1"
                     /transl_table=11
                     /translation="MPTRTARTAWTGGLQDGSGQVELASSGVGKYDVSFPKRSADSAD
                     GTTSPEELIAAAHSSCYAMALSAQIANAGGTPESLDVTADVTLGPDPAGGFRITGIQL
                     TVRGRVQGLDADGFQAAAEAAKAGCPVSKALAGVDSISLDAALA"
     CDS             complement(443321..444103)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4250"
                     /old_locus_tag="nfa4250"
                     /product="hypothetical protein"
                     /protein_id="BAD55267.1"
                     /transl_table=11
                     /translation="MPLTGSLKTLLLRGLLAGLIAGLLAATVGHFVGEPKVEAAIALE
                     EALAATPEEAPAEAAHSHEGASAHSHGDDEALVSRTGQKFGQFLALGLTGLALGAMFA
                     AAAHHARRWTALSGPALALVLAAGGWAAVVAVPFFKYPANPPAVGDPDTIDHRTLLWF
                     AVVLLGIAAVGAGGFVHRLLAGHPATLRLIAGVLAFVAVTAVGYVALPGVDEVPAGFP
                     PSLLWQFRVSSLAVSATLWTALGLGFAALTERATRSRELVAA"
     CDS             complement(444094..444291)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4260"
                     /old_locus_tag="nfa4260"
                     /product="hypothetical protein"
                     /protein_id="BAD55268.1"
                     /transl_table=11
                     /translation="MAIAHSPTTRSTDSVATVLVTIGVVLLALLTLYLVGFDQGAVSR
                     GGMFLHELMHDGRHLLGVPCH"
     CDS             complement(444475..444798)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4270"
                     /old_locus_tag="nfa4270"
                     /product="hypothetical protein"
                     /protein_id="BAD55269.1"
                     /transl_table=11
                     /translation="MAVVKINAIEVPEGAGPELEKRFAHRAHAVENSPGFLGFQLLRP
                     VAGDNRYFVVTQWDSEESFAAWRDGPARAAHAGSGEQKPVATGASLLEFEVVLDVPAK
                     AGAGE"
     CDS             444839..445588
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4280"
                     /old_locus_tag="nfa4280"
                     /product="putative hydrolase"
                     /protein_id="BAD55270.1"
                     /transl_table=11
                     /translation="MLYDEGGAGAPILLLHGLMGSARTWAGHLDWLRGHGHVYTFDAA
                     GHGRPAPPELTTEAFVADLAEATAGIGEPMAVIGHSMGGLHGWVFAAHHPERVRALVV
                     EDIAPDFTGRTAADWAAMIESWPQPFPDADAVLSYFGPVAGRYFLNSFEHGPQGYRLH
                     GSVATFRDISEEWGGRSFWAEWRAVRVPALLIEGEHTITPPGQMREMAAVNPHAEYVR
                     VAGAGHLVHDEQPRRYRAEVARFLDRVLGAP"
     CDS             complement(445596..446483)
                     /codon_start=1
                     /gene="mutY"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4290"
                     /old_locus_tag="nfa4290"
                     /product="putative A/G-specific adenine glycosylase"
                     /protein_id="BAD55271.1"
                     /transl_table=11
                     /translation="MGDGGGIDHDALLDWYAAAARDLPWRRPGVTAWQILMSEIMLQQ
                     TPVARVQPIWLEWVRRWPVPSAMAASSQAEVLRAWGKLGYPRRALRLHECAGVLAAEH
                     GDEVPADVDVLLGLPGIGAYTARAVACFAYGIRVPVVDTNVRRVVARAVHGRAEAGNP
                     SARDLAETEALLPAQVEPAARFSAALMELGATVCTARNPDCGRCPLPRCAWVSAGRPA
                     SEVVRRTQKYEGTDRQARGRLLDVLRAASGPVERVRLDLAWTRDPGQRDRALDSLLVD
                     GLIEQTADGLFALAGEGER"
     CDS             446631..447254
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4300"
                     /old_locus_tag="nfa4300"
                     /product="putative carbonic anhydrase"
                     /protein_id="BAD55272.1"
                     /transl_table=11
                     /translation="MPRSNPISAWKSLREGNERFVSGNLLHPSQGAADRAKLVAGQHP
                     SAILFGCGDSRVAAELIFDQGLGDMFVVRTAGHVIDSSVLGSIEYGVAVLDVPLIVVL
                     GHDSCGAVKATIDALDGGEVPGGFIRSVVERVAPSILVGRREGLSSVDEMEARHVVET
                     SKLLMQRSMIISEKVESGQLAIACVTYKLAEGKVQLQRVVGNIGEVV"
     CDS             447453..448043
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4310"
                     /old_locus_tag="nfa4310"
                     /product="hypothetical protein"
                     /protein_id="BAD55273.1"
                     /transl_table=11
                     /translation="MVLALVIWLVLMVARGGDSPGDAAAATTTSTSSADRATETTKPS
                     GSADPSAPKSSGASTTAAAPVANQCPDQSLAVKVTVAQPTYRVGEQPVFGIVITNISA
                     EPCARDVGSAAQQVFVQTLDGTRRLWASTDCYPDGQPDVRTLDRGEQAAFQVTWSGST
                     SQPNCAGERVPVPPGAYSVVAQLGSVRSAAEPFNIA"
     CDS             complement(448069..449457)
                     /codon_start=1
                     /gene="sms"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4320"
                     /old_locus_tag="nfa4320"
                     /product="putative DNA repair protein"
                     /protein_id="BAD55274.1"
                     /transl_table=11
                     /translation="MAKTKAIFRCSACSHEVAKWVGKCPDCGAWGTVDEVAVSAGAPG
                     APGRRAMLPSTAAAPISAIDSQVTKARPTGVSELDRVLGGGVVAGSVVLLSGEPGVGK
                     STLLLEVAHQWARRPGEKALYVTAEESAGQVRLRADRTGAVHEQVFLAAESDLSIVLG
                     HVEQVRPTLLVVDSVQTMLAPEAEGVIGGVTQVRAVTAALTSLAKASGIAVLLVGHVT
                     KDGNVAGPRTLEHLVDVVLQFEGDKNSTLRMVRGIKNRFGSADEVGCFELHEDGIACV
                     DDPSGLFLHHRTDPVPGTAVTVAMDGKRPLVGEVQGLTVKTEIPAPRRAVSGLDYNRV
                     AMVLAVLQSRGRVFLGKHDVYAATVGGMRLAEPAADLAIALAIASAECDTALPAGWVI
                     LGEVGLAGEVRKVTGVARRLAEAERLGFTTALVPPGSERLKGATIRVHEVGDVRSALR
                     ISGLRGRKSGGD"
     CDS             complement(449555..450253)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4330"
                     /old_locus_tag="nfa4330"
                     /product="hypothetical protein"
                     /protein_id="BAD55275.1"
                     /transl_table=11
                     /translation="MPGRHGGQAVTALNSRLMVTVAAFAAGAALALSGCSAGQISQTA
                     NQASAINGNFADVEEISLRNVHIVFPGEGYTNTQGGKALLALSVVNNSETTADELTSI
                     TTDLGQVEITPPAGKSRFEIGPQQMVVAAPAQTGASAAGEHGDGHGSATTSPAPTTTA
                     QPAADQDEAEHALIEITGLTKDITPGLAYTVSFNFKENGTVQVQVPVDAGTEAERHES
                     PLSGPAPEGHGGGH"
     CDS             complement(450276..450542)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4340"
                     /old_locus_tag="nfa4340"
                     /product="hypothetical protein"
                     /protein_id="BAD55276.1"
                     /transl_table=11
                     /translation="MRLDNGAINCAGQGHNEGTAGVDRTAGVCITLCQNELSTGITCG
                     CPERMSWRSRGKPPRDPSTVMQRMPTRPCRRPRNQRARVDYYAA"
     CDS             450578..451066
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4350"
                     /old_locus_tag="nfa4350"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55277.1"
                     /transl_table=11
                     /translation="MIFKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDL
                     TVRVPAENAEYVGVRDVVGQEGLDRVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVN
                     KVAEVVRDLWRREQDRGLSAGEKRMLAKARQILVGELALAEGTDDGKAETLLDEVLAA
                     AS"
     CDS             451069..451761
                     /codon_start=1
                     /gene="mect"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4360"
                     /old_locus_tag="nfa4360"
                     /product="putative 2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase"
                     /protein_id="BAD55278.1"
                     /transl_table=11
                     /translation="MNDADNDGSVVALVPAAGRGVRLGEKSPKAFVPVGGTPMVRLAV
                     DGLLAAGVVDRIIVMVPAEWVESAVALLPPSEVVRVVVGGAERTDSVRAGLAAAPDAG
                     YFLVHDAARALTPPALIGRIVGELRAGRRAVVPALPVVDTVKSVDAAGVVTGTPDRAA
                     LRAVQTPQGFTADLLRAAYAADVPATDDAGLVERLGEPVHTVAGDPLAFKITTPLDLR
                     LAETLLDRRAAL"
     CDS             451819..452286
                     /codon_start=1
                     /gene="mecs"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4370"
                     /old_locus_tag="nfa4370"
                     /product="putative 2-C-methyl-D-erythritol
                     2,4-cyclodiphosphate synthase"
                     /protein_id="BAD55279.1"
                     /transl_table=11
                     /translation="MRVGIGSDVHPIEPGRPCWMAGLLFEGEDGCSGHSDGDVAAHAL
                     CDALLSAAGLGDVGAVFGTGRPEWADVSGAAMLTEVRRLLGEAGFEVVNAAVQVIGNR
                     PKIGPRRAEAQRVLGDLLDAPVSVSGTTTDGLGLTGRGEGIAAVATALLRPRV"
     CDS             452353..453756
                     /codon_start=1
                     /gene="cysS"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4380"
                     /old_locus_tag="nfa4380"
                     /product="putative cysteinyl-tRNA synthetase"
                     /protein_id="BAD55280.1"
                     /transl_table=11
                     /translation="MTLRLFDTESRTMREFAPLVPGRASVYLCGATVQGEPHIGHVRS
                     GVAFDVLRRWLQAHDYDVWFIRNVTDIDDKILNKAAEAGRPWWEWAATYERAFDRAYR
                     LLGVQPPSAEPRATGHITQMVELMRRLIERGHAYASAGNVYFDVQSYPEYGALSGHKL
                     DDVHQGESAGEGKRDPRDFTLWKAAKPGEPSWPSPWGPGRPGWHLECSAMAEFYLGAE
                     FDIHCGGMDLVFPHHENEIAQSKAAGDGFARYWLHNGWVTMGGEKMSKSLGNVLSVPN
                     MLTKVRAVELRFYLGSAHYRSMLEYSDKALDDAVAGYQRIEAFLHRTAERVGEIPVGK
                     WTDAFAEAMDDDLAVPRALAEVFRLVTEGNKALEAGAVDTARELGGQVRAMLGILGVC
                     PFDPQWDHKQDDSVAQTALDVLVRAELDRRQQARADKDWATADAVRDRLHAAGIDVTD
                     TPNGPEWSLRTARGKAN"
     CDS             453756..454730
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4390"
                     /old_locus_tag="nfa4390"
                     /product="putative tRNA/rRNA methyltransferase"
                     /protein_id="BAD55281.1"
                     /transl_table=11
                     /translation="MAGNSQRRGAVRKSGTKKGQVVGSGGKRRRGLEGRGATPPAEMR
                     TKHPAAKRAAAKAKAAAKAGPRGAAGRPAGRKNDDGPELVLGRNPVVECLRAGVPATA
                     LYVAVGTENDERLTESVKLAADTGISILEVPRTDLDRMSSNGLHQGLALQVPPYRYAH
                     PDDLAERARSSAEPALLVALDNISDPRNLGAVIRSVAAFGGHGVLIPQRRSASVTAVA
                     WRTSAGAAARLPVARATNLTRTLKDWANQGMQIVGLDAGGDTSLDEFDGTDPTVIVVG
                     SEGKGLSRLVRETCDSVLSIPMAGPVESLNASVAAGVVLSEIARQRRR"
     CDS             454854..455132
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4400"
                     /old_locus_tag="nfa4400"
                     /product="hypothetical protein"
                     /protein_id="BAD55282.1"
                     /transl_table=11
                     /translation="MVIPNQPIGTPIEHPHATAVLFLGAASILCCGVLGPVAWALGKR
                     ALDQIEASGGAIGGRVQVMVGYILGVVGTVLMIIMAVLFLLVVLGGNA"
     CDS             complement(455170..455979)
                     /codon_start=1
                     /gene="echA2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4410"
                     /old_locus_tag="nfa4410"
                     /product="putative enoyl-CoA hydratase/isomerase family
                     protein"
                     /protein_id="BAD55283.1"
                     /transl_table=11
                     /translation="MSSELLVDVSAGIAVLTLNRPAQQNAFTPTMAAELGAALARCDA
                     EDAIRAVVITGTPPAFCAGADLSHRVGEVSATIEPAPWRVRKPVIAAVNGHAVGLGLA
                     LALQCDLRYLARDAVYGLNQVRRGVLADGYAHWTLPRLAGMANAADIMLTGRTFDGEE
                     AKAMGLANACLAGGEVLPTALSVAHDLANGSAPLPVALSKRLLWESLGMTPGMVGRLE
                     SELNAHVAKSVDGGEAMAAFRDRRQPNWTGSISTEWPTWDENSEPDRPSLD"
     CDS             complement(455999..457180)
                     /codon_start=1
                     /gene="fadE1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4420"
                     /old_locus_tag="nfa4420"
                     /product="putative acyl-CoA dehydrogenase"
                     /protein_id="BAD55284.1"
                     /transl_table=11
                     /translation="MVATVIDFSIPADLAAERDRVRRFVIDKIVPFERDPRLTAHGPT
                     DELRQELVELARAEKLLTVQAPEEFGGRGLSHVEQAVIYEAAGWSTLGPVAMNCAAPD
                     EGNMYLLGKIADRDQIDRYLMPVINGHQRSVFAMTEPEGAGSDPGQLSTEAVFDGENF
                     VVNGRKWLITGADGAKTWIIMARLAPNPHLPEGPTLFLTDGDQPGIVIERTMNTMDRN
                     YVAGHGVVRFDNLTLPRSALLGEAGQALRYAQLRLAPARLTHCMRWLGAAERAQSIAV
                     QHARTRTAFGKTIGEHQGVSFMLADNEIALHQCRLTIWHACWLMDQGEKARHESSMAK
                     SYVSEELFKVADRCVQVLGGIGISDETVVEMIFRDMRAFRLYDGPTEVHKYAIGRKIL
                     R"
     CDS             complement(457262..458128)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4430"
                     /old_locus_tag="nfa4430"
                     /product="putative ABC transporter membrane protein"
                     /protein_id="BAD55285.1"
                     /transl_table=11
                     /translation="MDKLADVLGKMFDLSTTADLLSYDFVQQAVLAAALLGLLAGAIG
                     PLIISRQMSFAVHGTSELSLTGAAAALLAGIGVGIGAIAGSVVAAVLFGLLGTRARER
                     DSVIAVVLSFGLGLSVLFLWLGPERAGSKFSLLTGQVVAVGYSGLALLITCTVLVLAV
                     LAAIYRPLLFASADPEVAVARGVPVRALAVVFAVLLGVTAAFGVQIVGALLVLALLIT
                     PAAAAAQVTANPVLATVLAIVFAELAAVGGILLSLAPGVPVSTFVTAISFAIYLLCRL
                     IGARRRRSVAVR"
     CDS             complement(458128..458964)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4440"
                     /old_locus_tag="nfa4440"
                     /product="putative ABC transporter ATP-binding protein"
                     /protein_id="BAD55286.1"
                     /transl_table=11
                     /translation="MPAVRLRAARLSFGERTLWDGLDLDIRPGEFVAVLGPNGSGKTS
                     LLKVLLGQLQLTEGTAEVVGKPARAGNADIGYIPQQRTIDAGVQLRGVDLVGLGVDGH
                     RWGLGLRGRAERNRKVAAAVAAVGAQHYADAPLETMSGGEQQRLRVAQALVGDPEVLL
                     CDEPLLSLDLANQRLVAELIDKRRRSHDTAVLFVTHEINPILPLVDRVLYLVDGRFRI
                     GTPAEVMTSEVLSELYRTEVDVLRVRGRLVVVGTGDTLDALGSAGAEHCHAEPSHSGV
                     NA"
     CDS             complement(459090..460082)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4450"
                     /old_locus_tag="nfa4450"
                     /product="putative periplasmic solute-binding proteins"
                     /protein_id="BAD55287.1"
                     /transl_table=11
                     /translation="MWSPVVRNRITRFAGIALGAVTIAAATACSGGSDGGDRITVVAS
                     TNVWGDIAAAVAGPDAEVSSLISDPAADPHSYEVTAVQAAELSDADLIVYNGGHYDEF
                     IDKAIGGKNKRTVNAVEIAGGGADEHGHDHGAEGDAQAAPADGHDHGNHEHDAHEHDN
                     EHVWYDTHVAGEVAERIADSLGELDPDHRQAYADRAAAFTARLAGIDAVVDRIAAEHP
                     NQPVVQTEPLAQYLVLAAKADDRTPHEFQEAIEQGTDPSPAAVAAVRDLITTKQVRAL
                     IYNVQTEDKITKDIRALADTAGIAVVEVTETLPEGLDYIQWQTRNAEALATALA"
     CDS             complement(460216..462786)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4460"
                     /old_locus_tag="nfa4460"
                     /product="putative trehalose-6-phosphate phophatase"
                     /protein_id="BAD55288.1"
                     /transl_table=11
                     /translation="MSAQDLPQELRRALSTVAREPRLLVASDYDGTLAPIVSDPSKAY
                     PHRESVSALRALAGLTGTTAAVISGRALRDLAALSRLPVEVQLIGSHGSEFDVGFVHA
                     IDNDAKQLLHEVQAALTQIADDNPGASVETKPASVALHVRNAAPEIGRRALEAVRQGP
                     ARWVGVQVTEGKAVIELAVIQTDKGTALDTIRHQEGATAAVFFGDDVTDEKAFRVLSG
                     PDVGIKVGEGESLAKYRVDSTEAVACALAFLLEERRTWLAGASAPRIERLTMLASPRS
                     VALLTPDATVTWFCHPEPDSAAVFAHLLGGPQAGHFSVAPERPGLPLSQRYVDGTMTV
                     ETRWASLQVTDYLPHDVAPTRTDLTRVISGHARAVVTFAPRPEFGQVPVSLEADRDGL
                     KVLGTNDPMVLRSPGVQWRIDNDGVHDVATAVVDPAQGPVVLELRCGTHDLDPASASE
                     TERRREAERYWREWANSLELPPLKPDLMKRSALTLRGLVHAPSGSILAAATTSLPEDI
                     GGVRNWDYRYCWLRDAALTAQSLVTLGSLTEAEQFLGWVHRVLETLPGPERLHPLYTI
                     YGETLPPEAVIDQLPGYAGSRPVRVGNAANMQVQLDVFGPIVDLISTLAHARERKGIT
                     EPAKALPDADWELVHAMVAAVQRRWTEPDHGIWEIRGNPRHHVYSKVMGWLTVDRALT
                     LAQKFDRPVDPEWVSLRETIAEEVKSKGWNDEVQSFTAAYDGTDLDAATLHIGLSGLI
                     DPSDPRFAATVVATEAELRSGSTVYRYHHDDGLPGGEGGFHLCAAWLVEAYLLIGKRS
                     DAEALFAQLVDVAGPTGLLSEEYDPVAERSLGNHPQAYSHLGLLRCAQLLSQPVQVLV
                     "
     CDS             complement(463036..463671)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4470"
                     /old_locus_tag="nfa4470"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55289.1"
                     /transl_table=11
                     /translation="MASPSRSQPAAARPATVTTLSEDELSSAAQRERRKRILDATLAL
                     ASKGGYDAVQMRAVAERADVAVGTLYRYFPSKVHLLVSALAREFEQFESKRKPLAGAT
                     PRERMHLLLTQITRMMQRDPLLTEAMTRAFMFADASAAAEVDRVGKVMDRVFARAMND
                     GEPDERQLAIARVISDVWLSNLVAWLTRRASATDVSDRLELTVDLLLGDKE"
     CDS             463862..466003
                     /codon_start=1
                     /gene="fadE2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4480"
                     /old_locus_tag="nfa4480"
                     /product="putative acyl-CoA dehydrogenase"
                     /protein_id="BAD55290.1"
                     /transl_table=11
                     /translation="MRGWAGSVRPIATMRAEPEGFWRGYWPALADLGVFRVAVAEEAG
                     GAGATVADLAVLLEQAAHDLVGGPVLTTALANLVTSGALAEDLPCGVALDTLDTLDSV
                     AETGFSPESAQSLPALAETGSLSGSWPLVLGAAPGTAVLLPVRSADGRRWCLLPPDAP
                     GLRVEPLRPTDPSTPLAAVHCAETPVTAGQVFTAPHRVEDLLVVLAAAELAGLAGWCL
                     ETAVDYAKVREQFGRKIGSFQAVKHICAWMLCRTELIRAVALDAAAAVDEGGAELPIA
                     AAIAAAIALDAAVETAKDCIQVLGGIGFTWEHDAHFYLRRATALRQLLGGSARWRARV
                     TELTRAGHRRTTGADRVLAADGVQVDGAAATGLAREVAAIAALPAEQQRAALVDAGLV
                     MPHWPPPYGRGADPMTGLMISEELRRAGLAAPDLAIGGWAIPTLLQHGTQEQIDRFAW
                     PTLHGEVVWCQLFSEPEAGSDLAALRTTATRVDGGWRLRGQKVWTSLGDRANWAICLA
                     RTDAEAPKHRGISYFLVDMKSPGLEVRPLVQITGEARFSEVFLDDVFVPDDCLVGALN
                     NGWKIARSTLSAERIAMGGNGIGPALEELIAKLPATGPGAELIADRLGGFVADAIGGL
                     LLEQRAALTVLAGGDAGAQSSVRKLVGVRHRQAVAEFAVEVAGPLGAQETAEVTEFLL
                     TRCLSIAGGTEQILLTVAAERILGLPRDADS"
     CDS             466028..467092
                     /codon_start=1
                     /gene="fadE3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4490"
                     /old_locus_tag="nfa4490"
                     /product="putative acyl-CoA dehydrogenase"
                     /protein_id="BAD55291.1"
                     /transl_table=11
                     /translation="MDFTRDEGQDAVAEVVVGLLEREPARDMGLWPSLVETGLLGLAL
                     PERFGGDGMGQAEISVLLTELATDAVAVPALPTLGFGLLPLLPVLPDAVAEVVYPEVG
                     KGAVLTAALSEPGRPFTTSPKTTAVADGAVVRVSGHKIAVPYAEEARWLLIPTDAGIA
                     LVDGDAEGLTRTASPASGGLPECTVRLADVAIPAERLLPGNLADLHRYAVSAIGSVAD
                     GLLKGALTLTAEHLRTRRQFGRPLAEFQAVAQEVADLYVVSRTLHAVAVSASWALAQE
                     EGDADHRARVDDDLDVLAYTVAAELPAAMQKCHHLHGGLGVDITHPMHRYYSQAKDLA
                     RWLGGESLRLDRLGARCSSI"
     CDS             467077..468246
                     /codon_start=1
                     /gene="fadE4"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4500"
                     /old_locus_tag="nfa4500"
                     /product="putative acyl-CoA dehydrogenase"
                     /protein_id="BAD55292.1"
                     /transl_table=11
                     /translation="MFIDLTAEQRALRDELRSYFAGLVTPEEEAEMAVNRHGDAYRAV
                     VRRMGRDGWLGVGWPKEFGGQGFGPVEQQIFYNEAVRADVPLPLVTLLTVGPTLQVYG
                     TEEQKQKFLPAILTGDIHFAIGYSEPEAGTDLAALRTSAVRDASGDWIVNGQKIFTTG
                     AHEADYIWLACRTGTVESRHRGITILIVDTKDPGYSWTPIITCDGAHHTNATYFDNVR
                     VPANMLVGEENRGWQLITTQLNHERVGLGPSGKIEQLYDRVREWAAAQGVLAEPDVRR
                     TLGRVHAMVRLNELLNWQVAGTAERADADQSQVIADASATKVFSTEKLQEAGRLVEEI
                     VGRYGDPAEPATAELLGWLDRRTKQNLVVTFGGGVNEIMRELVATAGLKLPRVPR"
     CDS             468289..469221
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4510"
                     /old_locus_tag="nfa4510"
                     /product="hypothetical protein"
                     /protein_id="BAD55293.1"
                     /transl_table=11
                     /translation="MPDTTTPEAIVAAAEQIIAAGECAPRLARDPVNQPMINNWVEAI
                     GDTNPIYVDEAAARAAGHPGIVAPPAMAQVWTMFGLGGVRPPDDPMAQTNDLLDAAGY
                     TSVVGTNCEQIYHRYLVPGEQVTVTSRLDSISGPKRTGLGEGWFVTFRTLWYVGDELV
                     TEMLFRILKFAPRPAAEQPAGERVKPLVSHDTEFFWAGTKLGELRIQRLPDGTLRHPP
                     IPAVWKDKSEQTDYVVASGRGTVFSYVVHHAPKVPGRQLPFVVALVELEEGVRMLGEL
                     RGIDPGEVRVGLPVEVAFEQLDDDATLPYWKVTA"
     CDS             469218..469655
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4520"
                     /old_locus_tag="nfa4520"
                     /product="hypothetical protein"
                     /protein_id="BAD55294.1"
                     /transl_table=11
                     /translation="MTETTDAPPIPARIEVGTTLPELVIHADPTFVISTAIATRDFQD
                     VHHDRDKAVARGSKDIFVNILTDTGLVQRFVTDWAGPRAVVKSIALRLGVPLYAGDTL
                     TLTGTVTEVSDTDVTIAVVGRDSLGDHITATAVIGFTGGSLDQ"
     CDS             469645..470841
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4530"
                     /old_locus_tag="nfa4530"
                     /product="hypothetical protein"
                     /protein_id="BAD55295.1"
                     /transl_table=11
                     /translation="MTSKSPADRSPLSGRAAIVGIGATDFSKESGRSELRLAAEAVHA
                     ALADAGLTAADVDGLTTFTMDNNTQAAVARATGIPQLTFFSHIGYGGGAACATVQQAA
                     MAVATGVAEVVVAYRAFNERSVSRFGQFSTALATAPTSSGIDAGWSYPHGLGTPAAQV
                     AMVARRYMHVYGATSEDFGRVAVADRKHAAVNPDAFFYGKPITLEDHQRSRWIAEPLH
                     LLDCCQESDGGVAIVVTSVERARDLPQKPAVIVGAAQGSGADQYVMTSYYRDAMTGLP
                     EMGLVGQQLWAQSGLGPQDMQAAILYDHFTPFVLMQLEELGFCGRGEARDFIADGAIE
                     HGGRLPLNTHGGQLGEAYIHGMNGITEAVRQIRGTSVNQVEGLANIVVTAGTGVPTSG
                     LVLSAG"
     CDS             470887..471342
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4540"
                     /old_locus_tag="nfa4540"
                     /product="putative MutT family protein"
                     /protein_id="BAD55296.1"
                     /transl_table=11
                     /translation="MTVRHFVDVHVLLVRDGSLLLSRRRSADRFDGRWHLPAGKLEAG
                     EPARAGAAREALEEVGVRIDPADLRLVHTAHVVDVGLEPRLGLFFLAERWTGEPVNRE
                     PDKCYELRWFALDALPADVIDYPAAGVRALRSGRPYSEIGWAAVPPGES"
     CDS             complement(471339..471923)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4550"
                     /old_locus_tag="nfa4550"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55297.1"
                     /transl_table=11
                     /translation="MSTDDRRTQIVATAVDLIADAGIRALTHRALDRALALPAGSASY
                     YFRTRRALLAGVVDHIAERSRADFREAGLTASDDVDAVADGIGNWLDDLLAARRAQLL
                     VRHALILELGADTELRERLAAGLFAVERVRELFAAWGIGDPHRAALDFVAVLEGAVFD
                     RFAGHRRALVAGTAESRAQLTGLVTAYLRGVRGR"
     CDS             471981..472949
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4560"
                     /old_locus_tag="nfa4560"
                     /product="putative ATPase"
                     /protein_id="BAD55298.1"
                     /transl_table=11
                     /translation="MTTGGVAVSGIVELDAGQRAAADRLAALLDGGRPRRRARGVYLH
                     GRPGRGKTMLMDHLLAATRTRTRRWHFHEFFALLHRARQDAGSVDGALTALIGDAELV
                     CFDEFHADDIGDAMLMARLLDALFARRVPLVVTSNQRPEQLLPNPLFHDRFLPVIAAI
                     RAHLDVVAVDGPLDYRRHGSGRTAAGFAAGRYLLGGPPCAATTAVRIGAHTVPVHAAT
                     AGTLVASFTDLCGSAVSAADYVALAARFERWVIGAVPLLRTVHADLVTRWIALIDVLY
                     DADRPVIVHAAAPPAALAAGMPAGSDLDRTVSRLYEISQPAARGTV"
     CDS             473072..474043
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4570"
                     /old_locus_tag="nfa4570"
                     /product="hypothetical protein"
                     /protein_id="BAD55299.1"
                     /transl_table=11
                     /translation="MVVMLVARARAPMTRVIVLIMLIAVATVALRGHIPGAPAAGPAE
                     PGPPSALTVALMPVLLTVSIVVLLAGVLASQHRLPLSMPEPEREPEPVQWRLGRTGLL
                     VLAALTAFALLVAAASVVVFVVLPAQAPTEPAPATGSGAPPEPAPTGAPSPGSGAAEL
                     SGTALTLSVVAAVALVAVACAGLLAVALATRRRARETVLVEAPAPPAEVGSLARAAEM
                     GLAAMNAPGQDPRTAIIACYVAMERGLASGRAAAPLASDTPMEVLARAFERGALHDTS
                     ARELVALFEEARFSPHAMLEWQRMRAEQLLRVVLADLQGEMPQEETV"
     CDS             474040..474537
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4580"
                     /old_locus_tag="nfa4580"
                     /product="hypothetical protein"
                     /protein_id="BAD55300.1"
                     /transl_table=11
                     /translation="MTRTAVAVTAIGAVLLLEAIAAARLREALLPLAAVPVAIALVLL
                     LASLRERTARAADDRADEIDNGPVEMLRRWEARAQMLADRADGTRADWDRHLRPLLAK
                     EFELSAGMRVAKNRRAMEAAGLHQFGPELWRWVDPANSELRDQTTPAPGRAALDEILH
                     RLQRM"
     CDS             474548..475510
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4590"
                     /old_locus_tag="nfa4590"
                     /product="putative regulator"
                     /protein_id="BAD55301.1"
                     /transl_table=11
                     /translation="MTMPLDVTVQRAEAVLRELSRVVVGKQEELRLIMIAVLSGGHVL
                     IEDLPGLGKTLIARSFAAALGLDFTRVQFTPDLLPADLLGSTIYDMNSGRFNFRRGPV
                     FTNVLLADEVNRTPPKTQAALLEAMAEGQVSIDGETFPLPQPFIVLATDNPIEYEGTY
                     PLPEAQLDRFAVQLRLGYLSEADETQMIRRRLERGSVQPEVDQVVDAHALLEMRQSVE
                     YVSVHPDVVGYVVALAGATRGHPQVEVGASPRAELDLVQMARARALLLGRDYVIPEDV
                     KALAIPAMAHRITLRPEMWVRRVRGEDVIGELLRRLPVPRATTT"
     CDS             475507..476781
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4600"
                     /old_locus_tag="nfa4600"
                     /product="hypothetical protein"
                     /protein_id="BAD55302.1"
                     /transl_table=11
                     /translation="MRHRDAETTVEAELRWQPAPLVYMLAGCAAVALLAAVVFARWQP
                     MVFAAPLLGVLATAPWQRSPTRIEVDGGGTQRCFETEEVVCTVAAFVESGHALLRITP
                     EPVPGLDVTIEETSDSGAAPAGLRLALSASRWGRYPLSVRVSALSPAGLAVATEILPA
                     GELFVYPVTDPQLMRMPRTELPERLGTHLTRRHGPGVEYADIRAYTPGDQLRTVNWPV
                     SARRGRLYVTERLTNRSADVVVLIDTSLQAPGPASDALELSVRGAAQVVQSTLSAGDR
                     TAVVCLGEQPRWLRPDIGRRQFYRIVDTVLAVGDEHIPTTGTLAPHAAVPLGAIVVAF
                     STLLDTQFALALIDLRKRGHVVVVVDVLRGTPFRDGLDPTLARMWHLERATMYRDMAA
                     IGVDIVPWPEDVRLDQVMRLLPEHRRSTRVRR"
     CDS             476778..477236
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4610"
                     /old_locus_tag="nfa4610"
                     /product="hypothetical protein"
                     /protein_id="BAD55303.1"
                     /transl_table=11
                     /translation="MTRFLAALAGALLVAAVALIFAPAALPALVLVVLSWWFRSAAVG
                     AVLLTVAVLALAADIGVVEAAATGLVATAYLLNAATVAAPAGVVPTTLPSVLGAVGGT
                     ACAATAAVLPLHLAWLPALAPVAVIALYAVLVPTLTPRPTPAAAPSPRRE"
     CDS             complement(477323..478183)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4620"
                     /old_locus_tag="nfa4620"
                     /product="hypothetical protein"
                     /protein_id="BAD55304.1"
                     /transl_table=11
                     /translation="MPIDPSVALGAQLPSREFAWTPSDVQLYHLGLGAGTRWTDEAEL
                     RYLDDREPQVLPTFATVAQTLHETEPPKVSFPGIDIDLAKVVHAHQEVQVHRPIPAAG
                     KATSTGRISELWDKGSAAVIVQEHTITGSDGAPLWTTRSSIFAKGEGGFGGERGPSTR
                     TELPDRDPDAEVAIPTLPQQALLYRMLGDRNPLHSDPAFAKAAGFPAPILHGLCTYGL
                     VCKAATDTVLDSDATRVTGFRARFAGVLFPGETIRARIWRGAGELTIAATVADRDDAP
                     VLGDVTLTFQ"
     CDS             complement(478396..480111)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4630"
                     /old_locus_tag="nfa4630"
                     /product="putative 3-ketosteroid 1-dehydrogenase"
                     /protein_id="BAD55305.1"
                     /transl_table=11
                     /translation="MTDPVLDPHSYDVVVVGSGAAGMTAALTAAHHGLRVVVLEKAAH
                     YGGSTARSGGGVWIPGNKALRASGRPDDREEARTYLHSIIGDVVPKERIDTYIDRGAE
                     AFDFVLDHTPLQMKWVPGYSDYYPEAPGGRGEGRSCEPKPFDLKVLGPEKDKLEPAYA
                     KAPLNVVVMQADFVRLNLIRRHPKGMLRAMRVGARTYWAKFTGKHIVGMGQAIIAAMR
                     KGLMDANVPLLLNTPMTKLVVEDGRVTGVEALHEGEPVVFSARYGVVLGSGGFEHNAE
                     MRAKYQRQPITTEWTTGAAANTGDGIRAGMEIGADVDFMEDAWWGPTIFKGGRPWFAL
                     AERNLPGCVIVNAQGKRFANESAPYVEAVHAMYGGEYGQGEGPGENIPAWLVFDQRYR
                     NRYIFAGLQPGQRFPSRWMEDQNIVKADTLAELAELIGVPVGNLTATVERFNKFAETG
                     KDEDFGRGDSHYDRYYGDPTVKPNPCLAALVQGPFYAAKIVPGDLGTKGGLVADESGR
                     VLREDGSPIPGLYASGNCSTPVMGHTYAGPGATIGPAITFGYLSVLDILARKNEQSPA
                     ASGTA"
     CDS             480220..481854
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4640"
                     /old_locus_tag="nfa4640"
                     /product="hypothetical protein"
                     /protein_id="BAD55306.1"
                     /transl_table=11
                     /translation="MASRVQASADADLAADVVVIGFGAAGACAALEATAAGAQVLVLE
                     RFTGGGTSALSGGIIYAGGGTSVQRAAGVSDTPEQMLAYLTREVGDAVAPETLRRFVE
                     ESPAMIDWLQGHGVPFEPSLCPYKTSYPNDKYYLYYSGSEVSGYGREVAEPAQRGHRV
                     KGRGTSGKKLTGPLAASAARHGVRVETLTTATRLITDADGAVVGVECRTLRDAPAAVR
                     DRYVRMAKVAAKPGIYYPPLRKNLERRLEALDRRYGTTIRVHARRGVIVSAGGFIANR
                     ELVHRYGPQYRHGLELGSTGDDGSGILMAQEVGAATDRMGNISAWRFILPPSAFTGAL
                     LVDAEGRRVIDETRYGAAVGHKLVNEHDGLGWVLADDERMRLGIAQMRTQPAWFQRAQ
                     FEVMRRKAIRGATLEDAARKAGIDPAGLRATVEAHNAAIAAGAPDPVGKPAEFCEPVR
                     SGPYWLLDVGIKPSVINPCPMLTLGGVVVDETTGAVRSTAGHDIPGLFAAGRTAVGIC
                     SDSYVSGLSLADCVFSGRRAGRSAAGVLEQASAEGN"
     CDS             481856..482641
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4650"
                     /old_locus_tag="nfa4650"
                     /product="putative hydratase"
                     /protein_id="BAD55307.1"
                     /transl_table=11
                     /translation="MLSDAVRTELADELWRAETERVAIDPLVARHPDIDVVDAYEIQL
                     INIRRRLDTGARVVGHKVGLSSLAMQQMMGVDEPDYGHLLAEMEVFEDVPVEAGRYLF
                     PRVEVEVGFVLGADLPGADCTEADVLAATVAYAPAIELIDSRIKDWNIGLCDTISDNA
                     SSAGFVLGPQRVAPADIDIKAIDAVLTRNGEVVAEGRSDAVLGDPVIAVAWLARKVAS
                     FGVRLRKGDIVLPGSCTRAIDARPGDTFHAEFAGLGSVRLQFT"
     CDS             482652..483560
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4660"
                     /old_locus_tag="nfa4660"
                     /product="putative acetaldehyde dehydrogenase"
                     /protein_id="BAD55308.1"
                     /transl_table=11
                     /translation="MSNGTVTAAIVGSGNISTDLLYKLLRSQAIEPRWMIGIDPESEG
                     LKRARGLGLETSHEGVDWLLAQSELPDMIFEATSAYVHRAAAPRYAEAGIRAVDLTPA
                     AVGPAVVPPVNLGANLDAPNVNMITCGGQATIPIVAAVSRVVPVPYAEIVASVSSVSA
                     GPGTRANIDEFTKTTSRGVETIGGAQRGKAIIILNPAEPPMIMRDTIFCAIPEDADTD
                     AIADSIHRMVADIQQYVPGYRLLNEPQFDEPSVVSGGLAKVSVFVEVEGAGDFLPPYA
                     GNLDIMTAAATKVGEVIAGQITSARV"
     CDS             483574..484611
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4670"
                     /old_locus_tag="nfa4670"
                     /product="putative 4-hydroxy-2-oxovalerate aldolase"
                     /protein_id="BAD55309.1"
                     /transl_table=11
                     /translation="MAYSAELDIRVTDTSLRDGSHHKRHQFTATEVRDIVAALDGAGV
                     PVIEVTHGDGLGGSSFNYGFSKTPEQELVTIAAQTAKQAKIAVLMLPGVGVKEDIKVS
                     QDNGASICRIATHCTEADVSIQHFGLARELGLETVGFLMMSHTQPPEVLAKQARIMAD
                     AGCQCVYIVDSAGALVLEQVSDRVAAVVAELGDDAQVGFHGHENLDLAVANSIYAIRA
                     GATQIDGSARRFGAGAGNTPVEALVGVCDKLGIRTGIDFFAIADAAEDVVRPAMPQEC
                     LLDRQALMMGYAGVYSSFLKHAERQAERYGVSAAEMLVRAGRRKLVGGQEDQLIDIAL
                     ELQREQQTATV"
     CDS             484799..485662
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4680"
                     /old_locus_tag="nfa4680"
                     /product="hypothetical protein"
                     /protein_id="BAD55310.1"
                     /transl_table=11
                     /translation="MTHGDEFWRKRTAASQGAYEIPPLEREGEQKPERPRKYKRWSEL
                     DFLSKAFLVFLVGWSCAIVLGGVAGLVSAMAAFRDEPSTTSAAAATSRSLLPPVTTTT
                     KPPSTTAPVHPGHQGVAVPARGIAYDVPAGWQVDNADTIRGFETEAGRVTGTGGAVDG
                     PNYCGAELRTVSYVSRSKAPDLATAATDFATDAAELGYAGSNWAQQSIGPVPLTTATG
                     ITGQMVEVTGPRTPKDPTCPGAEFSVYTFAFAGPDNPILVLTLAADRGVPGELTPAQA
                     REIFTTVRLLE"
     CDS             complement(485753..486139)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4690"
                     /old_locus_tag="nfa4690"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55311.1"
                     /transl_table=11
                     /translation="MAASPAKIFEALGDPIRRHLLELLAAGEQPAGALVAAVQQHAAI
                     SQPGVSQHLKTLRDAGLVTVRAEGTRRLYALDPTGLDTARTWLTTLLDPLHPFTQPLD
                     ALATEVARGKRTRRTRSDSETTARGA"
     CDS             complement(486139..486795)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4700"
                     /old_locus_tag="nfa4700"
                     /product="hypothetical protein"
                     /protein_id="BAD55312.1"
                     /transl_table=11
                     /translation="MALLTDPVATAGLVTREVRTGSRAGVPTRIAVARRSYPTEQADL
                     WDALTNAERLPRWFLPITGELGVGGRYQLEGNAGGIVEECDEPRQFAVTWEMGPQVSW
                     LRVTLTPGDDGTVLELEHEAPVDPQMWEQFGPGAVGVGWDLALMGLDEHVRTGEPVDT
                     DAALTLHTTPDGITFIRTAAESWADAAIADGDDPTTAHTAAEQTIVFYTTEPEEGAES
                     "
     CDS             complement(486868..487455)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4710"
                     /old_locus_tag="nfa4710"
                     /product="putative oxidoreductase"
                     /protein_id="BAD55313.1"
                     /transl_table=11
                     /translation="METNVTADANPVIDPRQFRTVLGQFCTGITVITTFGADAAPVGF
                     ACQSFAALSLDPPLVLFCPTKGSRSWAAIERSGRFCVNILAEAQQPVCARFGSREEDK
                     FAGTSWHTSELDLPVLDDALATVECRVDSVIDGGDHYIVIGRVLALSESTDSGRPLLF
                     YRGQYTAIEPEKTTPAPWRADLDHFLTTTTLDTWL"
     CDS             complement(487502..488410)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4720"
                     /old_locus_tag="nfa4720"
                     /product="putative ring-cleavage dioxygenase"
                     /protein_id="BAD55314.1"
                     /transl_table=11
                     /translation="MGIRSLGYLRIQATDMAAWREYGLKVLGMVEGKGGDPNSLYLRM
                     DEFPARLVIVPGEADRLLVSGWETANAEELQDIRDRLDRAGVPYKEGTEAEKADRRVY
                     ELISFEDPSGNVLEAFHGVALEHRRVVSPYGHRFVTEEQGLGHVVLSTKDDKAALEFY
                     RDVLGFRLRDSMRMPPQMVGRPADGEPAWLRFFGCNPRHHSLAFLPMPTPSGIVHLMI
                     EVENADDVGLCLDRALRRKVKMSATLGRHVNDKMLSFYMKTPGGFDVEFGCEGLEVDD
                     SDWIARESTAVSLWGHDFSVGMREQQ"
     CDS             complement(488413..489294)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4730"
                     /old_locus_tag="nfa4730"
                     /product="putative hydrolase"
                     /protein_id="BAD55315.1"
                     /transl_table=11
                     /translation="MTSTAELTYESTSRYAQVRPDLKLHYHEAGVGNGPTIVLLHGGG
                     PGASSWSNFARNIPVLAQNFHVLAVDQPGFGRSDKPVDHPQYFSHSAAALKDLLDTLG
                     VTERVHLLGNSLGGGAAVRFALDYPDRAGKLVLMGPGGLSMNAYAPDPTEGVKLLSRF
                     NFEPTRQNLEAFLRIMVFDQKLITDELIDERFASAATPEALAATRAMGKSFAGPDFEL
                     GMLWRDAYKLRQPVLLIWGREDRVNPLDGAIVATKMIPRVQLHVFGGCGHWAQLEKFD
                     EFNRLATDFLSGPGKES"
     CDS             complement(489294..490457)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4740"
                     /old_locus_tag="nfa4740"
                     /product="hypothetical protein"
                     /protein_id="BAD55316.1"
                     /transl_table=11
                     /translation="MTQEVTERVEALLPTLRERAQEAEDLRRIPDETMKSLQETGFFR
                     LLQPKQWGGYAADPVVFYDTVRRIAAACGSTGWVAGIIGVHNWHLALFDQQAQEDVWG
                     EDTEVRISSSYAPMGAGTAVEDGYRVSGSWAWSSGSDHATWVVVGGPVIKDGKPVDFG
                     SFLIPRSDYRIDDVWNVVGLRGTGSNTVVVEDVFVPRHRFLSFRAMNEMKSPGLERNT
                     DPVYKMPWGTIHPTTISTPIVGMAYGAYAAHVEHQGKRIRAAYAGEKAKDDPFTKVRV
                     AEASSDIDAAWRQLSGNVAEEYALLKEGKEVPFDLRVRARRDQVRATGRAIASIDKLF
                     EASGATALANGTPLQRFWRDAHAGRVHAANDPERAYVMYGTHEFGLPVTDGMV"
     CDS             490657..491874
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4750"
                     /old_locus_tag="nfa4750"
                     /product="putative oxygenase"
                     /protein_id="BAD55317.1"
                     /transl_table=11
                     /translation="MADTPKGGAKVRELDVGTTPTRYARGWHCLGLAKTFRDGKPHAV
                     EVFGTKLVVWADSAGELRVLDAYCRHMGGDLSMGEVKGDDIACPFHDWRWSGVNGKCT
                     AIPYARRVPPLARTRKWTTLERNGQLFVWHDHEGNPPPPEVTIPYIEGPYADAEGNPK
                     DGHDSGWTEWTWNSLLIEGANCREIIDNVVDMAHFFYIHFAFPTYFKNVFEGHVATQF
                     LETKGRPDVGMAAKYGGETLLKSEASYFGPSYMINPLTNIYGGYEIKVVLINCHYPVT
                     QDSFVLQWGLTVEKPTGIDDATAEKLAKSMTEFFGTGFLQDVEIWKHKSKVENPLLCE
                     EDGPVYQLRRWYEQFYVDVADVTEKMTQRFEFEVDTTKANEAWEAEVAENLRRKREAE
                     EAEQAKKEAEAGV"
     CDS             491874..492206
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4760"
                     /old_locus_tag="nfa4760"
                     /product="hypothetical protein"
                     /protein_id="BAD55318.1"
                     /transl_table=11
                     /translation="MGASWAKAPDFADQPARRAAVQAQTALDKQRYLEDGMTPLHCQG
                     CHSRVLVRKYSAHQTSVEWTEPPATRCPVFARLAESGAAPGRPDTCPSLEKTIKWAVD
                     EGVLPIPE"
     CDS             complement(492360..493601)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4770"
                     /old_locus_tag="nfa4770"
                     /product="putative transporter"
                     /protein_id="BAD55319.1"
                     /transl_table=11
                     /translation="MSTATHARPSAPASTRQPKAVWAVAFASVIAFMGIGLVDPILKP
                     IGEQLHASPSQVSLLFTSYMAVTGIAMLVTGVVSSRFGAKKTLLAGLAIIVVFSALAG
                     MSDSIGQIVGFRAGWGLGNALFIATALATIVGAASGGVAKAIILYEAALGIGIAAGPL
                     LGGVLGDISWRGPFFGVAALMAIAFVAIVALLPELPKPAQPTSLAAPFRALRHRGLLI
                     VSITALLYNFGFFTLLAYTPFPLDMGSYAIGFIFFGWGVLLAITSVFAAPRLQRRFGT
                     LPMIATVLGLFALDLAVMAMFAEHKPVLIVGVVLAGAFLGVNNTLITEAVMISAPVER
                     STASAAYSFVRFAGGAVAPWLAGKLGEHMVALPFWVGAACTAAAVAVLLLGRNALAHI
                     DDHDPAPHSITEAQAITLGDD"
     CDS             complement(493598..494080)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4780"
                     /old_locus_tag="nfa4780"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55320.1"
                     /transl_table=11
                     /translation="MWVRHAAVTRTDDTVVDLVVAASRLTRLAGAIADDDLPRATARA
                     LAVLDEHDAVRVSEFARNYGSSQPAATALLGRLVDAGYASRSKDPADSRAVVVALTPA
                     GRERLARVRAAYGTAMTARLADGIDPERLRSAHDVMTELLAALSTPAPRPDPSRTPHP
                     "
     CDS             complement(494196..495251)
                     /codon_start=1
                     /gene="fadE5"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4790"
                     /old_locus_tag="nfa4790"
                     /product="putative acyl-CoA dehydrogenase"
                     /protein_id="BAD55321.1"
                     /transl_table=11
                     /translation="MSESELKEFADSVRALLGKHAQPAAVRAAMDTDLGYDPALWRLL
                     CEQIGVAALAIPEEYGGIGASLVESLLVVGELGRTLAGVPMLGSAVLGAQALLLSGDD
                     EACARLLPEVAEGGRTLAVCWAGPRGWDEPGVRAGGESLSGTAHYVLDAAGAGTLIVV
                     TTEGLFEVAADAEGVARRVVPTLDPTRKLAEITFAEVPARRLGTGDPAPVMARLREVA
                     WAAVAAEQVGAAQRCLEMTVEYTKSRVQFGRPIGSFQALKHRMADMYVLVESAKSASR
                     LATESVATGAESAAEDVWVARAQCSRAFTDVVAETVQMHGGIAITWEHDAHLFFKRAH
                     GDAQLFGPARRPLPLTA"
     CDS             complement(495248..496276)
                     /codon_start=1
                     /gene="fadE6"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4800"
                     /old_locus_tag="nfa4800"
                     /product="putative acyl-CoA dehydrogenase"
                     /protein_id="BAD55322.1"
                     /transl_table=11
                     /translation="MRFALSPEQADFAASVRKLLDAGRTPAAVRAWAAGDREPGRALL
                     GQLAEQGVLGLAIDEDNGGMGAEPIDLVVAFVELGRAAAPGPLVESAAAIPALLQALP
                     DADAAQRWLPGIAEGSALATISFESAGTTVALDAEAADVVFVVSGDRVTVGRATGEVR
                     SVDPARRLSTVEPGETVAEGEPARAAVARAFDAGVLACAAQQLGAGRALLHAATEYAK
                     QRKQFGRPIGEFQAVKQKLADVLIALDLAEPLLYRAALTFDEPSRERDVSAAAVACGD
                     AAYTAARAALQVHGAIGYTAEYDLSLWLTKVTALRSAWGTADVHRGRIARALREEALR
                     ERALRGTA"
     CDS             complement(496273..497415)
                     /codon_start=1
                     /gene="fadE7"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4810"
                     /old_locus_tag="nfa4810"
                     /product="putative acyl-CoA dehydrogenase"
                     /protein_id="BAD55323.1"
                     /transl_table=11
                     /translation="MDLELDQAAQDFQREVREFLAANKPAQPLPSMDTKAGFEAHRDW
                     ERTLAEARFSVVSWPREYGGRDASLLEWVLFEQEYYAAQAPGRVSQNGIFLLAPTLFE
                     HGTPEQLDRIMPRMARGDDIWAQAWSEPEAGSDLAGIRSTARRTEGGWLLSGQKTWSS
                     RASFADWAFGLFRSDPEAERHKGLTYVMFPLTAEGVSVRPIPQLDGEPGFAEIFLDDV
                     FVPDQDVIGAPGEGWRVAMSTSSNERGLSLRSPGRFTATASRLIDLWLERGERTDTAQ
                     RDAVVDAWIRSEAYRLHTFGTVTRLNEGGKLGAESSITKVFWSELDIAMHETALDVLG
                     ADAELAGRWTDGYLFALSGPIYAGTNEIQRNIIAERLLGLPRGSSR"
     CDS             complement(497415..498308)
                     /codon_start=1
                     /gene="echA3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4820"
                     /old_locus_tag="nfa4820"
                     /product="putative enoyl-CoA hydratase/isomerase family
                     protein"
                     /protein_id="BAD55324.1"
                     /transl_table=11
                     /translation="MMSDQPAGVPDEGEVVTYERRGRVAIVTMNRPDYRNAQNSVMTY
                     ALDAAFERAVEDDEVGVIVLAGNGKHFSAGHDIGTPGRDHHVRYQNKATLWWDHVDKA
                     GGDQRFARESEVYLGMCRRWREIPKPTIAMVQGACIAGGLMLAWVCDLIVASDDAFFS
                     DPVVRMGIPGVEYFAHPWVLGPRAAKEFLFTGDRFGAAQAKEWGMVNRVVPRAELEAE
                     TMALAEKIAAMPRFGLALTKKAVNQAEDLMGMRTGMDSVFGLHHFAHAHNAEVGADSL
                     GGMNARSMRDSARTAEQNGTA"
     CDS             complement(498305..499861)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4830"
                     /old_locus_tag="nfa4830"
                     /product="putative acyl-CoA synthetase"
                     /protein_id="BAD55325.1"
                     /transl_table=11
                     /translation="MTPPAQTTPMALHDAARTHGAAPALADGEVRLDWTQLLAEVQRT
                     ARALIARGVRRGDRVAIWSPNTYHWVVAALAAHYAGAALVPLNTRYVADEAADVLGRV
                     RPAALFVAGTFLGRDRLTELRAAAPDLAIETVVVIPVEPGTSVPTDARTLNWPDLDAA
                     AETVTPAEAEQRAREVDPEDLSDILFTSGTTGRSKGTLVAHRQAMSVVRAWAERATLR
                     ADDRYLVVNPFFHNFGYKAGFLACMVTGATIVPQVTFDVPRTMQLIGSERITVLPGPP
                     TIYQTILDFPGRESYDLSSLRVAVTGAATVPVVLIERMRSELAFDVVLTAYGLSESAG
                     FGTMCSPDDDAVTVANTCGRPIADFELKLSEAGEVLLRGPNVMLGYLDDPEATAETID
                     AEGWLHTGDIGTVDERGYLKITDRLKDMYISGGFNVYPAEVEQALARLDGVAESAVIG
                     VPDERMGEVGKAYVVRKPGAELTEEQVIAHAKTVLANFKVPRFVEFRDQLPYSAAGKV
                     LKRQLREEKQ"
     CDS             499952..501142
                     /codon_start=1
                     /gene="fadE8"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4840"
                     /old_locus_tag="nfa4840"
                     /product="putative acyl-CoA dehydrogenase"
                     /protein_id="BAD55326.1"
                     /transl_table=11
                     /translation="MVAIQTSESGTAAQDAAFCAEVREWLAENLDGEFRELRGLGGPG
                     REHEAFDERLAWDRHLAAAGWTCLGWPKEYGGREASVRQQVIFHEEYARANAPARVSH
                     VGEELLGPTLLAFGTEAQKQRFLPGIRTVSELWCQGYSEPGAGSDLAAITTAAHLDGD
                     QWSINGQKIWTSLAHVADWCFVVARTEKGSSRHKGLSYLLVPMKQPGVEVRPIIQLTG
                     TSEFNEVFFDDARTDADLVVGEPGDGWKVAMGTLAVERGISTLGQQIRFARELADIEA
                     LARRTGAADDPLIADRIDRAWVGLRVLRAHALRTMEGGGIDESGQASVAKLLWANWHR
                     GLGELAMAVRGAEGLVAGEGDLDEWQRLYLFTRADTIYGGSNEVQRNIIAERVLGLPR
                     EARP"
     CDS             501139..501936
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4850"
                     /old_locus_tag="nfa4850"
                     /product="putative short chain dehydrogenase"
                     /protein_id="BAD55327.1"
                     /transl_table=11
                     /translation="MSGPLSVAPQPIPGHGLLTGRVAVITAAAGTGIGSATARRLLAE
                     GADVVISDWHERRLGETEVELKGEFPERRVAAIACDVQSTTQVDELVRGAAAALGRID
                     IMVNNAGLGGETPVVDMTDEQWDRVLDITLNGTFRCTRAALNYFRAAGHGGVIVNNAS
                     VLGWRAQYGQAHYAAAKAGVMALTRCSAIEAAELGVRINAVAPSIARHAFLDKVSSSE
                     LLDRLSEREAFGRAAEPWEVAATIAMLASDYTTYLTGEVVSISSQRA"
     CDS             502001..502237
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4855"
                     /old_locus_tag="nfa4855"
                     /product="hypothetical protein"
                     /protein_id="BAD55328.1"
                     /transl_table=11
                     /translation="MAGYIGECLDEVDAKVATLSGTGWEGVAAQAYVDAHVQWLAGAR
                     AFAEGVRDMSDAARVAHARYTRAVETNHKMFNGG"
     CDS             502369..503559
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4860"
                     /old_locus_tag="nfa4860"
                     /product="hypothetical protein"
                     /protein_id="BAD55329.1"
                     /transl_table=11
                     /translation="MAGDTAGCEAWAAAYDRATLGTLQTCTNLADALTNLGNMLYAAG
                     YNWALSNKSNPMPDVPSASAMTEHKVTIPSSKGSDGDGVIEGQGSIPGFYDALVGEVQ
                     KEFGSKLPNGNKQKLAAAAAVWRTFADHPSVSGAAARIAEISSLFDDIRDKDGGLQGL
                     LGHLTTLHGGATQLASASVNIAAPVGDYSTATAEVRDAFKSAVTNALIAAGTTVVIGV
                     AASWITAALSNVAAGVGVVAIAGNTARVLKSAYDASKLYRIIGAAAATAGATTFAITA
                     FDGVPDLTQVAAELAAIVAMKVYLNADDTEDINSGNPSGAFTSASMTTKVNKIANHYG
                     VPAQEVRDAIHKIKAQGAWRGDGANRNPDVVVDLDSGEVYVKLPGGEVSEDSIGNILD
                     ELED"
     CDS             503570..504076
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4870"
                     /old_locus_tag="nfa4870"
                     /product="hypothetical protein"
                     /protein_id="BAD55330.1"
                     /transl_table=11
                     /translation="MRSEIKEYEDRWVVQPMRGGRVVRTRWLPDQVEFETDTQFRIVV
                     GYGAELAHGSIAEDSPGRHAIGHWSRDEVERMVAAPVVSPVFFKSGSLRVGFRNGWML
                     LVSHRHPEVSAALFFQDRPIWTRSGLRGSMEFTVVAVDPWSGRRIDAPPWPTRPSNID
                     GNSEDING"
     CDS             504157..504795
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4880"
                     /old_locus_tag="nfa4880"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55331.1"
                     /transl_table=11
                     /translation="MLGCIMARVTAPDASKSTRRTELLGLAAELFAERGLRATTVRDI
                     ADAAGILSGSLYHHFDSKESMVDEILRGFLDDLFGRYREIVAAGLSSRDTLEALVLAS
                     YESFDRSHAAVAIYQAEAKRLRDAERFAYIDEYNREFRALWHRVLTNGVADGSFRPEL
                     DVELAYRFLRDTVWVAVRWYRPGGPITVENLAKQYLTIVLDGLTVPERTDQA"
     CDS             504819..506009
                     /codon_start=1
                     /gene="fadA2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4890"
                     /old_locus_tag="nfa4890"
                     /product="putative acyl-CoA thiolase"
                     /protein_id="BAD55332.1"
                     /transl_table=11
                     /translation="MSAPSARRPYAPLRDAYVVDAVRTPVGKRGGALAGVHPADLGAA
                     ALRGLFDRNSIDPINVDDVIVGCVDNVGPQAGNIGRTMWLAAGYPEEVPGVTVDRQCG
                     SSQQAINFGAQAIMSGTAEVIVAGGVQNMSAIPISAAMLAGKEYGFDSPFVGAQGWDH
                     RYGTEEVSQFRGAQLIAEKWNISRRDMEEWALRSHERARDAIKNGRFDNEIVPVGDFW
                     IDQGPRETSLEKMASLPPLAEGSPLTAAVASQISDGASATLLASEWAVQEYGLKPRAR
                     IHHVSARGADPIFMLTAPIPATKWALEKTGLTIDDIDVVEINEAFAPVVLAWIKETGA
                     DPEKVNVNGGAIALGHPLGATGAKLFATLLNELERRNGRYGLLTICEGGGTANATIIE
                     RLDR"
     CDS             complement(506142..506450)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4900"
                     /old_locus_tag="nfa4900"
                     /product="hypothetical protein"
                     /protein_id="BAD55333.1"
                     /transl_table=11
                     /translation="MIYAAQNADGGNRLIWSLRLSPSVQAIVQGPMSCGASVHGKTGY
                     HDFHPSIPADYWWHSVVTDLQLDRQYQLEAKCDFTATNGHTTAPGTVRYTVKFTMHSR
                     "
     CDS             complement(506609..506824)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4910"
                     /old_locus_tag="nfa4910"
                     /product="putative cold shock protein"
                     /protein_id="BAD55334.1"
                     /transl_table=11
                     /translation="MERATVYRWNIRNGTGVLTRTDGSLAWFHLSTVDKGDVFTLSEG
                     DPVDAEIENVPQGGYECRAVSVRRHVE"
     CDS             507019..507687
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4920"
                     /old_locus_tag="nfa4920"
                     /product="putative hydrolase"
                     /protein_id="BAD55335.1"
                     /transl_table=11
                     /translation="MVIEAVVFDVGETLVDETREYGSWADWLGVPRHTFVAVLGATIA
                     RGLDYRETFQVFRPGFDLTAEREARAAAGRPEWFGEDDLYADVRPALAELGAAGIWVG
                     VVGNQTARAGELLRGLDLPCDFIATSDEWGVSKPDTAFFHRIIEEADRPADVILYVGD
                     RLDNDIAPAKGVGMRTAFIQRGPWGWVHRDSPSVAELADFRIDFLTELPGLVATGADM
                     LDSH"
     CDS             complement(507996..508202)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4930"
                     /old_locus_tag="nfa4930"
                     /product="hypothetical protein"
                     /protein_id="BAD55336.1"
                     /transl_table=11
                     /translation="MSADLSGAHWFKSTFSNAGGECVEIAHMDNGGVRVRDSKNPSGA
                     VLTFTPAEWDAFLAGVRDGQFDRP"
     CDS             complement(508199..509092)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4940"
                     /old_locus_tag="nfa4940"
                     /product="putative DNA-binding protein"
                     /protein_id="BAD55337.1"
                     /transl_table=11
                     /translation="MTGSTLPRRALGRRLRELRERANKSQLAAGTRIEVSKQTIGRVE
                     VGRPARISTAQYRELLDLYGASEAEREEVLELHREVRAINDSVSTQGWWRAYSDVVNP
                     HFDHYMSLEQASDRVTAFQLTLLPGLVQTVNYRRWIESTTDPAVTAVDVERRLELLAR
                     RQHRLIESPGLQLNALLSEAALRHQIGGAEVMAEQLHHLIDVSRLPNVSLRVVPFTAG
                     PHMGLRTQSFVLLYFPPLSVHVEPEPPIVYVEGYTGALFLEEDALVALHRAAAEDIQR
                     VALDEESTRELVGQIAKEYTA"
     CDS             509513..510850
                     /codon_start=1
                     /experiment="expression in E. coli"
                     /locus_tag="NFA_4950"
                     /old_locus_tag="nfa4950"
                     /product="cytochrome P450 monooxygenase"
                     /protein_id="BAD55338.1"
                     /transl_table=11
                     /translation="MGVGNLDRPSVRYGVKPAAPSPSIGPHNSITPSKCPIGRGSPLD
                     ADNTARVPLYTAQFAADPHSAYARMRAHFGALVPVWLAPGVPATLVIGYWTALKILND
                     PEHFPADPSSWQRGISPDCPVLPMMRQRPNAQRSSGGRHARYRAAGVDALRRVNTAAL
                     CTGVERSALRLIDGFSRAGRADLLGDYARPLVFEVIGELIGCDPDIGARAAAGIAMMF
                     DSTVDAPRGDRLAVTALGELVARKRGRPGDDLTSWLLAHPADLDDAEVVHQLVGLCAA
                     AGELLTNLIANTALSMMSRPDFGGRVAAGAVSTREALTYVLFRDPPLANFCMSYPRQP
                     QLIGGTWVPAHQPIVISLAACNNDPTVMGGDLVGNESHLGFGAGPHRCPARALVELIA
                     GAAIEQLLDVLPEIGLAVPVDRLRWRPGPFHRSLRALPVVFPPVPSPSAPALR"
     CDS             510868..511200
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4960"
                     /old_locus_tag="nfa4960"
                     /product="hypothetical protein"
                     /protein_id="BAD55339.1"
                     /transl_table=11
                     /translation="MNDSHTTPAPGRPDPTRRGAPTSAGLSPIGAVVPLARASILRAT
                     ADEHRHDNPRWPTRSPRDAANALELHGDCAWHCSTKVAALLVSRDDYRYFRDRDRTDG
                     TVRSLSDC"
     CDS             complement(511298..512179)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4970"
                     /old_locus_tag="nfa4970"
                     /product="putative sigma factor"
                     /protein_id="BAD55340.1"
                     /transl_table=11
                     /translation="MHDEQYLADRFEEHRTHLRAVAYRMLGSLSDADDAVQEAWLRLA
                     RTETGDVDNLGGWLTTVVGRVCLDMLRARKTRHEEPLETEHLPDPVILGENTSDPEHE
                     ALLADSVGLALLVVLESLSPAERLAFVLHDMFAMPYEQIAPIVDRTPQTAKKLASQAR
                     RRVQGLTPAPDPDLPRQRRVVDAFLTAARGGDFDELLQLLDPDVVLRADAGEAMRVIR
                     GAAAVAGQAETFQRMATLCTVHPAVVNGGTGLVNTVEGAPFSVIGFTVANDRITAIDI
                     LSDPTRLARLDLTAVLN"
     CDS             512460..513632
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4980"
                     /old_locus_tag="nfa4980"
                     /product="putative esterase"
                     /protein_id="BAD55341.1"
                     /transl_table=11
                     /translation="MQAIEVHGTVADGYEQVRAEFAAVVAEEDGESGAQLAAFVRGRK
                     VVDLWAGREVSGTTLTGLHSTSKGAAGLVVALLIQDAALDVDRPVAHYWPRFAAAGKD
                     RITVRDVLVHRSGVVGADGGFTVDELADERVVAERLVGQRPFFEPGSVHGYGGFVTYA
                     IIGEVVRAVTGSTIQEHFEQRIRAPYGLDVYLGLPAELDHRYLPILPWRATPEMEAAF
                     AANSPNPHGIAGVSYNLNARGFTAADVMALPNDAKLRRLGQGSAGGVGSAHGVAAMYA
                     AATTGIGDREPLLSLETIATISAIHSHGPDLVRGDRVAYSLGFEAKSLLYPFLGAHAF
                     GHTGSAGSDGFADPHSGLAYGYTRRRAAFAFNAPENARLAAALHRAATTTGLATAA"
     CDS             513674..514114
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_4990"
                     /old_locus_tag="nfa4990"
                     /product="hypothetical protein"
                     /protein_id="BAD55342.1"
                     /transl_table=11
                     /translation="MSTRTTTMLTRGLELARWVPVTAVLAETAVGAYWDLARISYVRE
                     SFDHLGYPLYFATILGVAKTAALAAILTPGHPRTKEWAYAGLVFVYGGAAASHMAAGD
                     GPDKWAMPVFFAAATFAARAWLPRGGSLTAALRALGTTARPQTA"
     CDS             514153..514659
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5000"
                     /old_locus_tag="nfa5000"
                     /product="hypothetical protein"
                     /protein_id="BAD55343.1"
                     /transl_table=11
                     /translation="MSITTQQRDGSRLPNPQQLVPELGEIGAALFKATGNGTIPRTTI
                     GLVQLRAGQLVGSTYLAILHAGNLRAAGETEERIAAVATWRDAPYFSDAERVALALVE
                     AVLQPTAQGERVPEELYALATEYYDDKALATLAIAIGQVNFFVPLALIGQPLPGRAPA
                     EQWTPVSA"
     CDS             514783..516090
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5010"
                     /old_locus_tag="nfa5010"
                     /product="putative monooxygenase"
                     /protein_id="BAD55344.1"
                     /transl_table=11
                     /translation="MGEQNTRRRPLKTVTGVSGGEDIYAAAVDPARSTLASALDVAKI
                     AEDNRIDALFAADLLSFGKQGAIGAQEPLIYLAALSAVTSHVGLIATVTTTFHHPYNL
                     ARLFGTLDHVSNGRAAWNAVTSSLGEENYGDEGLPSPEERYARATESLEVVNALFDSW
                     QPGALVSDGAGGAKLDPGLVRPIDHRGRYFTVAGPLNIPPLPQRRPVQFQAGQSAGGV
                     ELGARFAEVVFTSLATLDDALDYTTRIRARAKELGRPDGLPLIFSSLHATFGATEAEA
                     ARLARDRDEATDFEEGRLRLADMLGGGVDLTDLPLDKPLPESLLPAVESVNRRRGRVE
                     IFTQLARSGRTLRELIIAAKDTGHWAAAGTPEQLADAVEERYAAGVLDVIGLGGLGDP
                     RTRDFVTNGLLPELRRRGIVGTDYVGGTFRENLELPALPDQRH"
     CDS             complement(516162..517031)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5020"
                     /old_locus_tag="nfa5020"
                     /product="putative DNA-binding protein"
                     /protein_id="BAD55345.1"
                     /transl_table=11
                     /translation="MANRTDLAAFLRARRADLQPSDVGLPQTGPRRTPGLRRQEVAQL
                     AGISVEYYVRLEQARGPHPSAQVVGALARALMLTADERNYLFRTAGHPPPVVAGPDRT
                     VSPAVRTILDGLTTMPAYVVDASYDILAWNAMAVFFISDLTDTPESDRNMVRWAFRRP
                     ADDPSWSDPETLQFATTTVADLRAAYARYPGNPRLSALVTELLGTSTRFAEMWAAQDV
                     AERRNHRKCVTHPDLGVLEFDCQVLHLPDSDQRIIVYCADSGSPTEAVFRELAEGTRP
                     LVPLALPGSERRS"
     CDS             517124..517903
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5030"
                     /old_locus_tag="nfa5030"
                     /product="putative short chain dehydrogenase"
                     /protein_id="BAD55346.1"
                     /transl_table=11
                     /translation="MVAMTHNDTATIALITGANKGLGYETARALAARGCTVLVGARDP
                     ERGRAAAEKLAADGGDVRFVRLDVTDAATIAETAAYLEAEFGRLDILVNNAAITGGFD
                     TGLLPSTTSIDIMRTVYETNVFGPVAVTNALLPLLRRAEAARIVNVSSEVGSVQLMND
                     QDGPMWPMVSITYPSSKTALTMITTMYAKELWDTPIKVNAANPGYCATDLNNNSGFRT
                     PEQGAEPIVHLATLPADGPTGQLWGYRWGATDGVEYGPLPW"
     CDS             complement(517968..518606)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5040"
                     /old_locus_tag="nfa5040"
                     /product="hypothetical protein"
                     /protein_id="BAD55347.1"
                     /transl_table=11
                     /translation="MTTAHRALVVVDVQQEYFGGPLEVQHPPREETLANIVAAMDAAA
                     AQNIPVAVVQHRSPEGAPVFVEGTPGWALRPEVAQRITPDTKHIHKVYGSVFAGTDLA
                     EWLRKRGVDTITVVGYMTNNCDIATVVEAEGLGFAAEILADATGAIHLANEAGAVSAQ
                     VLHETLMVLFQSNLAAVAGTAEWVSALASGAPLGKSNLVASAQQGRSAAALV"
     CDS             518752..519705
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5050"
                     /old_locus_tag="nfa5050"
                     /product="putative transcriptional regulator"
                     /protein_id="BAD55348.1"
                     /transl_table=11
                     /translation="MQIAVYAFDGFPMFHLAVPLTVFGEVGRLGLAADWQTRLWSDRA
                     GSVRTAEGYPIGDVAGPEILASADIVVVPSWLQSLAPAGDDLKNQLIDAHRRGATIAG
                     LCFGAFPLADAGLLDGRAAVTHWEVLPLLAERRPDTSVDASVLYIDHGDVLTSAGTAS
                     AIDACLHLVRKHLGVAAATRVARSLVVAPHREGGQAQYIERPLARPATDGAIGEVLDW
                     ALAHLDHPLTVDLLAERARMSRRSFVRHFQQATGTTPARWILDRRLDEARALLETTDW
                     PVDTIASACGFGSPVTLRQNFAAAYGTTPTTYRRRFAPTPA"
     CDS             complement(520290..521666)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5060"
                     /old_locus_tag="nfa5060"
                     /product="hypothetical protein"
                     /protein_id="BAD55349.1"
                     /transl_table=11
                     /translation="MTLVVDWQTYYEAAKKCHDVAASLRAADKPLHDLKNEFSGMAGD
                     ANGCRQWGEKYDQVARDTMQACTNLADALTNFGYALYATGYNYGIRARTNPAPDRPTV
                     QPMAIHKVSIPSSIGNNGNGVAKHDDGIAEFYDQLVDKIAEEFGKLPNGDVQKLGKAA
                     DEWRKFAENGAIVDAAGEIASIKSLFDKIQDKTNLPPILEKLDTLGSSAKQVSDGSAI
                     LAGLVSDYHTSTVAARSSFESEINLAVATAGIAVAGALVFAAVSFGGSFLAGAGAVGT
                     IVLNCVNAIRTAYQSSNLIRVIGLTTAAAGASVVLTHFDAIPNLDDLVTEGGKLGAII
                     IMKVLIDGNDPFWDLPAAPDNPAPGMTQGAEDYILGKHIKDAANYDHSKGTWPDGTTG
                     EDLDNLAEAAEVSPARGPNKDGNYEREVDAGRPIGSVSEQLGGHVTSRYKVVTDRFGG
                     IITMYPIP"
     CDS             complement(521669..521968)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5064"
                     /old_locus_tag="nfa5064"
                     /product="hypothetical protein"
                     /protein_id="BAD55350.1"
                     /transl_table=11
                     /translation="MSSEFSVDLDHLDEIVTKLSALAAFIDERLDGIDGRIATLSGTG
                     WESIAAQAYTEAHRQWSVSAREFVEGVKDLSDAAKKAHADLTYAVELNSNMLNGG"
     CDS             complement(521965..522303)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5065"
                     /old_locus_tag="nfa5065"
                     /product="hypothetical protein"
                     /protein_id="BAD55351.1"
                     /transl_table=11
                     /translation="MSDGGPPASATTLFVVPEKVGEVGKYLYELAQALQAALDSAAQD
                     VSSLTDGSWTGDHATDFANAWADLRTSGDQIMAALTELAEKLGVTAHTYQARDENNAG
                     AIQNSSLDLP"
     CDS             complement(522420..523517)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5070"
                     /old_locus_tag="nfa5070"
                     /product="putative dioxygenase"
                     /protein_id="BAD55352.1"
                     /transl_table=11
                     /translation="MNAPTPRLRTALTDLVGIEHPVVQTGMGWVAGPSLVSATANAGG
                     LGILASATMTYEELEAAIAKTKAQTDRSFGVNIRADASDANERIDLLIRERVKVASFA
                     LAPKKDLIAKLKDAGVVVIPSIGAAKHAVKVASWGADAVIVQGGEGGGHTGPVATTLL
                     LPSVLDAVDIPVVAAGGFFDGRGLAAALAYGAAGVAMGTRFLLTQDSSVPDAVKQEYL
                     NRHLQDTVVSLKVDGMPHRVLNTELVQRLEHSGRWRGFAAAVSNAARFKSMTGMKWST
                     IVKDGLAMRKTKDLTWSQVIMAANTPMLLRAGLVEGNTQAGVLAAGQVTGIIDDLPTC
                     KELIERIVTEAEERLDALASLRASAQPDASG"
     CDS             complement(523514..524278)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5080"
                     /old_locus_tag="nfa5080"
                     /product="hypothetical protein"
                     /protein_id="BAD55353.1"
                     /transl_table=11
                     /translation="MMTTTETVTRAEYCAIACAEIFAGAGEIMASPMTPMATLGARLA
                     KLTTEPDLLLSDGEALLLAETPPLGGKAPVEGWIPFRKVFDVVASGRRHVVMGANQID
                     RYGNQNLSAFGAHQQPSRQMFGVRGAPGNTINHPTSYWVARHSKRVFVDRVDIVCGVG
                     YDKVDQDNPAFRFLHLHRVVTNLGVFDFEGPDHTMRARSLHPGVTPEEVAENTSFEVA
                     GLGEAPQTRQPTAEELRIIREVLDPKKIREKEVPSS"
     CDS             complement(524347..525228)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5090"
                     /old_locus_tag="nfa5090"
                     /product="putative CoA-transferase alpha subunit"
                     /protein_id="BAD55354.1"
                     /transl_table=11
                     /translation="MKDKRMSLDDVVGELRSGMTIGIGGWGSRRKPMALVRAILRSDL
                     TDLTVVTYGGPDLGLLCSAGKVRKAYYGFVSLDSAPFYDPWFGKARTSGELVVREMDE
                     GMLKCGLEAAAARLPFLPIRAGLGSDVFTFWEGELKTVTSPYPGPDGTPETLSAMPAL
                     TLDAALVHLNLGDKHGNAAYLGVDPYFDDLYCLAAERRYLSVERVVETEELVKTVPPQ
                     QLLLNRMMVDGVVEAPGGAHFTLAGEDYGRDEKFQRHYVEAAKSPESWQTFVDTYLAV
                     SEDEYQAAVRRFADQEA"
     CDS             complement(525228..526001)
                     /codon_start=1
                     /gene="echA4"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5100"
                     /old_locus_tag="nfa5100"
                     /product="putative enoyl-CoA hydratase/isomerase family
                     protein"
                     /protein_id="BAD55355.1"
                     /transl_table=11
                     /translation="MGINRHTESTGITVVTVDYPPVNAIPTDGWFAIADAVRAAGRDP
                     ETKVVVLRAENRGFNAGVDIKEIQSKPGHQALIDANHGCFEAFGAVYDCPVPVIAVVQ
                     GFCLGGGIGLVGNADVVIASDDATFGLPEVDRGALGAATHLARLVPQHLMRALFYTAS
                     TITAQQLHHHGSVYQVVPRAELDAAAMEVAKNIAAKDGRVIRAAKRALNGIDVQDVHR
                     SYRYEQGFTFELNLAGVADEIRARFDDDLAARKAGNQEQ"
     CDS             526054..526848
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5110"
                     /old_locus_tag="nfa5110"
                     /product="putative short chain dehydrogenase"
                     /protein_id="BAD55356.1"
                     /transl_table=11
                     /translation="MGLEIDLSDRVVLVTGGVRGVGAGISRAFLAAGATVVACARRPG
                     EQPVTYEGRQAHFLPCDVRDAAAVRALIETLVDTHGRLDHVVNNAGGAPFASAATASV
                     NFHTKIIELNLMSALWVSQAANVVMQDQPEGGSILMISSLSGHRPSPGTAAYGAAKAG
                     VDSLTQSLSMEWAPKVRVNSLIVGPVETELSELHYGDRDGIEAVGATIPLGRLARPED
                     VGRAAAFLASPLAAYISGAMLQVHGGGERPPFLAASTAANGEQQRA"
     CDS             526898..527806
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5120"
                     /old_locus_tag="nfa5120"
                     /product="putative short chain dehydrogenase"
                     /protein_id="BAD55357.1"
                     /transl_table=11
                     /translation="MDEQICAGRVVIVTGAGRGIGRAHALAFAAAGARVVVNDVGTSL
                     HGDSTGETPAQQVVGEITAAGGEAVANGDDVADWDGARNLIRQAVDTFGRLDVLVNNA
                     GFVRDRMLVNLSEEEWDAVIRVHLKGHFATMRHAAEYWRGEAKAGRPVDARVINTSSG
                     AGLQGSVGQANYGAAKAGIAGLTLTAAAEFARYGVTVNAIAPSARTRMTETVFADMMA
                     KPESGFDAMAPENISPLVVWLGSTQSAGVTGRMFEVEGGKVALADGWRHGVAVDRGAR
                     WNPAELGPVVADLIAKAAPPEPVYGA"
     CDS             527935..529362
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5130"
                     /old_locus_tag="nfa5130"
                     /product="hypothetical protein"
                     /protein_id="BAD55358.1"
                     /transl_table=11
                     /translation="MAVGRTFRALAVASAVAGIALLGSGGAAAKPDGDPQGGPPGHSA
                     PAAPPGNGASSGGHGPGSPDTPTGPGRSANSTGAGNSANSNGAGNQTGTGPNGDPAPV
                     SGAAPGVPSTTTSPTGAPAGPLSSGSAGGPGSSGSSPADAGPVGPSLSLPPATQSPAA
                     EEIGSAASGSAGAAGSAGAGSAATGSAAGGILLGSGSAGLAAVLGTGSTGLGVGLVTG
                     SAGVGAVLGTGSAGLGLGLGTGSAGLGLGLATGSAGLGAALGSAGVGGAALGSAAVGS
                     AGVGSAAVGSAGVGSAGVGSAGVGSAGVGLGSAGAGSAGLGSAAVGSAALGSASPLLL
                     LLIPLPTPPAPEAPSVPLVIPPAPGVPAAPAVPAAPALPSAPGLPPIAVAAPEAPAPA
                     PAPQAPAPAAPSAPAPQAAAPTHDVRPTSADDGLPAPNALSVIGGLAAMALAAAGAGA
                     VSFQSASAAQARVDAARAEFFGPRS"
     CDS             529373..529888
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5140"
                     /old_locus_tag="nfa5140"
                     /product="hypothetical protein"
                     /protein_id="BAD55359.1"
                     /transl_table=11
                     /translation="MSQSRTQSSSRSYRRVAAAVDAVCAVAADFDATTLDEVVLAIAA
                     ERQRMIEIADAELGPGVCGQRRFYPDRDVIVLATALPSREHTLAHELGHIVFDHEGAP
                     ATEVTLEASDDLIAYMLSQRAHQQIVDDGADELAEWEAETFAAMLMTRLRVFNNRGAG
                     VSVLRFDEALG"
     CDS             529885..530907
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5150"
                     /old_locus_tag="nfa5150"
                     /product="hypothetical protein"
                     /protein_id="BAD55360.1"
                     /transl_table=11
                     /translation="MTLWLTALLVWVAAGARVGRVLVKPATTARVAIVVAVAAAAAAA
                     TLAVPEIALAVDNLLPEGAPPGMLADGVQVAAWLVFATATSVVAAAAWPVVSRRNLRQ
                     IALVIYGAGTLVIAATLVWSFTFGWCALALACVFIVVTGLRNLDWTALGRGIAIYTTG
                     TALTGLLAVLEVRRAWVGEPAAPAGEPNWGWQAWEIAALLIALGAVWIVVELWMRARA
                     VLRQTRALHRTMIKRFPEVIAHEQPSSSTQLRASDQVAQIMDALYLQSGGGVELAAAG
                     APPASIPERAERVARWARNPLGDIVIDARWIAPPEGVSPRGWVRAIARAFDTVDTPVL
                     EHTASR"
     CDS             complement(531217..531633)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5160"
                     /old_locus_tag="nfa5160"
                     /product="putative DNA-binding protein"
                     /protein_id="BAD55361.1"
                     /transl_table=11
                     /translation="MADFAARLNKLFETVHPPGRKPHTNAEVAAALTASGHPISKPYL
                     SQLRSGQRTNPSDETVAALAKFFKVKPDYFFNDIYAAKIDHDLELLSQLQGYGLRRLS
                     SRAFDLSEESQNLLTSMAEKLRASEGLPEIPPDGTE"
     CDS             complement(532009..533172)
                     /codon_start=1
                     /gene="fadA3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5170"
                     /old_locus_tag="nfa5170"
                     /product="putative acyl-CoA thiolase"
                     /protein_id="BAD55362.1"
                     /transl_table=11
                     /translation="MGTPVIVEAARTPIGKRGGWLAGLHAAELLGLAQRGLLERAHLD
                     PALVEQVVGGCVTQAGEQSNNITRVAWLHAGLPWQVGATTIDAQCGSAQQANHLIAGL
                     IAADAIDIGMACGVEAMSRVPLGANVGENAGPRRPASWSIDLPNQFEAAERIAKRRGI
                     TRDDVDEFGLRSQRLAAQAWAEGRFEREIIPVTAPAVDKEGTLTGEKLDVTRDQGLRE
                     TTKEGLAKLKPVLEGGVHTAGSSSQISDGAAAVLLMDEKAAERTGLRPRARIRTQVLV
                     GGEPEFHLDGPVQACSRLLERSGMSIGDIDLFEINEAFASVALSWASVHKPDMDRVNV
                     NGGAIALGHPVGSTGSRLITTALHELERTGGATAMILMCAGGAMATGTIIERI"
     CDS             533314..534582
                     /codon_start=1
                     /experiment="expression in E. coli"
                     /locus_tag="NFA_5180"
                     /old_locus_tag="nfa5180"
                     /product="cytochrome P450 monooxygenase"
                     /protein_id="BAD55363.1"
                     /transl_table=11
                     /translation="MVETRSARPNLPDGFDVTDPDIYAERVPVEEFAELRRTAPIWWN
                     PQPPEVGGFHDDGFWVVSKHADIKEVSRRSDVFSNFENTAIPRFNDDISREQIELQRI
                     VLLNMDAPEHTKLRKIISRGFTPRAINGLRAELSAKAEQIVKAAAAAGSGDFVTQVAC
                     ELPLQAIAELIGIPQEDRMKVFNWSNQMTGYDDPDNDADPVTASAEVLGYAYQMAAAR
                     KACPADDIVTTLIEADVDGDKLTEEEFGFFVIMLAVAGNETTRNAISHGMIAFLENPD
                     QWELYKKERPATAADEIIRWATPVTSFQRTALVDTELGGVQIKKGQRLVLLYRSANFD
                     EDVFENPYKFDIMRADNPHLSFGGTGAHFCIGANLARLEIDLIFNAIADHLPDITRLG
                     DPKRLRSGWLNGIKEFPVDYKTAARCPVSH"
     CDS             complement(534673..535092)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5190"
                     /old_locus_tag="nfa5190"
                     /product="hypothetical protein"
                     /protein_id="BAD55364.1"
                     /transl_table=11
                     /translation="MTTVTDHPARTAGLASQAAVRARDKQAWLALFAPDAVVEDPIGP
                     SGFDPEGKGHHGTEAIAAFWDKAIAPTESIEFLFGDSFACGNEVAFTGVIRSRLGGHV
                     IDAEGVFTYRVDAAGKLAALRAYWEVDRAMRTTRPAQ"
     CDS             complement(535089..535991)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5200"
                     /old_locus_tag="nfa5200"
                     /product="hypothetical protein"
                     /protein_id="BAD55365.1"
                     /transl_table=11
                     /translation="MTAPLQFTVGIALSPLDQLTALAVTAEECGFSSVALPDSLFYMQ
                     SQAAKYPYTADGSRFWGPDTPWVDPLIGATAMAAVTSRIRFYTNVLKLGSRNPLLLAR
                     QVGSVANLSNNRFGFGVGIGWAPEEFEWCGQPYARRGARVDEMIEVIKLVLGGGMVEF
                     HGEFYDFEPLQMSPAPSAPVPFYIGGHTEAALRRAARVGDGWTSAMMTFDELTATIGK
                     LDALRAEFGRSAEPFEIQAVCVDRGGRAGYQDLADAGVTDAIVVPWLLEGIGFDGELA
                     AKQDALRRFAEKYIADPIVGRDAR"
     CDS             complement(535988..537160)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5210"
                     /old_locus_tag="nfa5210"
                     /product="putative lipid-transfer protein"
                     /protein_id="BAD55366.1"
                     /transl_table=11
                     /translation="MSFPAAVLGTGQTHHVTKRHDVSMAGMCREAIDRALADAGLTIA
                     DIDAVVVGKAPDMFEGVMMPELFLADALGASGKPLIRVHTAGSVGGSTGIVATNLVQA
                     GVHKRVLAVAWEKQSESNAMWALSIPVPFTMPVGAGAGGYFAPHVRSYIRRSNAPSHI
                     GAMVAVKDRRNGAKNPLAHLRQPDITLESVLASQMLWDPIRFDETCPSSDGACAIVLG
                     DAEAAERVEAEGRKVAWVHGTAMRTEPTTYAGRDQVNPEAGRHAAAALWEAAGITDPL
                     EEIDAAEIYVPFSWFEPMWLENLGFAAPGEGWKLTEKGETEIGGRLPVNPSGGVLSSN
                     PIGASGLIRFAEAAKQVMERAGDYQVKGARKALGHAYGGGSQYFSMWVVGSERPRS"
     CDS             complement(537157..538197)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5220"
                     /old_locus_tag="nfa5220"
                     /product="hypothetical protein"
                     /protein_id="BAD55367.1"
                     /transl_table=11
                     /translation="MTDNATDIAVVGFAHAPHVPETYGTTNGVEMLVPCFQQLYTELG
                     ITKSDIDFWCSGSSDYLAGRAFSFISAVDSIGAVPPINESHVEMDAAWALYEAFVKLE
                     SGQARTALVYGFGKSSAGTLRQVLTMQLDPYLVAPLWPDALSIAGLQARAGIDAGRWS
                     ERDMAAVAAGAGGDVDSLLDAPYVADPLRAHDVAPITDGAAAIVLAVGDRARELCERP
                     AWITSMAHRIDTPVLGARDLTVSPSTAKAAQEATGGDLSGFDIAELHAPFSHQQLILA
                     EAIGLKPETTVNPSGGALAANPMFAAGLERIGFAARAIMTGTAGRALAHATSGPALQQ
                     NLVTVLDSEASR"
     CDS             complement(538210..539178)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5230"
                     /old_locus_tag="nfa5230"
                     /product="hypothetical protein"
                     /protein_id="BAD55368.1"
                     /transl_table=11
                     /translation="MSTSTAPDVLSAPLRMRFDYTRSVGPTIGRFLTGLRARKIVGVR
                     GSDGRVLVPPPEYDPVTSEALTEFVDVADTGTVSTWTWVRDPLPGQPFDRPFAWALIT
                     LDGADSALLHAVDVDSPDQMRTGMRVRARWAEQTEGFIKDIVCFEPGETSTAPAAPVD
                     EGEPVTMITTPVDLSYKHTASPQETVYLRGLAEGKLIGARTDAAGKVYFPPRGANPTD
                     GRPTEDYIELSDHGTVTTFCIVNVPFLGQRIKPPYVAAYVLLDGADIPVLHLVLGCDA
                     SEVRMGMRVKAVWKPREQWGHGLENVDHFEPSGEPDADYETYKHHL"
     CDS             539399..540439
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5240"
                     /old_locus_tag="nfa5240"
                     /product="putative oxidoreductase"
                     /protein_id="BAD55369.1"
                     /transl_table=11
                     /translation="MMKFGLQLGYWMAQPPANAGELVVAAEAAGFDAVFAAESWGSDA
                     FGPLMWWGSRTERVRLGTSVVQLSARTPAATAMHALTLDHLSGGRAVLGLGVSGPQVV
                     EGWYGQPFAKPLQRTREYVEIIRKVLAREAPVTSDGPHYPLPYTGPGATGLGKPLKPI
                     VHPLRADLPIWLGAEGPKNVALTAEIADGWLAIYFAPRLADMYHGWLDEGFARPGARR
                     TREDFEIAASCQVVITDDPAAELERMRWIMALYIGGMGAPELNFHAQVYRRMGYDREV
                     DEIGALFQAGKKAEAAAAVPDELILDTAIIGDENHVREQLKVWEAAGVTMMLVSVPDV
                     EQLHRLAPLVEQ"
     CDS             540462..542015
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5250"
                     /old_locus_tag="nfa5250"
                     /product="putative acyl-CoA synthetase"
                     /protein_id="BAD55370.1"
                     /transl_table=11
                     /translation="MTTQESEILGLWNIADAEPDRIALVDPSGREVTYRELATLANRY
                     ATGLRDLGLRTGDVLVSMVHNCVEAIAAYFAAYQSGLYIVAVNWHLTGPEVAYILSDS
                     EAKAFFADERFAAAAEAAADEAGLPASARFSVGEINGFTPLSELGDADAGRPDDRTTG
                     APMLYTSGTTGRPKGVRRPLTGADPDVVSPANTSFFALFGLQPYDDHVHICGSPLYHT
                     AVLNFATISIQLGHKVVLMDKWDAEEMLRLIERHRVTHSHMVPTQFHRLLALPDEVRA
                     KYDVSSLRSMVHGAAPCPEETKRRMLEWWGPTVTEYYAATEGGGTVISGAEWLRKPGS
                     VGKAWPYSVIKVLSEEDGSELPPGETGLVYMKMGASSFEYHHDKTKTEESRVGDLFTV
                     GDIGYLDEDGYLYLCDRRSDLILSGGVNIYPAEIETVLITHPKVADVAVFGIPHEDWG
                     QEVKAVVQPAEGVEADAALTEELLAFAATRLAKYKMPRSIDYLDELPRDPNGKLYKRK
                     LRERYVPAS"
     CDS             complement(542060..543103)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5260"
                     /old_locus_tag="nfa5260"
                     /product="putative sigma factor"
                     /protein_id="BAD55371.1"
                     /transl_table=11
                     /translation="MSDSTVAASPATPGASVAAAGAPGADADVLASFEAHRRELCAYA
                     YRMLGSSFEAEDAVQETFTRAWKSYGSFEGRASLRSWLYRIATNVCLDMLDGPQRRAR
                     PMDLSGPSRPDSPLPAPQPDYVWVEPIPNALAFGADPAEHAATKDSLRLAFVAACQHL
                     PATQRAILIMREVLRFSANETAEALTMSPASVNSALQRARATMSKVRPTATDDYDETD
                     ENQRKLVDEFVTAFEAYDMDALTALLKADVALSMPPIELWVRGPENVAAFMRGHGSGC
                     EGSRMVRLEGANGLPAFGHYKRTDTPGVYAPWSITVLEFDGPVISGLNFFLDTERLFP
                     LFGLPMELREPAS"
     CDS             543234..543653
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5270"
                     /old_locus_tag="nfa5270"
                     /product="hypothetical protein"
                     /protein_id="BAD55372.1"
                     /transl_table=11
                     /translation="MSSKMIFINLPVRELSRSKDFYQALGWKLNEDFTDDNAACIVVD
                     DNICLMLLTRQYFQTFTKRPVAETTGATGAAYALSLGSAAEVDALTEAALAAGGSEEV
                     NEDKRAQEAEVGMHGRTFLDPDGHQWEPFWMDYPGGA"
     CDS             complement(543717..544499)
                     /codon_start=1
                     /gene="echA5"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5280"
                     /old_locus_tag="nfa5280"
                     /product="putative enoyl-CoA hydratase/isomerase family
                     protein"
                     /protein_id="BAD55373.1"
                     /transl_table=11
                     /translation="MPHCLVEKRDHVLIVTMNRPEARNALSGEMMTIMKDAWDQVDND
                     PDIRAAILTGAGGAFCAGADLKAMTSTHPGDQFSGGGWDLSRIEALLKGRRLTKPLIA
                     AVEGPAIAGGTEILQGTDIRVAGESAKFGVSEARWGLFPLGGSAVRLVRQIPYTVAAD
                     ILLTGRHISAAEAKEIGLIGHVVPDGTALDKALELAAQIAANGPLAVQAILRTIRETE
                     GMHEDEAFKIDAELGTAVFKSADAKEGPRAFAEKRKPNFTGA"
     CDS             544569..546218
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5290"
                     /old_locus_tag="nfa5290"
                     /product="putative acyl-CoA synthetase"
                     /protein_id="BAD55374.1"
                     /transl_table=11
                     /translation="MSYNIADLVEHAIDLMPDRVALVDDAREVTYAQLEERTNKLAHY
                     LLEHGVQPGDKVGIYSRNTIEAVEAMVAVFKARAVMINVNYRYVENELQYIFDNSDMV
                     ALIHERRYSDKVAAVRARTPKLRTVVVVDDDTTGTVPTAADSVEYETALAQSSADRDF
                     GERSPDDLYMLYTGGTTGMPKGVMWRQEDVWRVLGGGINFLTGEYVADEWDLAKEGQA
                     NGALTRYPIPPMIHGGSQWATFQSLFSGGKVVMLPEFSGHGVWRTIDRHGVNVIFITG
                     DAMARPMLDALLEGNPETGKPYELASLFAIASSAALFSPAIKEKFLELLPNRVITDSI
                     GSSETGFGGISMVAKGAEHTGGPRVKIDASTEVLDEQGNPVTPGSGQIGILARKGHIP
                     LGYYKDEAKTAATFKEFNGVRYSIPGDYARVEEDGTVTMLGRGSVSINSGGEKIFPEE
                     VEGALKAHPDIFDALVVGVEDERWGQRVCAVVQCRGDKRPTIEELRPVLTQEIAPYKH
                     PRSLWFVEEIKRSPAGKPDYRWAKEQTTARAADVHAEVSAK"
     CDS             546279..547124
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5300"
                     /old_locus_tag="nfa5300"
                     /product="hypothetical protein"
                     /protein_id="BAD55375.1"
                     /transl_table=11
                     /translation="MARTLANQSLRQHRSLADMDIPLAFFERTERGFEALPMAVSAWS
                     PDMVNGPAICGLLGGALESAHRPDGFIPARLTVDLFRPTLRKPVEVTTTEVRRGTRIA
                     VADAELLQEGRAVARATAVFLRPSAQPPGRVWTRQERPDLPPAELLDGSSSHLWHTDT
                     TGWSARLSEHQNAERKRNFQQPISVILGEPPSPLAAAATIGESTSMMTHWGDRGVGFI
                     NADLTLTMSRLPHGPIGVQAENHFSTDGVAVGNATLFDRDGFFGACVVTALANPAAQV
                     DFSGA"
     CDS             complement(547222..548325)
                     /codon_start=1
                     /gene="fadE9"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5310"
                     /old_locus_tag="nfa5310"
                     /product="putative acyl-CoA dehydrogenase"
                     /protein_id="BAD55376.1"
                     /transl_table=11
                     /translation="MDFTPTEGQLDLGTLTGEVCGKLVTADRLRELDTAGRFDEPLWA
                     ALAETGILAATLPEEVDGGGLGPLEQAAVLRELGKSVAAVPYLWSVVVGAGALARFGS
                     AEQRKWARRAGAGSVVLTAALAEDHNYEPTVPATVAVERDGAWRLTGAKTTVAYADRA
                     ARILVPATVSGATGVFLVDPAAAGVRISPQEVVDFSAESAVEFADAPAELVGTLAEGG
                     DILDWLLTRAWFGLAAQQLGTLEQALDLVAGYAREREQFGKAIGSFQAVAQRLADAYI
                     DVQGLRLAVTQAAWRLAEGLSAAEAVHTAKFWAADAGHRVAHTVVHIHGGVGIDRDHI
                     VHNYFTAAKHNEFALGGATDHLRALGALLADPA"
     CDS             complement(548363..549556)
                     /codon_start=1
                     /gene="fadE10"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5320"
                     /old_locus_tag="nfa5320"
                     /product="putative acyl-CoA dehydrogenase"
                     /protein_id="BAD55377.1"
                     /transl_table=11
                     /translation="MRIAYTPQQEELRAELRDYFARLITPERRAALSATTGEYGQGNV
                     YREVVREMGRDGWLALGWPKEFGGQDRPTMDQLIFTDEAAIAGAPVPFLTINSVAPTI
                     MHYGSEEQKRFFLPKIAAGELHFAIGYSEPGAGTDLASLRTTAVRDGDEYVINGQKMW
                     TSLIAYADYVWLAVRTDPNAKKHKGISMLIVPTDAEGFSWTPVHTMAGPDTSATYYQD
                     VRVPVSSLVGQENGGWALITNQLNHERVALTSAGSLLTGLQQTVEWARTTKAADGSRV
                     IDREWVRVNLAKVHAKVEYLKLLNWEIASRADQGGAAAPRPWDASTCKVYGTELATEA
                     YRLLMEVLGPQAYLRQDSVGAELRGRLERLHRAALILTFGGGTNEVQRDIIAMTALRQ
                     PAAAR"
     CDS             549712..549900
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5330"
                     /old_locus_tag="nfa5330"
                     /product="putative ferredoxin"
                     /protein_id="BAD55378.1"
                     /transl_table=11
                     /translation="MKVSVDLDQCEANGICVGFAPDVFELDDDDQLHILTDEVPADRR
                     AEVEDAVAQCPKAALKLL"
     CDS             549897..550850
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5340"
                     /old_locus_tag="nfa5340"
                     /product="putative short chain dehydrogenase"
                     /protein_id="BAD55379.1"
                     /transl_table=11
                     /translation="MSDACRSVGTRSKVGPVSESNLSLAGRVALVTGAGAGLGKAEAL
                     ALAAAGAAVVVNDLAENDAVAETMAEIRARGAKAEFVAGSIAERATADAMIRTAQESF
                     GSVDIVVNNAGITRDRMLFNMSDEEFDAVVAVHLRGHFLLTRNAAAYWRAKSKEAGAP
                     VYGRLINTSSEAGLLGPEGQANYGAAKAGITALTLSAARALSRYGVRANAIAPRARTA
                     MTAAVFSDAPEGGIDPLSPDHVARLVAYLASPAAEAVSGQLFVVYGPMVALMAAPVVE
                     QRFDAAGEAWDATELASTLSGYFADRPAGRTFSASALTELG"
     CDS             551238..552029
                     /codon_start=1
                     /gene="yrbE1A"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5350"
                     /old_locus_tag="nfa5350"
                     /product="putative YrbE family protein"
                     /protein_id="BAD55380.1"
                     /transl_table=11
                     /translation="MLNDQGGSRMNEVLAVPLRAVGGFFELSADVARASVRRPFQARE
                     FIDQSWFIARVSIVPTLLVAIPFTVLVSFTLNILLREIGAADLSGAGAAFGAVTQVGP
                     IVTVLIVAGAGATAICADLGARTIREEIDAMRVLGINPVQRLVVPRVLASMFVALMLN
                     SLVCTIGIVGGFLFSVYLQDVNPGAFVNGITLLTHLPELIISEVKAGLFGLIAGLVAC
                     YLGLNVKGGPKSVGDAVNQTVVFAFMALFVVNVVVTAVGIKFTVR"
     CDS             552034..552885
                     /codon_start=1
                     /gene="yrbE1B"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5360"
                     /old_locus_tag="nfa5360"
                     /product="putative YrbE family protein"
                     /protein_id="BAD55381.1"
                     /transl_table=11
                     /translation="MAFVIQSRFPRAVRRVRRMSDSLDSVGKHAVFYAQALASIPRAL
                     MHYRTETIRLIAEISMGTGALAVIGGTVVIVGFLTLFSGGTIAVQGYSSLGNIGVEAL
                     TGFFSAFLNVRIAAPVISGIGLAATIGAGSTAQLGAMRVSEEIDALETMAIRPVPYLI
                     GTRVLAGMIAIVPLYALAVIASFFAARFATVVIYGQSAGVYDHYFSTFLIPSDILWSF
                     SQAILMALAVMMIHTYYGYFAAGGPVGVGVAVGNAVRASLVAVVTVTLLMSLAIYGTS
                     GNFNLSG"
     CDS             552898..554088
                     /codon_start=1
                     /gene="mce1A"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5370"
                     /old_locus_tag="nfa5370"
                     /product="putative Mce family protein"
                     /protein_id="BAD55382.1"
                     /transl_table=11
                     /translation="MADSKQLRDALGLKLAGLAMVLALVAIVAVALTMFVGGFTRTAT
                     VLVQAPRSGLVLDPDAKVKVRGVEIGKVAAVRQDENGATLELALDPEKLKLVPANAGV
                     DIRSTTVFGAKYVNFVVPQVPSSDSLRPGATVVAEQVTVEFNTLFQHLSDVLAKLEPQ
                     KLNATLAALGQALQGRGQTLGTLLADLDGYLREMNPTLPTLREDLRATADVSHLYADT
                     VGDLLRTVDNAVVTSQTLVDEQSSLDDMLANLTGLADTTGSVLRENEQNLGTALDLLR
                     PTTALLDEYAPGLNCMINAVANLLPVGEAVFGGNQPGVAMNTNFMFGAEPYTYPDDLP
                     KVNATGGPRCEGLVDRVPGSHANYVVTDTSEGGPYVPSMELKFNGPKVFQLLFAGLPG
                     VSAP"
     CDS             554085..555107
                     /codon_start=1
                     /gene="mce1B"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5380"
                     /old_locus_tag="nfa5380"
                     /product="putative Mce family protein"
                     /protein_id="BAD55383.1"
                     /transl_table=11
                     /translation="MRNTATTVKLAIFTLVMTLIFAGLAVVFSQMRFAREHGYHAVFT
                     SSSGILPGAKVRIAGVPVGSVTSVEVGKDYLAHVEFDVDRKYRLLTSTRAQIKYENLV
                     GDRYLELLDGPGSADVLKAGGTIPKERTAPALDLDMLLGGFKPLLRGLDPGQVNDLTE
                     ALLQVFQGQGGTLVSLLDSGGSFAKTLGERDALIGSVIDNLNTVLATIDERGEQFDTT
                     LTELQRLVSGLAQDRDPIGAAIPRIAGATGDLTDLLAQARPDLRNTVEQTGRLATNLN
                     AGEDTMQWVIERLPETYRKLIRIGSYGSFLALYVCATNFIIDGPDGKPLLVNMPGGQD
                     TGRCAF"
     CDS             555107..556171
                     /codon_start=1
                     /gene="mce1C"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5390"
                     /old_locus_tag="nfa5390"
                     /product="putative Mce family protein"
                     /protein_id="BAD55384.1"
                     /transl_table=11
                     /translation="MNEQRSPAVTIGIVGIVVAVAVALSALQFDRLPFIRAGAAYTAY
                     FADAGGLVPGDNVQVAGVRSGRVDEVELAGDKVLVRFTLDESIVLGDKTSAAIKTNTV
                     LGRKSLEVVPAGAGALRRADTIPLERTTSPYSLNDALGELATTVDGLDMDKVDQTLDA
                     LSATFADTPAPLRAALDGVTELSRTINSRDQALSQLLERAQNVTKILSDRSAQINALL
                     LDGNQLLGELDARRTAIGQLIVHVNGLAQQLRGLVADNEAQLQPALDRLNSVLDVLQR
                     NRQNITEALDGLGPFAAALGEQVGNGPWFNAYVVNATSVGLQPLVDALVWPEHLPADL
                     RNFFLNPPPSIEPAVQEPPR"
     CDS             556168..557439
                     /codon_start=1
                     /gene="mce1D"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5400"
                     /old_locus_tag="nfa5400"
                     /product="putative Mce family protein"
                     /protein_id="BAD55385.1"
                     /transl_table=11
                     /translation="MNSSKIFRKPPRWVLLLAGAVVVALVAAGAYQGITRLGTTTVTA
                     YFPSTNGLYAGDDVRVLGVKVGRIDKVEPGHERVKVTMTVDRGVDLPADARAVIVSPS
                     LVTARFIQLAPAYTGGEKLGDGDEIPIERTAVPVEWDDIKAELSKLATTLGPVGDDQQ
                     GSFGRFVDTAAENLDGNGERMRETLRELSATLNTLSDGRTDLFGTIRNLQQFVEVLSA
                     SNEQIVQFGGRLASVSSVLAGVSEDLGAGLDNLDLAVADVQRFLDSSGAELTESTQRL
                     AEVTQILVDKRPEVERVLHSGPTALVNFYQLYKPAQGTLTGAVALNNTADPLSFLCGS
                     VRALEENDSDRSADLCATYLAPVIDSLAMNYAPIMLNPATGVQAFPNQLTFSPPSLAN
                     EVPDEVKNPRPVPAVTVPNGLAGLAIPGGGR"
     CDS             557436..558662
                     /codon_start=1
                     /gene="mce1E"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5410"
                     /old_locus_tag="nfa5410"
                     /product="putative Mce family protein"
                     /protein_id="BAD55386.1"
                     /transl_table=11
                     /translation="MRRARRTATVLALGVSLTLGLTACEWDGLNSLPMPGAEGTGEGA
                     YQIRIQMPNVTTLTANSPVRVDDVDVGSVTDIEVQDWHALVTVSLNRDVRLPANAIAK
                     IGQTSLLGSNHVELSPPTDVVPEGQLRPGDVIPLDRAGAYPTTEEVLSSLSVVLNGGG
                     IAQLETITKELNAALTGREDAIRDLLPQLNELTTNLRDQTGDIIAAMEGLDRFGGQLA
                     QQRTVLETALDGIHPALTVLADRRENITRAITALGELSDVTQRVIDTSGENLKANLAS
                     LGPVLQQLADTGNNLTESLKILLTFPFPMKNLDNAIKGDYLNLFMTVDMTGKRLDTNW
                     LTGTPLGGRFGGVEGIVGSFAPTTASDTGNPATGPIAGPTPTPSPTPTIPGLPPIPGL
                     PAIPGLTVPLEGGQGR"
     CDS             558659..560080
                     /codon_start=1
                     /gene="mce1F"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5420"
                     /old_locus_tag="nfa5420"
                     /product="putative Mce family protein"
                     /protein_id="BAD55387.1"
                     /transl_table=11
                     /translation="MKLTRFVRIQLAIFAVLTVVGLTVMAGTYVQLPAMFGIGRYEVT
                     VELAATGGLYEHANVAYRGTNVGRVQEVRLTPDGVAAKLSIDSSQKIPADVDAWVRSV
                     SAIGEQYVDLIPPEQPGRGNLADGAVIPVERTKLPQDVGTLLDQTDRLLSSVADTRLR
                     QVIDEAFKAFNGAGPDLQRFIDSASLLVQEAQNSTEPTKKLIEQIGPLLDTQVRSDSA
                     IRSWTADLATVTDQLRAHDPALRNLLRDSPAAMQRVTQQFNELQPTLPILLSNLVSMG
                     QVSTIYHAGIEQILVVYPPLVAALMTAIRGPLEYGVLVDFMTTVHDPPACTTGFLPPD
                     QRRSPSDTTFVETPPGLYCKIPQDSPIEVRGIRNTPCMEFPGVRAPTPELCRTGYVPE
                     GDNPPFGPPNPVAPAGGPGTTESTEVAPAAYTAPAAARSYDPSTGVYIGTDGRTYRQG
                     DVGPGGSGTVPASWQAMLEEQQR"
     CDS             560077..561024
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5430"
                     /old_locus_tag="nfa5430"
                     /product="hypothetical protein"
                     /protein_id="BAD55388.1"
                     /transl_table=11
                     /translation="MSDSNDQSRRTRRKAVRSAGPPVGEPGEAPVTEAAAPGEGAGRA
                     EVTGRAEASSKTDAAGSTKAAGSTEAAGSTQAAGSTEAVGQSEAAGEAEAAEAVSAKD
                     GMQHTAKTSLAKSGLSKSGPSKAGLSKDGPDEKPADGAADDAAAAEQTDRRTGTGRRI
                     FLAAAAVVLLAALITGAVFSVVTVRDIDQRAERRTEYVQTARQAILNLTTIRADSAKE
                     DIDRILSLASGQFKTEFDGRVDPFLSIVQQAKVVSNGEIVEAALESDDDDSAKVLVAA
                     KQTLTNAGQAEPQTRYYRFRVTVTRSDAGLTASNVEFVP"
     CDS             561021..561509
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5440"
                     /old_locus_tag="nfa5440"
                     /product="hypothetical protein"
                     /protein_id="BAD55389.1"
                     /transl_table=11
                     /translation="MKRTDRLIASFLAGAVALTALIVIGFGGWRHWSSEQDEKAREQA
                     LTAADRAVSAMFTYDHTTVDTELPKAADNLSPSFREDYLKLITAAIAPGAKEKQLTVK
                     ATTQAAGIVSADRDNAVVMLFLNQVTTSSDSPQGTTTGSRVRVNLNKDGDRWLVDAVT
                     PI"
     CDS             complement(561496..563031)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5450"
                     /old_locus_tag="nfa5450"
                     /product="putative two-component system sensor kinase"
                     /protein_id="BAD55390.1"
                     /transl_table=11
                     /translation="MSTGRPGRDAARTAPGRLRQGREWIGHRLGAVPLRVTLVLALVV
                     FAGLGLLVSGTVVTSALEKSLLARTDQQLRDAVTTRPRVRPTVPPPATDPRTPPSPFY
                     IVSESTSGAGTLVLRPFNVDAAPDLSGTPVGEPVTVDSVGDAPVRWRVLTVVSGDDRT
                     TIALPMTQNEETVQRLVMLQVVVGLAVLAVLALAAYFVIRRSLRPLRRVENIAAAIAR
                     GDLFRRVPVRGTNTEVDRLSRSLNGMLAQIQSAFAATEASEAAARESEARMRRFVADA
                     SHELRTPLTTIRGFAELYRQGATTDPAMFMDRIEHEARRMGLLVEDLLMLARLDAQRP
                     LEIGTVDLLTVAGDAVHNARAVAAAADPAGPRRRIELDVHAGTGTLEVPGDEDRLRQV
                     LANLLNNALTHTPPDAAVTVRLTPEPDEVILAVADTGPGLTPEAAERVFERFYRTDVS
                     RARASGGSGLGLSIVQALVVAHGGSVSVDSAPGAGATFTVRLPRAGRRAPHRGAAGNV
                     RSA"
     CDS             complement(563028..563747)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5460"
                     /old_locus_tag="nfa5460"
                     /product="putative two-component system response
                     regulator"
                     /protein_id="BAD55391.1"
                     /transl_table=11
                     /translation="MTGVPAAAPPEARVLVVDDEPMIVELLSVSLRFQGFEVETAVDG
                     AQALDKARSFRPQAMIVDVMMPGIDGFGLLPRLRADGIDAPVLFLTARDDVQDKVAGL
                     TLGADDYITKPFSLEEVVARLRVVLRRAGHGAPVRESSRIRFEDIELDDDTHEVWKAG
                     VPVSLSPTEFTLLRYFMVNAGTVLSKPRILDHVWRYDFGGEVGVVETYVSYLRKKVDT
                     GERRLIHTLRGVGYVMRAPGR"
     CDS             complement(563817..565322)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5470"
                     /old_locus_tag="nfa5470"
                     /product="putative trehalose-6-phosphate synthase"
                     /protein_id="BAD55392.1"
                     /transl_table=11
                     /translation="MRTGANAPQGAGSGFVVVANRLPVDLERLPDGSTRWKRSPGGLV
                     TALEPVLRNNKGAWVGWAGVPDVDVDPIIEDGLELHPVPLSAQEVADYYEGFSNGTLW
                     PLYHDVIVRPTYDRAWWAAYVQVNRRFAEETAKVAAEGATVWVQDYQLQLVPKMLRML
                     RPDLTIGFFLHIPFPPVELFMQMPWRTEIIEGLLGADLIGFHLPGGAQNFLYLARRLA
                     GQPTSRGTVGVRSKLGVVQVGFRTVRVGAFPISIASAELDEQSRRRSIRERAAKIRAE
                     LGNPKNILLGVDRLDYTKGIDIRLNALEELLVEGRFDPAETVMVQLATPSRERVESYI
                     QMRGDIERQVGRINGEFARVGYPVVHYLHRPIPRDELLAFFVAADVMLVTPLRDGMNL
                     VAKEYVACHSGLNGALVLSEFTGAAAELRQAYLCNPHDLDSVKDAIVSALEDDRETKR
                     RRMRSLRRQVLAHDVDRWARAFLDALAQDQVAGSALITENDDYGDNDAPSR"
     CDS             complement(565482..565652)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5480"
                     /old_locus_tag="nfa5480"
                     /product="hypothetical protein"
                     /protein_id="BAD55393.1"
                     /transl_table=11
                     /translation="MAAKGSANDIADEDLEPLADETARQAQRVVAAYAADADECRMLL
                     SMLGIGPNSRAE"
     CDS             565827..566660
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5490"
                     /old_locus_tag="nfa5490"
                     /product="putative hydrolase"
                     /protein_id="BAD55394.1"
                     /transl_table=11
                     /translation="MPLATVNGISLNYQVKGDRAKGTEAKGSAPLVVMIMGTGSPGRV
                     WELHQVPALLAAGYRVCTFDNRGIAPSFEAADGITIDDLVGDTAGLIELLDEGPALVV
                     GTSMGARVAQELALARPDLVRKAVFMAGHGRLDQFQKTLSLGEHDLDASGITLPPKYE
                     AAVTAVMNLSPATLADANAARDWLDLFEFTGGPVTPGIRAQRRMDHDFDRVQAYRGIT
                     VPCLAVGFADDRMIPAYLTREVAEAIPGARYQEVPDAGHFGYLERPEIVNKILLDFFA
                     A"
     CDS             566859..567101
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5500"
                     /old_locus_tag="nfa5500"
                     /product="putative MbtH family protein"
                     /protein_id="BAD55395.1"
                     /transl_table=11
                     /translation="MSTNPFDDEDGRFFVLVNDEEQHSLWPAFAEVPAGWRVVFGEDS
                     RAACVEYVEKNWTDMRPKSLRDAMAADDAARQGAQS"
     tRNA            567211..567285
                     /gene="thrU"
                     /inference="profile:tRNAscan-SE"
                     /locus_tag="NFA_80120"
                     /old_locus_tag="nfa80120"
                     /product="putative tRNA-Thr"
     CDS             567365..567661
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5510"
                     /old_locus_tag="nfa5510"
                     /product="hypothetical protein"
                     /protein_id="BAD55396.1"
                     /transl_table=11
                     /translation="MEVGPAMGRGIERGRGGRGRGRTRCSGCSSASSVLACWRWSVSA
                     WPRNRRCTWRIAPRRPPRADRKSVHRKAVVANDGGAERCACLAGNGLRWCRGSG"
     CDS             567675..568838
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5520"
                     /old_locus_tag="nfa5520"
                     /product="putative DNA-binding protein"
                     /protein_id="BAD55397.1"
                     /transl_table=11
                     /translation="MHRGARLRAAREAAGVGLREMARLTHYSPAYLSLVECGKRPVPP
                     AVAAAYGAVLGELADGDPAGAEWVARVAASDVCGATLERLETAVDDLAVAYATAPPAE
                     LLVDIRRQLGGAARLLAGRTTLVQHRRLLVAAGWLALLAGTCHIDLGHRRAADVRLRA
                     AREIARECEHREMAAWTLETRAWQHLVDREFGVAAELSEAARRMAPGGGSARIQATAQ
                     RGRALARLGDSAGGYGALRGVARLVSGLRAPERPEHHFRYDPAKADAYVATTLSWLGD
                     PAAESYARHVLLDLERAACVRPRRIAMARLDLGLALVAAGKPEEATDVALAVVTSGRL
                     VPSHHWRVADVVAAIGQRDRRGAALVRAAFRDTYAGPLSPGRWPNARDPAGPA"
     CDS             complement(568789..569214)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5530"
                     /old_locus_tag="nfa5530"
                     /product="hypothetical protein"
                     /protein_id="BAD55398.1"
                     /transl_table=11
                     /translation="MASVFSAIIAGQLPGRFVWEDDEFVGFLTIAPVTQGHTLVVPRA
                     EIDQWQDVDPELFARLTGVAQKIGQAVRAAFDAPRAGLLIAGLEVPHLHLHVFPAYEM
                     GNFDISGADPDPSPESLDEAQAKIKQALRDLGHSANVPD"
     CDS             complement(569254..569631)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5540"
                     /old_locus_tag="nfa5540"
                     /product="hypothetical protein"
                     /protein_id="BAD55399.1"
                     /transl_table=11
                     /translation="MGLIDGLMGNAGRVDPAQAQQEYAKLFGNGEQVYAAYILVRDAM
                     LFTNRRLIIVDKQGLSGRKVNYHSIPYRAITHFAVETAGTFDLDAELLIWIAGTAEPV
                     HKRFNRQVDIYEVQGILSHFVAV"
     CDS             569854..571125
                     /codon_start=1
                     /gene="purD"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5550"
                     /old_locus_tag="nfa5550"
                     /product="putative phosphoribosylglycinamide synthetase"
                     /protein_id="BAD55400.1"
                     /transl_table=11
                     /translation="MRVLVIGSGAREHALVLALRRDPAVTALIAAPGNAGIAQHAQVR
                     PVDASSADAVVALATDVSADLVVIGPEVPLVLGVADAVRAAGIACFGPSAAAARIEGS
                     KAFAKDVMAAAGVRTAHSEVVDSPAELDAALDRFGPTWVVKDDGLAAGKGVVVTADRS
                     AARDHGAELLEQGHPVLLESFLDGPEVSLFCLVDGETVVPLLPAQDHKRVGDGDTGPN
                     TGGMGAYTPLPWLPAETVSEIVEDVVRPVAAELVRRDCPFSGLLYAGLAIGAAGPAVV
                     EFNCRFGDPETQAVLALLESPLGELLHATATGTLDKVAAPRWRDGAAVTVVLAAENYP
                     GRPRLGDVISGAGESSGDDTATVLHAGTATREDGALVSSGGRVLNVVGVGADLAEARA
                     KAYQRMSGIKLPGGHFRTDIGLAAVESRISV"
     CDS             complement(571129..572109)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5560"
                     /old_locus_tag="nfa5560"
                     /product="putative peptidase"
                     /protein_id="BAD55401.1"
                     /transl_table=11
                     /translation="MVGVMLDKARRAGLDRVREAGGIVVVPPDWRTRARPRTTAAGRD
                     LTALWRRARREARALRRGPRPDPRRWWTEQKKAEYRALLRTHKWLIAGLAAVLLVAAA
                     DGVASRPGTGPLGPNEAQRVFFAHPQQFQSTPPSVRRYLNAIANGERLREQAVVAAAA
                     RATLERAKAEAAAAAAGEWQPWINEPGTVIVPGSVIPDISGFVLPARGMFTSGFGSRW
                     GTFHNGIDVAGPIGTPIYAVAAGTVIDAGPAQGFGLWVRIRHDDGAITVYGHMYDFFV
                     SVGERVPAGMQIARMGNRGDSTGPHLHFEVIVNGRHVDPRAWLAARGLSY"
     CDS             572151..573320
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5570"
                     /old_locus_tag="nfa5570"
                     /product="putative aminotransferase"
                     /protein_id="BAD55402.1"
                     /transl_table=11
                     /translation="MSRESRRSTIPPFYVMDVWKAAAERARTHGDVLVLAAGQPSTPA
                     PAPVLRATKAAIDAELLGYTETFGILPLRRAIAEHHSRTYGYAVDPDDVVVTTGSSGA
                     FTLIFLAAFDAGDTVVVARPGYPAYRNTLTALGCRVVELDCGPDTRFQPTVAMLDALP
                     EPPAGLIVASPANPTGTMIDPAELAALARWCDEHGTLLVSDEIYHGITYGSAGADART
                     ASAWETSRTAVVIGSVSKYFSMTGWRLGWMLAPADLRPALQRLASNMTVCPPAISQYA
                     AVHAFGAEAKAELDGHVGRYATNRRLLLDGLAALGITDLAPADGAFYAYADIGHLTDD
                     SLKWCAELLGQTGVALAPGIDFDTVAGHRFVRFSFAGATAEIEEALARLGRHLAS"
     CDS             573449..574105
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5580"
                     /old_locus_tag="nfa5580"
                     /product="hypothetical protein"
                     /protein_id="BAD55403.1"
                     /transl_table=11
                     /translation="MITATTPKGERRRQALVAAAAELLLEGGFDAVRHRSVATRADLP
                     LASTTYYFESLEDLIARAVEFSGNAELEAMRRRIGEVSHRRRGAEATVELVLDLLIGG
                     DWQDEAARGQLIARYERSVASARHPELREVQLRLRAQLEELLADVLRRSDRGVRAEHL
                     RRLVAVVDGAVVAALTENDPDPRRMARAALLEVIDIVAPPLRSPGPEHVNGHGVRQLD
                     "
     CDS             574112..575533
                     /codon_start=1
                     /gene="purB"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5590"
                     /old_locus_tag="nfa5590"
                     /product="putative adenylosuccinate lyase"
                     /protein_id="BAD55404.1"
                     /transl_table=11
                     /translation="MSLVPNVLATRYASPELVHLWSPEHKIVLERRLWLEVLRAQSEL
                     GIDVPDGVLADYERVVDRVDLAAIAERERVTRHDVKARIEEFNALAGHEHVHKGMTSR
                     DLTENVEQLQIRLSLEHVHAHGVAIAARLAERAAEYRALVMAGRSHNVAAQATTLGKR
                     FASAADELLIALTRLRELIDRYPLRGIKGPMGTAQDMLDLLGGDPAKLARLEQQVARH
                     LGFATVLTSVGQVYPRSLDHDVLSALVQVGAGPSSLAHTIRLMAGHELVTEGFQPGQV
                     GSSAMPHKMNTRSCERVNGLQVVLRGYASMAAELAGAQWNEGDVFCSVVRRVALPDAF
                     FAVDGMMETFLTVLAEFGAYPAVISRELDRYLPFLATTRILMAAVRAGVGRETAHEVI
                     KEHAVAVALAMREQGREPDLLDRLAADDRLPLDRAALDAALADKSVFVGAADDQTGAV
                     IAQVQKLVEAYPEAARYTPSPIL"
     CDS             575538..576140
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5600"
                     /old_locus_tag="nfa5600"
                     /product="hypothetical protein"
                     /protein_id="BAD55405.1"
                     /transl_table=11
                     /translation="MLIGPERAPCVVTLRCRLRALTARAVSPLPRPGLRIRLRRTLPR
                     LARRLRLRFGVDPYTIFSDIIAGRAPASTVYEDSDVLAFMDIRPMTPGHLLVVPKVPA
                     RSLAELDPAIGGKLFQVGQKLAAALRASEVACDGVNFFLADGVAAGQEVFHVHLHVIP
                     RTAGDGFGLRGRPTSPPRADLDYLAGSIRGALTRAGSASS"
     CDS             576255..577214
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5610"
                     /old_locus_tag="nfa5610"
                     /product="putative esterase"
                     /protein_id="BAD55406.1"
                     /transl_table=11
                     /translation="MRRRRIAGAVLAAVLAVLGPLVAVQAPASAAQVVRVDELSPTRS
                     AVFVDSPAMGRVIQVQVLHPAGGAARPSYYLLDGLDPGVGQSTWTNATDAEAFFRGKN
                     VNVVLPVGGQASYYTDWQTDDPKFGRYKWETFLTRELPPIIDAQFAGNGVNGIGGLSM
                     GGNAAYILAARNPHLYTAVAGYSACPDTGLATGAVMFSIANRGGNPLNMWGPPGSPAW
                     AEHDPARLAGNLRGKTLYLSTGTGIPGPHEAELKPQLAENIFLGGPVEVGVNICTVAF
                     EQRLRGLGIPARIDYSPVGTHSWSYWQDTLHASWSTIGRALGA"
     CDS             complement(577222..578268)
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5620"
                     /old_locus_tag="nfa5620"
                     /product="hypothetical protein"
                     /protein_id="BAD55407.1"
                     /transl_table=11
                     /translation="MRTATAARLAAAAAVLCTALGMGAVAPASACACGGVVSPGDTAR
                     VDQETAVLAWDGRRETILMRLALTAESAHAALIVPTPRPATVTAGSPDTFAELSRLTA
                     PEFVVETEWFADAADGSGAPAAVAPTVLDQVRLGPLEATTLSGGDLTGLRTWLGANGY
                     ALRPEVTATLAPYVREGWSFVAMRLTGAQPLDGALDPVRLSFDSDRLVYPMRMSAAAR
                     TPQSVHLYVLDRHRVARADDDAAHHYSSVEFAGRVDPADVADPLLRELTAAGQDYLTE
                     MQVHIADPTTVTTDFTFTAAPEDADYRRRFVQTDEVMLFGLPAGYVVLGAAGLAAAVV
                     VIAVVRVARARPGA"
     CDS             578346..580496
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5630"
                     /old_locus_tag="nfa5630"
                     /product="putative protease"
                     /protein_id="BAD55408.1"
                     /transl_table=11
                     /translation="MSVESGVAAPIAKRVPTERVHHGDVFVDEYEWLRDKENPEVIAY
                     LEAENAYTEAQTAHLSGLREKIFEEIKSRTQETDLSVPTRMGEYWYYSRSFEGKQYGV
                     HCRCPIDTTADAAAAWNPPQLEAEGEIPGEEVLLDSNELAEGHEFFALGAFSVSHDGT
                     LLAYSVDTVGDERYTLRIKDLRTGELLADEIAGTAPGATWSLDGTHVFYQTVDESWRP
                     DTVWRHRLGTGTDADVRVFHEPDERYWVSIGATRSEKYLMIWVGSKITTEGWVLESDD
                     PEGEFRVLLPRREGVEYSAEHAVIGGQDRFLILHNDVVDGVKAQNFVLAEASVDNPAD
                     LRILIGHRDDVRLEDIDAFADHLVLSYRREALTRLAVWPLTETGYGDLRELEFDLELF
                     AVGMGGNPEWAQPTLRLGLTSFITPMRVYDYVPATGELLLRKEQPVLGGYDAGDYRQR
                     REWAVAADGTRVPISLVWKTGVADPGVEPRPLLLYGYGSYEASMDPSFSVARLSLLDR
                     GMVFAVAHVRGGGEMGRLWYENGKTLTKKNTFTDFVACARHLIDTGVTAPDRLVADGG
                     SAGGLLMGAVANLAPELFAGILANVPFVDPLTSILDPSLPLTVIEWDEWGNPLADKDV
                     YEYMKSYSPYENVEAKDYPAILAITSLNDTRVLYVEPAKWVAKLRATKTGDAPLLLKT
                     EMSAGHGGVSGRYAKWKEVAFEYAWVLDTAGLGE"
     CDS             580510..581274
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5640"
                     /old_locus_tag="nfa5640"
                     /product="hypothetical protein"
                     /protein_id="BAD55409.1"
                     /transl_table=11
                     /translation="MFVAPSSALHGAYMSIRHRWCMNAELIVSVSGIRDTTRDAAIEF
                     AAEMDRREVRLSLLVAPRLEGKYRLTDDPATQAWLRGRRARGDAIVLHGYDQAATKRR
                     RAEFATLPRHEARLRLTAADRVMEQVELRTRLFAAPRWNASTGALAALPEVGFRLALG
                     LTGIHDLERDTVQRARVYGIGEGFRAEPWWCRALVMGAARTARRGGVLRLAISGAQLR
                     RPGPRQAMLDAVDLALYHGAVSEVYRWQPGPVAQAA"
     CDS             581486..582850
                     /codon_start=1
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /locus_tag="NFA_5650"
                     /old_locus_tag="nfa5650"
                     /produ