LOCUS       AM743169             4851126 bp    DNA     circular BCT 06-FEB-2015
DEFINITION  Stenotrophomonas maltophilia K279a complete genome, strain K279a.
ACCESSION   AM743169
VERSION     AM743169.1
DBLINK      BioProject:PRJNA30351
            BioSample:SAMEA1705934
KEYWORDS    complete genome.
SOURCE      Stenotrophomonas maltophilia K279a
  ORGANISM  Stenotrophomonas maltophilia K279a
            Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales;
            Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia
            group.
REFERENCE   1  (bases 1 to 4851126)
  AUTHORS   Crossman L.C.
  JOURNAL   Submitted (24-MAY-2007) to the INSDC. Crossman L.C., Pathogen
            Sequencing Unit, The Wellcome Trust Sanger Institute, Hinxton,
            Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM.
REFERENCE   2
  AUTHORS   Crossman L.C., Gould V.C., Dow J.M., Vernikos G.S., Okazaki A.,
            Sebaihia M., Saunders D., Arrowsmith C., Carver T., Peters N.,
            Adlem E., Kerhornou A., Lord A., Murphy L., Seeger K., Squares R.,
            Rutter S., Quail M.A., Rajandream M.A., Harris D., Churcher C.,
            Bentley S.D., Parkhill J., Thomson N.R., Avison M.B.
  TITLE     The complete genome, comparative and functional analysis of
            Stenotrophomonas maltophilia reveals an organism heavily shielded
            by drug resistance determinants
  JOURNAL   Genome Biol. 9(4), R74-R74(2008).
   PUBMED   18419807
FEATURES             Location/Qualifiers
     source          1..4851126
                     /organism="Stenotrophomonas maltophilia K279a"
                     /strain="K279a"
                     /mol_type="genomic DNA"
                     /country="United Kingdom"
                     /db_xref="taxon:522373"
     CDS             1..1332
                     /transl_table=11
                     /gene="dnaA"
                     /locus_tag="Smlt0001"
                     /product="putative chromosomal replication initiator
                     protein DnaA"
                     /note="similarity:fasta; with=UniProt:P03004; Escherichia
                     coli.; dnaA; Chromosomal replication initiator protein
                     dnaA.; length=467; id 56.250%; ungapped id 59.559%;
                     E()=9.6e-78; 432 aa overlap; query 2-410; subject 36-466"
                     /note="similarity:fasta; with=UniProt:Q8PRG2; Xanthomonas
                     axonopodis pv. citri.; dnaA; Chromosomal replication
                     initiator protein dnaA.; length=442; id 89.512%; ungapped
                     id 89.731%; E()=2.2e-133; 410 aa overlap; query 2-411;
                     subject 34-442"
                     /db_xref="EnsemblGenomes-Gn:Smlt0001"
                     /db_xref="EnsemblGenomes-Tr:CAN85568"
                     /db_xref="GOA:B2FUW1"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010921"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="InterPro:IPR013317"
                     /db_xref="InterPro:IPR018312"
                     /db_xref="InterPro:IPR020591"
                     /db_xref="InterPro:IPR024633"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/Swiss-Prot:B2FUW1"
                     /protein_id="CAN85568.1"
                     /translation="MDAWSRSLERLEAEFPPEDVHTWLKPLQADLRVDSLVLYAPNAF
                     IVDQVRELYLARIRELLAHFAGFSDVFLEIGSRPRPVEAQNAPVSTPSAHVSSEPQVP
                     FAGNLDNHYTFANFVEGRSNQLGLAAAFQAAQKPGDRAHNPLLLYGGTGLGKTHLMFA
                     AGNAMRQANPGAKVLYLRSEQFFSAMIRALQEKTMDQFKRQFQQVDALLIDDIQFFAG
                     KDRTQEEFFHTFNALFDGKQQIILTCDRYPREVEGLEARLKSRLAWGLSVAIEPPDFE
                     TRAAIVLAKARERGAEIPDDVAFLIAKKMRSNVRDLEGALNTLTARANFTGRAITTEF
                     AQETLRDLLRAQQQAISIPNIQKTVADYYGLQIKDLLSKRRTRSLARPRQVAMALTKE
                     LTEHSLPEIGDAFAGRDHTTVLHACRQIRTLMETDGKLREDWDKLIRKLSE"
     misc_feature    319..978
                     /gene="dnaA"
                     /locus_tag="Smlt0001"
                     /note="HMMPfam hit to PF00308, Bacterial dnaA protein,
                     score 4.9e-120"
                     /inference="protein motif:HMMPfam:PF00308"
     misc_feature    1051..1260
                     /gene="dnaA"
                     /locus_tag="Smlt0001"
                     /note="HMMPfam hit to PF08299, Bacterial dnaA protein
                     helix-turn-helix, score 1.3e-41"
                     /inference="protein motif:HMMPfam:PF08299"
     CDS             1608..2708
                     /transl_table=11
                     /gene="dnaN"
                     /locus_tag="Smlt0002"
                     /product="putative DNA polymerase III beta subunit"
                     /EC_number="2.7.7.7"
                     /note="similarity:fasta; with=UniProt:P0A988
                     (EMBL:J01602;); Escherichia coli.; dnaN; DNA polymerase
                     III subunit beta (EC 2.7.7.7).; length=366; id 50.678%;
                     ungapped id 51.515%; E()=6.2e-62; 369 aa overlap; query
                     1-366; subject 1-366"
                     /note="similarity:fasta; with=UniProt:Q3BZT0
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; dnaN; DNA polymerase III beta chain (EC
                     2.7.7.7).; length=366; id 89.344%; ungapped id 89.344%;
                     E()=1.7e-110; 366 aa overlap; query 1-366; subject 1-366"
                     /db_xref="EnsemblGenomes-Gn:Smlt0002"
                     /db_xref="EnsemblGenomes-Tr:CAQ43620"
                     /db_xref="GOA:B2FT80"
                     /db_xref="InterPro:IPR001001"
                     /db_xref="InterPro:IPR022634"
                     /db_xref="InterPro:IPR022635"
                     /db_xref="InterPro:IPR022637"
                     /db_xref="UniProtKB/TrEMBL:B2FT80"
                     /protein_id="CAQ43620.1"
                     /translation="MRFTLQREAFLKPLAQVVNVVERRQTLPVLANFLVQVQNGQLSL
                     TGTDLEVEMVSRIAVEDAQDGETTIPARKLFEIIRALPDGSRITVSQTGDKITVQAGR
                     SRFTLATLPSNDFPSVDEVEATERVAIGEATLKELIERTAFAMAQQDVRYYLNGLLFD
                     LRGDALRTVATDGHRLALCETDLAKPSGSKRQIIVPRKGVTELQRLLESGDREIELEV
                     GRSHVRVKRDDVTFTSKLIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNE
                     KYRGIRVEVSPGNLKISAHNPEQEEAQEEIEADTTVSDLAIGFNVNYLLDALSALRDE
                     EVIIQLRDSNSSALVRESSSEKSRHVVMPLRL"
     misc_feature    1608..1964
                     /gene="dnaN"
                     /locus_tag="Smlt0002"
                     /note="HMMPfam hit to PF00712, DNA polymerase III beta
                     subunit, N-te, score 1.2e-54"
                     /inference="protein motif:HMMPfam:PF00712"
     misc_feature    1989..2336
                     /gene="dnaN"
                     /locus_tag="Smlt0002"
                     /note="HMMPfam hit to PF02767, DNA polymerase III beta
                     subunit, cent, score 1.3e-50"
                     /inference="protein motif:HMMPfam:PF02767"
     misc_feature    2340..2702
                     /gene="dnaN"
                     /locus_tag="Smlt0002"
                     /note="HMMPfam hit to PF02768, DNA polymerase III beta
                     subunit, C-te, score 1e-40"
                     /inference="protein motif:HMMPfam:PF02768"
     misc_feature    2717..2728
                     /note="tgttccacgtgg"
     misc_feature    2718..2731
                     /note="gttccacgtggaac"
     misc_feature    complement(2718..2731)
                     /note="gttccacgtggaac"
     misc_feature    complement(2718..2729)
                     /note="tccacgtggaac"
     misc_feature    2720..2732
                     /note="tccacgtggaacc"
     misc_feature    2720..2731
                     /note="tccacgtggaac"
     repeat_region   2760..2768
                     /rpt_unit_seq="(t)9"
     misc_feature    complement(2772..2784)
                     /note="tccacgtggaacc"
     misc_feature    complement(2773..2784)
                     /note="tccacgtggaac"
     CDS             complement(2957..3274)
                     /transl_table=11
                     /locus_tag="Smlt0003"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0003"
                     /db_xref="EnsemblGenomes-Tr:CAQ43621"
                     /db_xref="UniProtKB/TrEMBL:B2FT81"
                     /protein_id="CAQ43621.1"
                     /translation="MDKKALLPDLPNYPQVPPQPEGPLYRGFQLHKSLENQLDNAFFH
                     EIWAHHHHHALDLYPDLEARPALIRPQPTLWTVTSADEATTAIADAIRFIHPTRSGHP
                     QSG"
     misc_feature    complement(3560..3571)
                     /note="tgttccacgtgg"
     CDS             3704..4798
                     /transl_table=11
                     /gene="recF"
                     /gene_synonym="uvrF"
                     /locus_tag="Smlt0004"
                     /product="putative DNA replication and repair protein
                     RecF"
                     /note="similarity:fasta; with=UniProt:P0A7H0
                     (EMBL:K02179;); Escherichia coli.; recF; DNA replication
                     and repair protein recF.; length=356; id 34.072%; ungapped
                     id 35.143%; E()=4.6e-32; 361 aa overlap; query 3-360;
                     subject 2-354"
                     /note="similarity:fasta; with=UniProt:Q8PEH3
                     (EMBL:AE012093;); Xanthomonas campestris pv. campestris.;
                     recF; DNA replication and repair protein recF.;
                     length=368; id 73.757%; ungapped id 73.961%; E()=1.4e-104;
                     362 aa overlap; query 1-361; subject 1-362"
                     /db_xref="EnsemblGenomes-Gn:Smlt0004"
                     /db_xref="EnsemblGenomes-Tr:CAQ43622"
                     /db_xref="GOA:B2FT82"
                     /db_xref="InterPro:IPR001238"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR018078"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/Swiss-Prot:B2FT82"
                     /protein_id="CAQ43622.1"
                     /translation="MLIRRLALHQLRRFSAVDLSPQPGLNLLTGDNGAGKTSVLEALH
                     LMAYGRSFRGRVRDGLVRQGQEALEIFVEWDEQRADHPPHRRKAGLRHSGQDWKGRLD
                     GEDVAQLGNLCAALAVVTFEPGSHALVSGGGEPRRRFLDWGLFHVEPDFLSLWRRYSR
                     ALKQRNALLKQGGPSRMLDTWDHELAEAGEPLTSRRQHYLERLQQRTVALAASLAPQL
                     GIQGLELSPGWRRHELPLADALLLARERDRQAGYTSVGPHRADWSVDFHSIPGRDALS
                     RGQAKLTALACLLAQAEDYAEQRGEWPVIALDDLASELDRTHQARVLERLLNGPAQIF
                     ITATETPAALLDLTHIARFHVEHAQIVAVP"
     misc_feature    3707..4786
                     /gene="recF"
                     /locus_tag="Smlt0004"
                     /note="HMMPfam hit to PF02463, RecF/RecN/SMC N terminal
                     domain, score 4e-08"
                     /inference="protein motif:HMMPfam:PF02463"
     repeat_region   4094..4101
                     /rpt_unit_seq="(g)8"
     misc_feature    4134..4145
                     /note="tgttccacgtgg"
     misc_feature    4135..4148
                     /note="gttccacgtggaac"
     misc_feature    complement(4135..4148)
                     /note="gttccacgtggaac"
     misc_feature    complement(4135..4146)
                     /note="tccacgtggaac"
     misc_feature    4137..4149
                     /note="tccacgtggaacc"
     misc_feature    4137..4148
                     /note="tccacgtggaac"
     misc_feature    complement(4758..4770)
                     /note="tccacgtggaacc"
     misc_feature    4759..4772
                     /note="gttccacgtggaac"
     misc_feature    complement(4759..4772)
                     /note="gttccacgtggaac"
     misc_feature    complement(4759..4770)
                     /note="tccacgtggaac"
     misc_feature    4761..4772
                     /note="tccacgtggaac"
     misc_feature    complement(4762..4773)
                     /note="tgttccacgtgg"
     CDS             4911..7370
                     /transl_table=11
                     /gene="gyrB"
                     /locus_tag="Smlt0005"
                     /product="putative DNA gyrase subunit B"
                     /EC_number="5.99.1.3"
                     /note="similarity:fasta; with=UniProt:P0AES6
                     (EMBL:D87842;); Escherichia coli.; gyrB; DNA gyrase
                     subunit B (EC 5.99.1.3).; length=803; id 61.084%; ungapped
                     id 62.000%; E()=1.4e-185; 812 aa overlap; query 11-819;
                     subject 1-803"
                     /note="similarity:fasta; with=UniProt:Q8PEH2
                     (EMBL:AE012093;); Xanthomonas campestris pv. campestris.;
                     gyrB; DNA gyrase subunit B.; length=814; id 80.512%;
                     ungapped id 81.404%; E()=0; 821 aa overlap; query 1-819;
                     subject 1-814"
                     /db_xref="EnsemblGenomes-Gn:Smlt0005"
                     /db_xref="EnsemblGenomes-Tr:CAQ43623"
                     /db_xref="GOA:B2FT83"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR011557"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="InterPro:IPR013759"
                     /db_xref="InterPro:IPR013760"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018522"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:B2FT83"
                     /protein_id="CAQ43623.1"
                     /translation="MSDEQNTPANNGNYDANSITALEGLEAVRKRPGMYIGDVHDGTG
                     LHHMVFEVVDNSIDEALAGHADHVAVTIHADGSVSVSDNGRGIPTGKHEQMSAKLGRE
                     VSAAEVVMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLLVDVFQNGFHYQQEF
                     SNGAAVTALAKLETTTKRGTTVRFWPSTVAFHDNVEFHYDILARRLRELSFLNSGVKI
                     VLADERGDGRRDDFHYEGGIRSFVEHLAQLKTPLHPNVISVTGEHNGIVVDVALQWTD
                     SYQETMYCFTNNIPQKDGGTHLAGFRGALTRVLNNYIEQNGIAKQAKINLTGDDMREG
                     MIAVLSVKVPDPSFSSQTKEKLVSSDVRPAVENAFGARLEEFLQENPNEAKAIAGKIV
                     DAARAREAARKARDLTRRKGALDIAGLPGKLADCQEKDPALSELFIVEGDSAGGSAKQ
                     GRNRKNQAVLPLRGKILNVERARFDRMLSSDQVGTLITALGTGIGRDEYNPDKLRYHK
                     IIIMTDADVDGAHIRTLLLTFFYRQMPELIERGYVYIGLPPLYKIKQGKQELYLKDDP
                     ALDSYLASSAVENAALVPATGEPGIEGLALEKLLLAYAAALDSIERNAHRYDRNLLEA
                     LVDFVPMDLESLRAAGEGEGLDALAKRLNQGSLGSPRFTLELQEANDERPAAVLVTRR
                     HMGEQHIQVLPMSAFESGELRAIHQASKLLHGLVREGATISRGAKSIEVDSFAKAQNW
                     LLEEAKRGRQIQRFKGLGEMNPEQLWDTTVNPETRRLLQVRIEDAVAADQIFSTLMGD
                     VVEPRRDFIEDNALKVANLDI"
     misc_feature    5028..5477
                     /gene="gyrB"
                     /locus_tag="Smlt0005"
                     /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
                     gyrase B-, and H, score 1.5e-28"
                     /inference="protein motif:HMMPfam:PF02518"
     misc_feature    5619..6131
                     /gene="gyrB"
                     /locus_tag="Smlt0005"
                     /note="HMMPfam hit to PF00204, DNA gyrase B, score
                     5.7e-87"
                     /inference="protein motif:HMMPfam:PF00204"
     repeat_region   6092..6099
                     /rpt_unit_seq="(cg)4"
     misc_feature    6210..6548
                     /gene="gyrB"
                     /locus_tag="Smlt0005"
                     /note="HMMPfam hit to PF01751, Toprim domain, score
                     6.9e-06"
                     /inference="protein motif:HMMPfam:PF01751"
     repeat_region   6321..6328
                     /rpt_unit_seq="(cg)4"
     misc_feature    7137..7334
                     /gene="gyrB"
                     /locus_tag="Smlt0005"
                     /note="HMMPfam hit to PF00986, DNA gyrase B subunit,
                     carboxyl terminus, score 6.2e-44"
                     /inference="protein motif:HMMPfam:PF00986"
     repeat_region   complement(7384..7412)
                     /rpt_family="GC_rich"
                     /inference="nucleotide motif:RepeatScout"
     CDS             7438..8283
                     /transl_table=11
                     /locus_tag="Smlt0006"
                     /product="putative transmembrane protease"
                     /note="similarity:fasta; with=UniProt:Q3BZS7
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Putative membrane protease.; length=278;
                     id 58.088%; ungapped id 58.955%; E()=1.3e-50; 272 aa
                     overlap; query 10-279; subject 7-276"
                     /db_xref="EnsemblGenomes-Gn:Smlt0006"
                     /db_xref="EnsemblGenomes-Tr:CAQ43624"
                     /db_xref="GOA:B2FT84"
                     /db_xref="InterPro:IPR003675"
                     /db_xref="UniProtKB/TrEMBL:B2FT84"
                     /protein_id="CAQ43624.1"
                     /translation="MSASAPVSAPPPVPPASAAPRAVSPLAGFFIDLGIAAVTLFGLS
                     LVSGLLWGLYRGVVVGYANAQAGAGAPDASSVAASLGQPGALAQILMALFATGGAALL
                     LYFWRRPANAAERHASRQALRRPSTWGWTLLVATLIVLGSNGIAFLAKQVGVEPVPTN
                     LALMQSAIARFPLFLVLFAVVLAPAYEELLFRRVLFGRLWQAGRPGLGVVLSSLAFAL
                     IHEIPGTSANGPAEIAQLWLVYGGMGAAFCWLYRRTGTLWAAVTAHALNNAVALAAMV
                     FLGST"
     sig_peptide     7438..7491
                     /locus_tag="Smlt0006"
                     /note="Signal peptide predicted for Smlt0006 by SignalP
                     2.0 HMM (Signal peptide probability 0.656) with cleavage
                     site probability 0.651 between residues 18 and 19"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    order(7522..7590,7687..7755,7816..7884,7927..7995,
                     8053..8106,8134..8187,8206..8274)
                     /locus_tag="Smlt0006"
                     /note="7 probable transmembrane helices predicted for
                     Smlt0006 by TMHMM2.0 at aa 29-51, 84-106, 127-149,
                     164-186, 206-223, 233-250 and 257-279"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    7957..8262
                     /locus_tag="Smlt0006"
                     /note="HMMPfam hit to PF02517, CAAX amino terminal
                     protease family, score 1.2e-14"
                     /inference="protein motif:HMMPfam:PF02517"
     CDS             8355..9161
                     /transl_table=11
                     /locus_tag="Smlt0007"
                     /product="putative peptidase"
                     /note="similarity:fasta; with=UniProt:Q8PRF7
                     (EMBL:AE011623;); Xanthomonas axonopodis pv. citri.;
                     Hypothetical protein XAC0006.; length=268; id 79.104%;
                     ungapped id 79.104%; E()=3.4e-79; 268 aa overlap; query
                     1-268; subject 1-268"
                     /db_xref="EnsemblGenomes-Gn:Smlt0007"
                     /db_xref="EnsemblGenomes-Tr:CAQ43625"
                     /db_xref="GOA:B2FT85"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="UniProtKB/TrEMBL:B2FT85"
                     /protein_id="CAQ43625.1"
                     /translation="MKQLLLALVITTLVSACATTTSPTGRRQMVGGVSQAQLDQLGAQ
                     AFAETKQKEKISTDGRQNGYVQCVVNALVAQLPAQYRGVRWETAVFVDKEPNAFALPG
                     GKVGVNTGIFTVAKNQDQLAAVIGHEIGHVIARHHEERITRQMGAQTGLAVLGALAGA
                     AYGEGAASTVNQLGGMGAQTAFLLPGSRTQESEADVIGQRLMAQAGFNPAQAVDLWQN
                     MMAASGGRSPQWLSTHPDPANRIQELRRDAPGLTPVYQQAQAAGLRPKCG"
     sig_peptide     8355..8408
                     /locus_tag="Smlt0007"
                     /note="Signal peptide predicted for Smlt0007 by SignalP
                     2.0 HMM (Signal peptide probability 0.998) with cleavage
                     site probability 0.325 between residues 18 and 19"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    8556..9101
                     /locus_tag="Smlt0007"
                     /note="HMMPfam hit to PF01435, Peptidase family M48, score
                     6.5e-45"
                     /inference="protein motif:HMMPfam:PF01435"
     CDS             9294..10481
                     /transl_table=11
                     /locus_tag="Smlt0008"
                     /product="conserved hypothetical TPR repeat family
                     protein"
                     /note="similarity:fasta; with=UniProt:Q8PRF6
                     (EMBL:AE011623;); Xanthomonas axonopodis pv. citri.;
                     Hypothetical protein XAC0007.; length=397; id 74.937%;
                     ungapped id 75.127%; E()=3.3e-102; 395 aa overlap; query
                     2-395; subject 3-397"
                     /db_xref="EnsemblGenomes-Gn:Smlt0008"
                     /db_xref="EnsemblGenomes-Tr:CAQ43626"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:B2FT86"
                     /protein_id="CAQ43626.1"
                     /translation="MIFRNHKAVLSVLVATALTGAVVTDAFAQSSRSSERGNRGGKQA
                     KAEALYPNATRQEPTVKASAKMGSKLQKMIDSYNKEKFPETRTQADAILADSAANEYD
                     KSLAAQLASQAAYQTDDAPAAIAYLKQVLQFNGLDNNGHFQSMLMLGQLQLQEDQTAE
                     GLATLDKYFAESKSTKPEELIAKGQALYQLERYQEAIPVLKQAIAGSAEPKDNWNQLL
                     MAALSEAGQSGEAVKEAEALAAKNPNDKKAQLNLASMYMQADQMDKAAAVMDKLRSSG
                     QLTEEREYKQLYSIYANTDKKEKDVIAVINEGLQKGILKPDYQVYLALAQSYYYSDQV
                     PQAIDAWQKAAPLSKDGETYLNLARVLHAEGRIPEAKQAAQQALAKGVKNQADAKKII
                     NLK"
     sig_peptide     9294..9377
                     /locus_tag="Smlt0008"
                     /note="Signal peptide predicted for Smlt0008 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.702 between residues 28 and 29"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    9822..9923
                     /locus_tag="Smlt0008"
                     /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
                     score 0.083"
                     /inference="protein motif:HMMPfam:PF00515"
     misc_feature    10245..10346
                     /locus_tag="Smlt0008"
                     /note="HMMPfam hit to PF00515, Tetratricopeptide repeat,
                     score 0.25"
                     /inference="protein motif:HMMPfam:PF00515"
     misc_feature    10344..10421
                     /locus_tag="Smlt0008"
                     /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
                     score 0.0011"
                     /inference="protein motif:HMMPfam:PF07721"
     CDS             10625..11293
                     /transl_table=11
                     /locus_tag="Smlt0009"
                     /product="putative proline-rich TonB dependent receptor
                     protein"
                     /note="similarity:fasta; with=UniProt:Q9RMT3
                     (EMBL:AE004458;); Pseudomonas aeruginosa.; tonB2; TonB2
                     (Hypothetical protein).; length=270; id 36.986%; ungapped
                     id 40.500%; E()=1.2e-17; 219 aa overlap; query 23-222;
                     subject 52-270"
                     /note="similarity:fasta; with=UniProt:O34261
                     (EMBL:AE012094;); Xanthomonas campestris pv. campestris.;
                     tonB; Protein tonB.; length=223; id 83.856%; ungapped id
                     84.234%; E()=1e-67; 223 aa overlap; query 1-222; subject
                     1-223"
                     /db_xref="EnsemblGenomes-Gn:Smlt0009"
                     /db_xref="EnsemblGenomes-Tr:CAQ43627"
                     /db_xref="GOA:B2FT87"
                     /db_xref="InterPro:IPR006260"
                     /db_xref="UniProtKB/TrEMBL:B2FT87"
                     /protein_id="CAQ43627.1"
                     /translation="MTEQLVVHRYEQPDDKGLSWPRIVGIAFVIALHLAAFMMLLIPA
                     VAPKAVAEKERNVMVTIVDAPPPPPPPPPPPPPTDTPPPPVKNLSPPKPSPVPPPPQA
                     PVVDVPEPRPSDIVTPPSPPAPPAPATSIEASVDISSKAMNPPRYPPAAFRAGIQGEV
                     ILIIDVDANGNVTNVTVEKSSRNRDLDRAAMEAARKWRFNAAESGGKKAAGRVRVPVN
                     FALN"
     misc_feature    10691..10759
                     /locus_tag="Smlt0009"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0009 by TMHMM2.0 at aa 23-45"
                     /inference="protein motif:TMHMM:2.0"
     repeat_region   complement(10815..10933)
                     /rpt_family="(CGG)n"
                     /inference="nucleotide motif:RepeatScout"
     repeat_region   10815..10829
                     /rpt_unit_seq="(cgc)5"
     repeat_region   10832..10855
                     /rpt_unit_seq="(ccg)8"
     repeat_region   10865..10876
                     /rpt_unit_seq="(ccg)4"
     repeat_region   10913..10924
                     /rpt_unit_seq="(ccg)4"
     repeat_region   10974..11001
                     /rpt_family="GC_rich"
                     /inference="nucleotide motif:RepeatScout"
     misc_feature    11054..11158
                     /locus_tag="Smlt0009"
                     /note="HMMPfam hit to PF03544, Gram-negative bacterial
                     tonB protein, score 1.5e-14"
                     /inference="protein motif:HMMPfam:PF03544"
     repeat_region   11365..11372
                     /rpt_unit_seq="(ca)4"
     CDS             11388..12149
                     /transl_table=11
                     /gene="exbB1"
                     /locus_tag="Smlt0010"
                     /product="putative biopolymer transport exbB protein"
                     /note="similarity:fasta; with=UniProt:O34260
                     (EMBL:AE012094;); Xanthomonas campestris pv. campestris.;
                     exbB; Biopolymer transport exbB protein.; length=253; id
                     91.339%; ungapped id 92.063%; E()=5.2e-80; 254 aa overlap;
                     query 1-253; subject 1-253"
                     /note="similarity:fasta; with=UniProt:Q8PRF4
                     (EMBL:AE011624;); Xanthomonas axonopodis pv. citri.; exbB;
                     Biopolymer transport ExbB protein.; length=253; id
                     91.732%; ungapped id 92.460%; E()=1.5e-80; 254 aa overlap;
                     query 1-253; subject 1-253"
                     /db_xref="EnsemblGenomes-Gn:Smlt0010"
                     /db_xref="EnsemblGenomes-Tr:CAQ43628"
                     /db_xref="GOA:B2FT88"
                     /db_xref="InterPro:IPR002898"
                     /db_xref="UniProtKB/TrEMBL:B2FT88"
                     /protein_id="CAQ43628.1"
                     /translation="MLQEIFIAAAAGGNPSNALSQMGFEHLIHEMTTKPGDFAVSWVV
                     LLTLIAMSAMSWYWTVINIFRATRLKSAADRVVSLFWDTPNAQDAIRAMEEQPASEPF
                     SKIALDAAQAAAHHQRAEGGATGGVGENLSRSEFVDRALRQAVTRESNKLQSGMTLLA
                     TVGATAPFVGLLGTVWGIYGALIKIGATGSASIDAVAGPVGEALIMTAIGLFVAIPAV
                     FAFNFFSKINSATISKFDTFAHDLHDFFATGSRVR"
     sig_peptide     11388..11447
                     /gene="exbB1"
                     /locus_tag="Smlt0010"
                     /note="Signal peptide predicted for Smlt0010 by SignalP
                     2.0 HMM (Signal peptide probability 0.732) with cleavage
                     site probability 0.564 between residues 20 and 21"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    order(11499..11567,11868..11936,11994..12062)
                     /gene="exbB1"
                     /locus_tag="Smlt0010"
                     /note="3 probable transmembrane helices predicted for
                     Smlt0010 by TMHMM2.0 at aa 38-60, 161-183 and 203-225"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    11682..12107
                     /gene="exbB1"
                     /locus_tag="Smlt0010"
                     /note="HMMPfam hit to PF01618, MotA/TolQ/ExbB proton
                     channel family, score 2.1e-57"
                     /inference="protein motif:HMMPfam:PF01618"
     CDS             12212..12637
                     /transl_table=11
                     /gene="exbD1"
                     /locus_tag="Smlt0011"
                     /product="putative biopolymer transport ExbD1 protein"
                     /note="similarity:fasta; with=UniProt:O34259
                     (EMBL:AE012094); Xanthomonas campestris pv. campestris.;
                     exbD1; Biopolymer transport exbD1 protein.; length=140; id
                     89.362%; ungapped id 90.000%; E()=8.1e-45; 141 aa overlap;
                     query 1-141; subject 1-140"
                     /note="similarity:fasta; with=UniProt:Q4V0R9
                     (EMBL:CP000050); Xanthomonas campestris pv. campestris
                     (strain 8004).; Biopolymer transport ExbD1 protein.;
                     length=140; id 89.362%; ungapped id 90.000%; E()=8.1e-45;
                     141 aa overlap; query 1-141; subject 1-140"
                     /db_xref="EnsemblGenomes-Gn:Smlt0011"
                     /db_xref="EnsemblGenomes-Tr:CAQ43629"
                     /db_xref="GOA:B2FT89"
                     /db_xref="InterPro:IPR003400"
                     /db_xref="UniProtKB/TrEMBL:B2FT89"
                     /protein_id="CAQ43629.1"
                     /translation="MAFSSGNSGGPMADINVTPLVDVMLVLLIIFIITAPLMSHKVKV
                     DLPEANLIQKPEDAEKRSGPITLAVKEDGSIYWNDEEINKQTLESRLATAAQQTPQPP
                     LNLRGDRTTKMRVINDLTKVAQEQGMLDVGFVATKEKGQ"
     misc_feature    12233..12625
                     /gene="exbD1"
                     /locus_tag="Smlt0011"
                     /note="HMMPfam hit to PF02472, Biopolymer transport
                     protein ExbD/TolR, score 7.4e-15"
                     /inference="protein motif:HMMPfam:PF02472"
     misc_feature    12254..12322
                     /gene="exbD1"
                     /locus_tag="Smlt0011"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0011 by TMHMM2.0 at aa 15-37"
                     /inference="protein motif:TMHMM:2.0"
     CDS             12641..13054
                     /transl_table=11
                     /gene="exbD2"
                     /locus_tag="Smlt0012"
                     /product="putative biopolymer transport ExbD2 protein"
                     /note="similarity:fasta; with=UniProt:O34258; Xanthomonas
                     campestris pv. campestris.; exbD2; Biopolymer transport
                     exbD2 protein.; length=136; id 83.824%; ungapped id
                     83.824%; E()=7.2e-38; 136 aa overlap; query 1-136; subject
                     1-136"
                     /note="similarity:fasta; with=UniProt:Q8PRF2; Xanthomonas
                     axonopodis pv. citri.; exbD2; Biopolymer transport ExbD2
                     protein.; length=137; id 84.672%; ungapped id 84.672%;
                     E()=1.5e-38; 137 aa overlap; query 1-137; subject 1-137"
                     /db_xref="EnsemblGenomes-Gn:Smlt0012"
                     /db_xref="EnsemblGenomes-Tr:CAQ43630"
                     /db_xref="GOA:B2FT90"
                     /db_xref="InterPro:IPR003400"
                     /db_xref="UniProtKB/TrEMBL:B2FT90"
                     /protein_id="CAQ43630.1"
                     /translation="MAFSSGGGKGPMADINVTPLVDVMLVLLIIFIVTAPIMTYPIAV
                     DLPQRVLNPPPQLVEPPPPIELKIDASNQVSWNNSPINTSELQQRMEQEVQRDPTNQP
                     ELRIDASPDSEYDVMAKVLAAAKNAQMKKIGFVQQ"
     misc_feature    12662..13051
                     /gene="exbD2"
                     /locus_tag="Smlt0012"
                     /note="HMMPfam hit to PF02472, Biopolymer transport
                     protein ExbD/TolR, score 2.9e-05"
                     /inference="protein motif:HMMPfam:PF02472"
     misc_feature    12698..12766
                     /gene="exbD2"
                     /locus_tag="Smlt0012"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0012 by TMHMM2.0 at aa 20-42"
                     /inference="protein motif:TMHMM:2.0"
     repeat_region   12818..12829
                     /rpt_unit_seq="(ccg)4"
     repeat_region   13115..13123
                     /rpt_unit_seq="(t)9"
     CDS             13157..14617
                     /transl_table=11
                     /gene="cls"
                     /locus_tag="Smlt0013"
                     /product="putative cardiolipin synthetase"
                     /EC_number="2.7.8.-"
                     /note="similarity:fasta; with=UniProt:P45860; Bacillus
                     subtilis.; ywiE; Probable cardiolipin synthetase 1 (EC
                     2.7.8.-) (Cardiolipin synthase 1) (CL synthase 1).;
                     length=500; id 32.724%; ungapped id 34.773%; E()=3.1e-47;
                     492 aa overlap; query 37-512; subject 22-500"
                     /note="similarity:fasta; with=UniProt:Q8PRE9; Xanthomonas
                     axonopodis pv. citri.; cls; Cardiolipin synthetase.;
                     length=486; id 72.840%; ungapped id 72.840%; E()=2.3e-144;
                     486 aa overlap; query 27-512; subject 1-486"
                     /db_xref="EnsemblGenomes-Gn:Smlt0013"
                     /db_xref="EnsemblGenomes-Tr:CAQ43631"
                     /db_xref="GOA:B2FT91"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR022924"
                     /db_xref="InterPro:IPR025202"
                     /db_xref="InterPro:IPR027379"
                     /db_xref="UniProtKB/TrEMBL:B2FT91"
                     /protein_id="CAQ43631.1"
                     /translation="MLALFDSLRHWLDGIAHLGSILAVAYLLYLFALAGWIMLQKREP
                     VATLSWILSLALLPYLGLFIYYLLGPQKVKRQRLRRGRARSGMEHYSDVCPPDADCTE
                     LAKIAQATTGLAPSSATEVTWLVDGAATYAALLEAVAQARDHVHLEYYIFNPDHAGTA
                     LRDALVERARAGVQVRLLLDAVGSSALPRRFLQPLIDAGGEAVWFHPRQLLKPFKRPW
                     LNLRTHRKLVIVDGRLAFTGGINITDDEDESRKPNAYRDLHMRIRGHVVRSLQLVFAE
                     DWLYASGQDPSRMDIARLWPADMPLRGDGAINAQVLVSGPDSGWETIHRLHVAAIQEA
                     HERVWLVTPYFVPGEAARMALTSAALGGLDVRLLVPKMSDSWFVTQAARSYFDELLHA
                     GVKIYEYGPRMLHTKAFIADDDVCIVGSANFDHRSFRLNFELSMMISDRDRVAALAGL
                     LQGEFDRATRVHDQAGRSLWLHRLPEAFARLASPLL"
     misc_feature    order(13199..13267,13304..13363)
                     /gene="cls"
                     /locus_tag="Smlt0013"
                     /note="2 probable transmembrane helices predicted for
                     Smlt0013 by TMHMM2.0 at aa 15-37 and 50-69"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    13811..13894
                     /gene="cls"
                     /locus_tag="Smlt0013"
                     /note="HMMPfam hit to PF00614, Phospholipase D Active site
                     motif, score 3.9e-06"
                     /inference="protein motif:HMMPfam:PF00614"
     misc_feature    14354..14437
                     /gene="cls"
                     /locus_tag="Smlt0013"
                     /note="HMMPfam hit to PF00614, Phospholipase D Active site
                     motif, score 1.9e-06"
                     /inference="protein motif:HMMPfam:PF00614"
     CDS             14658..14927
                     /transl_table=11
                     /locus_tag="Smlt0014"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PEG7; Xanthomonas
                     campestris pv. campestris.; Hypothetical protein XCC0013.;
                     length=89; id 49.425%; ungapped id 51.190%; E()=3.7e-12;
                     87 aa overlap; query 1-84; subject 1-87"
                     /db_xref="EnsemblGenomes-Gn:Smlt0014"
                     /db_xref="EnsemblGenomes-Tr:CAQ43632"
                     /db_xref="GOA:B2FT92"
                     /db_xref="UniProtKB/TrEMBL:B2FT92"
                     /protein_id="CAQ43632.1"
                     /translation="MYWLYLLLALGCFAFALKTPSAALMTLCLLAALAFLLAWVRGRY
                     VARFGDLQRDPATLVDAEELRRLREQAQARRNADANDHDPSPLSK"
     sig_peptide     14658..14759
                     /locus_tag="Smlt0014"
                     /note="Signal peptide predicted for Smlt0014 by SignalP
                     2.0 HMM (Signal peptide probability 0.993) with cleavage
                     site probability 0.328 between residues 34 and 35"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    14715..14783
                     /locus_tag="Smlt0014"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0014 by TMHMM2.0 at aa 20-42"
                     /inference="protein motif:TMHMM:2.0"
     CDS             14937..15680
                     /transl_table=11
                     /locus_tag="Smlt0015"
                     /product="putative pyridoxal phosphate biosynthetic
                     protein"
                     /note="similarity:fasta; with=UniProt:O69158;
                     Bradyrhizobium japonicum.; pdxJ; Pyridoxal phosphate
                     biosynthetic protein pdxJ (PNP synthase).; length=250; id
                     36.694%; ungapped id 38.889%; E()=6.3e-11; 248 aa overlap;
                     query 3-247; subject 7-243"
                     /note="similarity:fasta; with=UniProt:Q8PEG8; Xanthomonas
                     campestris pv. campestris.; pdxJ; Pyridoxal phosphate
                     biosynthetic protein pdxJ (PNP synthase).; length=256; id
                     76.016%; ungapped id 76.016%; E()=9.3e-68; 246 aa overlap;
                     query 2-247; subject 3-248"
                     /db_xref="EnsemblGenomes-Gn:Smlt0015"
                     /db_xref="EnsemblGenomes-Tr:CAQ43633"
                     /db_xref="GOA:B2FT93"
                     /db_xref="InterPro:IPR004569"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:B2FT93"
                     /protein_id="CAQ43633.1"
                     /translation="MTQLSVNVNKIAVLRNSRGGAEPDVVRAAQACLDAGAHGITVHP
                     RPDRRHITAEDVLALSTLTRARGVEFNIEGNPFAPPREGYPGLLPLCAQTRPAQATLV
                     PDGDGQITSDHGFDFERDAERLRPLVAELKAMGCRVSLFVDAGNPLLEQAAEVGADRV
                     ELYTGPYAEAHAAGDAAAMLELFATAARRAQAMGLGVNAGHDLSQDNLRDFLAHVPDV
                     LEVSIGHALIGEALYDGLDATVRGYLALL"
     misc_feature    14940..15677
                     /locus_tag="Smlt0015"
                     /note="HMMPfam hit to PF03740, Pyridoxal phosphate
                     biosynthesis protein Pdx, score 1.7e-120"
                     /inference="protein motif:HMMPfam:PF03740"
     repeat_region   15126..15133
                     /rpt_unit_seq="(cg)4"
     CDS             15782..16033
                     /pseudo
                     /transl_table=11
                     /locus_tag="Smlt0016"
                     /product="conserved hypothetical protein, pseudogene"
                     /note="Similar to N-terminus to codon 80 of Xanthomonas
                     campestris pv. campestris hypothetical protein xcc0015.
                     UniProt:Q8PEG5 (364 aa) fasta scores: E()=4.4e-22, 75.949%
                     id in 79 aa"
                     /note="similarity:fasta; with=UniProt:Q8PEG5; Xanthomonas
                     campestris pv. campestris.; Hypothetical protein XCC0015.;
                     length=364; id 75.949%; ungapped id 75.949%; E()=4.4e-22;
                     79 aa overlap; query 1-79; subject 1-79"
                     /db_xref="PSEUDO:CAQ43634.1"
     CDS             complement(16178..16402)
                     /transl_table=11
                     /locus_tag="Smlt0017"
                     /product="putative DNA-binding protein"
                     /note="similarity:fasta; with=UniProt:Q52622; Proteus
                     vulgaris.; pvuIIC;; PvuIIC. PvuIIC.; length=84; id
                     40.000%; ungapped id 40.000%; E()=1.1e-05; 60 aa overlap;
                     query 10-69; subject 14-73"
                     /note="similarity:fasta; with=UniProt:Q63NB9; Burkholderia
                     pseudomallei (Pseudomonas pseudomallei).; Putative
                     DNA-binding regulatory protein.; length=81; id 44.928%;
                     ungapped id 44.928%; E()=1.2e-06; 69 aa overlap; query
                     6-74; subject 13-81"
                     /db_xref="EnsemblGenomes-Gn:Smlt0017"
                     /db_xref="EnsemblGenomes-Tr:CAQ43635"
                     /db_xref="GOA:B2FT95"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="UniProtKB/TrEMBL:B2FT95"
                     /protein_id="CAQ43635.1"
                     /translation="MVEHTNQAKLADVIRAHRIDLGVSQEAFADHIQMHRAYYSKIER
                     GEKNLTLATLERVAKGMGTSMSALLRAAGL"
     misc_feature    complement(16199..16363)
                     /locus_tag="Smlt0017"
                     /note="HMMPfam hit to PF01381, Helix-turn-helix, score
                     1.4e-13"
                     /inference="protein motif:HMMPfam:PF01381"
     CDS             16483..16818
                     /transl_table=11
                     /locus_tag="Smlt0018"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0018"
                     /db_xref="EnsemblGenomes-Tr:CAQ43636"
                     /db_xref="UniProtKB/TrEMBL:B2FT96"
                     /protein_id="CAQ43636.1"
                     /translation="MNFYLVCPELEFTLELPFSPMGREQVAMQMRRMQEEEGQARGFE
                     YRLAEELSKLIPQLTDWDIKPPTGAQMAYATSLCAQLGIPLPAATRRSRALMQIFLAE
                     AKALHGQRS"
     CDS             16909..18060
                     /transl_table=11
                     /locus_tag="Smlt0019"
                     /product="putative radical SAM domain protein"
                     /note="similarity:fasta; with=UniProt:Q8PRE6; Xanthomonas
                     axonopodis pv. citri.; Hypothetical protein XAC0017.;
                     length=375; id 65.041%; ungapped id 65.041%; E()=1.7e-97;
                     369 aa overlap; query 15-383; subject 7-375"
                     /db_xref="EnsemblGenomes-Gn:Smlt0019"
                     /db_xref="EnsemblGenomes-Tr:CAQ43637"
                     /db_xref="GOA:B2FT97"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:B2FT97"
                     /protein_id="CAQ43637.1"
                     /translation="MLRRLWLAIILTARPSQVVAMEQDARKAQVPLKGRGAASRVPSR
                     FDTTATVGVDDGWESVYQEMEDAPPLRTQVQEERARTVISHNSSPDVGFSASVNPYRG
                     CEHGCVYCFARPSHSYLSLSPGLDFETRLFAKTNAPERLRAEISKSNYKCTPIALGIN
                     TDGYQPIERNYQITRQCLEVLADAKHPVSFVTKSALITRDVELLASMAKDRLVTVYFS
                     VTTLDRKLSAKLEPRAAAPHARLRAMNQLHEAGVPVGVLIAPVIPMITDHDLEAILEA
                     AHEHGARAAGYVLLRLPNEIKDIWREWLELHYPDRAAHVLSLMRQMHGGKEYDASFGT
                     RMSGTGPVADLIRKRFEKKHRELGFTRLPALATHLFQPPQDKSPQGQLF"
     sig_peptide     16909..16968
                     /locus_tag="Smlt0019"
                     /note="Signal peptide predicted for Smlt0019 by SignalP
                     2.0 HMM (Signal peptide probability 0.999) with cleavage
                     site probability 0.996 between residues 20 and 21"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    17197..17739
                     /locus_tag="Smlt0019"
                     /note="HMMPfam hit to PF04055, Radical SAM superfamily,
                     score 2.3e-18"
                     /inference="protein motif:HMMPfam:PF04055"
     CDS             18258..19148
                     /transl_table=11
                     /locus_tag="Smlt0020"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q44Z00
                     (EMBL:AAHI01000025); Burkholderia cenocepacia AU 1054.;
                     Hypothetical protein.; length=314; id 33.453%; ungapped id
                     35.769%; E()=3.5e-22; 278 aa overlap; query 23-285;
                     subject 24-298"
                     /db_xref="EnsemblGenomes-Gn:Smlt0020"
                     /db_xref="EnsemblGenomes-Tr:CAQ43638"
                     /db_xref="UniProtKB/TrEMBL:B2FT98"
                     /protein_id="CAQ43638.1"
                     /translation="MPKQVRGLSVYRSTIERLPQFRILSGPLTEHQAAMLGFDDLPLA
                     GASIVPSAEGPATLFNARGKEIIRKDLPMVTKSRSINTSWKDWHGHTHHGTQTRSYET
                     YPREYVAPPGEFLTAVDTDSGIAMATRIIDRTEPEESIANLLNIYLECFQHFEIVDPD
                     LAVPVRVEKINWRILPPGKFPFDRAMQVLDSYLKQLTDSDRAVAKQRIRTITRHEPDF
                     MAVGLGGFSEYIVFGFTGRNRYVFESPESGNATYIFRNEWEAVSQLTKRQILQEQLQE
                     TRIIHTSRWAVEVSEAIQRK"
     CDS             19267..19740
                     /transl_table=11
                     /locus_tag="Smlt0021"
                     /product="conserved hypothetical protein"
                     /note="N-terminus is similar to hahella chejuensis (strain
                     kctc 2396). hypothetical protein. UniProt:Q2SGS8
                     (EMBL:CP000155 (90 aa) fasta scores: E()=4.9e-10, 54.795%
                     id in 73 aa"
                     /note="similarity:fasta; with=UniProt:Q2SGS8
                     (EMBL:CP000155;); Hahella chejuensis (strain KCTC 2396).;
                     Hypothetical protein.; length=90; id 54.795%; ungapped id
                     54.795%; E()=4.9e-10; 73 aa overlap; query 4-76; subject
                     18-90"
                     /db_xref="EnsemblGenomes-Gn:Smlt0021"
                     /db_xref="EnsemblGenomes-Tr:CAQ43639"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:B2FT99"
                     /protein_id="CAQ43639.1"
                     /translation="MKPTILALDLEGTLISNAVSQIPRPGLHRFLEDVRSQFEELVLF
                     TTVPEALARRIAGLLAREGSVPAWFVELRYIHWSGRTKDLSYVSPHVGEAFLLDDHGP
                     YVHDGQERLWVEIPLFGSPYSSDDDGLQIAAERLTDRIIELQSASDLGHMIADHG"
     misc_feature    19279..19683
                     /locus_tag="Smlt0021"
                     /note="HMMPfam hit to PF03031, NLI interacting factor-like
                     phosphatase, score 0.094"
                     /inference="protein motif:HMMPfam:PF03031"
     repeat_region   20322..20329
                     /rpt_unit_seq="(a)8"
     CDS             20360..21661
                     /transl_table=11
                     /locus_tag="Smlt0023"
                     /product="putative integrase/recombinase"
                     /note="Codons 165 to the C-terminus are similar to codons
                     85 to the C-terminus of Xanthomonas campestris pv.
                     campestris intIA site-specific recombinase intIA
                     (site-specific recombinase). UniProt:Q9AMK4 (327 aa) fasta
                     scores: E()=0.084, 30.909% id in 275 aa, and to Geobacter
                     sulfurreducens hypothetical protein. UniProt:Q74AC3 (457
                     aa) fasta scores: E()=0.0011, 27.124% id in 306 aa"
                     /note="similarity:fasta; with=UniProt:Q9AMK4; Xanthomonas
                     campestris pv. campestris.; intIA; Site-specific
                     recombinase IntIA (Site-specific recombinase).;
                     length=327; id 30.909%; ungapped id 37.778%; E()=0.084;
                     275 aa overlap; query 165-423; subject 86-326"
                     /note="similarity:fasta; with=UniProt:Q74AC3; Geobacter
                     sulfurreducens.; Hypothetical protein.; length=457; id
                     27.124%; ungapped id 30.970%; E()=0.0011; 306 aa overlap;
                     query 116-397; subject 145-436"
                     /db_xref="EnsemblGenomes-Gn:Smlt0023"
                     /db_xref="EnsemblGenomes-Tr:CAQ43640"
                     /db_xref="GOA:B2FTA0"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR004107"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013762"
                     /db_xref="InterPro:IPR023109"
                     /db_xref="UniProtKB/TrEMBL:B2FTA0"
                     /protein_id="CAQ43640.1"
                     /translation="MVYDVEICTARAIASEATGIKCAQGVPLPEGFCFLVSRSDGTIV
                     QPAFEFFADAHLTIGPKPKLACSKNTTAAIAADLTDFHHFLDARKKLVSDVDEDLLRS
                     YADTLTDLDSAVTLDKLAAATIHRRWSTVTKLIAFCVKRGYLRKAPALLSKQTKRGTV
                     QVLDVGVDLPGLNDADELITALHPETVVGILDELGPNPVLERNGLVELAYATTAQRLM
                     AELCYQAGLRRAEVCDLKAKTILQARTEGRDPLTAVAIPVLGKGNKKRNVPVPVWLLN
                     ALKRYAKGVRQRLVDLRLGYHKLEDHGVLFVLDANNRKHAGNPITPQIFDRHFAQAKD
                     RLLKRLSKERDLARYESTQRERITIHALRHTFALYTYMEKRANGDMDAIKYVQSVLGH
                     SLRDTTESIYLRSANAFESETRESIRLHLEGQPFMRIGVEA"
     misc_feature    20954..21604
                     /locus_tag="Smlt0023"
                     /note="HMMPfam hit to PF00589, Phage integrase family,
                     score 2e-06"
                     /inference="protein motif:HMMPfam:PF00589"
     CDS             22025..23593
                     /transl_table=11
                     /locus_tag="Smlt0024"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0024"
                     /db_xref="EnsemblGenomes-Tr:CAQ43641"
                     /db_xref="UniProtKB/TrEMBL:B2FTZ0"
                     /protein_id="CAQ43641.1"
                     /translation="MSGLVQYLTVKGVKISGPDDTPMDLGESFLTYLKGRDTTHPTVL
                     SVETQRHYYGTFKKVVLALHEMDPRWKVIRIPPKPFAGLPRKSKPKELDRAAWANVMK
                     AAVEECISTMDEVWPLLDRVHSALAQKKKGDAVSLSDPAEAIAQILANFDGHLPRQGA
                     VHKLPGVGKISESEYFRLRRLAHPIGGDLIPFFLVLAMHSGFNEQPLRTLTLNGISEH
                     YPLGQKRTVIKSSKRRAGSSAQGATQRAAFPASDHPLAPERLISFVIAWTKRIRDYAA
                     GELANDFFLHAVSEGGRHKRRGMHIDSYSARTDDVTTRVTGYITLFCKRRGLKYSGSQ
                     ANRLAFSEAVDGLTDGDAFELRAMLGHRLLSTGQDSYQTTTMQHRQKEQLAGAMTAQE
                     RWVTSNGKIDTRSARSDREQTAATQGFCCADPFQSPQPGQRHGKLCTSYGSCPACPLA
                     AADPNEAYALARFLQLQELYEEARAELGSEIWRRKFENAYLALRDSWIPAVSTTANRQ
                     SAMMIMLTPLPGLE"
     CDS             23632..25704
                     /transl_table=11
                     /locus_tag="Smlt0025"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q35GX7
                     (EMBL:AALJ01000004;); Bradyrhizobium sp. BTAi1.;
                     Hypothetical protein.; length=624; id 22.609%; ungapped id
                     25.743%; E()=0.018; 690 aa overlap; query 1-679; subject
                     1-617"
                     /db_xref="EnsemblGenomes-Gn:Smlt0025"
                     /db_xref="EnsemblGenomes-Tr:CAQ43642"
                     /db_xref="UniProtKB/TrEMBL:B2FTZ1"
                     /protein_id="CAQ43642.1"
                     /translation="MAMPAARKVETAQAATLHPSFQVDYDSDVWTFAQTTVGQQKEFV
                     TVDWAIPVARGELLTDYKHRGLLSELKCYLKTAIIEDTVRMTVGSIPGTYMGMRELVK
                     FMGEREIHSLFDITTAMSWDYVEGLEEQYMTARSDAGRDRAWTHATAYKLIHPLTQIY
                     EIADSLRARGGQAPCEAPFDGRKTYDVVTEPLGLARTGGLMPVPDEISVPILSYACEW
                     IEYGSEDVIRLQAEVIPMLIDARSATGPRRIACFRQIKRHIEEFQMSPIPGTLTPWHE
                     PLATIDRIDDAGDEREISGTQGLRRLILMTQSACSVLLQGCTGIRAHELIGLSLDHDP
                     TLQHGVVKSVTSLDGLMEVFSICGISAKREATRHEWTAGLRPLGTNHLPIVLKSVEVL
                     VRLMEPWRALSGTKSLMLSFSHAKSLPSGPDGIGRMTASRNSLLQREFAVEALTKKRG
                     IETTQAVYEVRYLRPQRWRITFAHYVFRSKPELMPALRTHFRHMSEQITDQGYIGNDA
                     ALLENLEGERVMETSRFLVQITLGRPIGGGPAQRLLMQHAESMTEALSKMDGETPIDK
                     AVAYVKLTDLRIWTGTYASCLIDMLPDRSSCNPQASLLTVRASPNFGLRSPGLCAGCK
                     CCIILPEHKDFWEDRLLKNQAIVQMERTNSRDQYSKIAMSRVVQSRAVLRMISNATGD
                     ASDRSGES"
     repeat_region   25178..25185
                     /rpt_unit_seq="(ga)4"
     CDS             complement(25896..26756)
                     /transl_table=11
                     /locus_tag="Smlt0026"
                     /product="putative ISXac3 like transposase"
                     /note="Similar to C-terminus from codon 105 of Aeromonas
                     salmonicida Tnp putative transposase. UniProt:Q8GLR2
                     (EMBL:AY129557) (383 aa) fasta scores: E()=2.1e-40,
                     42.912% id in 261 aa, and to entire protein of Xanthomonas
                     campestris pv. vesicatoria (strain 85-10) isxac3
                     transposase. UniProt:Q3BUI8 (EMBL:AM039952) (286 aa) fasta
                     scores: E()=7.8e-103, 85.315% id in 286 aa"
                     /note="similarity:fasta; with=UniProt:Q8GLR2
                     (EMBL:AY129557); Aeromonas salmonicida.; tnp; Putative
                     transposase Tnp.; length=383; id 42.912%; ungapped id
                     43.580%; E()=2.1e-40; 261 aa overlap; query 7-266; subject
                     103-360"
                     /note="similarity:fasta; with=UniProt:Q3BUI8
                     (EMBL:AM039952); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; ISxac3 transposase.; length=286; id
                     85.315%; ungapped id 85.315%; E()=7.8e-103; 286 aa
                     overlap; query 1-286; subject 1-286"
                     /db_xref="EnsemblGenomes-Gn:Smlt0026"
                     /db_xref="EnsemblGenomes-Tr:CAQ43643"
                     /db_xref="GOA:B2FKD5"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR025948"
                     /db_xref="UniProtKB/TrEMBL:B2FKD5"
                     /protein_id="CAQ43643.1"
                     /translation="MIERCRDEFPVRLMCRCLRVSASGYYDWSKRLPSARERDNQRLL
                     GRIRELHEDSRGTLGAGRMHEDLAEEGETASLNRVARLMATDGLQGWPRPKRRGQRGK
                     PALTPPGVRNLLERDFTALEPETRWVTDITELKTRQGKLYLCIVLDLFDQRVVGWSMH
                     HRQDRQMVIRAVQMAVWQRQGSHPLILHSDRGSQFRSGDYQRYLAANGLVCSMSAVGH
                     CGDNAACEGFFGLLKRERVYRMTYPTLDAARADVFEYIERFHNPRMRRRVARQDQKFS
                     ALLQPSVISG"
     misc_feature    complement(25920..26402)
                     /locus_tag="Smlt0026"
                     /note="HMMPfam hit to PF00665, Integrase core domain,
                     score 3.3e-32"
                     /inference="protein motif:HMMPfam:PF00665"
     CDS             complement(26765..27052)
                     /transl_table=11
                     /locus_tag="Smlt0027"
                     /product="putative ISXac3 related insertion element"
                     /note="similarity:fasta; with=UniProt:Q46068
                     (EMBL:CGISABL); Corynebacterium glutamicum (Brevibacterium
                     flavum).; IS3 related insertion element.; length=97; id
                     36.170%; ungapped id 39.535%; E()=0.00011; 94 aa overlap;
                     query 4-92; subject 3-93"
                     /note="similarity:fasta; with=UniProt:Q3BYS7
                     (EMBL:AM039949); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; ISxac3 transposase.; length=95; id
                     91.489%; ungapped id 91.489%; E()=7.8e-30; 94 aa overlap;
                     query 1-94; subject 1-94"
                     /db_xref="EnsemblGenomes-Gn:Smlt0027"
                     /db_xref="EnsemblGenomes-Tr:CAQ43644"
                     /db_xref="GOA:B2FS60"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:B2FS60"
                     /protein_id="CAQ43644.1"
                     /translation="MSKRRKFSTEFKRGAVEQASQPGVSCAQVARELGIRDALLTRWK
                     REAQSRGQVAFGGTGTPRDEELARLKRELARVKKERDFLREAATFFAKGSS"
     misc_feature    complement(26804..27043)
                     /locus_tag="Smlt0027"
                     /note="HMMPfam hit to PF01527, Transposase, score 1.1e-20"
                     /inference="protein motif:HMMPfam:PF01527"
     CDS             complement(27395..28816)
                     /transl_table=11
                     /locus_tag="Smlt0028"
                     /product="conserved hypothetical protein"
                     /note="From codon 35, similar to Ralstonia eutropha
                     (Alcaligenes eutrophus) hypothetical protein.
                     UniProt:Q7WXI2 (440 aa) fasta scores: E()=7.8e-83, 52.403%
                     id in 437 aa, and entire protein is similar to Micrococcus
                     sp. 28 mc29. UniProt:Q8VPP4 (498 aa) fasta scores:
                     E()=3.4e-36, 34.221% id in 488 aa"
                     /note="similarity:fasta; with=UniProt:Q7WXI2; Ralstonia
                     eutropha (Alcaligenes eutrophus).; Hypothetical protein.;
                     length=440; id 52.403%; ungapped id 52.765%; E()=7.8e-83;
                     437 aa overlap; query 34-469; subject 3-437"
                     /note="similarity:fasta; with=UniProt:Q8VPP4; Micrococcus
                     sp. 28.; MC29.; length=498; id 34.221%; ungapped id
                     37.783%; E()=3.4e-36; 488 aa overlap; query 4-471; subject
                     12-473"
                     /db_xref="EnsemblGenomes-Gn:Smlt0028"
                     /db_xref="EnsemblGenomes-Tr:CAQ43645"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B2FTZ4"
                     /protein_id="CAQ43645.1"
                     /translation="MLPEIDLLAIQRGSITAPAGCGKTQLIAEALASHSGNRPILVLT
                     HTNAGVTALRTRLKRAGVPSSAYRLSTIDGFAMRLIAKFPARSGHHPQLLELNNAGSD
                     YPAIRESFRQLLDSGHIAAPIAATYARLLVDEYQDCSTVQHSIVSTLAALLPTCVLGD
                     PLQAIFGFGGNRLVHWEQDVQSSFPAAGSLRTPWRWQIAGNEELGQWLLSQRHALTAG
                     LPIDLTTAPSSVRWIQLVAGSEVQQRLTAARTNAPGSQGTVLVIGESMNVQGRHQLTS
                     QTPGAMAVEAVDMRDLVNFARQFNLQAPSALQDLATFSALMMTGVGTANLVTRVGTIR
                     RGRARTPPTPVEAEAVAFESERTMTRALRLVDALAEQTGTRVYRPEILHCCRSAMRSV
                     INGEQDLLGAALHARERNRHLSRPIARRAVGSTLLLKGLEADIAVVLYPESMSVQNLY
                     VALTRGAKGLVICSSTPTLTPTP"
     CDS             complement(28806..30533)
                     /transl_table=11
                     /locus_tag="Smlt0029"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q7WXI3
                     (EMBL:AY305378); Ralstonia eutropha (Alcaligenes
                     eutrophus).; Hypothetical protein.; length=571; id
                     50.699%; ungapped id 51.693%; E()=3.3e-96; 572 aa overlap;
                     query 1-569; subject 1-564"
                     /db_xref="EnsemblGenomes-Gn:Smlt0029"
                     /db_xref="EnsemblGenomes-Tr:CAQ43646"
                     /db_xref="GOA:B2FTZ5"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004604"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B2FTZ5"
                     /protein_id="CAQ43646.1"
                     /translation="MPRIRHLAIRNFRSIKALDWSPAPGINCLIGPGDSGKSTILDAI
                     DLCLGARRSISFGDMDFFDLDVSEPIRIAVTFGELPASLMDIDVYGDFLRGFDSVFDT
                     LEDEPAAGLETVLTLLLQVGADLEPSWTLISDRSLQQGLERSLPWKERIVLAPARIGS
                     FTSSNLSWSRGSVLNRLTDERAELGAQLALAARQARANFGAQASPHLSQTLGIVRTTA
                     QSLGVDVGSMPQALLDSHSVSIGEGAIALHSEAGIPLRSLGTGSSRLLVTGLQRAAAE
                     SAPIALVDEVEYGLEPHRLMRLLDSLGAKETPPPLQAFLTTHSPVALRELSGEQLLVV
                     RPRPAGHVVISAGSTDEIQSTLRTDPEAFLAKSVIVCEGASEVGFVRGLDLWGVASKE
                     SSFLALGGAYVNAGGGTPDNAFARATALMDLGYRVLVFIDADKPAAPGVAEAYLQSGG
                     SLVTWRAGMTLEDELFLCLPDTSIDALLLKAKERVGEDLMNQQLVAKSNGLTTLASIE
                     ALRPNSPYPPDIRVLLGEVSRIKKNSWFKSLTTYQSIVLDIVSRGYANADASFKAVVD
                     QLWAFTRAA"
     misc_feature    complement(29505..30527)
                     /locus_tag="Smlt0029"
                     /note="HMMPfam hit to PF02463, RecF/RecN/SMC N terminal
                     domain, score 8.9e-05"
                     /inference="protein motif:HMMPfam:PF02463"
     repeat_region   29944..29951
                     /rpt_unit_seq="(gc)4"
     CDS             complement(31220..32554)
                     /transl_table=11
                     /locus_tag="Smlt0032"
                     /product="putative MFS family transporter protein"
                     /note="Similar, but unfragmented, to Streptococcus
                     pneumoniae MefE macrolide-efflux pump (fragment).
                     UniProt:Q9RHW1 (402 aa) fasta scores: E()=1.2e-09, 22.475%
                     id in 396 aa, and similar, but truncated at the
                     N-terminus, to Rhizobium meliloti (Sinorhizobium meliloti)
                     probable nreb protein. UniProt:Q92YI4 (440 aa) fasta
                     scores: E()=2.2e-95, 59.551% id in 445 aa, and similar to
                     entire protein of Alcaligenes xylosoxydans xylosoxydans
                     (Achromobacter xylosoxidans) NreB protein. UniProt:Q44591
                     (474 aa) fasta scores: E()=7.1e-92, 57.494% id in 447 aa"
                     /note="similarity:fasta; with=UniProt:Q9RHW1;
                     Streptococcus pneumoniae.; mefE; Macrolide-efflux pump
                     (Fragment).; length=402; id 22.475%; ungapped id 25.070%;
                     E()=1.2e-09; 396 aa overlap; query 10-385; subject 11-385"
                     /note="similarity:fasta; with=UniProt:Q92YI4; Rhizobium
                     meliloti (Sinorhizobium meliloti).; Probable NreB
                     protein.; length=440; id 59.551%; ungapped id 60.920%;
                     E()=2.2e-95; 445 aa overlap; query 1-443; subject 1-437"
                     /note="similarity:fasta; with=UniProt:Q44591; Alcaligenes
                     xylosoxydans xylosoxydans (Achromobacter xylosoxidans).;
                     nreB; NreB protein.; length=474; id 57.494%; ungapped id
                     58.542%; E()=7.1e-92; 447 aa overlap; query 1-443; subject
                     29-471"
                     /db_xref="EnsemblGenomes-Gn:Smlt0032"
                     /db_xref="EnsemblGenomes-Tr:CAQ43647"
                     /db_xref="GOA:B2FTZ6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B2FTZ6"
                     /protein_id="CAQ43647.1"
                     /translation="MLEVLSHPAFRRLFGAQIVALVGTGLATVALALLAYDLAGSQAG
                     AVLGTALAIKMVVYVTLAPVSGALVPARLRKRVLIALDLVRAVVAVCLPFVTEIWQVY
                     VLIAVLQSASACFTPLFQSTIPEILQEERDYTRALSLSRLAYDLESLLSPALAAALLT
                     IISFHGLFAGTSVGFILSALLVASTTFPALAAVSSKDGPYARAIRGMRIYLRTPRLQG
                     LLALNLCAAAGGAMVFVNTVVMVRTVLGGAEEQVAWALAAFGGGSMLVALLLPKVLDR
                     ISDRTVMLAAGLFMSVVLVTFLGVWFALKGHPGWTAVIPAWTLLGMAYAGLVTPGGRL
                     LRRSAESADLPFLFAAQFSLSHVCWLIAYPLAGWVGARYGLHVALAALGILATLGLVA
                     AWRRWPAHDPEEIAHKHEHLAEDDPHLLAHRDVDGTHRHRFVIDQLHTRWPG"
     misc_feature    complement(order(31379..31438,31466..31525,31562..31630,
                     31643..31711,31745..31804,31832..31900,32006..32074,
                     32228..32296,32354..32422,32450..32518))
                     /locus_tag="Smlt0032"
                     /note="10 probable transmembrane helices predicted for
                     Smlt0032 by TMHMM2.0 at aa 13-35, 45-67, 87-109, 161-183,
                     219-241, 251-270, 282-304, 309-331, 344-363 and 373-392"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(31442..32518)
                     /locus_tag="Smlt0032"
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 1.6e-14"
                     /inference="protein motif:HMMPfam:PF07690"
     sig_peptide     complement(32450..32554)
                     /locus_tag="Smlt0032"
                     /note="Signal peptide predicted for Smlt0032 by SignalP
                     2.0 HMM (Signal peptide probability 0.706) with cleavage
                     site probability 0.494 between residues 35 and 36"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(32720..32959)
                     /transl_table=11
                     /locus_tag="Smlt0033"
                     /product="hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:Smlt0033"
                     /db_xref="EnsemblGenomes-Tr:CAQ43648"
                     /db_xref="UniProtKB/TrEMBL:B2FTZ7"
                     /protein_id="CAQ43648.1"
                     /translation="MKTHSAVIAGLLFSMSLFTTASAHDPALHADPAPPAAPKAKPTT
                     CEQLADRSKYKVDLKDAQTKALKERCDAQAAPKKK"
     sig_peptide     complement(32891..32959)
                     /locus_tag="Smlt0033"
                     /note="Signal peptide predicted for Smlt0033 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.942 between residues 23 and 24"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(32999..33637)
                     /transl_table=11
                     /locus_tag="Smlt0034"
                     /product="putative transmembrane anchor protein"
                     /note="Similar to C-terminus from codon 170 of Ruegeria
                     sp. PR1b rc177. UniProt:Q8KW13 (352 aa) fasta scores:
                     E()=1.2e-05, 33.163% id in 196 aa"
                     /note="similarity:fasta; with=UniProt:Q8KW13; Ruegeria sp.
                     PR1b.; RC177.; length=352; id 33.163%; ungapped id
                     36.932%; E()=1.2e-05; 196 aa overlap; query 21-211;
                     subject 170-350"
                     /db_xref="EnsemblGenomes-Gn:Smlt0034"
                     /db_xref="EnsemblGenomes-Tr:CAQ43649"
                     /db_xref="GOA:B2FTZ8"
                     /db_xref="UniProtKB/TrEMBL:B2FTZ8"
                     /protein_id="CAQ43649.1"
                     /translation="MSITINQPLPTTGRLLKSTLVAAAIAGALLVTAVLPAEYGIDPT
                     GIGRALGLTALADGGSTAADPATPTSSTASDAATTLAEKAAAAFGANKGQSLDPAAVS
                     LTNGELRQDAMTITLEPGKGKEVKSHMAAGAGILFSWKATGDVAVDMHGERPDVKGAW
                     TSYAVEAAQREAHGTFVAPFEGTHGWYWQNRSDTPVTVSIELVGYQADIYQP"
     misc_feature    complement(33533..33601)
                     /locus_tag="Smlt0034"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0034 by TMHMM2.0 at aa 13-35"
                     /inference="protein motif:TMHMM:2.0"
     sig_peptide     complement(33539..33637)
                     /locus_tag="Smlt0034"
                     /note="Signal peptide predicted for Smlt0034 by SignalP
                     2.0 HMM (Signal peptide probability 0.977) with cleavage
                     site probability 0.778 between residues 33 and 34"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(33657..34388)
                     /transl_table=11
                     /locus_tag="Smlt0035"
                     /product="putative transmembrane protein"
                     /note="similarity:fasta; with=UniProt:Q2SFW0
                     (EMBL:CP000155;); Hahella chejuensis (strain KCTC 2396).;
                     Hypothetical protein.; length=242; id 67.094%; ungapped id
                     67.672%; E()=2.2e-54; 234 aa overlap; query 10-243;
                     subject 10-241"
                     /db_xref="EnsemblGenomes-Gn:Smlt0035"
                     /db_xref="EnsemblGenomes-Tr:CAQ43650"
                     /db_xref="GOA:B2FTZ9"
                     /db_xref="InterPro:IPR032809"
                     /db_xref="UniProtKB/TrEMBL:B2FTZ9"
                     /protein_id="CAQ43650.1"
                     /translation="MNHPSPFCTRNLSLTSSNKLFAWLSMLAAVLLPFAAFAHGVSEG
                     DQAFLEESTGRQLIAFTYLGAKHMVTGYDHLLFLFGVIFFLYRMRDVSIYVTLFAIGH
                     STTLLLGVLGGFHVDAYLVDAIIGLSVVYKALDNMGAFKRWFGVQPNTKIAVLVFGFF
                     HGFGLATKLQDFSLSPDGLVPNMLAFNVGVELGQLLALAGILIVMGFWRRLPSFNRQA
                     YGVNTILMTAGFVLIGMQLTGYFAS"
     misc_feature    complement(order(33669..33737,33771..33839,33867..33935,
                     33969..34037,34050..34118,34131..34184,34263..34331))
                     /locus_tag="Smlt0035"
                     /note="7 probable transmembrane helices predicted for
                     Smlt0035 by TMHMM2.0 at aa 20-42, 69-86, 91-113, 118-140,
                     152-174, 184-206 and 218-240"
                     /inference="protein motif:TMHMM:2.0"
     sig_peptide     complement(34275..34388)
                     /locus_tag="Smlt0035"
                     /note="Signal peptide predicted for Smlt0035 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.956 between residues 38 and 39"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(34385..37522)
                     /transl_table=11
                     /gene="smmL"
                     /locus_tag="Smlt0036"
                     /product="putative AcrA/AcrD/AcrF family protein"
                     /note="similarity:fasta; with=UniProt:Q48815; Legionella
                     pneumophila.; helA; Protein helA.; length=1052; id
                     61.700%; ungapped id 61.996%; E()=0; 1047 aa overlap;
                     query 1-1044; subject 1-1045"
                     /note="similarity:fasta; with=UniProt:Q9A5Q7; Caulobacter
                     crescentus.; AcrB/AcrD/AcrF family protein.; length=1057;
                     id 69.231%; ungapped id 69.632%; E()=0; 1040 aa overlap;
                     query 1-1036; subject 15-1052"
                     /db_xref="EnsemblGenomes-Gn:Smlt0036"
                     /db_xref="EnsemblGenomes-Tr:CAQ43651"
                     /db_xref="GOA:B2FU00"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="InterPro:IPR004763"
                     /db_xref="InterPro:IPR027463"
                     /db_xref="UniProtKB/TrEMBL:B2FU00"
                     /protein_id="CAQ43651.1"
                     /translation="MLERIIRASIAHRWLVLLLVLALSGLGIWNYSKLPIDAVPDITN
                     VQVQINTEAPGYSPLEAEQRVTFPVETALAGLAKLEYTRSISRYGLSQVTVVFEDGTD
                     IYFARQQVAERLQQAGSQLPVGLKPSLGPVATGLGEIFMYTVEAESGAEETWTPMALR
                     TLQDWVIRPQMRHLKGVTEVNTVGGYVRQFHITPDPKKLQAYGLTLQDVLEAVARSNT
                     NVGAGYIEKSGEQYLVRVPGQVADMAGLRKIVVANRDGMPLRVGDLAEVVEGTELRTG
                     AATKDGNEVVLGTAFMLIGENSRDVAQRTAAKLKDIDATLPDGVRAHPVYDRTELVDR
                     TIETVKKNLLEGALLVIAVLFLLLGNLRAALITAAVIPLTMLLTITGMVQNRVSANLM
                     SLGALDFGLIVDGAVIIVENCLRRFGERQHLQGRLLTREERFSLAASASAEVIKPSLF
                     GLFIIAAVYIPIFALSGVEGKMFHPMALTVVIALTGAMALSLTFVPAAVAQFVTGKVS
                     EKETKAMRRVTNVYGPMLERAVNARKVVVASAAVLTVLAGLLASRLGTEFIPNLDEGD
                     IALHALRIPGTSLTQAIGMQRQLEAAIKQFPEVDEVVAKIGTAEVATDPMPPSVADTF
                     IMLKDRDQWPDPRKPKAQLVAELEKVVRAIPGNNYEFTQPVQMRMNELIAGVRAEVAV
                     KLYGDDLEQLATIGSQVENVASEIQGAADVKLEQITGLPLMTITPDLDALARYGVAID
                     DVQKTISVALGGESVGQVFEGDRRFDIVVRLSENLRQDVRTLASLPVAVAPGVSTGQE
                     RSFVPLGQLAKVEIAPGPNQISRENGKRRVVITSNVRGRDLGSFVEELRTKVGQEVQL
                     PEGYWIEYGGTFEQLISASKRLSVVVPVVLVMIFGLLFMAFGSGKDAAIVFSGVPLAL
                     TGGVVALWLRDIPMSISAGVGFIALSGVAVLNGLVMISFIKNLREEGVPLHKAVTEGA
                     LTRLRPVLMTALVASLGFLPMALNVGAGAEVQRPLATVVIGGIISSTLLTLLVLPALY
                     RLVHREDSVLESRSS"
     misc_feature    complement(34421..37510)
                     /gene="smmL"
                     /locus_tag="Smlt0036"
                     /note="HMMPfam hit to PF00873, AcrB/AcrD/AcrF family,
                     score 0"
                     /inference="protein motif:HMMPfam:PF00873"
     misc_feature    complement(order(34436..34504,34523..34591,34661..34729,
                     34754..34813,34823..34891,36023..36091,36119..36178,
                     36293..36352,36410..36478,37427..37495))
                     /gene="smmL"
                     /locus_tag="Smlt0036"
                     /note="10 probable transmembrane helices predicted for
                     Smlt0036 by TMHMM2.0 at aa 10-32, 349-371, 391-410,
                     449-468, 478-500, 878-900, 904-923, 932-954, 978-1000 and
                     1007-1029"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(37532..38767)
                     /transl_table=11
                     /gene="smmK"
                     /locus_tag="Smlt0037"
                     /product="putative cation efflux component protein"
                     /note="similarity:fasta; with=UniProt:Q48814; Legionella
                     pneumophila.; HelB.; length=400; id 32.410%; ungapped id
                     32.773%; E()=8.3e-37; 361 aa overlap; query 39-397;
                     subject 42-400"
                     /note="similarity:fasta; with=UniProt:Q9A5Q8; Caulobacter
                     crescentus.; Cation efflux system protein, putative.;
                     length=420; id 48.756%; ungapped id 49.246%; E()=5.6e-67;
                     402 aa overlap; query 12-411; subject 21-420"
                     /db_xref="EnsemblGenomes-Gn:Smlt0037"
                     /db_xref="EnsemblGenomes-Tr:CAQ43652"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR032317"
                     /db_xref="UniProtKB/TrEMBL:B2FU01"
                     /protein_id="CAQ43652.1"
                     /translation="MNRYVFLILLPIALAACGGNESSQRAKPEDTAATAGDYERGPHR
                     GRMLRDGDFALEVTVYETNTPPHFRLYAYRNDKPLAPGEVKATIQLKRLDGEVNNFSF
                     IPEKDYLVGSGEVVEPHSFDVKADAVVGGKNYAWSYASYEGRTTIDPKAAADAGVVVE
                     SAEPGTIRDTVSLMGNVAVDTGRFAAVKARFPGVVRSVAVEMGQRVSAGQTLATVEGN
                     DSMRTYSVTAPFSGVVLARSTSVGDVAADNTLFEIADLSEVWVDLRALGSDAERLSPG
                     QMVTIRSATGGLEATGKLQGILPLASAGQTVVARVALTNSEGRWRPGMAVSAEVVIAE
                     TEVPLTVKESGLQRFRDFTVVFAQVGNSYEVRMLELGRRDGDRVEVLKGLKPGTRYVS
                     EQSYLIRADIEKSGASHDH"
     misc_feature    complement(38009..38215)
                     /gene="smmK"
                     /locus_tag="Smlt0037"
                     /note="HMMPfam hit to PF00364, Biotin-requiring enzyme,
                     score 0.00023"
                     /inference="protein motif:HMMPfam:PF00364"
     sig_peptide     complement(38699..38767)
                     /gene="smmK"
                     /locus_tag="Smlt0037"
                     /note="Signal peptide predicted for Smlt0037 by SignalP
                     2.0 HMM (Signal peptide probability 0.967) with cleavage
                     site probability 0.389 between residues 23 and 24"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(38764..40014)
                     /transl_table=11
                     /gene="smmJ"
                     /locus_tag="Smlt0038"
                     /product="putative cation efflux transporter component"
                     /note="similarity:fasta; with=UniProt:Q48809; Legionella
                     pneumophila.; HelC.; length=414; id 25.635%; ungapped id
                     27.520%; E()=2.1e-15; 394 aa overlap; query 23-403;
                     subject 21-400"
                     /note="similarity:fasta; with=UniProt:Q8PF26; Xanthomonas
                     axonopodis pv. citri.; czcC; Cation efflux system
                     protein.; length=423; id 34.541%; ungapped id 35.930%;
                     E()=1.1e-32; 414 aa overlap; query 6-408; subject 1-409"
                     /db_xref="EnsemblGenomes-Gn:Smlt0038"
                     /db_xref="EnsemblGenomes-Tr:CAQ43653"
                     /db_xref="GOA:B2FU02"
                     /db_xref="InterPro:IPR003423"
                     /db_xref="UniProtKB/TrEMBL:B2FU02"
                     /protein_id="CAQ43653.1"
                     /translation="MKLRSLWALAIAGAYGVAVPGHAAEVLRLEDVVARALGTHPSVQ
                     ADTARLEAVRSRAGREALPTPLVLGGELENVAGSGGLSGLDAAESTFRISKVLELGGK
                     RAARQALGGAEVDAARSEADVTRIAIATLAAGRFVDVLAAQEHVEHAEERIKMASAMR
                     REVARWVAAARNPDSDLRSAEIALLDAELKREQALQALESARMSLAATWGAPSPDFGS
                     VAGDTAVLPPLDDFDDLSRRLATTPQQRALDAQAGVIDARREIARASAKPDVSVGLGI
                     RRLEATKDSGLVMSVSVPLGSRRRSDFSVAEADYELTSLKYRRQAQMLEMRQELFGIY
                     QQLKQAQSEVESVRQRQLPKAQQAFDQSRRGFEEGRFSFLVLSQAQQRLFDLREREVE
                     AAARYLRLLVEADRLTASALDIRP"
     misc_feature    complement(38788..39321)
                     /gene="smmJ"
                     /locus_tag="Smlt0038"
                     /note="HMMPfam hit to PF02321, Outer membrane efflux
                     protein, score 0.0011"
                     /inference="protein motif:HMMPfam:PF02321"
     misc_feature    complement(39385..39930)
                     /gene="smmJ"
                     /locus_tag="Smlt0038"
                     /note="HMMPfam hit to PF02321, Outer membrane efflux
                     protein, score 0.00081"
                     /inference="protein motif:HMMPfam:PF02321"
     sig_peptide     complement(39946..40014)
                     /gene="smmJ"
                     /locus_tag="Smlt0038"
                     /note="Signal peptide predicted for Smlt0038 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.998 between residues 23 and 24"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(40105..40473)
                     /transl_table=11
                     /locus_tag="Smlt0039"
                     /product="putative transmembrane protein"
                     /note="similarity:fasta; with=UniProt:Q4J3U2
                     (EMBL:AAAU03000001); Azotobacter vinelandii AvOP.;
                     Hypothetical protein precursor.; length=121; id 30.088%;
                     ungapped id 34.694%; E()=0.025; 113 aa overlap; query
                     20-121; subject 11-119"
                     /db_xref="EnsemblGenomes-Gn:Smlt0039"
                     /db_xref="EnsemblGenomes-Tr:CAQ43654"
                     /db_xref="GOA:B2FU03"
                     /db_xref="UniProtKB/TrEMBL:B2FU03"
                     /protein_id="CAQ43654.1"
                     /translation="MSAFSARHRRLIRFSLFVLMLLSVVVRPIVIQQGELHTAEHDIA
                     ATAEHGHSHGPGTGDNVDPKHASGVHSVLHQADVSFAGMLVSSNLNLATVPPASLLPG
                     LHSVDEPSGHRGSPFRPPIV"
     sig_peptide     complement(40378..40473)
                     /locus_tag="Smlt0039"
                     /note="Signal peptide predicted for Smlt0039 by SignalP
                     2.0 HMM (Signal peptide probability 0.809) with cleavage
                     site probability 0.591 between residues 32 and 33"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    complement(40381..40440)
                     /locus_tag="Smlt0039"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0039 by TMHMM2.0 at aa 12-31"
                     /inference="protein motif:TMHMM:2.0"
     CDS             40895..41482
                     /transl_table=11
                     /locus_tag="Smlt0040"
                     /product="conserved hypothetical protein"
                     /note="Similar, but truncated at the C-terminus, to
                     Rhodobacter capsulatus (Rhodopseudomonas capsulata) RypA
                     hypothetical protein. UniProt:O07839 (EMBL:RCDCTP) (419
                     aa) fasta scores: E()=2.8e-28, 45.745% id in 188 aa"
                     /note="similarity:fasta; with=UniProt:O07839
                     (EMBL:RCDCTP); Rhodobacter capsulatus (Rhodopseudomonas
                     capsulata).; Hypothetical protein rypA.; length=419; id
                     45.745%; ungapped id 47.778%; E()=2.8e-28; 188 aa overlap;
                     query 2-183; subject 4-189"
                     /db_xref="EnsemblGenomes-Gn:Smlt0040"
                     /db_xref="EnsemblGenomes-Tr:CAQ43655"
                     /db_xref="GOA:B2FU04"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR003595"
                     /db_xref="InterPro:IPR022778"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:B2FU04"
                     /protein_id="CAQ43655.1"
                     /translation="MSRTSNSHPLQIATLPIGVNGGAIGVTFAPGKYQDVAMTGSWAR
                     DLDIDLASIVAWGAQHLITLIEPWEFEELRITSLAERAKAHGLMWHGLPIKDGAAPDA
                     RLLLPWQSTGPQFAAELLSGSRIVVHCKGGLGRAGTVASMLLIDTGCAPDGIDAIAKV
                     RSVRPGAVETAEQEEFILNWPARRASSLGVVAMPG"
     CDS             41597..42457
                     /pseudo
                     /transl_table=11
                     /locus_tag="Smlt0041"
                     /product="conserved hypothetical protein, pseudogene"
                     /note="Similar to Xanthomonas campestris pv. campestris
                     hypothetical protein xcc0015. UniProt:Q8PEG5
                     (EMBL:AE012094) (364 aa) fasta scores: E()=4.2e-86,
                     77.352% id in 287 aa"
                     /note="similarity:fasta; with=UniProt:Q8PEG5
                     (EMBL:AE012094); Xanthomonas campestris pv. campestris.;
                     Hypothetical protein XCC0015.; length=364; id 77.352%;
                     ungapped id 78.723%; E()=4.2e-86; 287 aa overlap; query
                     3-286; subject 80-364"
     CDS             42650..45037
                     /transl_table=11
                     /locus_tag="Smlt0042"
                     /product="putative RHS-repeat protein"
                     /note="Codons 35 to 740 are similar to codons 560 to 1240
                     of Methanosarcina barkeri (strain Fusaro/DSM 804)
                     hypothetical protein. UniProt:Q466C0 (EMBL:CP000099) (2096
                     aa) fasta scores: E()=1.7e-15, 23.699% id in 730 aa, and
                     codons 80 to 760 are similar to codons 1490 to 2165 of
                     bacillus subtilis. WapA UniProt:Q07833 (EMBL:D29985 (2334
                     aa) fasta scores: E()=0.0098, 22.269% id in 714 aa."
                     /note="similarity:fasta; with=UniProt:Q07833
                     (EMBL:D29985;); Bacillus subtilis.; wapA; Wall-associated
                     protein precursor.; length=2334; id 22.269%; ungapped id
                     25.000%; E()=0.0098; 714 aa overlap; query 80-759; subject
                     1495-2164"
                     /note="similarity:fasta; with=UniProt:Q466C0
                     (EMBL:CP000099;); Methanosarcina barkeri (strain
                     Fusaro/DSM 804).; Hypothetical protein.; length=2096; id
                     23.699%; ungapped id 27.074%; E()=3.2e-15; 730 aa overlap;
                     query 33-732; subject 568-1236"
                     /db_xref="EnsemblGenomes-Gn:Smlt0042"
                     /db_xref="EnsemblGenomes-Tr:CAQ43657"
                     /db_xref="InterPro:IPR010916"
                     /db_xref="InterPro:IPR031325"
                     /db_xref="UniProtKB/TrEMBL:B2FU05"
                     /protein_id="CAQ43657.1"
                     /translation="MTHVATRNTLQSRLLLLPLLSLPMTLATAANTLETVQVTATLPV
                     GGGGAGGFGFGGGSGVHLSESQMDNGGGGGAIPTETAKEQPTDDKEKDCNGRKGNPVV
                     LYSGNKVEPELDFASQGEMGLFLQRNYNHYWSATGLFGNHWLSNFDYSLAFTDANQLA
                     WVQRPDGRRIKYLKDPASGRWYEDKAQPIAYLAANGDGTFTLRNENNGTEIYNAEGYI
                     TRLSNEQGVSWTFSYTDRYLQKVTHSSGRSISFGWTNGQVSQVTDPAGNIYRYTYTPN
                     VFGNGRGRLASTTLPGAPATTISYHYEDGRFPGALTGKSFDGVRYSTFAYDAERRAIS
                     TEHNGGIERFRFSYAVRSTEPVLPPPAPARPGGVRADEERGWCEQRPGGSRICYQPRS
                     LPVDSLPMESALGMTAAAAPSLTRPVDIDVTVINPLGRSTTYTFKDGKIVSTKGDPSP
                     NCPASYKEQSYDANGYPDLVHDFQDNLTNFDYSAQGYLLKRVEAVGSTAERTTLQEWD
                     TARNRLLKTTVVGDLEVAYTYDDRGNVASVTERNLTARGVPSQTRVTRTTYSYHANGL
                     KASIKIDGPLPQDDVTSTFNNQGDLTSTTNALGHTISYSNFNGLGLPGRIVNANGGVR
                     ELTYDGRGRVVSDRTSSGTGWATTAIGYTSAGDIASLTQPDGVTVRYGYDAGRRLTHE
                     VRSLGDGTWAWTRHSYNNASNRTRTEVSQTDYPIDTAVKGMIDEITHDGQWNWFARGW
                     ACSTGSAGSIQVDGYAEGNVYLGSTQANLASEPGVAAACQASGNGYRYQLPISLA"
     sig_peptide     42650..42736
                     /locus_tag="Smlt0042"
                     /note="Signal peptide predicted for Smlt0042 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.899 between residues 29 and 30"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    43406..43534
                     /locus_tag="Smlt0042"
                     /note="HMMPfam hit to PF05593, RHS Repeat, score 3.1"
                     /inference="protein motif:HMMPfam:PF05593"
     misc_feature    44093..44221
                     /locus_tag="Smlt0042"
                     /note="HMMPfam hit to PF05593, RHS Repeat, score 5.9"
                     /inference="protein motif:HMMPfam:PF05593"
     misc_feature    44234..44452
                     /locus_tag="Smlt0042"
                     /note="HMMPfam hit to PF05593, RHS Repeat, score 7.8"
                     /inference="protein motif:HMMPfam:PF05593"
     misc_feature    44468..44593
                     /locus_tag="Smlt0042"
                     /note="HMMPfam hit to PF05593, RHS Repeat, score 1.3"
                     /inference="protein motif:HMMPfam:PF05593"
     misc_feature    44603..44719
                     /locus_tag="Smlt0042"
                     /note="HMMPfam hit to PF05593, RHS Repeat, score 0.58"
                     /inference="protein motif:HMMPfam:PF05593"
     CDS             45221..45865
                     /transl_table=11
                     /locus_tag="Smlt0043"
                     /product="putative wall-associated protein"
                     /note="Similar to codons 315 to 510 of Xanthomonas
                     axonopodis pv. citri. WapA UniProt:Q8PMX0 (EMBL:AE011761
                     (1199 aa) fasta scores: E()=2.8e-16, 36.364% id in 198 aa,
                     and to codons 315 to 510 of Xanthomonas campestris pv.
                     vesicatoria (strain 85-10). putative secreted protein
                     precursor. UniProt:Q3BVX8 (EMBL:AM039952 (990 aa) fasta
                     scores: E()=4.2e-16, 36.364% id in 198 aa"
                     /note="similarity:fasta; with=UniProt:Q8PMX0
                     (EMBL:AE011761;); Xanthomonas axonopodis pv. citri.; wapA;
                     Wall-associated protein.; length=1199; id 36.364%;
                     ungapped id 38.919%; E()=2.8e-16; 198 aa overlap; query
                     2-192; subject 316-507"
                     /note="similarity:fasta; with=UniProt:Q3BVX8
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Putative secreted protein precursor.;
                     length=990; id 36.364%; ungapped id 38.919%; E()=4.2e-16;
                     198 aa overlap; query 2-192; subject 317-508"
                     /db_xref="EnsemblGenomes-Gn:Smlt0043"
                     /db_xref="EnsemblGenomes-Tr:CAQ43658"
                     /db_xref="UniProtKB/TrEMBL:B2FU06"
                     /protein_id="CAQ43658.1"
                     /translation="MGVNAATTVHIYAGGPAGAGTYLGSVTGTLVPNDDVKAACQSQG
                     AYWFGFTLDSNMRNAHGGKPIYVHGISPSGQAHLLLNRSGTFTVPAVVRNAEVVGASA
                     YPYQIFNGGSSTLIFEFRNTSNVVWNPGDTYLAFGLNQPNENIALSAPVPPGGVARFS
                     RSVGPNNPGSGNRTFSYVARMASGGVAWGAEAKVFLSVENNKGSCGRVVCERPR"
     CDS             45995..48031
                     /transl_table=11
                     /locus_tag="Smlt0044"
                     /product="putative RHS-repeat protein"
                     /note="Codons 140 to 650 are similar to N-terminus to
                     codon 520 of Acinetobacter sp. (strain adp1). putative
                     RHS-related protein. UniProt:Q6FD94 (EMBL:CR543861 (552
                     aa) fasta scores: E()=5.4e-44, 30.451% id in 532 aa, and
                     N-terminus to codon 585 are similar to codon 705 to 1300
                     of Xanthomonas campestris pv. vesicatoria (strain 85-10).
                     RHS family protein. UniProt:Q3BMW5 (EMBL:AM039952 (1437
                     aa) fasta scores: E()=2.2e-35, 31.922% id in 614 aa"
                     /note="similarity:fasta; with=UniProt:Q6FD94
                     (EMBL:CR543861;); Acinetobacter sp. (strain ADP1).;
                     Putative RHS-related protein.; length=552; id 30.451%;
                     ungapped id 32.465%; E()=5.4e-44; 532 aa overlap; query
                     140-654; subject 1-516"
                     /note="similarity:fasta; with=UniProt:Q3BMW5
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Rhs family protein.; length=1437; id
                     31.922%; ungapped id 34.938%; E()=2.2e-35; 614 aa overlap;
                     query 3-581; subject 704-1299"
                     /db_xref="EnsemblGenomes-Gn:Smlt0044"
                     /db_xref="EnsemblGenomes-Tr:CAQ43659"
                     /db_xref="GOA:B2FU07"
                     /db_xref="InterPro:IPR006530"
                     /db_xref="InterPro:IPR022385"
                     /db_xref="InterPro:IPR031325"
                     /db_xref="UniProtKB/TrEMBL:B2FU07"
                     /protein_id="CAQ43659.1"
                     /translation="MRYAYDAEGRVTQVTDSQNRVTRMSYDARGRLIQSIDAAGGKTQ
                     IAYDHADRPIRVSDPRNLVTTYEFDGFGQMWKQVSPDTGTTQHQYDAAGLRTSTTRAD
                     GSVVSFDYDGLGRMTSASAEDRTLGYSYDWCGNGKGLLCGTSGPGTATHFAYTANGSL
                     QIRRDFTDLSGQKTDYSTTYGYDGINRLSEITYPNGDKATYSYGSHGKPSALVATVDG
                     TQRSIISQASWKATGARGWLAYGNGLGRGYNHDPEGRLTAMSVWGPNSSKVSYWDYQY
                     SGDGEITAIVDAVDPSMTQLIGYDSLSRLTQLTRFGVTNNLSYDAGGNHDRYQAGSQL
                     TQYSIDPGSNRVLNYTNQDGSRQYQYDALGNRISETAGSRISTYEYDAFNRMSRSNIG
                     GVATDYVLNAQGQRVAKINQSTNSRYFYAGQNQLMTELNNGVWTNYFWFDGELVGLAR
                     SGQHNYVHTDHLGRPEFVTSPSQQTVWKAYNYAYGRSVQKDEIGGLNIGFPGQYYDAE
                     SGLWYNGFRDYDASIGRYVQSDPIGLAGGMNTYAYVSGNPISRTDPWGLTQCDIDVAF
                     SFAKQNNPDLKFGNGAPQVDIPRPGDEGRSDLYGDGRIHLNKRYLDVLDWAGVYNVLD
                     TIIHEGFHFTRPRKLQTEENGWDHRYISPEATKRAREQVYNYDKARKATCECTQ"
     misc_feature    46007..46120
                     /locus_tag="Smlt0044"
                     /note="HMMPfam hit to PF05593, RHS Repeat, score 2.2e-09"
                     /inference="protein motif:HMMPfam:PF05593"
     misc_feature    46133..46240
                     /locus_tag="Smlt0044"
                     /note="HMMPfam hit to PF05593, RHS Repeat, score 0.0075"
                     /inference="protein motif:HMMPfam:PF05593"
     misc_feature    46259..46369
                     /locus_tag="Smlt0044"
                     /note="HMMPfam hit to PF05593, RHS Repeat, score 2.1e-05"
                     /inference="protein motif:HMMPfam:PF05593"
     misc_feature    46538..46654
                     /locus_tag="Smlt0044"
                     /note="HMMPfam hit to PF05593, RHS Repeat, score 0.0029"
                     /inference="protein motif:HMMPfam:PF05593"
     misc_feature    46742..46870
                     /locus_tag="Smlt0044"
                     /note="HMMPfam hit to PF05593, RHS Repeat, score 2.8"
                     /inference="protein motif:HMMPfam:PF05593"
     misc_feature    47072..47176
                     /locus_tag="Smlt0044"
                     /note="HMMPfam hit to PF05593, RHS Repeat, score 0.0015"
                     /inference="protein motif:HMMPfam:PF05593"
     CDS             48028..48621
                     /transl_table=11
                     /locus_tag="Smlt0045"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0045"
                     /db_xref="EnsemblGenomes-Tr:CAQ43660"
                     /db_xref="UniProtKB/TrEMBL:B2FU08"
                     /protein_id="CAQ43660.1"
                     /translation="MKFFVYAAYSLLSLAFCTQLIHARELHECIVVSQASNVTDMPDG
                     LDEFEQRLWTANSGQIVRKGADTLLLLRVFSEAPGVMDSQQYTKITGILKGYAPSADK
                     APDVGSARLTSGGAGFAHKGDYWLSDAAAVELRQPHSHSSRMEVKVTAVGWNSYRKEH
                     RPFDLRFTCQLREIPVDRLSAWQGGNGDLWLSFGPTK"
     sig_peptide     48028..48096
                     /locus_tag="Smlt0045"
                     /note="Signal peptide predicted for Smlt0045 by SignalP
                     2.0 HMM (Signal peptide probability 0.977) with cleavage
                     site probability 0.975 between residues 23 and 24"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(48633..49343)
                     /transl_table=11
                     /locus_tag="Smlt0046"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PRE5
                     (EMBL:AE011624); Xanthomonas axonopodis pv. citri.;
                     Hypothetical protein XAC0018.; length=305; id 72.368%;
                     ungapped id 72.368%; E()=2e-72; 228 aa overlap; query
                     8-235; subject 77-304"
                     /db_xref="EnsemblGenomes-Gn:Smlt0046"
                     /db_xref="EnsemblGenomes-Tr:CAQ43661"
                     /db_xref="GOA:B2FU09"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="UniProtKB/TrEMBL:B2FU09"
                     /protein_id="CAQ43661.1"
                     /translation="MHEQGPVDFIEVIHNAVPSEVCAAIVERMRAAQGLRPGAVGSGV
                     FPELKHSKDLRISGLDGWQDVDHQLQHAVFNGLLTYLRRYPQALIAPLMLQIQDSNGQ
                     PRRLSAEDFPDMPPQQLADLARTCLRPGAINLQWYAAGEGGYPYWHCELYPKDAQAET
                     LHRHVLWTLYLNDEFEEGETEFLFQGRKIAPRTGSLLIAPTAFTHTHRGNRPQGGDKF
                     IATSWILFQSAQKLFGGG"
     CDS             complement(49452..50468)
                     /transl_table=11
                     /locus_tag="Smlt0047"
                     /product="putative fructose-1,6-bisphosphatase
                     (d-fructose-1,6-bisphosphate 1-phosphohydrolase)"
                     /EC_number="3.1.3.11"
                     /note="similarity:fasta; with=UniProt:P09195 (EMBL:TAFBP);
                     Triticum aestivum (Wheat).; FBP;
                     Fructose-1,6-bisphosphatase, chloroplast precursor (EC
                     3.1.3.11) (D- fructose-1,6-bisphosphate
                     1-phosphohydrolase) (FBPase).; length=409; id 42.433%;
                     ungapped id 44.828%; E()=2.8e-48; 337 aa overlap; query
                     5-329; subject 75-405"
                     /note="similarity:fasta; with=UniProt:Q8PE85
                     (EMBL:AE012103); Xanthomonas campestris pv. campestris.;
                     cbbFC; Fructose-1,6-bisphosphatase.; length=338; id
                     83.432%; ungapped id 83.432%; E()=6.7e-114; 338 aa
                     overlap; query 1-338; subject 1-338"
                     /db_xref="EnsemblGenomes-Gn:Smlt0047"
                     /db_xref="EnsemblGenomes-Tr:CAQ43662"
                     /db_xref="GOA:B2FU10"
                     /db_xref="InterPro:IPR000146"
                     /db_xref="InterPro:IPR028343"
                     /db_xref="InterPro:IPR033391"
                     /db_xref="UniProtKB/Swiss-Prot:B2FU10"
                     /protein_id="CAQ43662.1"
                     /translation="MSRTSLTRFLIQEQHAGRINADLRQLIAVVARACTSISIAVSKG
                     ALGGVLGDAGTGNVQGEAQKKLDVISNEILLEANAWGGHLAACASEEMDHSQPVPDIY
                     PRGDFLLLFDPLDGSSNIDVNVSVGTIFSVLRCPTNVELPGDDAFLQPGSKQIAAGYC
                     IYGPSTQLVLTVGHGTHAFTLDREKGEFVLTTENMQIPAATQEFAINMSNQRHWEAPM
                     QAYVGDLLAGKEGTRGKNFNMRWIASMVADVHRILTRGGIFIYPWDKKDPSKAGKLRL
                     MYEANPMGLLVEQAGGAAWTGRERILDIQPDQLHQRVPVFLGSREEVAEAVRYHHAHD
                     NAQG"
     misc_feature    complement(49470..50459)
                     /locus_tag="Smlt0047"
                     /note="HMMPfam hit to PF00316,
                     Fructose-1-6-bisphosphatase, score 2.8e-164"
                     /inference="protein motif:HMMPfam:PF00316"
     CDS             complement(50702..51904)
                     /transl_table=11
                     /gene="aspC"
                     /locus_tag="Smlt0048"
                     /product="putative aspartate aminotransferase"
                     /EC_number="2.6.1.1"
                     /note="similarity:fasta; with=UniProt:P72173
                     (EMBL:AE004738); Pseudomonas aeruginosa.; aspC; Aspartate
                     aminotransferase (EC 2.6.1.1) (Transaminase A) (AspAT).;
                     length=398; id 61.558%; ungapped id 61.869%; E()=7.4e-92;
                     398 aa overlap; query 1-397; subject 1-397"
                     /note="similarity:fasta; with=UniProt:Q5H700
                     (EMBL:AE013598); Xanthomonas oryzae pv. oryzae.; tyrB;
                     Aromatic-amino-acid aminotransferase.; length=416; id
                     79.950%; ungapped id 79.950%; E()=9.4e-121; 399 aa
                     overlap; query 1-399; subject 17-415"
                     /db_xref="EnsemblGenomes-Gn:Smlt0048"
                     /db_xref="EnsemblGenomes-Tr:CAQ43663"
                     /db_xref="GOA:B2FU11"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:B2FU11"
                     /protein_id="CAQ43663.1"
                     /translation="MSFFANVELVPGDPILGLTEAYNADSRPTKVNLGVGIYYDESGR
                     IPLLRAVKQIEQQLAAEAKPRGYLPIDGLPAYTQATRELVFGKDSPLLAAGRVTTAQT
                     VGGSGALRVGADVLKKLLPHATVALSNPSWENHRAVFSAAGFDVLDYTYFDPSTHGVD
                     FDGMLADLGKLDAGTVVLLHACCHNPTGADLTVTQWKQVAQLLKDKQLFPFIDMAYQG
                     FDKGIEQDGAAVRIIAEAGIDSFIVANSYSKSFSLYGERVGALSMVAPTAADAKAVQS
                     QVKRVIRTIYSSPSTHGAALVAGVLTNPELRAMWEQELTEMRERIHALRQGLVEKLAA
                     AGAPQFGFINEQAGMFSYSGLSREQVERLRDEFGIYAVGTGRICVAALNQNNLEYVAK
                     AVATVAKG"
     misc_feature    complement(50723..51823)
                     /gene="aspC"
                     /locus_tag="Smlt0048"
                     /note="HMMPfam hit to PF00155, Aminotransferase class I
                     and II, score 1.2e-108"
                     /inference="protein motif:HMMPfam:PF00155"
     CDS             52076..54169
                     /transl_table=11
                     /locus_tag="Smlt0049"
                     /product="putative iron transporter protein"
                     /note="similarity:fasta; with=UniProt:Q3YE91
                     (EMBL:DQ141608;); Vibrio parahaemolyticus.; PvuA.;
                     length=712; id 22.394%; ungapped id 24.651%; E()=8.5e-12;
                     710 aa overlap; query 21-696; subject 34-712"
                     /note="similarity:fasta; with=UniProt:Q4V0I1
                     (EMBL:CP000050;); Xanthomonas campestris pv. campestris
                     (strain 8004).; Iron transporter.; length=727; id 66.277%;
                     ungapped id 67.359%; E()=1.6e-180; 685 aa overlap; query
                     21-696; subject 43-725"
                     /db_xref="EnsemblGenomes-Gn:Smlt0049"
                     /db_xref="EnsemblGenomes-Tr:CAQ43664"
                     /db_xref="GOA:B2FU12"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="UniProtKB/TrEMBL:B2FU12"
                     /protein_id="CAQ43664.1"
                     /translation="MNPAARRRCLPLSALLLSPWAAVAEPAPTALPAVQVQAARVPGI
                     DPFALPASQDTVWIDASRAGTGAQLSEALAGVPGLLARDRQNFAQDTQLSIRGFGARS
                     TFGVRGVRVLIDGVPATMPDGQGQLSHASLLGAERIEVLRGPFSALYGNSSGGVLQVW
                     SAQGQAGDPWRLRVNAGADNTLSVGAQLKGAGQVLDYNIAANHFRTDGWRDHSRARRE
                     SLNARIGGELGGGRLELLLNALDAPDAQDPLGLTRAQVAADPRQATAVAHQYNTRKTV
                     RQQQAGLRWTRETGAQRWQLMGYAGQRAVRQYLPIPPAPQTNSPLHAGGVIDLQGGYG
                     GLDARWGWHGDLAGRPLDLVAGLSADRQRQHRTGFENFIGSALGVRGRLRRDQIDVVQ
                     NVDQFTQAWWQWSPRWSLLAGLRHSAVRFESNDRYIVGANPDDSGHRRYQATTPVAGV
                     SFEASPQWRLHAAVGRGFETPTFNELGYRADGQAGLALDLAAARSRSIEVGSKWHAQD
                     GNQLDISLFRADTDDELAVASNIGGRSTYRNIGRTRRQGLELQYRQPLAEHLELQLAW
                     TWLQAQVRSPYLTSNTLVAAGSRLPGVPRQQAFARLQWSPADWQWALEATASSDTVVN
                     DVATERAPGYALLHLEAGRRWTLPGGELRAFARLENVLDQAYIGSVIVNDGNGRFYEP
                     GPGRRANVGLQWSWR"
     sig_peptide     52076..52147
                     /locus_tag="Smlt0049"
                     /note="Signal peptide predicted for Smlt0049 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.990 between residues 24 and 25"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    52208..52543
                     /locus_tag="Smlt0049"
                     /note="HMMPfam hit to PF07715, TonB-dependent Receptor
                     Plug Domain, score 5.3e-17"
                     /inference="protein motif:HMMPfam:PF07715"
     repeat_region   52715..52722
                     /rpt_unit_seq="(cg)4"
     misc_feature    53408..54163
                     /locus_tag="Smlt0049"
                     /note="HMMPfam hit to PF00593, TonB dependent receptor,
                     score 2.3e-29"
                     /inference="protein motif:HMMPfam:PF00593"
     repeat_region   53962..53969
                     /rpt_unit_seq="(gc)4"
     CDS             complement(54249..54665)
                     /transl_table=11
                     /locus_tag="Smlt0050"
                     /product="conserved hypothetical protein"
                     /note="Codons 105 to the C-terminus are similar to codons
                     23 to the C-terminus of xanthomonas campestris pv.
                     campestris (strain 8004). hypothetical protein.
                     UniProt:Q4UQ58 (EMBL:CP000050 (55 aa) fasta scores:
                     E()=0.00022, 70.588% id in 34 aa"
                     /note="similarity:fasta; with=UniProt:Q4UQ58
                     (EMBL:CP000050;); Xanthomonas campestris pv. campestris
                     (strain 8004).; Hypothetical protein.; length=55; id
                     70.588%; ungapped id 70.588%; E()=0.00022; 34 aa overlap;
                     query 105-138; subject 22-55"
                     /db_xref="EnsemblGenomes-Gn:Smlt0050"
                     /db_xref="EnsemblGenomes-Tr:CAQ43665"
                     /db_xref="UniProtKB/TrEMBL:B2FU13"
                     /protein_id="CAQ43665.1"
                     /translation="MFMTPGSQRLYLRGGVVESPKGRYQTMSRETSRDPLRENHPPIP
                     GEQRGKRDADNADYRGTGAPFFDAEHDHLPVKHEAEQAAQDRKDGGDRHRGGQESPLK
                     RRERKQRASDNQDEALEETFPASDPTSPFVPAKAPD"
     CDS             54734..55132
                     /transl_table=11
                     /locus_tag="Smlt0051"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PR35; Xanthomonas
                     axonopodis pv. citri.; Hypothetical protein XAC0131.;
                     length=152; id 50.794%; ungapped id 51.200%; E()=9.5e-22;
                     126 aa overlap; query 2-127; subject 23-147"
                     /db_xref="EnsemblGenomes-Gn:Smlt0051"
                     /db_xref="EnsemblGenomes-Tr:CAQ43666"
                     /db_xref="UniProtKB/TrEMBL:B2FU14"
                     /protein_id="CAQ43666.1"
                     /translation="MPRLERPAPSVFNALLDPLGQRSAQRRTRRHEDPQAVAQDYLQY
                     MLSDYEERRGQSHRNWRDLCPVYAFALTTHAADWPRGDAADTCEELAEHWEQMRGQSR
                     LGWSQARPVVEDAWRALDHIPAAAVRPLLQ"
     repeat_region   55081..55088
                     /rpt_unit_seq="(gc)4"
     repeat_region   55101..55112
                     /rpt_unit_seq="(cgg)4"
     CDS             55297..56217
                     /transl_table=11
                     /locus_tag="Smlt0052"
                     /product="putative Ku domain protein"
                     /note="similarity:fasta; with=UniProt:Q8PE77
                     (EMBL:AE012104); Xanthomonas campestris pv. campestris.;
                     Hypothetical protein XCC0104.; length=313; id 76.677%;
                     ungapped id 78.431%; E()=2.4e-86; 313 aa overlap; query
                     1-306; subject 1-313"
                     /db_xref="EnsemblGenomes-Gn:Smlt0052"
                     /db_xref="EnsemblGenomes-Tr:CAQ43667"
                     /db_xref="GOA:B2FU15"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR009187"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="UniProtKB/TrEMBL:B2FU15"
                     /protein_id="CAQ43667.1"
                     /translation="MARPIWTGTLSFGLLNVPVSLMSGERKVDLQFRMLDSRDRKPIR
                     FERVNADTGEEVPWKDIVKAYEYDKGSYVVLEEGDIRSAAPESHEAVEVESFVDAAQI
                     DPRYYEKPYLLVPGKKAEKGYVLLRETLRSTGKVGIARVVVRTREYLCAVMPHEDALV
                     LMILRYPQELVDPEDYKLPTGKLSDYRITSKETAMAEQLIESMAGDWDPSQYHDEFRE
                     RLQQVLNKRIKSKGGTTRVDDEPAPREDASTNVVDFMALLQKSLDANKRTPAKKAATR
                     KATAKSPVKKAAKKTTKKAAKKTAPRRKAG"
     misc_feature    55324..55902
                     /locus_tag="Smlt0052"
                     /note="HMMPfam hit to PF02735, Ku70/Ku80 beta-barrel
                     domain, score 1.9e-42"
                     /inference="protein motif:HMMPfam:PF02735"
     CDS             56221..58707
                     /transl_table=11
                     /locus_tag="Smlt0053"
                     /product="putative ATP-dependent DNA ligase"
                     /note="Similar to C-terminus of ralstonia eutropha (strain
                     jmp134) (alcaligenes eutrophus). ATP dependent DNA ligase,
                     C-terminal:ATP dependent DNA ligase, central.
                     UniProt:Q46SV9 (EMBL:CP000091 (930 aa) fasta scores:
                     E()=1.8e-108, 40.502% id in 837 aa, and to entire protein
                     of rhizobium meliloti (sinorhizobium meliloti).
                     hypothetical protein smb20685. UniProt:Q92TV3
                     (EMBL:AL591985 (818 aa) fasta scores: E()=6.8e-102,
                     39.074% id in 842 aa"
                     /note="similarity:fasta; with=UniProt:Q46SV9
                     (EMBL:CP000091;); Ralstonia eutropha (strain JMP134)
                     (Alcaligenes eutrophus).; ATP dependent DNA ligase,
                     C-terminal:ATP dependent DNA ligase, central.; length=930;
                     id 40.502%; ungapped id 42.481%; E()=1.8e-108; 837 aa
                     overlap; query 2-823; subject 110-922"
                     /note="similarity:fasta; with=UniProt:Q92TV3
                     (EMBL:AL591985;); Rhizobium meliloti (Sinorhizobium
                     meliloti).; Hypothetical protein SMb20685.; length=818; id
                     39.074%; ungapped id 41.384%; E()=6.8e-102; 842 aa
                     overlap; query 3-826; subject 6-818"
                     /db_xref="EnsemblGenomes-Gn:Smlt0053"
                     /db_xref="EnsemblGenomes-Tr:CAQ43668"
                     /db_xref="GOA:B2FU16"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014143"
                     /db_xref="InterPro:IPR014144"
                     /db_xref="InterPro:IPR014145"
                     /db_xref="InterPro:IPR014146"
                     /db_xref="InterPro:IPR033651"
                     /db_xref="UniProtKB/TrEMBL:B2FU16"
                     /protein_id="CAQ43668.1"
                     /translation="MSLHQYRRKRRLGGGAGQTTEPDDTPAPGDPKQRPTFVIQLHHA
                     SSRHYDFRLEMDGVLKSWAVPKGPSLRVGEKRLAVEVEDHPLSYAGFEGDIPEGHYGA
                     GHVEVFDHGTWACEGDPLQALAAGKIDFVLHGQRLAGGWKLVRTAMKGRQVQWLLIKR
                     GDGEARDAEADDLLTAPMPKRTPAAKKRSADKTARAAPVARTTTRKADVRWHARALQL
                     HGARDAPYPHAFKPQLTDHRDSAPDGDRWLHEIKWDGYRLLADLHDGEVKLRSRNGLD
                     WTDDFPEVVQAVQALPVRDARLDGELVVLDKEGRSDFAALQRVIDGSSKQPLRYIVFD
                     LPGVAGADISRAPLLERKALLKELIGPAPGTLAFSEHVIDHGPQVFDASGKAGFEGTV
                     SKQVDAPYVNTRARSWVKVKHEDTDEFLIVGYTAPKGSRVGFGSLLLATPDKGGLRYV
                     GRVGTGFDDQSLRALLKALQPLAVKTPVLQLPAHVPFRAASVRWVKPVAVAEVAFRGW
                     GKEGLLRQASFKRLRSDKQKEDLGMSTADTETGGEVEITHPERVVFPRQKLRKGDVAD
                     YYQRMARWILPEIAGRPLSLLRCPDGVGKACFFQKHHGPGLGDAVHAVPLQQKSGRED
                     YVYVDDARGLLQLVQMNTLELHPWGATVADPEHPDRLVFDLDPGEGVSWAQVKAAARD
                     VRDRLQEVGLQSFVRLSGGKGVHVVVPLQPKAGWDEAKAFCEAFAQAMALEQPDRYVA
                     TMSKAKRGGVIFIDWLRNTRGATSVCSWSLRARDAAGVAVPLRWEELARVSAADAFPM
                     AKALARAKRLKGDPWQGIARLKQRLPSLKR"
     misc_feature    56914..57456
                     /locus_tag="Smlt0053"
                     /note="HMMPfam hit to PF01068, ATP dependent DNA ligase
                     domain, score 5.8e-31"
                     /inference="protein motif:HMMPfam:PF01068"
     repeat_region   57430..57437
                     /rpt_unit_seq="(cg)4"
     misc_feature    57508..57735
                     /locus_tag="Smlt0053"
                     /note="HMMPfam hit to PF04679, ATP dependent DNA ligase C
                     terminal re, score 8.6e-11"
                     /inference="protein motif:HMMPfam:PF04679"
     repeat_region   57606..57613
                     /rpt_unit_seq="(gc)4"
     repeat_region   58530..58539
                     /rpt_unit_seq="(gc)5"
     repeat_region   58627..58634
                     /rpt_unit_seq="(gc)4"
     repeat_region   complement(58701..58731)
                     /rpt_family="R=14"
                     /inference="nucleotide motif:RepeatScout"
     CDS             complement(58779..59117)
                     /transl_table=11
                     /locus_tag="Smlt0054"
                     /product="putative transmembrane protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0054"
                     /db_xref="EnsemblGenomes-Tr:CAQ43669"
                     /db_xref="GOA:B2FU17"
                     /db_xref="UniProtKB/TrEMBL:B2FU17"
                     /protein_id="CAQ43669.1"
                     /translation="MLSLALVSSVAGWLPPLLGLSPDSNSVQLGWDLAFSVLGGVAGI
                     SFATYYAPCWPRSHGFSIWSLIALGCGYAMWTAGADFPFWFVISLLASLPLQLLVGWW
                     FGRRPSRDLR"
     misc_feature    complement(order(58809..58877,58887..58946,58965..59033))
                     /locus_tag="Smlt0054"
                     /note="3 probable transmembrane helices predicted for
                     Smlt0054 by TMHMM2.0 at aa 29-51, 58-77 and 81-103"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(join(59378..60244,70874..71014))
                     /pseudo
                     /transl_table=11
                     /locus_tag="Smlt0055"
                     /product="putative alcohol dehydrogenase, pseudogene"
                     /note="Similar to N-terminus of Rhizobium meliloti
                     (Sinorhizobium meliloti) AdhA alcohol dehydrogenase (ec
                     1.1.1.1). UniProt:O31186 (340 aa) fasta scores:
                     E()=1.7e-07, 73.171% id in 41 aa, and to Bradyrhizobium
                     japonicum alcohol dehydrogenase. UniProt:Q89IH9 (341 aa)
                     fasta scores: E()=8.2e-09, 73.171% id in 41 aa"
                     /note="similarity:fasta; with=UniProt:O31186; Rhizobium
                     meliloti (Sinorhizobium meliloti).; adhA; Alcohol
                     dehydrogenase (EC 1.1.1.1).; length=340; id 73.171%;
                     ungapped id 73.171%; E()=1.7e-07; 41 aa overlap; query
                     4-44; subject 2-42"
                     /note="similarity:fasta; with=UniProt:Q89IH9;
                     Bradyrhizobium japonicum.; Alcohol dehydrogenase.;
                     length=341; id 73.171%; ungapped id 73.171%; E()=8.2e-09;
                     41 aa overlap; query 4-44; subject 3-43"
                     /db_xref="PSEUDO:CAQ43670.1"
     misc_feature    complement(59492..59905)
                     /locus_tag="Smlt0072"
                     /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
                     score 2e-39"
                     /inference="protein motif:HMMPfam:PF00107"
     misc_feature    complement(order(59993..60244,70874..70930))
                     /locus_tag="Smlt0072"
                     /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
                     GroES-like domain, score 2e-35"
                     /inference="protein motif:HMMPfam:PF08240"
     CDS             60466..61656
                     /transl_table=11
                     /locus_tag="Smlt0056"
                     /product="putative integrase"
                     /note="similarity:fasta; with=UniProt:Q93UI5; Escherichia
                     coli.; Integrase-like gene 1.; length=401; id 38.579%;
                     ungapped id 40.000%; E()=7.8e-46; 394 aa overlap; query
                     1-389; subject 1-385"
                     /note="similarity:fasta; with=UniProt:Q8XY92; Ralstonia
                     solanacearum (Pseudomonas solanacearum).; PUTATIVE
                     INTEGRASE PROPHAGE PROTEIN.; length=405; id 51.269%;
                     ungapped id 51.662%; E()=7.5e-74; 394 aa overlap; query
                     1-393; subject 1-392"
                     /db_xref="EnsemblGenomes-Gn:Smlt0056"
                     /db_xref="EnsemblGenomes-Tr:CAQ43671"
                     /db_xref="GOA:B2FU19"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013762"
                     /db_xref="InterPro:IPR023109"
                     /db_xref="InterPro:IPR025166"
                     /db_xref="UniProtKB/TrEMBL:B2FU19"
                     /protein_id="CAQ43671.1"
                     /translation="MPLTDTAIRKTKPSASVQKLRDGGGLYLLLRPDGAKWWRWDYRR
                     PVTGKRNTLSLGTYPDVSLAVARERHVAARKLLAGGIDPGEHRKAQKKAVVESSASTF
                     EAVAAEYFSMRAGKLSAESISHERRIVERDLNPYLGRSPVGAIPARELLDALRRIESR
                     GAVKTAHRARGIAGRVFRYAIATGRADRNPADDLRGALASSEVQHFPSITDPSLITGL
                     LRATHGYQGSPVVQAALRLAPLVFVRPGELRHALWDDIDLDAGQWRFTATKTGQPHIV
                     PLAVQAVAILRELHPLTCRAKYVFPCMIGKGRPMSENAVNGALRRLGYESGSMTGHGF
                     RAMARTVLDEVLGFRPDYIEHQLAHAVRDPNGRAYNRTAHLVERAKMMQAWADYLDGL
                     RTSP"
     misc_feature    61117..61602
                     /locus_tag="Smlt0056"
                     /note="HMMPfam hit to PF00589, Phage integrase family,
                     score 3e-07"
                     /inference="protein motif:HMMPfam:PF00589"
     repeat_region   61657..61664
                     /rpt_unit_seq="(c)8"
     CDS             62251..62523
                     /transl_table=11
                     /locus_tag="Smlt0057"
                     /product="putative phage DNA-binding protein"
                     /note="similarity:fasta; with=UniProt:P12552;
                     Bacteriophage P4.; Hypothetical protein ORF88 (Putative
                     DNA-binding protein).; length=88; id 38.272%; ungapped id
                     40.789%; E()=3e-06; 81 aa overlap; query 1-81; subject
                     4-79"
                     /note="similarity:fasta; with=UniProt:Q7P0B9;
                     Chromobacterium violaceum.; Probable prophage regulatory
                     protein.; length=72; id 50.000%; ungapped id 50.000%;
                     E()=4.9e-07; 58 aa overlap; query 28-85; subject 14-71"
                     /db_xref="EnsemblGenomes-Gn:Smlt0057"
                     /db_xref="EnsemblGenomes-Tr:CAQ43672"
                     /db_xref="GOA:B2FU20"
                     /db_xref="InterPro:IPR010260"
                     /db_xref="UniProtKB/TrEMBL:B2FU20"
                     /protein_id="CAQ43672.1"
                     /translation="MLGSPTPPATAPGQPADHSRHDAGRGERFLRKPEVLSRTGISRS
                     HLYGLMKRGRFPASIPLSPRVTVWLESDVDAWIATHIPDTHLRVQP"
     misc_feature    62329..62481
                     /locus_tag="Smlt0057"
                     /note="HMMPfam hit to PF05930, Prophage CP4-57 regulatory
                     protein (AlpA), score 5.7e-25"
                     /inference="protein motif:HMMPfam:PF05930"
     CDS             62520..62723
                     /transl_table=11
                     /locus_tag="Smlt0058"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0058"
                     /db_xref="EnsemblGenomes-Tr:CAQ43673"
                     /db_xref="UniProtKB/TrEMBL:B2FU21"
                     /protein_id="CAQ43673.1"
                     /translation="MKDTIVLTISNQKFNLSPEEAKFLAEHLRTAVAQPNLALNFSQS
                     RTAQGGRIALSRGVAGSRSVTDC"
     CDS             62733..63020
                     /transl_table=11
                     /locus_tag="Smlt0059"
                     /product="putative bacteriophage transcriptional regulator
                     protein"
                     /note="similarity:fasta; with=UniProt:Q8Y0S9; Ralstonia
                     solanacearum (Pseudomonas solanacearum).; PUTATIVE
                     BACTERIOPHAGE TRANSCRIPTIONAL ACTIVATOR-RELATED
                     TRANSCRIPTION REGULATOR PROTEIN.; length=73; id 40.000%;
                     ungapped id 40.000%; E()=1.1e-06; 70 aa overlap; query
                     8-77; subject 1-70"
                     /db_xref="EnsemblGenomes-Gn:Smlt0059"
                     /db_xref="EnsemblGenomes-Tr:CAQ43674"
                     /db_xref="InterPro:IPR007684"
                     /db_xref="UniProtKB/TrEMBL:B2FU22"
                     /protein_id="CAQ43674.1"
                     /translation="MTSSRAFLRCPHCDTAAIVRTSVLHSKLLRESLLQCRNALCGHT
                     FSAYTEIVRTHTQSACPRNDICLPISSPAERAALSAQAKQEPVTTPGKARR"
     misc_feature    62757..62897
                     /locus_tag="Smlt0059"
                     /note="HMMPfam hit to PF04606, Ogr/Delta-like zinc finger,
                     score 8e-14"
                     /inference="protein motif:HMMPfam:PF04606"
     CDS             63050..63526
                     /transl_table=11
                     /locus_tag="Smlt0060"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0060"
                     /db_xref="EnsemblGenomes-Tr:CAQ43675"
                     /db_xref="UniProtKB/TrEMBL:B2FU23"
                     /protein_id="CAQ43675.1"
                     /translation="MQHCPVAAQSATGFSSPNPKAHQRPSTDARRFFVARCVVAGDCL
                     PVLRRAVRGGRKACRLLGSGLLTAYRPSPRLAARWRIPTYPRNPAMSHDTLAAPSRFA
                     TRIAHHLGEIADTLDWDHSRWLALTARLEATGKAPEALTLGEVQHAIAATVQEAAR"
     CDS             63523..63738
                     /transl_table=11
                     /locus_tag="Smlt0061"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q883U7; Pseudomonas
                     syringae pv. tomato.; Hypothetical protein.; length=253;
                     id 35.938%; ungapped id 40.351%; E()=5.5; 64 aa overlap;
                     query 8-71; subject 26-82"
                     /db_xref="EnsemblGenomes-Gn:Smlt0061"
                     /db_xref="EnsemblGenomes-Tr:CAQ43676"
                     /db_xref="UniProtKB/TrEMBL:B2FU24"
                     /protein_id="CAQ43676.1"
                     /translation="MNVSALNFAVANDDAATHDLFSAVRQLQRIHTMPMAALTQLVAA
                     LERRPGALEALSVGQLLVMVRDAEVAA"
     CDS             63735..64385
                     /transl_table=11
                     /locus_tag="Smlt0062"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0062"
                     /db_xref="EnsemblGenomes-Tr:CAQ43677"
                     /db_xref="UniProtKB/TrEMBL:B2FU25"
                     /protein_id="CAQ43677.1"
                     /translation="MNTETVRVSGVPGVADGVLSATITDTWFDAERTAHIVEVARRIE
                     RLHSKASRRLAIVSGELDEALEGHPLEDRLRERLLWPLERDCLELATVAARVRVRLSL
                     FAPAQSQEQFDRGMALQLADLQAEQAAVEPPQERAPSAAPMPYGYWISEDSFNRVERA
                     RSASLLLSSVGEGIGESVALSFDAVAASAAYVHEDLAAVVASARHSSQMEADDDAA"
     repeat_region   64139..64146
                     /rpt_unit_seq="(gc)4"
     CDS             64372..65223
                     /transl_table=11
                     /locus_tag="Smlt0063"
                     /product="putative primase domain protein"
                     /note="Similar to codons 340 to 623 of Escherichia coli
                     TraC DNA primase (ec 2.7.7.-) (replication primase).
                     UniProt:P27189 (EMBL:ECRP4TRA) (1061 aa) fasta scores:
                     E()=9.7e-30, 40.283% id in 283 aa, and to Pelobacter
                     propionicus DSM 2379 toprim. UniProt:Q3G182
                     (EMBL:AAJH01000013) (277 aa) fasta scores: E()=5.2e-40,
                     44.364% id in 275 aa. This CDS is similar to the
                     C-terminus of TraC starting at a Met codon"
                     /note="similarity:fasta; with=UniProt:P27189
                     (EMBL:ECRP4TRA); Escherichia coli.; traC; DNA primase traC
                     (EC 2.7.7.-) (Replication primase).; length=1061; id
                     40.283%; ungapped id 42.697%; E()=9.7e-30; 283 aa overlap;
                     query 4-274; subject 656-934"
                     /note="similarity:fasta; with=UniProt:Q3G182
                     (EMBL:AAJH01000013); Pelobacter propionicus DSM 2379.;
                     TOPRIM.; length=277; id 44.364%; ungapped id 45.522%;
                     E()=5.2e-40; 275 aa overlap; query 1-274; subject 1-269"
                     /db_xref="EnsemblGenomes-Gn:Smlt0063"
                     /db_xref="EnsemblGenomes-Tr:CAQ43678"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="UniProtKB/TrEMBL:B2FU26"
                     /protein_id="CAQ43678.1"
                     /translation="MTRPEGFIAALRAAGLCVATGDAVLANGRLCRVRAEGDGSGQRS
                     GWYVLHAGPPQAGAYGNWKTGLNESWCEAGSEALSEADRAMLREAVVRAQRQQQAERA
                     QRQAVARQQARERWQRASAATPDHPYLVAKGVGVHGLRQLDGLLLVPLRDAQGRLWSL
                     QTIAADGSKRFLAGGRKRGLYYAVGRTVSDVVCIAEGYATAASIHEATGHPTAVAFDA
                     GNLEPVACALRAKFPSAVIVVCADDDAATASRLGINPGVANAQRAADAVGGVVAMPPR
                     PSHEATS"
     misc_feature    64939..65193
                     /locus_tag="Smlt0063"
                     /note="HMMPfam hit to PF01751, Toprim domain, score
                     0.0012"
                     /inference="protein motif:HMMPfam:PF01751"
     CDS             65282..67132
                     /transl_table=11
                     /locus_tag="Smlt0064"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q5WXM2; Legionella
                     pneumophila (strain Lens).; Hypothetical protein.;
                     length=591; id 44.704%; ungapped id 45.191%; E()=5.8e-93;
                     557 aa overlap; query 54-609; subject 35-586"
                     /db_xref="EnsemblGenomes-Gn:Smlt0064"
                     /db_xref="EnsemblGenomes-Tr:CAQ43679"
                     /db_xref="InterPro:IPR009270"
                     /db_xref="UniProtKB/TrEMBL:B2FU27"
                     /protein_id="CAQ43679.1"
                     /translation="MSNVTSVDFNDAAKNAGTGAVRGSIQRAVRKGAKGRTKGNKDAV
                     DSASAARAHYQLNETGVYYVGVTEDGDLAEPVFVCSPLKVEAKTRDSQSEQWGRLLTW
                     TDADGHPHQWAAPAEMLVGDPREFVRQLAAGGVEMSAHRNTMQRLLAYIIQERIDTRA
                     RNVAVPGWHEGRYVLPNGESYGNGAERLVYQHSGGLQHHYAAVGSLEDWRCDVARRCQ
                     DNSRLVLAVSAMFAGPLLHFTGATGGGFHLVGSSSSGKSTALRVAASVVGPPEYAREW
                     RSTANGLEGVAVLHNDATLILDELAQIDPKQAGDAAYLLANGNGKSRANRAGEARAAA
                     RWRVLILSAGEVGLAQHMAEVGKQARAGQSVRLADVPAEAEGGHGVFERLHDASDGAA
                     LSALLKDAAARTYGAPWPLWMGYLTQQDSPTLTAQLRESTDRFLASYVPEDASGEVRR
                     VAERFAVVAFAGELASTCRHRITGWPKGEATRGVATCFQAWLQRRGGSGSADTDELLA
                     RVRAFFEAHGESRLELLRGPEGTVPVRDRVGFRRFDEVGLTEYLVLQEAFRRELCAGF
                     DVRLAARTLAEAGWLKRSADGRPSQAVRIPGLGAIRVFVFDPRKVHDSGL"
     misc_feature    65408..66286
                     /locus_tag="Smlt0064"
                     /note="HMMPfam hit to PF06048, Domain of unknown function
                     (DUF927), score 6.3e-05"
                     /inference="protein motif:HMMPfam:PF06048"
     repeat_region   66807..66818
                     /rpt_unit_seq="(gcgt)3"
     CDS             67166..67954
                     /transl_table=11
                     /locus_tag="Smlt0065"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0065"
                     /db_xref="EnsemblGenomes-Tr:CAQ43680"
                     /db_xref="UniProtKB/TrEMBL:B2FU28"
                     /protein_id="CAQ43680.1"
                     /translation="MSASPPSFQRRFNMSNIETTTTTTSELATQPGEGAEVASVSENR
                     RRLNELAQQLASAVQRKRALVGKVDTMQRAKQAAQGDAAAARQQWGAKLRQSDGTLTR
                     DIQKLRANERSALSLAEEYEAMEGEIAAELPRLELELAEAADRCLSTTNGVIREAASQ
                     AYGQLLEQAGDSLAVAFALFSRAENAGVNHRQAASDDELASAFFGNLCNAVRHRLDDA
                     TVTEQVAERLALPPMDMSEVDMQLAGSTAARIRRRVELNAEGVA"
     repeat_region   67220..67237
                     /rpt_unit_seq="(acc)6"
     CDS             67990..68991
                     /transl_table=11
                     /gene="Q"
                     /locus_tag="Smlt0066"
                     /product="putative phage portal vertex protein"
                     /note="similarity:fasta; with=UniProt:P25480;
                     Bacteriophage P2.; Q; Presumed portal vertex protein
                     (GpQ).; length=344; id 46.526%; ungapped id 47.095%;
                     E()=3.8e-62; 331 aa overlap; query 2-328; subject 9-339"
                     /note="similarity:fasta; with=UniProt:Q8P6J8; Xanthomonas
                     campestris pv. campestris.; Q; Phage-related capsid
                     packaging protein.; length=343; id 66.766%; ungapped id
                     67.988%; E()=3.5e-95; 334 aa overlap; query 3-332; subject
                     10-341"
                     /db_xref="EnsemblGenomes-Gn:Smlt0066"
                     /db_xref="EnsemblGenomes-Tr:CAQ43681"
                     /db_xref="InterPro:IPR006430"
                     /db_xref="InterPro:IPR006944"
                     /db_xref="InterPro:IPR030935"
                     /db_xref="UniProtKB/TrEMBL:B2FU29"
                     /protein_id="CAQ43681.1"
                     /translation="MPAPSAGTAGAITAFSFGEPTPVLDSRGLFDYLECWRNGRYYEP
                     PITLSGLSRTTRSNPFLHSGLIFKRNMLVRTFVPHRLLDRTAFSQMALDYLVFGMAYM
                     ERQISYSGRLLQLQPLMAQYMRRGVQPGEFFQVRAGRAEHEFAPGSVYQLREADTDQE
                     IYGMPEWLAVVQSALLNESATLFRRRYYTNGSHAGFILYMTDPQPEGMDVDALRQALR
                     DSRGPGNFRNLFVHSPNGKKDGLQLIPISEVAAKDEFTGIKRVTRDDILAALRIPPQL
                     LGIVPQNAGGFGSIRDAATVWASMELAPLQSRMAMVNEWIGEDVITFAPFDLAPGAT"
     sig_peptide     67990..68043
                     /gene="Q"
                     /locus_tag="Smlt0066"
                     /note="Signal peptide predicted for Smlt0066 by SignalP
                     2.0 HMM (Signal peptide probability 0.698) with cleavage
                     site probability 0.687 between residues 18 and 19"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    68071..68970
                     /gene="Q"
                     /locus_tag="Smlt0066"
                     /note="HMMPfam hit to PF04860, Phage portal protein, score
                     2.9e-60"
                     /inference="protein motif:HMMPfam:PF04860"
     CDS             complement(69087..69434)
                     /transl_table=11
                     /locus_tag="Smlt0067"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q88AB0; Pseudomonas
                     syringae pv. tomato.; Hypothetical protein.; length=116;
                     id 57.000%; ungapped id 58.163%; E()=2.3e-16; 100 aa
                     overlap; query 4-103; subject 18-115"
                     /db_xref="EnsemblGenomes-Gn:Smlt0067"
                     /db_xref="EnsemblGenomes-Tr:CAQ43682"
                     /db_xref="GOA:B2FU30"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="UniProtKB/TrEMBL:B2FU30"
                     /protein_id="CAQ43682.1"
                     /translation="MSKNPHIGSSFDDFLESEGLLEESASVAVKRVIAWQVAEAMKVA
                     KVSKSDLAKRMNTSRSQLDRVLDEADTGLTLDTLSRAATALGYRIHVDLVPPKQQGSK
                     RRKDATEATVRAA"
     CDS             complement(69431..69772)
                     /transl_table=11
                     /locus_tag="Smlt0068"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:P44031; Haemophilus
                     influenzae.; Hypothetical protein HI0660.; length=119; id
                     31.579%; ungapped id 35.294%; E()=8.1e-05; 114 aa overlap;
                     query 6-111; subject 3-112"
                     /note="similarity:fasta; with=UniProt:Q5X919; Legionella
                     pneumophila (strain Paris).; Hypothetical protein.;
                     length=107; id 47.143%; ungapped id 47.826%; E()=3.8e-06;
                     70 aa overlap; query 45-113; subject 38-107"
                     /db_xref="EnsemblGenomes-Gn:Smlt0068"
                     /db_xref="EnsemblGenomes-Tr:CAQ43683"
                     /db_xref="InterPro:IPR009241"
                     /db_xref="UniProtKB/TrEMBL:B2FU31"
                     /protein_id="CAQ43683.1"
                     /translation="MKTVLDVRFYRSASADEPVRIWLKEEVSAEARRAIGGDIKTVQL
                     GWPMGMPLVRKMDDRLWEVRSSIPEGIARVMFTTVKQDMVLLHGFVKKSDKTPKADLA
                     VAKKRRDEVIK"
     misc_feature    complement(69440..69604)
                     /locus_tag="Smlt0068"
                     /note="HMMPfam hit to PF05973, Phage derived protein
                     Gp49-like (DUF891), score 6.5e-13"
                     /inference="protein motif:HMMPfam:PF05973"
     CDS             complement(69882..70085)
                     /transl_table=11
                     /locus_tag="Smlt0069"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0069"
                     /db_xref="EnsemblGenomes-Tr:CAQ43684"
                     /db_xref="UniProtKB/TrEMBL:B2FU32"
                     /protein_id="CAQ43684.1"
                     /translation="MRTIRWEQLVTLVTGRTAKTRLIDWLTTARRPFQASQRRLDYVT
                     GDCPAPRRQDARTHHRFHRGYLL"
     CDS             complement(71111..71749)
                     /transl_table=11
                     /locus_tag="Smlt0073"
                     /product="putative khg/kdpg aldolase"
                     /EC_number="4.1.2.14"
                     /note="similarity:fasta; with=UniProt:Q9JR44
                     (EMBL:AL162756;); Neisseria meningitidis serogroup A.;
                     eda; 2-keto-4-hydroxyglutarate aldolase (EC 4.1.3.16).;
                     length=212; id 51.429%; ungapped id 51.923%; E()=1.7e-35;
                     210 aa overlap; query 1-210; subject 1-208"
                     /note="similarity:fasta; with=UniProt:P0A955
                     (EMBL:L20897;); Escherichia coli.; eda; KHG/KDPG aldolase
                     [Includes: 4-hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16)
                     (2-keto-4-hydroxyglutarate aldolase) (KHG-aldolase);
                     2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14)
                     (Phospho-2- dehydro-3-deoxygluconate aldolase)
                     (Phospho-2-keto-3-deoxygluconate aldolase)
                     (2-keto-3-deoxy-6-phosphogluconate aldolase)
                     (KDPG-aldolase)].; length=213; id 49.495%; ungapped id
                     49.495%; E()=1.1e-29; 198 aa overlap; query 10-207;
                     subject 10-207"
                     /db_xref="EnsemblGenomes-Gn:Smlt0073"
                     /db_xref="EnsemblGenomes-Tr:CAQ43685"
                     /db_xref="GOA:B2FU33"
                     /db_xref="InterPro:IPR000887"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR031337"
                     /db_xref="InterPro:IPR031338"
                     /db_xref="UniProtKB/TrEMBL:B2FU33"
                     /protein_id="CAQ43685.1"
                     /translation="MSSADPRLRALLKLAPVIPVYTPEDVNEAVEVAQALFRGGLPVI
                     EVTLRTPQALDAIKAMVEAVPDAVIGAGTVLNAAQMQAAKQAGARFAVSPGATPALYA
                     AARDADLPYLPGAATASDLILGLEHGTDTFKFFPAVQAGGAALLAAWHGPFADVRFCP
                     TGGISAQTAPQFLHLPNVLCVGGSWLTTPALLQTRDWDAIERLAREASVLAS"
     misc_feature    complement(71141..71728)
                     /locus_tag="Smlt0073"
                     /note="HMMPfam hit to PF01081, KDPG and KHG aldolase,
                     score 2.8e-80"
                     /inference="protein motif:HMMPfam:PF01081"
     repeat_region   71434..71441
                     /rpt_unit_seq="(cg)4"
     repeat_region   71483..71490
                     /rpt_unit_seq="(gc)4"
     repeat_region   71719..71726
                     /rpt_unit_seq="(gc)4"
     CDS             complement(71863..72519)
                     /transl_table=11
                     /locus_tag="Smlt0074"
                     /product="putative cysteine dioxygenase type I"
                     /note="similarity:fasta; with=UniProt:Q2AMT9
                     (EMBL:AAOY01000058;); Bacillus weihenstephanensis KBAB4.;
                     Cysteine dioxygenase type I.; length=192; id 31.515%;
                     ungapped id 32.704%; E()=2.8e-10; 165 aa overlap; query
                     39-200; subject 13-174"
                     /db_xref="EnsemblGenomes-Gn:Smlt0074"
                     /db_xref="EnsemblGenomes-Tr:CAQ43686"
                     /db_xref="GOA:B2FU34"
                     /db_xref="InterPro:IPR010300"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:B2FU34"
                     /protein_id="CAQ43686.1"
                     /translation="MNAGATRANTNIPLTMLRYSRGMDLQTSPFPAFRGRDRLIAAVD
                     AAMTSGDAGRITADLQLALQEAIADSRIELPECVHRPVSDHYARRPLYHSQEHGYSVI
                     AMSWGPGQGTPLHDHDAMWCVEGVWLGELEITRYELLECAGERWRFRRHAALRGGCGS
                     AGSLIPPHEYHTLRNASDEALAISVHVYEAPMERSAVFDPLGGDWYQRRIQALQADAV
                     "
     misc_feature    complement(71917..72381)
                     /locus_tag="Smlt0074"
                     /note="HMMPfam hit to PF05995, Cysteine dioxygenase type
                     I, score 1.1e-06"
                     /inference="protein motif:HMMPfam:PF05995"
     repeat_region   72496..72503
                     /rpt_unit_seq="(cg)4"
     CDS             72692..73747
                     /transl_table=11
                     /locus_tag="Smlt0075"
                     /product="putative LacI family transcriptional regulator"
                     /note="similarity:fasta; with=UniProt:Q8PE33; Xanthomonas
                     campestris pv. campestris.; Transcriptional regulator lacI
                     family.; length=355; id 68.768%; ungapped id 69.364%;
                     E()=4.8e-85; 349 aa overlap; query 1-347; subject 4-351"
                     /db_xref="EnsemblGenomes-Gn:Smlt0075"
                     /db_xref="EnsemblGenomes-Tr:CAQ43687"
                     /db_xref="GOA:B2FU35"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="UniProtKB/TrEMBL:B2FU35"
                     /protein_id="CAQ43687.1"
                     /translation="MSVRNMSDAALPASKGKAATINDIARLSGVSKKTVSRIINNSPL
                     VRKDTRDKVEALMREVGYVPDPLARGLAFRRSFLIGLVYDDPGAQCIVDLQHGALEAL
                     RGTGYELVVHPCNSQDPDCADGVRRFVQQQKLHGVILGPRASESVALAQMLDDIDCRY
                     VRINAHASEEDVQAVVTHDRDGAAAAAGYLLSLGHRDIAVIAGPGDRRAARERTHGFL
                     DRLAQVGLTLPGERVLEAGDTFESGVHAAERLLLGGQRPSAIFAGNDEMAAGVYQVAL
                     RAGIAVPQQLSIVSYDDSPLASRLWPPLTSVRRHVSDIGRVAASMLVQADVPDAPTAA
                     SVHPQLMVRGSCRAVDA"
     misc_feature    72746..72823
                     /locus_tag="Smlt0075"
                     /note="HMMPfam hit to PF00356, Bacterial regulatory
                     proteins, lacI fami, score 1.5e-10"
                     /inference="protein motif:HMMPfam:PF00356"
     misc_feature    72917..73729
                     /locus_tag="Smlt0075"
                     /note="HMMPfam hit to PF00532, Periplasmic binding
                     proteins and sugar b, score 2e-10"
                     /inference="protein motif:HMMPfam:PF00532"
     CDS             complement(73912..74382)
                     /transl_table=11
                     /locus_tag="Smlt0076"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0076"
                     /db_xref="EnsemblGenomes-Tr:CAQ43688"
                     /db_xref="InterPro:IPR029278"
                     /db_xref="UniProtKB/TrEMBL:B2FU36"
                     /protein_id="CAQ43688.1"
                     /translation="MSVETKPRKRVRVIAGDVYAVPLDAEHQSFGYIRAYRDVDIAVL
                     PVLSKGRILSITQISTLNSVLDVFLFQEAIREGRWPRVGNVPFEDDASAWAPPRKQVA
                     AIRPDVRMVVFQGHFIPAAKFGQYDNLPEFRKFDENDVIEEILRRSGDFLVFDS"
     CDS             complement(74625..75518)
                     /transl_table=11
                     /gene="phhA"
                     /locus_tag="Smlt0077"
                     /product="putative phenylalanine-4-hydroxylase"
                     /EC_number="1.14.16.1"
                     /note="similarity:fasta; with=UniProt:Q8PQZ5
                     (EMBL:AE011641;); Xanthomonas axonopodis pv. citri.; pah;
                     Phenylalanine hydroxylase.; length=296; id 84.589%;
                     ungapped id 84.589%; E()=8.7e-103; 292 aa overlap; query
                     6-297; subject 5-296"
                     /note="similarity:fasta; with=UniProt:P30967
                     (EMBL:AE016825;); Chromobacterium violaceum.; phhA;
                     Phenylalanine-4-hydroxylase (EC 1.14.16.1) (PAH)
                     (Phe-4-monooxygenase).; length=297; id 65.799%; ungapped
                     id 66.292%; E()=1.9e-71; 269 aa overlap; query 29-297;
                     subject 31-297"
                     /db_xref="EnsemblGenomes-Gn:Smlt0077"
                     /db_xref="EnsemblGenomes-Tr:CAQ43689"
                     /db_xref="GOA:B2FU37"
                     /db_xref="InterPro:IPR001273"
                     /db_xref="InterPro:IPR005960"
                     /db_xref="InterPro:IPR018301"
                     /db_xref="InterPro:IPR019774"
                     /db_xref="UniProtKB/TrEMBL:B2FU37"
                     /protein_id="CAQ43689.1"
                     /translation="MDLAQPRRVEHQQTDKGYVPVYTTALVEQPWDTYTADDHATWST
                     LYQRQRELLVGRACQEFLDAQDEMGMSAHMIPRFEQLNEVLGAATGWTLVGVEGLLPE
                     LDFFDHLANRRFPVTWWIRRPDQIDYIAEPDLFHDLFGHVPLLMNPVFADYMEAYGRG
                     GVKAHAIGPDALQNLTRLYWYTVEFGLIDTPEGLRIYGAGIVSSKGESLYSLESAAPN
                     RIGFDLQRIMRTKYRIDTFQKTYFVIDSFEQLMQATSPDFTPIYAALASQAHLPAGDV
                     QGDDRVFQKGTGEGWADGGDV"
     misc_feature    complement(74718..75503)
                     /gene="phhA"
                     /locus_tag="Smlt0077"
                     /note="HMMPfam hit to PF00351, Biopterin-dependent
                     aromatic amino acid h, score 6.5e-12"
                     /inference="protein motif:HMMPfam:PF00351"
     CDS             75644..76129
                     /transl_table=11
                     /locus_tag="Smlt0078"
                     /product="putative AsnC family transcriptional regulator"
                     /note="similarity:fasta; with=UniProt:Q8PQZ4
                     (EMBL:AE011641;); Xanthomonas axonopodis pv. citri.;
                     Transcriptional regulator asnC family.; length=160; id
                     71.698%; ungapped id 71.698%; E()=1.6e-38; 159 aa overlap;
                     query 1-159; subject 1-159"
                     /db_xref="EnsemblGenomes-Gn:Smlt0078"
                     /db_xref="EnsemblGenomes-Tr:CAQ43690"
                     /db_xref="GOA:B2FU38"
                     /db_xref="InterPro:IPR000485"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR019885"
                     /db_xref="InterPro:IPR019887"
                     /db_xref="InterPro:IPR019888"
                     /db_xref="UniProtKB/TrEMBL:B2FU38"
                     /protein_id="CAQ43690.1"
                     /translation="MAGEVQFDRTDIRLLAEIQRDGRATNAELAARVNLSPSACLRRL
                     QRLESEGVIVGYGARLEPRQLRLGLQAFVRVQLEKHDQAAIGHFVDSVQAWDEVVACH
                     ALTGDMDYLLHVYVRDLEHFSRFLLDRLLNAGGVADANSSFVLRTVKGFQALPLSQLE
                     S"
     misc_feature    75854..76084
                     /locus_tag="Smlt0078"
                     /note="HMMPfam hit to PF01037, AsnC family, score 1.3e-29"
                     /inference="protein motif:HMMPfam:PF01037"
     CDS             76325..77020
                     /transl_table=11
                     /locus_tag="Smlt0079"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0079"
                     /db_xref="EnsemblGenomes-Tr:CAQ43691"
                     /db_xref="UniProtKB/TrEMBL:B2FU39"
                     /protein_id="CAQ43691.1"
                     /translation="MPAAAGASPQIANAQPLALSCGTTEFVGMTSNSSTLAKRQCNGS
                     YVYGIGVSVNEAVENLNGFMAVLQAGVSCSADASSIVSGAYGKGVFAQFVCNGWSIAG
                     VGNSPTTAARNSLAIATEMAATGTHCAAPLQGSYYPESWGFRFRYDCGNTQTLKSWSI
                     SGLGASIDDANVIAMRLMRYSTAAGQSCNFEKAEINGVILHATLVCNGSYIHGYGSSV
                     TAAANDALAQIGA"
     CDS             complement(77067..78059)
                     /transl_table=11
                     /locus_tag="Smlt0080"
                     /product="putative patatin-like phospholipase"
                     /note="similarity:fasta; with=UniProt:Q3YML9
                     (EMBL:DQ077748;); uncultured bacterium.; Patatin-like
                     phospholipase.; length=287; id 49.831%; ungapped id
                     53.455%; E()=1.4e-43; 295 aa overlap; query 1-289; subject
                     1-281"
                     /note="similarity:fasta; with=UniProt:Q8PE24
                     (EMBL:AE012112;); Xanthomonas campestris pv. campestris.;
                     Hypothetical protein XCC0159.; length=345; id 73.977%;
                     ungapped id 77.370%; E()=9.8e-78; 342 aa overlap; query
                     2-330; subject 3-342"
                     /db_xref="EnsemblGenomes-Gn:Smlt0080"
                     /db_xref="EnsemblGenomes-Tr:CAQ43692"
                     /db_xref="GOA:B2FU40"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:B2FU40"
                     /protein_id="CAQ43692.1"
                     /translation="MSLFRPRMLLSVALIGLLAGCGGDPVRPTPPPAPTVVPQAKPVK
                     IGIALGGGAAKGFAHIGVIKMLEANGFEPAVVSGTSAGSVVGALYASGMDAFQMQSKA
                     VALDEASIRDVRLFSGGLVQGQKLQDYVNEQVANRPAERLKKPFAAVATQLETGERAI
                     FVRGNVGQAVRASSSIPGVFEPVKIGGRNYIDGGVVSPVPVDAARQLGADFVIAVDIS
                     SKASGKAPTDMLGIVNQSISIMGQRLGEQELARADIVIRPKVLDIGAADFSQRGTAIL
                     EGEKAAMAAMPQIRARIQQLQRARAAAAAPAPVAAPKCEEASRLGKLMGRKDKC"
     misc_feature    complement(77445..77921)
                     /locus_tag="Smlt0080"
                     /note="HMMPfam hit to PF01734, Patatin-like phospholipase,
                     score 4.7e-45"
                     /inference="protein motif:HMMPfam:PF01734"
     sig_peptide     complement(77991..78059)
                     /locus_tag="Smlt0080"
                     /note="Signal peptide predicted for Smlt0080 by SignalP
                     2.0 HMM (Signal peptide probability 0.915) with cleavage
                     site probability 0.403 between residues 23 and 24"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(78510..79526)
                     /transl_table=11
                     /locus_tag="Smlt0082"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q3BZC0
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Hypothetical protein.; length=335; id
                     75.000%; ungapped id 76.577%; E()=3.9e-98; 340 aa overlap;
                     query 1-338; subject 1-335"
                     /db_xref="EnsemblGenomes-Gn:Smlt0082"
                     /db_xref="EnsemblGenomes-Tr:CAQ43693"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="InterPro:IPR016031"
                     /db_xref="UniProtKB/TrEMBL:B2FU41"
                     /protein_id="CAQ43693.1"
                     /translation="MTQWYFHASAQAERIGPLDDEAARRYAQANPRALAWCQGMSGWT
                     PIAEVAELQAVAPGMPNTPPPVPVGASGRADDIEFRIVGHEMQFVEIELDPGESAIAE
                     AGALMFKDATVQMDTVFGAANGDQGGGFMGKVMAAGKRVLTGESLFATVYTQSGHGKG
                     KVAFAAPYPGTVLAMKLDQHGGRLICQKDSFLAGARGVQIGVQFQRKIMTGLFGGEGF
                     IMQKLEGDGWVFIHAGGCVVERELAAGERLDVDTGCVVAYHPTVDMDVRRVAGIKSML
                     FGGEGVFLATLTGPGKVWLQSLPFSRLAGRMWMAAPQGGGQNRGEGSVLGGLGRMLDG
                     DNRF"
     misc_feature    complement(78594..79298)
                     /locus_tag="Smlt0082"
                     /note="HMMPfam hit to PF01987, Protein of unknown function
                     DUF124, score 1.2e-97"
                     /inference="protein motif:HMMPfam:PF01987"
     repeat_region   79427..79434
                     /rpt_unit_seq="(gc)4"
     CDS             79684..81954
                     /transl_table=11
                     /locus_tag="Smlt0083"
                     /product="putative TonB dependent receptor protein"
                     /note="similarity:fasta; with=UniProt:Q9R9W7
                     (EMBL:AF126201;); Pseudomonas putida.; SftP.; length=778;
                     id 28.730%; ungapped id 32.725%; E()=2.6e-24; 811 aa
                     overlap; query 3-756; subject 8-776"
                     /note="similarity:fasta; with=UniProt:Q1GX69
                     (EMBL:CP000356;); Sphingopyxis alaskensis RB2256.;
                     TonB-dependent receptor precursor.; length=754; id
                     47.375%; ungapped id 49.116%; E()=1.3e-126; 762 aa
                     overlap; query 11-756; subject 4-754"
                     /db_xref="EnsemblGenomes-Gn:Smlt0083"
                     /db_xref="EnsemblGenomes-Tr:CAQ43694"
                     /db_xref="GOA:B2FU42"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="UniProtKB/TrEMBL:B2FU42"
                     /protein_id="CAQ43694.1"
                     /translation="MSPTRTSRGRLPVARPLVAALSALLPLVAAAQETPAAKDPVALD
                     ALQVTAQRRVENAKDVPVALSAIQGEKLDVLGSAGDDIRFLAARVPSLNIESSYGRAF
                     PRFYIRGLGNTDFDLNASQPVSLVYDDVVQESPLLKGFPLFDLANVEVLRGPQGTLFG
                     RNTPAGVVKFDSARPSQDADGYVRVGYGSYNSWNVQGAYGGPLTDRWSARVSAIYQRR
                     DDWVDNTRAGAPNSGFEGYDEAAGRVQFLYEGDDFEALFNLHKRKLNGTARLFRANII
                     QKGGNSLVENFDRDKVANDGVNFSDLETWGGSARLQWNLGSVTLHSITGYETAESLNR
                     GDIDGGYGAAFLGAGNYGPGLIPFSSESADGLPHHRQWTQEVRIESNEWGRFDWQAGV
                     FYFDEDVTINNFNYDSLTPGNPQTGHVVQNQRNKAWAVFASGDFDVTDRFKLRAGVRY
                     TQDKKDFSASVLQAVPFGTPVSGPYLANTDVNDVSWDVSGVYKLTDDINAYARVAKGF
                     RAPSIQGRLAFAPGLSQADSEKVLSYEAGIKADLFERRARLGLSVFRYNVDGQQLIAV
                     GGSNNTATLLNADKTIGQGVELDLEAYLADNVLLTFGSSYNDTEIKDKDLAVAICGGG
                     CTINDPTTVINGQTYALVNGNPLPQAPKWIHNATLRVGFPLSDGSELYAYTDWAYRSA
                     VNFFIYESPEFRGRSSLEGGLRLGYNWDYGQYDVAVFGRNLTNQTRVVGAIDFNNLTG
                     FLNEPRTWGVEFTAKF"
     sig_peptide     79684..79776
                     /locus_tag="Smlt0083"
                     /note="Signal peptide predicted for Smlt0083 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.988 between residues 31 and 32"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    79849..80184
                     /locus_tag="Smlt0083"
                     /note="HMMPfam hit to PF07715, TonB-dependent Receptor
                     Plug Domain, score 3e-16"
                     /inference="protein motif:HMMPfam:PF07715"
     repeat_region   79941..79948
                     /rpt_unit_seq="(cg)4"
     repeat_region   80606..80613
                     /rpt_unit_seq="(gc)4"
     misc_feature    81136..81951
                     /locus_tag="Smlt0083"
                     /note="HMMPfam hit to PF00593, TonB dependent receptor,
                     score 5.2e-23"
                     /inference="protein motif:HMMPfam:PF00593"
     repeat_region   81319..81326
                     /rpt_unit_seq="(cg)4"
     repeat_region   82058..82065
                     /rpt_unit_seq="(gc)4"
     CDS             complement(82066..82905)
                     /transl_table=11
                     /locus_tag="Smlt0084"
                     /product="putative phosphatase"
                     /note="similarity:fasta; with=UniProt:Q2PT43
                     (EMBL:DQ303409;); uncultured bacterium.; PhoC.;
                     length=281; id 49.466%; ungapped id 51.103%; E()=1.7e-45;
                     281 aa overlap; query 3-274; subject 1-281"
                     /note="similarity:fasta; with=UniProt:Q8P342
                     (EMBL:AE012551;); Xanthomonas campestris pv. campestris.;
                     phoC; Phosphatase.; length=280; id 56.767%; ungapped id
                     57.854%; E()=1.8e-54; 266 aa overlap; query 9-272; subject
                     11-273"
                     /db_xref="EnsemblGenomes-Gn:Smlt0084"
                     /db_xref="EnsemblGenomes-Tr:CAQ43695"
                     /db_xref="GOA:B2FU43"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="InterPro:IPR001011"
                     /db_xref="InterPro:IPR011158"
                     /db_xref="InterPro:IPR018296"
                     /db_xref="UniProtKB/TrEMBL:B2FU43"
                     /protein_id="CAQ43695.1"
                     /translation="MSLISHPARPLLGLAVVAALAGCAATATKPTAVEANITTKAVGY
                     LDKSAVPASLDLVPAPPVAGSAALALDEQVSREARALRGSPRFAQAGVDAELGFPEGA
                     NHFSCAADIDVDAVKTPALYRLLERSRIDASAATKAAKNHYQRPRPFMVNGEPTCSPK
                     DEEGLRKNGSYPSGHTSIGWAWALILSEIAPDRADAIQARGRNYGESRLVCNVHWQSD
                     ILEGRFMGAAAVARLHDNAAFNKDLLAARKEIAAARKAGLHSSRDCTTENAVLKVRPQ
                     SAL"
     misc_feature    complement(82180..82545)
                     /locus_tag="Smlt0084"
                     /note="HMMPfam hit to PF01569, PAP2 superfamily, score
                     2.4e-11"
                     /inference="protein motif:HMMPfam:PF01569"
     sig_peptide     complement(82825..82905)
                     /locus_tag="Smlt0084"
                     /note="Signal peptide predicted for Smlt0084 by SignalP
                     2.0 HMM (Signal peptide probability 0.999) with cleavage
                     site probability 0.324 between residues 27 and 28"
                     /inference="protein motif:SignalP:2.0"
     CDS             83169..84047
                     /transl_table=11
                     /locus_tag="Smlt0085"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q2ZX12
                     (EMBL:AALB01000001;); Shewanella putrefaciens CN-32.;
                     Hypothetical protein precursor.; length=287; id 69.176%;
                     ungapped id 69.675%; E()=3.2e-79; 279 aa overlap; query
                     13-290; subject 10-287"
                     /db_xref="EnsemblGenomes-Gn:Smlt0085"
                     /db_xref="EnsemblGenomes-Tr:CAQ43696"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B2FU44"
                     /protein_id="CAQ43696.1"
                     /translation="MRSTATGSTVLALLLGLATAPAQAADVVGVAFVHGTGAQTNATQ
                     DYWQPAIIDTVRQGLPNSSNYVVINCDFTQYMWKPEAAGCLANQLTSFIDSRGITQLV
                     VITHSNGGNVVRWILSNPTYDSRYPKIIRTVRKVTALAPSSAGTPLADAVLNGNTFET
                     SLGWLLGYKNDAVRQQQVASMATYNAQNLYGTAGRPALPKPFRAVVGSDVESAVWDSN
                     SYCGGYAANVGLEFTQNWLSSCSDGFLECSSQKAAGTTWFTDKARTQGAEPLSHNQSR
                     RECFGLGTLLRNDLTQ"
     sig_peptide     83169..83240
                     /locus_tag="Smlt0085"
                     /note="Signal peptide predicted for Smlt0085 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.999 between residues 24 and 25"
                     /inference="protein motif:SignalP:2.0"
     CDS             84059..85261
                     /transl_table=11
                     /locus_tag="Smlt0086"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q33XG7
                     (EMBL:AALS01000004;); Shewanella sp. PV-4.; Hypothetical
                     protein precursor.; length=428; id 31.421%; ungapped id
                     35.593%; E()=1.4e-11; 401 aa overlap; query 19-389;
                     subject 34-417"
                     /db_xref="EnsemblGenomes-Gn:Smlt0086"
                     /db_xref="EnsemblGenomes-Tr:CAQ43697"
                     /db_xref="InterPro:IPR031979"
                     /db_xref="UniProtKB/TrEMBL:B2FU45"
                     /protein_id="CAQ43697.1"
                     /translation="MTIQSTLLAGAVLAALSLSAAQAAQPLQAARAGDQVPAALVAAP
                     LPADDSERAPLSFAWALDPAQSLQAATPYASVSRSYWQQVDGTQLQRGLDLPLTAADA
                     VIQLSPAEGARAVPANSLQVRDPAGRSSVARSVDARALQEAGMPVSDGSSMLRTGATS
                     AAGAYTLQSAQAQGRYVVQVLEPNSPLRLEVQANQGQVLAGGNLQLQARLLEDGATPA
                     TLASRRSSLGGEALLVAPDGRSWPQRLLRTTDGALRAQVRIPADVGNAQGLWELQVFA
                     QADGVLRDGKVAFAVARPTARFSGQAAPDPASRQVALPLQVAAAGRYEARGTLYATGR
                     DGQLKPVAQAHAAAWFDGPGRGQLVLPFDQAALPAGFGAPYELRDLQLQDQSRMAPIE
                     SRALALRF"
     sig_peptide     84059..84127
                     /locus_tag="Smlt0086"
                     /note="Signal peptide predicted for Smlt0086 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.888 between residues 23 and 24"
                     /inference="protein motif:SignalP:2.0"
     repeat_region   84466..84475
                     /rpt_unit_seq="(cg)5"
     CDS             complement(85445..86266)
                     /transl_table=11
                     /locus_tag="Smlt0087"
                     /product="putative ATP-binding component of ABC
                     transporter protein"
                     /note="similarity:fasta; with=UniProt:Q8PQZ0
                     (EMBL:AE011642;); Xanthomonas axonopodis pv. citri.; ylmA;
                     ABC transporter ATP-binding protein.; length=281; id
                     75.746%; ungapped id 75.746%; E()=1.6e-56; 268 aa overlap;
                     query 6-273; subject 13-280"
                     /db_xref="EnsemblGenomes-Gn:Smlt0087"
                     /db_xref="EnsemblGenomes-Tr:CAQ43698"
                     /db_xref="GOA:B2FU46"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B2FU46"
                     /protein_id="CAQ43698.1"
                     /translation="MTAAPSVAELPPLIELDRATVVRGQVKVLHGLSLRIAQGQHTAL
                     LGPNGCGKSTFIKLITRELYPLAQGDGSVAVKVLGQNRWQVDRLRSQLGIVTGDLSSN
                     LADMPGLTVEQAVLSGFFASYVVPAFREVTADMRTRVGETLAMTGALSLRERAYAELS
                     AGETRRVLIARALVNRPQALLLDEPSTGLDLVAREQLVATMRVLAQQGITLVLVTHHI
                     EEIIPEIERVVLLRDGRVLADGTRAELLRSAPLSAVFGGPITVCEQEGRLTAYAG"
     misc_feature    complement(85565..86152)
                     /locus_tag="Smlt0087"
                     /note="HMMPfam hit to PF00005, ABC transporter, score
                     2.6e-40"
                     /inference="protein motif:HMMPfam:PF00005"
     CDS             86328..87620
                     /transl_table=11
                     /locus_tag="Smlt0088"
                     /product="putative fatty acid desaturase"
                     /note="similarity:fasta; with=UniProt:O65797
                     (EMBL:AC024174;); Arabidopsis thaliana (Mouse-ear cress).;
                     ADS1; Delta-9 acyl-lipid desaturase 1 (EC 1.14.19.-).;
                     length=305; id 29.804%; ungapped id 32.340%; E()=1.1e-15;
                     255 aa overlap; query 49-295; subject 61-303"
                     /note="similarity:fasta; with=UniProt:Q3BZB8
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Fatty acid desaturase precursor.;
                     length=401; id 82.750%; ungapped id 82.750%; E()=9.4e-138;
                     400 aa overlap; query 31-430; subject 2-401"
                     /db_xref="EnsemblGenomes-Gn:Smlt0088"
                     /db_xref="EnsemblGenomes-Tr:CAQ43699"
                     /db_xref="GOA:B2FU47"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:B2FU47"
                     /protein_id="CAQ43699.1"
                     /translation="MTVAITAAGMQFATQAPMMSAIPASIRRAAMPDALMSLLTGGVL
                     GLGWWAMLGVLLVFTQITIFSVTLYLHRSQAHRGVDFHPALAHVFRFWLWLTTSMITR
                     EWVAIHRKHHAKVETEDDPHSPVTRGIGTVFWHGVELYREARGMRADIEQYGRGTPDD
                     AIERHLYTPHATLGPVLLLAINSVLFGLPGVALWAIQMAWIPFWAAGVVNGLGHWWGY
                     RNYESADTSTNLTPWGFWIGGEELHNNHHAFPSSARFAMRRWEFDIGWSAIRLLQALR
                     LAKVLRVAPAMDVRPNIAVPDAETLKALLSHRFQAMTDYQRNVFMPALREEAAHAGAK
                     LRRLLPRRLRRGLVNDGRWLKPDSRAQLSEWVAQRPRIRTLVEYRARLAALLEARGHD
                     AAERLHQLQAWCREAEESGIAALQAYAARLKGYSLVGA"
     misc_feature    86469..87125
                     /locus_tag="Smlt0088"
                     /note="HMMPfam hit to PF00487, Fatty acid desaturase,
                     score 5.1e-08"
                     /inference="protein motif:HMMPfam:PF00487"
     misc_feature    order(86469..86537,86847..86915)
                     /locus_tag="Smlt0088"
                     /note="2 probable transmembrane helices predicted for
                     Smlt0088 by TMHMM2.0 at aa 48-70 and 174-196"
                     /inference="protein motif:TMHMM:2.0"
     repeat_region   87462..87469
                     /rpt_unit_seq="(cg)4"
     CDS             87617..87949
                     /transl_table=11
                     /locus_tag="Smlt0089"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PE20
                     (EMBL:AE012112;); Xanthomonas campestris pv. campestris.;
                     Hypothetical protein XCC0163.; length=117; id 60.000%;
                     ungapped id 61.165%; E()=7.3e-20; 105 aa overlap; query
                     6-110; subject 15-117"
                     /db_xref="EnsemblGenomes-Gn:Smlt0089"
                     /db_xref="EnsemblGenomes-Tr:CAQ43700"
                     /db_xref="GOA:B2FU48"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:B2FU48"
                     /protein_id="CAQ43700.1"
                     /translation="MRAGYGVLLAVLLPGAALAQVTDTASYLQRMDSDGDGKVSEAEY
                     VQWMLYAFDRMDRNGDGVLSAEELPGGKGRAIRREQQRQVIVQRFHKQDANGDGVLDA
                     RELAAPPR"
     sig_peptide     87617..87673
                     /locus_tag="Smlt0089"
                     /note="Signal peptide predicted for Smlt0089 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.996 between residues 19 and 20"
                     /inference="protein motif:SignalP:2.0"
     CDS             87969..88781
                     /transl_table=11
                     /gene="fpg"
                     /gene_synonym="mutM"
                     /locus_tag="Smlt0090"
                     /product="putative formamidopyrimidine-dna glycosylase
                     (fapy-dna glycosylase) (dna-(apurinic or apyrimidinic
                     site) lyase mutm)"
                     /EC_number="4.2.99.18"
                     /note="similarity:fasta; with=UniProt:Q9L7T2
                     (EMBL:AE004473;); Pseudomonas aeruginosa.; mutM;
                     Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)
                     (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic
                     site) lyase mutM) (EC 4.2.99.18) (AP lyase mutM).;
                     length=269; id 60.967%; ungapped id 60.967%; E()=7.7e-57;
                     269 aa overlap; query 2-270; subject 1-269"
                     /note="similarity:fasta; with=UniProt:Q8P3C4
                     (EMBL:AE012540;); Xanthomonas campestris pv. campestris.;
                     mutM; Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)
                     (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic
                     site) lyase mutM) (EC 4.2.99.18) (AP lyase mutM).;
                     length=270; id 79.630%; ungapped id 79.926%; E()=2.5e-76;
                     270 aa overlap; query 2-270; subject 1-270"
                     /db_xref="EnsemblGenomes-Gn:Smlt0090"
                     /db_xref="EnsemblGenomes-Tr:CAQ43701"
                     /db_xref="GOA:B2FU49"
                     /db_xref="InterPro:IPR000214"
                     /db_xref="InterPro:IPR010663"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR012319"
                     /db_xref="InterPro:IPR015886"
                     /db_xref="InterPro:IPR015887"
                     /db_xref="InterPro:IPR020629"
                     /db_xref="UniProtKB/Swiss-Prot:B2FU49"
                     /protein_id="CAQ43701.1"
                     /translation="MPELPEVETTRRGLAPHLQGRRVHGVILRRADLRWPIPPEVAEL
                     LPGQRIEDIRRRAKYLLLDTAIGSAVLHLGMSGSLRVLPGDTPLRAHDHVDISLDNGR
                     LLRFNDPRRFGSLLWQPAGEVHPLLQGLGPEPLDDAFDGDYLFARSRGRSAPVKTFLM
                     DQAVVVGVGNIYAAESLFKAGISPLREAGKISRERYQRLADAVKEILGYAITRGGTTL
                     RDFISPDGAPGYFEQELLVYGRDGLPCPNCGRALKHATIGQRASVWCSHCQR"
     misc_feature    87972..88313
                     /gene="fpg"
                     /locus_tag="Smlt0090"
                     /note="HMMPfam hit to PF01149, Formamidopyrimidine-DNA
                     glycosylase N-, score 1.5e-39"
                     /inference="protein motif:HMMPfam:PF01149"
     repeat_region   88232..88239
                     /rpt_unit_seq="(gc)4"
     misc_feature    88356..88634
                     /gene="fpg"
                     /locus_tag="Smlt0090"
                     /note="HMMPfam hit to PF06831, Formamidopyrimidine-DNA
                     glycosylase H2, score 3.8e-41"
                     /inference="protein motif:HMMPfam:PF06831"
     CDS             88888..90492
                     /transl_table=11
                     /gene="mdoD"
                     /locus_tag="Smlt0091"
                     /product="putative glucan biosynthesis protein d
                     precursor"
                     /note="similarity:fasta; with=UniProt:P40120
                     (EMBL:X15860;); Escherichia coli.; mdoD; Glucans
                     biosynthesis protein D precursor.; length=551; id 45.290%;
                     ungapped id 47.529%; E()=5.4e-88; 552 aa overlap; query
                     1-534; subject 1-544"
                     /note="similarity:fasta; with=UniProt:Q3BM95
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; opgD; Periplasmic glucan biosynthesis
                     protein.; length=550; id 80.970%; ungapped id 81.733%;
                     E()=6.1e-185; 536 aa overlap; query 1-534; subject 18-550"
                     /note="similarity:fasta; with=UniProt:Q8P3C6
                     (EMBL:AE012540;); Xanthomonas campestris pv. campestris.;
                     opgD; Glucans biosynthesis protein D precursor.;
                     length=533; id 80.784%; ungapped id 81.544%; E()=1.1e-184;
                     536 aa overlap; query 1-534; subject 1-533"
                     /db_xref="EnsemblGenomes-Gn:Smlt0091"
                     /db_xref="EnsemblGenomes-Tr:CAQ43702"
                     /db_xref="GOA:B2FU50"
                     /db_xref="InterPro:IPR007444"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014438"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR023724"
                     /db_xref="UniProtKB/Swiss-Prot:B2FU50"
                     /protein_id="CAQ43702.1"
                     /translation="MQRRDFIRNASLALAAFGLPSLPACAASRSGQMGLRRLGQPQPF
                     DFATLKGQARALAQAPYKSHKRVLPGRLEGLDWDQYQSIGYRQDHALWADQPGKFQAK
                     FFHLGLYFHSPVRMFDVVDGKAQELAYDGAAFNYGKSGIKDGELPADLGFAGFRLNTR
                     KDTDRDFAAFLGASYFRAVGKEGQYGQSARGLAIDTGMGKPEEFPDFIAYYLEQPSAD
                     SDTIVVYGLLDSPSVAGAYRFAITNGDVLLMDIDSALYPRKAIERLGIAPCTSMYQVG
                     ENDRRMAWDWRPEIHDTDGLSLWTGAGEWIWRPLLNPRNLRFNMFVDRNPRGFGLLQR
                     DRNFDHYQDDGVFYEKRPCLWVEPKGEWGEGSVQLVEIPTVDETFDNIVAFWNPKEKP
                     QPGQELLVGYRLYWGAEPPARPPLAHCVASRTGLGGVVGKKREYFSWRFAVDFEGGEL
                     ARLIDKGEVEAVVEASRGRVEIVSARPLREINGYRAMFDLVPPEGSTEQIDIRLFLRS
                     GGKTLTETWLYQYTPPPAGAPERTLY"
     sig_peptide     88888..88965
                     /gene="mdoD"
                     /locus_tag="Smlt0091"
                     /note="Signal peptide predicted for Smlt0091 by SignalP
                     2.0 HMM (Signal peptide probability 0.999) with cleavage
                     site probability 0.797 between residues 26 and 27"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    89017..90465
                     /gene="mdoD"
                     /locus_tag="Smlt0091"
                     /note="HMMPfam hit to PF04349, Periplasmic glucan
                     biosynthesis protein, Mdo, score 9.1e-304"
                     /inference="protein motif:HMMPfam:PF04349"
     repeat_region   89044..89053
                     /rpt_unit_seq="(gc)5"
     repeat_region   90495..90703
                     /rpt_family="R=3"
                     /inference="nucleotide motif:RepeatScout"
     repeat_region   90543..90987
                     /rpt_family="R=8"
                     /inference="nucleotide motif:RepeatScout"
     repeat_region   complement(90826..91045)
                     /rpt_family="R=3"
                     /inference="nucleotide motif:RepeatScout"
     repeat_region   90966..90983
                     /rpt_unit_seq="(ttgctg)3"
     CDS             complement(91047..91667)
                     /transl_table=11
                     /gene="tdk"
                     /locus_tag="Smlt0092"
                     /product="putative thymidine kinase"
                     /EC_number="2.7.1.21"
                     /note="similarity:fasta; with=UniProt:P23331
                     (EMBL:X51523;); Escherichia coli.; tdk; Thymidine kinase
                     (EC 2.7.1.21).; length=205; id 60.317%; ungapped id
                     60.638%; E()=1e-40; 189 aa overlap; query 1-189; subject
                     1-188"
                     /note="similarity:fasta; with=UniProt:Q4UNV0
                     (EMBL:CP000050;); Xanthomonas campestris pv. campestris
                     (strain 8004).; tdk; Thymidine kinase (EC 2.7.1.21).;
                     length=209; id 83.981%; ungapped id 83.981%; E()=2.3e-67;
                     206 aa overlap; query 1-206; subject 1-206"
                     /db_xref="EnsemblGenomes-Gn:Smlt0092"
                     /db_xref="EnsemblGenomes-Tr:CAQ43703"
                     /db_xref="GOA:B2FU51"
                     /db_xref="InterPro:IPR001267"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B2FU51"
                     /protein_id="CAQ43703.1"
                     /translation="MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRVAILTPRLDDRA
                     GAGVVASRIGLRADGMAFDRDTDLQHWVEQDLAANGPMGCVLVDEAQFLTRAQVWQLS
                     EVVDQLRIPVLCYGLRTDFRGELFEGSQYLLAWADEMQEIKTICHSGKKATMTVRVDE
                     HGHAVKDGPQVEIGGNDRYVSVSRAEFKKITRGEGRIDPAQAPLPL"
     misc_feature    complement(91107..91664)
                     /gene="tdk"
                     /locus_tag="Smlt0092"
                     /note="HMMPfam hit to PF00265, Thymidine kinase, score
                     1.2e-65"
                     /inference="protein motif:HMMPfam:PF00265"
     CDS             complement(91677..92408)
                     /transl_table=11
                     /locus_tag="Smlt0093"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0093"
                     /db_xref="EnsemblGenomes-Tr:CAQ43704"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:B2FU52"
                     /protein_id="CAQ43704.1"
                     /translation="MKAKQAPRFCLLLGLSMAAAVTARECPVEAPRQIPSTVLTGGFF
                     DAHPDLFWRSMAQRAERDRQPARALDYYTRSARYADKFSQAMVARLYQEGLGTRADPV
                     MAYIWMDLAAERMYHDFLVLREHYWARLDALQQAQAIERGQQIYADYGDRVAKPRMER
                     ALRDGRQQITGSRLGYVSSGLIVVQRRGNEQGIVTPGSIVYDNDYWRAADYWCLQDNY
                     WRPARTPSVEIGRPDAVRDDKAVDD"
     sig_peptide     complement(92340..92408)
                     /locus_tag="Smlt0093"
                     /note="Signal peptide predicted for Smlt0093 by SignalP
                     2.0 HMM (Signal peptide probability 0.999) with cleavage
                     site probability 0.791 between residues 23 and 24"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(92447..93229)
                     /transl_table=11
                     /locus_tag="Smlt0094"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0094"
                     /db_xref="EnsemblGenomes-Tr:CAQ43705"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:B2FU53"
                     /protein_id="CAQ43705.1"
                     /translation="MHAVPKLLIRHRSTGARCMRPTASAALLGTLLLLLAPLAARSAD
                     CAPDAGASLQSALMTPGFLQAHPDLHWRELGLQSWRQGRPDHALVRFKRAAAHADKLS
                     QSLVARMYQEGTGTAPDPVLAYIWMDLAAERGYRDLLLERERYWNRLDAAQRQRVLAE
                     GPALYAAYGDATAKPRMEAAMRVGRSGMTGSRTGWVSSMLQVELSDGPEAGWPTRGDD
                     YYRDAYWDPAAYWCMQDRIWEQEFRGRSVEVGPLSPVGGAGR"
     misc_feature    complement(92825..92932)
                     /locus_tag="Smlt0094"
                     /note="HMMPfam hit to PF08238, Sel1 repeat, score 3.3e-05"
                     /inference="protein motif:HMMPfam:PF08238"
     sig_peptide     complement(93104..93229)
                     /locus_tag="Smlt0094"
                     /note="Signal peptide predicted for Smlt0094 by SignalP
                     2.0 HMM (Signal peptide probability 0.996) with cleavage
                     site probability 0.784 between residues 42 and 43"
                     /inference="protein motif:SignalP:2.0"
     CDS             93275..95251
                     /transl_table=11
                     /gene="rep"
                     /locus_tag="Smlt0095"
                     /product="putative ATP-dependent DNA helicase Rep"
                     /EC_number="3.6.1.-"
                     /note="similarity:fasta; with=UniProt:P09980
                     (EMBL:M11055;); Escherichia coli.; rep; ATP-dependent DNA
                     helicase rep (EC 3.6.1.-).; length=673; id 45.224%;
                     ungapped id 46.832%; E()=1.2e-100; 670 aa overlap; query
                     4-656; subject 3-666"
                     /note="similarity:fasta; with=UniProt:Q8P3D2
                     (EMBL:AE012539;); Xanthomonas campestris pv. campestris.;
                     rep; ATP-dependent DNA helicase.; length=658; id 84.043%;
                     ungapped id 84.043%; E()=0; 658 aa overlap; query 1-658;
                     subject 1-658"
                     /db_xref="EnsemblGenomes-Gn:Smlt0095"
                     /db_xref="EnsemblGenomes-Tr:CAQ43706"
                     /db_xref="GOA:B2FU54"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR005752"
                     /db_xref="InterPro:IPR013986"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B2FU54"
                     /protein_id="CAQ43706.1"
                     /translation="MHGLNPPQAAAVLHIEGPLLVLAGAGSGKTRVIVEKIAHLIGSG
                     RYPARRIAAITFTNKSAKEMRERVAKRLREQDADEVTICTFHALGLKFLQIEHAAVGL
                     KRGFSIFDADDAAAQIKDLMYGAKPDDIEDMKNLVSRAKNAGLSPEQAMAAARSNREK
                     EAASVYERYQLRLTAFNAVDFDDLIRLPVQILEENPEIALAWRERIGYLLVDECQDTN
                     DAQYRLLKQLAGDKGNFTCVGDDDQSIYAWRGANPENLQQMGRDYPALEIIKLEQNYR
                     CSNRVLRAANALIANNPHEHLKKLWSDQADGERIRVWECRNSEHEAEKVAAEIAFVAQ
                     SRNVPWSDFCILFRGNFQSRPLEKAMQLLRIPYHLTGGTMFLERQEVKDTLAWLRLLV
                     NPDDDTAFMRAVQSPKRDVGAGTLARLAELAQEKDMPMAQAAEAIGALQQLPPRAANS
                     LARFTDILRDLRAQMRQVTSGDMIRKVAKESGLLSELRQQAKEEASYQRRANNIEELA
                     QWFEGGPRGATAADLAGQLALLSRSDKDEGGNQVRMMTMHASKGLEFPYVFIVGCEDG
                     VLPHQVSLDEGNLQEERRLLYVGITRAKIQLWMSYSKLTRKFGEHVRLKPSRFFDEIP
                     AEEIQRDGADPVADAARKKERASAGLAAIEALFD"
     misc_feature    93284..94723
                     /gene="rep"
                     /locus_tag="Smlt0095"
                     /note="HMMPfam hit to PF00580, UvrD/REP helicase, score
                     1.3e-183"
                     /inference="protein motif:HMMPfam:PF00580"
     repeat_region   94657..94664
                     /rpt_unit_seq="(gc)4"
     repeat_region   complement(95296..95423)
                     /rpt_family="R=8"
                     /inference="nucleotide motif:RepeatScout"
     CDS             95512..96036
                     /transl_table=11
                     /locus_tag="Smlt0096"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PER0
                     (EMBL:AE012081;); Xanthomonas axonopodis pv. citri.;
                     Acetyltransferase.; length=184; id 42.683%; ungapped id
                     42.683%; E()=7.8e-19; 164 aa overlap; query 4-167; subject
                     11-174"
                     /db_xref="EnsemblGenomes-Gn:Smlt0096"
                     /db_xref="EnsemblGenomes-Tr:CAQ43707"
                     /db_xref="GOA:B2FU55"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:B2FU55"
                     /protein_id="CAQ43707.1"
                     /translation="MQPIESERLRLRAIEPDRDAAPMLALLNDPGFVRFIGDRNVRSE
                     EQARDYIALRVLHSYALNGFGMYAIERLSDGAWLGNAGLVRRDGLPGPDIGYAVLSEF
                     AGQGYAGEAARAVFAHARAGLGLHDLYGITDLDNVVSGKILLGLGMQERGVIQLPGVD
                     SPSRLYATPGAAQI"
     repeat_region   95866..95873
                     /rpt_unit_seq="(gc)4"
     CDS             complement(96114..96767)
                     /transl_table=11
                     /locus_tag="Smlt0097"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q3BMA2
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Hypothetical protein.; length=222; id
                     66.822%; ungapped id 68.421%; E()=4.6e-47; 214 aa overlap;
                     query 6-216; subject 3-214"
                     /db_xref="EnsemblGenomes-Gn:Smlt0097"
                     /db_xref="EnsemblGenomes-Tr:CAQ43708"
                     /db_xref="InterPro:IPR007432"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/Swiss-Prot:B2FU56"
                     /protein_id="CAQ43708.1"
                     /translation="MTDSVQTPDVPLLDAVQARLLGCLVEKEATTPDTYPLTVNAAQS
                     AANQKTAREPVMNIDAGSVQHALRQLEALGLARQHFSSRADRYEHRLQAALDLTRQQT
                     VLLALLLLRGPQTLGELITRSERLHRFADTDEARHAIERLQQRALLVVLPRASGQRED
                     RYMHLLCGEVDGAALAARYASSGGGSSDAADPGLAERVAQLEAAVAELQAQLAELRG"
     misc_feature    complement(96246..96731)
                     /locus_tag="Smlt0097"
                     /note="HMMPfam hit to PF04337, Protein of unknown
                     function, DUF480, score 2.9e-84"
                     /inference="protein motif:HMMPfam:PF04337"
     repeat_region   96329..96336
                     /rpt_unit_seq="(gc)4"
     repeat_region   96516..96523
                     /rpt_unit_seq="(cg)4"
     CDS             96869..97792
                     /transl_table=11
                     /gene="hel"
                     /locus_tag="Smlt0098"
                     /product="putative lipoprotein E precursor (outer membrane
                     protein p4)"
                     /note="similarity:fasta; with=UniProt:P26093
                     (EMBL:L42023;); Haemophilus influenzae.; hel; Lipoprotein
                     E precursor (Outer membrane protein P4) (OMP P4).;
                     length=274; id 34.800%; ungapped id 40.278%; E()=5.8e-15;
                     250 aa overlap; query 61-301; subject 46-270"
                     /note="similarity:fasta; with=UniProt:Q8P3D6
                     (EMBL:AE012538;); Xanthomonas campestris pv. campestris.;
                     lppC; Acid phosphatase.; length=318; id 77.389%; ungapped
                     id 79.412%; E()=5e-88; 314 aa overlap; query 1-306;
                     subject 4-317"
                     /db_xref="EnsemblGenomes-Gn:Smlt0098"
                     /db_xref="EnsemblGenomes-Tr:CAQ43709"
                     /db_xref="GOA:B2FU57"
                     /db_xref="InterPro:IPR005519"
                     /db_xref="InterPro:IPR006423"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:B2FU57"
                     /protein_id="CAQ43709.1"
                     /translation="MRRPVSLSLTLLATAALGLSACKRVDAPAAEAAAPEAPAAAAKA
                     DGALDATANDNLNAVLWMQRAQEYKAITEQTYRAAADHLDAALKEAHWDALVPEERGN
                     EAKGLKPAVVLDVDETVLDNSPYQARLVRDGKEYDELSWDQWVAEKKAKAIPGVVDFA
                     KAANAKGVTLLYISNRAVHLKDATLANLREQGLPVADDSVFLGLGTVVEGCEQAGSEK
                     NCRRRLAGQKYRVLMQFGDQLGDFVEVTANTNEGRDALLQQYHDWFGERWWMLPNPTY
                     GGFEPAQFNNDYSHSRQARHDAKRAALDYAP"
     sig_peptide     96869..96964
                     /gene="hel"
                     /locus_tag="Smlt0098"
                     /note="Signal peptide predicted for Smlt0098 by SignalP
                     2.0 HMM (Signal peptide probability 0.999) with cleavage
                     site probability 0.674 between residues 32 and 33"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    96953..97705
                     /gene="hel"
                     /locus_tag="Smlt0098"
                     /note="HMMPfam hit to PF03767, HAD superfamily, subfamily
                     IIIB (Acid, score 7.1e-47"
                     /inference="protein motif:HMMPfam:PF03767"
     repeat_region   97057..97064
                     /rpt_unit_seq="(gc)4"
     repeat_region   97527..97538
                     /rpt_unit_seq="(gcc)4"
     CDS             97789..98514
                     /transl_table=11
                     /gene="pyrF"
                     /locus_tag="Smlt0099"
                     /product="putative orotidine 5'-phosphate decarboxylase"
                     /EC_number="4.1.1.23"
                     /note="similarity:fasta; with=UniProt:Q59654
                     (EMBL:AE004714;); Pseudomonas aeruginosa.; pyrF; Orotidine
                     5'-phosphate decarboxylase (EC 4.1.1.23) (OMP
                     decarboxylase) (OMPDCase) (OMPdecase).; length=232; id
                     41.150%; ungapped id 42.466%; E()=1.3e-20; 226 aa overlap;
                     query 14-234; subject 8-231"
                     /note="similarity:fasta; with=UniProt:Q3BMA4
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; pyrF; Orotidine 5'-phosphate
                     decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase)
                     (OMPdecase).; length=243; id 82.353%; ungapped id 82.353%;
                     E()=2.8e-67; 238 aa overlap; query 1-238; subject 1-238"
                     /db_xref="EnsemblGenomes-Gn:Smlt0099"
                     /db_xref="EnsemblGenomes-Tr:CAQ43710"
                     /db_xref="GOA:B2FU58"
                     /db_xref="InterPro:IPR001754"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014732"
                     /db_xref="InterPro:IPR018089"
                     /db_xref="UniProtKB/Swiss-Prot:B2FU58"
                     /protein_id="CAQ43710.1"
                     /translation="MSRAPLPLRDDERLIFALDVPDRAQALEWVDRLGDSVAFYKIGM
                     ELLASGEYFQVLDELARRDKRVFVDLKFFDIPATAAAVIKRLSQWPVSYATIHGWHPA
                     MMEACAAANSSDMRLLAVTVLTSMGRPDLAQMGIDREPVDVVVERALAAQAAGIDGVI
                     ASGQEAGPIRAATGAGFSIVCPGIRPGGPVGDDQKRTVGVAQAFADGADAIVVGRPIR
                     LATDPQAAARAIQQEIASALAAR"
     misc_feature    97822..98478
                     /gene="pyrF"
                     /locus_tag="Smlt0099"
                     /note="HMMPfam hit to PF00215, Orotidine 5'-phosphate
                     decarboxylase / HUMP, score 1e-60"
                     /inference="protein motif:HMMPfam:PF00215"
     CDS             98939..99892
                     /transl_table=11
                     /locus_tag="Smlt0101"
                     /product="conserved hypothetical protein"
                     /note="Similar to codons 215 to the C-terminus of
                     Xanthomonas campestris pv. campestris hypothetical protein
                     xcc4130. UniProt:Q8P3E2 (537 aa) fasta scores:
                     E()=8.8e-44, 48.113% id in 318 aa"
                     /note="similarity:fasta; with=UniProt:Q8P3E2; Xanthomonas
                     campestris pv. campestris.; Hypothetical protein XCC4130.;
                     length=537; id 48.113%; ungapped id 49.675%; E()=8.8e-44;
                     318 aa overlap; query 1-315; subject 216-526"
                     /db_xref="EnsemblGenomes-Gn:Smlt0101"
                     /db_xref="EnsemblGenomes-Tr:CAQ43711"
                     /db_xref="UniProtKB/TrEMBL:B2FU59"
                     /protein_id="CAQ43711.1"
                     /translation="MSVAVRGRSARGWGLAAMLLLAVAACRESAQDPAKPAAEPVAAV
                     QAMALRLAEDDLVGYAKLSVPPSQYQRLQQAWTEGHSQWPLTELPLGDQLLPMLAALR
                     KPNASAELQRSFDRQLAGQAGAVRQAAQSMGNFGVQYLRHQKGYTPGQQAHYIALVET
                     LASWAQGAPISDRARARSTIAALVGAANKVGFDDEAGLQAAGMEGSLAQLAPFIHTLK
                     AVLGSYGLGVDDALRSVRGELLSVEGDNALVRLRYDLAGREMSLQLPLSRREGHWYLT
                     RTLADTDALLRKAEAARAAASPSPAEAPAEGGEAATPPPKP"
     sig_peptide     98939..99028
                     /locus_tag="Smlt0101"
                     /note="Signal peptide predicted for Smlt0101 by SignalP
                     2.0 HMM (Signal peptide probability 0.987) with cleavage
                     site probability 0.906 between residues 30 and 31"
                     /inference="protein motif:SignalP:2.0"
     CDS             99901..102528
                     /transl_table=11
                     /gene="plsB"
                     /locus_tag="Smlt0102"
                     /product="putative glycerol-3-phosphate acyltransferase"
                     /EC_number="2.3.1.15"
                     /note="similarity:fasta; with=UniProt:P0A7A7
                     (EMBL:AF106625;); Escherichia coli.; plsB;
                     Glycerol-3-phosphate acyltransferase (EC 2.3.1.15)
                     (GPAT).; length=806; id 39.003%; ungapped id 40.559%;
                     E()=4.1e-94; 782 aa overlap; query 50-821; subject 3-764"
                     /note="similarity:fasta; with=UniProt:Q8P3E3
                     (EMBL:AE012537;); Xanthomonas campestris pv. campestris.;
                     plsB; Glycerol-3-phosphate acyltransferase (EC 2.3.1.15)
                     (GPAT).; length=886; id 86.183%; ungapped id 87.171%;
                     E()=0; 883 aa overlap; query 1-873; subject 1-883"
                     /db_xref="EnsemblGenomes-Gn:Smlt0102"
                     /db_xref="EnsemblGenomes-Tr:CAQ43712"
                     /db_xref="GOA:B2FU60"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="InterPro:IPR022284"
                     /db_xref="InterPro:IPR028354"
                     /db_xref="UniProtKB/TrEMBL:B2FU60"
                     /protein_id="CAQ43712.1"
                     /translation="MSKQNPLPFPGEESQSTPADTVPASPSTGTGPNPVPPPVHARPA
                     GRRPLWARLLGRLVEPWLSLKIEPEDPGQYNDGRPVMYVLEDYGLSNALILDKACRQA
                     GLPSPLVPLAGDPTGRKRAYLALSRRSSSNSLIPEQRGAKTHSDSLAKVLQAHRVRDD
                     LDVHLVPVSIFVGRAPDKQSGWFAVLFSENWALVGRFRRLLAVLLNGRSTIVRFAPPI
                     SLRSIIDEGLEPERTVRKLQRVLRTHFRRIRESVIGPDLSTRRLLVDQVLAAEPVREA
                     IAAQAKRDNSKTADAWKKAHAYAWEIAADYSSPVVRSASFMLSHVWNRIYAGVLVHHL
                     DKFKAAAPGHEVVYVPSHRSHMDYLLLSYLLYDRGIVPPHIVAGINLNLPVVGTLLRK
                     GGAFFIRRSIRGNALYSAVLSEYVAQLVAGGYSLEYFVEGGRSRTGRLLQPKGGMISM
                     TLRAFLRQPRKPVLFQPIYIGYEKLMEGGSYLDELSGRPKEKESIWSLLWGIPKVLKQ
                     NYGQVVVNFGEPIALNDVLAEKAPEWKGEAVSEDEKPAWLSTTVDTLAERIQVRINGA
                     ADVNPINLLALALLSTPKHAMGEADLIAQIELCKTLLVEMPYSDRVTVTPHSPERIIA
                     HAEEINVLTRIKHPLGDVLSVSGDTAVLLSYFRNNVLHLFTASSWVACCFQNNRRMSR
                     TGLVQLGRTVYPFLQAELFLPWSEDEFAQRIDQTINVFVREGLLQNVNDDDGGILARN
                     TGQTDEVFRLRAIGHSLQQAFERYYIAISVLVKNGPGVLGAAELESLCQQAAQRLSLL
                     YAPAAPEFFDRTLFRGFIQKLRELRLVWPDENSKLLFDERLDAWAKDAKFILGRELRH
                     TIERVSPEAARPDEPAPQD"
     misc_feature    100882..101313
                     /gene="plsB"
                     /locus_tag="Smlt0102"
                     /note="HMMPfam hit to PF01553, Acyltransferase, score
                     5.3e-34"
                     /inference="protein motif:HMMPfam:PF01553"
     CDS             102902..103831
                     /transl_table=11
                     /locus_tag="Smlt0103"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q87B85; Xylella
                     fastidiosa (strain Temecula1/ATCC 700964).; Hypothetical
                     protein.; length=312; id 78.218%; ungapped id 79.264%;
                     E()=2.5e-94; 303 aa overlap; query 3-304; subject 13-312"
                     /db_xref="EnsemblGenomes-Gn:Smlt0103"
                     /db_xref="EnsemblGenomes-Tr:CAQ43713"
                     /db_xref="GOA:B2FU61"
                     /db_xref="InterPro:IPR011063"
                     /db_xref="InterPro:IPR012089"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/Swiss-Prot:B2FU61"
                     /protein_id="CAQ43713.1"
                     /translation="MEPMSAVISLPDPQPRAARDPRVAEREQHKLAKRLRRQVGEAIA
                     DFGMIEAGDKVMVCLSGGKDSYTLLDVLLQLQKKAPVPFELVAVNLDQKQPDFPEHVL
                     PEYLAGLGVPYHIIEQDTYSVVSRVIPEGKTMCSLCSRLRRGALYNYAETHGFTKIAL
                     GHHRDDMVATFFMNLFHHAKLSGMPPKLRSDDGKHVVIRPLAYVRESDIVDYAQARQF
                     PIIPCNLCGSQENLQRRQVGLMLKQWEKDHPGRIEQIARAMGEVRPSQLADTTLFDFM
                     ALGRRDDAPLPDAHAWLAGSPADADADPETPTV"
     misc_feature    103061..103675
                     /locus_tag="Smlt0103"
                     /note="HMMPfam hit to PF01171, PP-loop family, score
                     5e-12"
                     /inference="protein motif:HMMPfam:PF01171"
     repeat_region   103666..103673
                     /rpt_unit_seq="(cg)4"
     CDS             103868..104773
                     /transl_table=11
                     /gene="rdgC"
                     /locus_tag="Smlt0104"
                     /product="putative recombination-associated protein"
                     /note="similarity:fasta; with=UniProt:P36767; Escherichia
                     coli.; rdgC; Recombination-associated protein rdgC.;
                     length=303; id 33.333%; ungapped id 33.673%; E()=4.5e-28;
                     297 aa overlap; query 1-295; subject 2-297"
                     /note="similarity:fasta; with=UniProt:Q8PEW7; Xanthomonas
                     axonopodis pv. citri.; rdgC; Recombination-associated
                     protein rdgC.; length=301; id 81.728%; ungapped id
                     81.728%; E()=2.5e-98; 301 aa overlap; query 1-301; subject
                     1-301"
                     /db_xref="EnsemblGenomes-Gn:Smlt0104"
                     /db_xref="EnsemblGenomes-Tr:CAQ43714"
                     /db_xref="GOA:B2FU62"
                     /db_xref="InterPro:IPR007476"
                     /db_xref="UniProtKB/TrEMBL:B2FU62"
                     /protein_id="CAQ43714.1"
                     /translation="MFFRNLTFFRFPTTTDFSEVDTLLPHALLKPVGALEMNSRGFIS
                     PFGREEKELLSHRIAEHLWLTVGGEDKILPAAVVNDLLERKLEEIEEKEGRRPGGRER
                     KRMKDDLLHELLPRAFVKSSRNDAFIDLQHGYVAVDTSSRKTGEYFMSDIRGLLGSFP
                     AMPLNAEVAPRSILTGWIAGEPLPTGLSLGEECEMKDPVEGGAVVKCQHQELRCDEID
                     KHLDAGKQVTKLALIFEDNLSFVIGDDLIVRKLKFLDGALDQLEHADEDGRRAEFDAR
                     FALQSAEIRRLFLLLEEAFKLSKAD"
     misc_feature    103868..104767
                     /gene="rdgC"
                     /locus_tag="Smlt0104"
                     /note="HMMPfam hit to PF04381, Putative exonuclease, RdgC,
                     score 6.1e-154"
                     /inference="protein motif:HMMPfam:PF04381"
     CDS             104833..105612
                     /transl_table=11
                     /locus_tag="Smlt0105"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8P3H4; Xanthomonas
                     campestris pv. campestris.; Hypothetical protein XCC4097.;
                     length=263; id 72.308%; ungapped id 73.152%; E()=1.4e-71;
                     260 aa overlap; query 1-259; subject 3-260"
                     /db_xref="EnsemblGenomes-Gn:Smlt0105"
                     /db_xref="EnsemblGenomes-Tr:CAQ43715"
                     /db_xref="InterPro:IPR002725"
                     /db_xref="UniProtKB/TrEMBL:B2FU63"
                     /protein_id="CAQ43715.1"
                     /translation="MSRLLRRLISPTPPATVQRDTVRLRLEDAEIEVLRVRDPRARRI
                     KLSVDERGARLTLPPRASLVMGERFLEQHRDWLALQLRQYQGQGLPAPLQPGEDGVLP
                     LRGELLPLRWQEGRYARLEIDAHGACVQWPTRGGDATLRRLLREFYEAQTRADVGRWL
                     PKYLPTLPRAPSRLRLKVMSSQWGSLAPDGSMALDLALVLGRPEAFEYVLVHELCHLI
                     QPNHSPAFWHEVEQRFPAWREQRDYFQLEGRRLKAMLRQLL"
     misc_feature    104956..105573
                     /locus_tag="Smlt0105"
                     /note="HMMPfam hit to PF01863, Protein of unknown function
                     DUF45, score 3.4e-57"
                     /inference="protein motif:HMMPfam:PF01863"
     repeat_region   104987..104994
                     /rpt_unit_seq="(gc)4"
     repeat_region   105701..105708
                     /rpt_unit_seq="(gc)4"
     repeat_region   complement(105758..105878)
                     /rpt_family="R=4"
                     /inference="nucleotide motif:RepeatScout"
     repeat_region   complement(105760..105830)
                     /rpt_family="R=6"
                     /inference="nucleotide motif:RepeatScout"
     CDS             complement(105938..106804)
                     /transl_table=11
                     /locus_tag="Smlt0106"
                     /product="putative methylglyoxal synthase"
                     /note="Codons 150 to to C-terminus are similar to
                     agrobacterium tumefaciens (strain c58/atcc 33970). mgsa
                     UniProt:Q8UIV6 (EMBL:AE007869 (127 aa) fasta scores:
                     E()=1.4e-07, 45.217% id in 115 aa, and entire protein is
                     similar to bordetella avium (strain 197n). mgsa
                     UniProt:Q2L230 (EMBL:AM167904 (298 aa) fasta scores:
                     E()=3.2e-76, 70.318% id in 283 aa"
                     /note="similarity:fasta; with=UniProt:Q8UIV6
                     (EMBL:AE007869;); Agrobacterium tumefaciens (strain
                     C58/ATCC 33970).; mgsA; Methylglyoxal synthase (EC
                     4.2.3.3) (MGS).; length=127; id 45.217%; ungapped id
                     49.524%; E()=1.4e-07; 115 aa overlap; query 152-265;
                     subject 2-107"
                     /note="similarity:fasta; with=UniProt:Q2L230
                     (EMBL:AM167904;); Bordetella avium (strain 197N).; mgsA;
                     Putative methylglyoxal synthase (EC 4.2.3.3).; length=298;
                     id 70.318%; ungapped id 70.567%; E()=3.2e-76; 283 aa
                     overlap; query 1-282; subject 6-288"
                     /db_xref="EnsemblGenomes-Gn:Smlt0106"
                     /db_xref="EnsemblGenomes-Tr:CAQ43716"
                     /db_xref="GOA:B2FU64"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR018148"
                     /db_xref="UniProtKB/TrEMBL:B2FU64"
                     /protein_id="CAQ43716.1"
                     /translation="MRIGLAANRLHHHDARAALFRWLRVSEPGLRELGVSLHAVGRTH
                     DAIQRQGFLTGYAGLHRYPYGREGGLMKLVAEVVGMGPDRTLDGAVYLIDPVDPSSVF
                     PEATALKRQCVIHGKPFISTVATARDWIEVERIHAGLAADAGADDLHAFEGQTLALIA
                     HDAMKPAMLAFADEHFDVLARFGERVATGTTGQRLNELAWSRGWPSDTPWVTRYQSGP
                     MGGDAQIADRVLEGRCQRAIFFEDPHVARQHEADIQLLERAVTTVTDQAVCITAPRVA
                     ARWAAAAALRAG"
     repeat_region   complement(105953..105993)
                     /rpt_family="GC_rich"
                     /inference="nucleotide motif:RepeatScout"
     repeat_region   105953..105967
                     /rpt_unit_seq="(cgc)5"
     repeat_region   106423..106430
                     /rpt_unit_seq="(cg)4"
     repeat_region   106755..106762
                     /rpt_unit_seq="(gc)4"
     CDS             106963..109380
                     /transl_table=11
                     /locus_tag="Smlt0107"
                     /product="putative sensor histidine kinase transcriptional
                     regulatory protein two-component regulator"
                     /note="Codons 50 to the C-terminus are similar to codons
                     330 to 1090 of Bordetella bronchiseptica (Alcaligenes
                     bronchisepticus) BvgS virulence sensor protein bvgs
                     precursor (ec 2.7.13.3). UniProt:P26762 (1238 aa) fasta
                     scores: E()=1.8e-38, 30.670% id in 776 aa, and codons 400
                     to the C-terminus are similar to the N-terminus to codon
                     430 of Chromobacterium violaceum probable sensory box
                     histidine kinase/response regulator (ec 2.7.3.-).
                     UniProt:Q7NWX7 (552 aa) fasta scores: E()=2.7e-42, 40.244%
                     id in 410 aa"
                     /note="similarity:fasta; with=UniProt:P26762; Bordetella
                     bronchiseptica (Alcaligenes bronchisepticus).; bvgS;
                     Virulence sensor protein bvgS precursor (EC 2.7.13.3).;
                     length=1238; id 30.670%; ungapped id 33.102%; E()=1.8e-38;
                     776 aa overlap; query 55-791; subject 331-1088"
                     /note="similarity:fasta; with=UniProt:Q7NWX7;
                     Chromobacterium violaceum.; Probable sensory box histidine
                     kinase/response regulator (EC 2.7.3.-).; length=552; id
                     40.244%; ungapped id 41.457%; E()=2.7e-42; 410 aa overlap;
                     query 404-802; subject 15-423"
                     /db_xref="EnsemblGenomes-Gn:Smlt0107"
                     /db_xref="EnsemblGenomes-Tr:CAQ43717"
                     /db_xref="GOA:B2FU65"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="UniProtKB/TrEMBL:B2FU65"
                     /protein_id="CAQ43717.1"
                     /translation="MPIVNAAGLRAATAVVAGLLLPALAAAADCRTPLRIAWPADRAP
                     LSSSEQGQPRGLSAQYLKLLGAQRPLQMQPLPTAAIAEGTVPPDVQALLGWSRSQLPT
                     GWVASAPYVQLPQVIVRRRDASPVLGLEALRGGTVASPDPLSLVGALTEQASGVQLLP
                     PAPIDDALSLLGTGLVDAVVANLGEVEAALRHYQGEPLVIAAPAGIDDAPVLATVPAC
                     ADVIPVFERAVSQLTANEREAIRTAWLPNQPRHPPSASPLRWLVPASLTLLALMLVYA
                     FGYWRVHRESERRRVAAQRLQEVTSNLPAVVYQVRRSATGHYSFPQIAGDVQALFGIS
                     VETALIDHQRLLAAVHPDDRSRLMDTVDAAALARGPIDVTFRTRSPQGWRWVHSHGRP
                     LSLDSGDVEWSGYWIDVSGVQARTHALAEARRAAEQAALAKAHFLATMSHEIRTPMST
                     LLGMLERLEGSDLDHRQQQVLVTVGDAAQMLRQILDDVLHSQRLQALPPQLRPTSVAA
                     LVRAVQQLLMPVAASRGLHLRIQLDPELQAGSLADGLRLRQILFNLAGNALKFTEHGG
                     VDLQVQVLQQHDRGQRLRLQVSDSGVGISPERQQAVFAAYTQAEASTTRRFGGSGLGL
                     AICRELAASMEAELCLRSAPGKGTTVWLELDLDACELPAEALPLPAEAARPLSSARVL
                     VAEDHPTNLHLLEQRLHDLGLQVHACTDGRQAFEAWQARAFDLVITDCHMPHMDGFAL
                     ARAIRADACAVRAQVPIIALTASALGRTREACREAGIDHFLAKPVAAQELRGLLAVLL
                     APESMRQ"
     sig_peptide     106963..107037
                     /locus_tag="Smlt0107"
                     /note="Signal peptide predicted for Smlt0107 by SignalP
                     2.0 HMM (Signal peptide probability 0.998) with cleavage
                     site probability 0.647 between residues 25 and 26"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    107920..108198
                     /locus_tag="Smlt0107"
                     /note="HMMPfam hit to PF08447, PAS fold, score 9.3e-07"
                     /inference="protein motif:HMMPfam:PF08447"
     misc_feature    108256..108453
                     /locus_tag="Smlt0107"
                     /note="HMMPfam hit to PF00512, His Kinase A
                     (phosphoacceptor) domain, score 6.9e-17"
                     /inference="protein motif:HMMPfam:PF00512"
     misc_feature    108586..108933
                     /locus_tag="Smlt0107"
                     /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
                     gyrase B-, and HS, score 4.3e-34"
                     /inference="protein motif:HMMPfam:PF02518"
     misc_feature    108997..109347
                     /locus_tag="Smlt0107"
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 1.8e-29"
                     /inference="protein motif:HMMPfam:PF00072"
     CDS             complement(109366..110811)
                     /transl_table=11
                     /gene="gltD"
                     /locus_tag="Smlt0108"
                     /product="putative glutamate synthase [nadph] small chain"
                     /EC_number="1.4.1.13"
                     /note="similarity:fasta; with=UniProt:P09832; Escherichia
                     coli.; gltD; Glutamate synthase [NADPH] small chain (EC
                     1.4.1.13) (Glutamate synthase subunit beta) (NADPH-GOGAT)
                     (GLTS beta chain).; length=471; id 57.829%; ungapped id
                     59.570%; E()=1.1e-95; 479 aa overlap; query 4-479; subject
                     2-469"
                     /note="similarity:fasta; with=UniProt:Q8PEE9; Xanthomonas
                     campestris pv. campestris.; gltD; Glutamate synthase, beta
                     subunit.; length=493; id 86.902%; ungapped id 87.265%;
                     E()=1.1e-151; 481 aa overlap; query 1-479; subject 1-481"
                     /db_xref="EnsemblGenomes-Gn:Smlt0108"
                     /db_xref="EnsemblGenomes-Tr:CAQ43718"
                     /db_xref="GOA:B2FU66"
                     /db_xref="InterPro:IPR006006"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="InterPro:IPR028261"
                     /db_xref="UniProtKB/TrEMBL:B2FU66"
                     /protein_id="CAQ43718.1"
                     /translation="MSRKHAFQFLDLPRTMPQRIPVELRTSGDWGELYGKFGKEDAQY
                     QAGRCLDCGNPYCSWKCPVHNAIPQWLQLVQENRIHEAATLCHSTNPLPEVCGRVCPQ
                     DRLCEGSCTLEEFGAVTIGAVEKYIVDTALATGWRPDLGAVQPTGRSVAVIGAGPAGL
                     ACADRLARAGIAAVVYDRYEQIGGLLQFGIPSFKLDKDVIHRRREVLEGMGVQFRLGV
                     EIGRDLSVQQLLDSHDAVFVGTGAYRYTDGGLDGQDLKGVLPALPFLVQNSRIVGGDD
                     PKGRPIAGWEDSIALPDLNGKRVVVLGGGDTGMDCVRSAVRLGAAKVTCAYRRDEANM
                     PGSAREVANAREEGVRFLFNRQPLSIEAGADDEVIGVTVVETRLGEPDANGRQNAVPI
                     EGSESLLEADVVIIAFGFSPTVPAWLAEHGVEGRSNGRIVAGGKDRLPFQTAHPRLFA
                     GGDAVRGADLVVTAVAEGRDAAASIIRLLAH"
     misc_feature    complement(109435..110367)
                     /gene="gltD"
                     /locus_tag="Smlt0108"
                     /note="HMMPfam hit to PF07992, Pyridine
                     nucleotide-disulphide oxidoreduc, score 1.4e-06"
                     /inference="protein motif:HMMPfam:PF07992"
     misc_feature    complement(109585..109920)
                     /gene="gltD"
                     /locus_tag="Smlt0108"
                     /note="HMMPfam hit to PF00070, Pyridine
                     nucleotide-disulphide oxidoreduc, score 2.8e-06"
                     /inference="protein motif:HMMPfam:PF00070"
     repeat_region   109794..109801
                     /rpt_unit_seq="(cg)4"
     repeat_region   110306..110313
                     /rpt_unit_seq="(gc)4"
     CDS             complement(110896..115350)
                     /transl_table=11
                     /gene="gltB"
                     /locus_tag="Smlt0109"
                     /product="putative glutamate synthase [nadph] large chain
                     precursor"
                     /EC_number="1.4.1.13"
                     /note="similarity:fasta; with=UniProt:P09831; Escherichia
                     coli.; gltB; Glutamate synthase [NADPH] large chain
                     precursor (EC 1.4.1.13) (Glutamate synthase subunit alpha)
                     (NADPH-GOGAT) (GLTS alpha chain).; length=1517; id
                     53.504%; ungapped id 54.050%; E()=0; 1484 aa overlap;
                     query 9-1484; subject 33-1509"
                     /note="similarity:fasta; with=UniProt:Q8PEE8; Xanthomonas
                     campestris pv. campestris.; gltB; Glutamate synthase,
                     alpha subunit.; length=1490; id 85.848%; ungapped id
                     86.312%; E()=0; 1491 aa overlap; query 1-1484; subject
                     1-1490"
                     /db_xref="EnsemblGenomes-Gn:Smlt0109"
                     /db_xref="EnsemblGenomes-Tr:CAQ43719"
                     /db_xref="GOA:B2FU67"
                     /db_xref="InterPro:IPR002489"
                     /db_xref="InterPro:IPR002932"
                     /db_xref="InterPro:IPR006982"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:B2FU67"
                     /protein_id="CAQ43719.1"
                     /translation="MAPRNRQGLYDPRSERDACGFGMVAQLDDQPSRLLVDTAIAALS
                     RMTHRGGVAADGLTGDGCGLLLRRPDAFLKLLASEAGITTAARFAAGLVFLPHDADAA
                     QACRAQLQAQVEAVGCKVAGWREVPTDDSVCGQLARDTLPRIEQVFVDAGVGQDDAGF
                     ALALFLARRRSEQQLREHADFYVTTLTPDAISYKGMVLPDKLSRFFPDLQRRELASSA
                     IVFHQRFSTNTLPRWPLAHPFRMLAHNGEINTIEGNRRWAQARSKVWKTPRFHIGEFD
                     PVISMHGSDSQSLDNMLELMVAGGMELIQALRILVPPATQSLEFKDPDLAAFYEFHGL
                     NSEPWDGPAGIVACDSRYAVCTLDRNGLRPARWMLTADRHFLVASEAGVWEVPTERVV
                     RKGKLGPGEMIAIDLKRGDLLDSDAVDRINRGRAPYKQWLQQGVTYLQTELIDPSLVE
                     EPFDEGTLRSYHKLYQLSSEEVEQVLRPLAETEQEATGSMGDDTPMAVLSQRSRPLYD
                     YFRQAFAQVTNPPIDPLREDCAMSLSTQLGKETNIFHAGPETVNHVILNSPVLSQRKL
                     RQLLKMEQYVQANRLLDLSYSEDEGLRAGIERICAEAEQAARDGMVMLLLSDRYPVAG
                     RPMVHALLATSAIHHHLSRLGLRCDVNLIVETGTARDPHHMACLLGFGATAVYPYLAY
                     QTLFDLGRRGILKLSKGGEQSQIGRRYRKGVYKGLSKIISKMGICTVASYRGAQLFEI
                     IGLEPEVVDLCFPDTASRIGGAGFARLDADARELCAQAWDAQQDVDVGGLLKYVHGGE
                     YHMYNPDVVTTLQRAARSGDPRAWQQYCDAVHARPPSALRDLLELVPAATPVPLDEVA
                     PASTLFPRFDTAAISLGALSPEAHEALAIAMNRLGGRSNSGEGGEDPARYGTAKRSKI
                     KQVASGRFGVTAEYLVNAEVLQIKVAQGAKPGEGGQLPGHKVNELIARLRYARPGIGL
                     ISPPPHHDIYSIEDLAQLIYDLKQVNPTALVSVKLVSHAGVGTIAAGVVKAGADLITI
                     SGHDGGTGASPVSSIRYAGVPWELGVAEAHQALLANDLRGRTLLQTDGGLKTGLDVVK
                     AALLGADSFGFGTAPMIVLGCKYLRICHLNNCATGVATQDERLRENHFTGQPERVENF
                     FRLLAEEVRGWLAYLGARSLEEIVGRTDLLRQIEAAPRDGVRVDLSRLLADARYEGSH
                     CAAQRLYESPDGLATQMDGLLAPAIEHKRGGEHRFLIHNTDRSIGTRLAGAVARAHGN
                     QGMAEAPLELRFRGSAGQSFGAFNVGGLHLEVEGEANDYVGKGMAGGRLVVRPPRGAR
                     FEARSTAIIGNTCLYGATGGELFAAGRAGERFAVRNSGALAVVEGAGDHCCEYMTDGV
                     VLVLGKVGLNFGAGFTGGLAYVLDVDRDFVDRYNHELIDIHRVSAEGFENYRQHLHRL
                     IGRHRELTGSIWAQQILDEFRDYIGKFWLVKPKAASIESLTETLRRAA"
     misc_feature    complement(111043..111642)
                     /gene="gltB"
                     /locus_tag="Smlt0109"
                     /note="HMMPfam hit to PF01493, GXGXG motif, score 3e-94"
                     /inference="protein motif:HMMPfam:PF01493"
     repeat_region   111391..111398
                     /rpt_unit_seq="(gc)4"
     repeat_region   111573..111582
                     /rpt_unit_seq="(gc)5"
     misc_feature    complement(111859..112953)
                     /gene="gltB"
                     /locus_tag="Smlt0109"
                     /note="HMMPfam hit to PF01645, Conserved region in
                     glutamate synthas, score 7.2e-220"
                     /inference="protein motif:HMMPfam:PF01645"
     repeat_region   112419..112430
                     /rpt_unit_seq="(gcg)4"
     misc_feature    complement(113116..113979)
                     /gene="gltB"
                     /locus_tag="Smlt0109"
                     /note="HMMPfam hit to PF04898, Glutamate synthase central
                     domain, score 2.3e-160"
                     /inference="protein motif:HMMPfam:PF04898"
     repeat_region   113526..113533
                     /rpt_unit_seq="(cg)4"
     misc_feature    complement(114208..115296)
                     /gene="gltB"
                     /locus_tag="Smlt0109"
                     /note="HMMPfam hit to PF00310, Glutamine amidotransferases
                     class-II, score 1.3e-169"
                     /inference="protein motif:HMMPfam:PF00310"
     CDS             116026..117081
                     /transl_table=11
                     /locus_tag="Smlt0110"
                     /product="putative viral-like DNA topoisomerase"
                     /note="similarity:fasta; with=UniProt:P68698
                     (EMBL:AY243312;); Vaccinia virus (strain Western
                     Reserve/WR) (VACV).; TOP1; DNA topoisomerase 1 (EC
                     5.99.1.2) (DNA topoisomerase I) (Late protein H7).;
                     length=314; id 23.288%; ungapped id 25.856%; E()=0.0043;
                     292 aa overlap; query 31-311; subject 7-280"
                     /note="similarity:fasta; with=UniProt:Q8PEE6
                     (EMBL:AE012097;); Xanthomonas campestris pv. campestris.;
                     Hypothetical protein XCC0034.; length=394; id 72.917%;
                     ungapped id 73.134%; E()=6.7e-96; 336 aa overlap; query
                     9-343; subject 17-352"
                     /db_xref="EnsemblGenomes-Gn:Smlt0110"
                     /db_xref="EnsemblGenomes-Tr:CAQ43720"
                     /db_xref="GOA:B2FU68"
                     /db_xref="InterPro:IPR001631"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013500"
                     /db_xref="InterPro:IPR014711"
                     /db_xref="InterPro:IPR027362"
                     /db_xref="UniProtKB/TrEMBL:B2FU68"
                     /protein_id="CAQ43720.1"
                     /translation="MPTPSTPERQAARAAGLRYVDDTQPGISRRRAGKGFSYRDADGH
                     AIRDATTLQRIRALAIPPAYTAVWICAHANGHLQATGRDARGRKQYRYHPDWARERDA
                     GKFDRIIAFGEALPTLRRRLSRDLKRPGFPKEKVLAMVVALLADTLVRVGNETYAQQN
                     RSFGLTTLRNRHLELLRGGRVRMRFRGKSGQLQEVTVGDRRLGLLVRRLQQLPGQALF
                     QYRDDDGALQPVDSGAVNDYLREVMGEDFTAKDFRTWGGTVAAVQAFAATELPEPASQ
                     RALAQAQRAVVCEVASLLGNTPAVCRKAYIDPCVFAGWERGELATLAGLRGPRQWEQA
                     TLRVLRRARRLSRSRSR"
     repeat_region   116059..116066
                     /rpt_unit_seq="(gc)4"
     repeat_region   116853..116860
                     /rpt_unit_seq="(gc)4"
     CDS             complement(117059..117442)
                     /transl_table=11
                     /locus_tag="Smlt0111"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PEE4; Xanthomonas
                     campestris pv. campestris.; Hypothetical protein XCC0036.;
                     length=156; id 54.135%; ungapped id 60.000%; E()=5.4e-12;
                     133 aa overlap; query 8-127; subject 24-156"
                     /db_xref="EnsemblGenomes-Gn:Smlt0111"
                     /db_xref="EnsemblGenomes-Tr:CAQ43721"
                     /db_xref="UniProtKB/TrEMBL:B2FU69"
                     /protein_id="CAQ43721.1"
                     /translation="MMCTAFIPPPRAPSHPARNHTRNASMKHAIATAAVCFALAACSS
                     TPVAQVQPIDGVISGQCHSDRVRGALGLAASDATVARARVDSDSLHVRVLRHDGPRVP
                     PASEGGDRLTIEKGRTNNITAIYCG"
     sig_peptide     complement(117299..117442)
                     /locus_tag="Smlt0111"
                     /note="Signal peptide predicted for Smlt0111 by SignalP
                     2.0 HMM (Signal peptide probability 0.988) with cleavage
                     site probability 0.561 between residues 48 and 49"
                     /inference="protein motif:SignalP:2.0"
     repeat_region   117565..117572
                     /rpt_unit_seq="(c)8"
     CDS             117870..118703
                     /transl_table=11
                     /locus_tag="Smlt0112"
                     /product="putative short-chain dehydrogenase/reductase"
                     /note="Similar, but truncated at the N-terminus, to
                     rhizobium loti (mesorhizobium loti). oxidoreductase,
                     short-chain dehydrogenase/reductase family. UniProt:Q987Y1
                     (EMBL:BA000012 (287 aa) fasta scores: E()=3.2e-57, 60.073%
                     id in 273 aa, and similar to entire protein of bordetella
                     bronchiseptica (alcaligenes bronchisepticus). putative
                     short-chain dehydrogenase. UniProt:Q7WIK5 (EMBL:BX640445
                     (335 aa) fasta scores: E()=9e-64, 65.091% id in 275 aa"
                     /note="similarity:fasta; with=UniProt:Q987Y1
                     (EMBL:BA000012;); Rhizobium loti (Mesorhizobium loti).;
                     Oxidoreductase, short-chain dehydrogenase/reductase
                     family.; length=287; id 60.073%; ungapped id 60.073%;
                     E()=3.2e-57; 273 aa overlap; query 2-274; subject 14-286"
                     /note="similarity:fasta; with=UniProt:Q7WIK5
                     (EMBL:BX640445;); Bordetella bronchiseptica (Alcaligenes
                     bronchisepticus).; Putative short-chain dehydrogenase.;
                     length=335; id 65.091%; ungapped id 65.091%; E()=9e-64;
                     275 aa overlap; query 1-275; subject 59-333"
                     /db_xref="EnsemblGenomes-Gn:Smlt0112"
                     /db_xref="EnsemblGenomes-Tr:CAQ43722"
                     /db_xref="GOA:B2FU70"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:B2FU70"
                     /protein_id="CAQ43722.1"
                     /translation="MPAQQLAKPGHEHELELAPRFLAPDYTGSGKLQGMRAIVTGGDS
                     GIGRAVAVLFAREGADVAVLHLDEAEDADITRQHVEREGGRCVVIAGDVRDPRFCDKA
                     VKQVAKAFGGIDILVNNAAFQLHCERLEDLEDAHLQETLQTNIGGYIQMARAVLPHLG
                     EGASIINTGSETGIFGSKALIDYSATKGAIHAFTKSLASQLLPRGIRVNCVAPGPVWT
                     PLNPADKPAQDVAEFGKDSDMGRPAQPEELSPAYVFLASPACASYISGVILPVMGGPR
                     G"
     misc_feature    117972..118475
                     /locus_tag="Smlt0112"
                     /note="HMMPfam hit to PF00106, short chain dehydrogenase,
                     score 9.5e-22"
                     /inference="protein motif:HMMPfam:PF00106"
     repeat_region   118323..118330
                     /rpt_unit_seq="(gc)4"
     CDS             118826..120241
                     /transl_table=11
                     /locus_tag="Smlt0113"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PNA9; Xanthomonas
                     axonopodis pv. citri.; Hypothetical protein XAC1164.;
                     length=437; id 46.819%; ungapped id 55.422%; E()=1.3e-26;
                     393 aa overlap; query 14-352; subject 1-386"
                     /db_xref="EnsemblGenomes-Gn:Smlt0113"
                     /db_xref="EnsemblGenomes-Tr:CAQ43723"
                     /db_xref="UniProtKB/TrEMBL:B2FU71"
                     /protein_id="CAQ43723.1"
                     /translation="MPEMDISAAADEVVALLRQNDARGAAARLEALHNGQRAVVQESL
                     DRYIAARGATELEALRRSGGVSATDAATVKPMLDRLSDATRPPRMPDAAETAGLSQAQ
                     QYDVYGSIVAQRGNAAANDAMATQDRVVLGLRDENRTTEARGRGVYDDRIVVLWKDAQ
                     DHGHVREFNQATTEPTAQYDGHAKTTPRSPGFGNVAPRTKTEGEDVNGDRVKDLGRLG
                     EGTTEMRATTHPRNGHPDEFALRPSQAAITAGAGRVERDTNGDGWFDARDTQGVQHLN
                     DTFKIHRGSRSNTDSAGCQTIGGGEYDDFVATVRGTPGQNRWQYVLTSVAPGQARGLG
                     QDTPLAANDDPRQPQHRDHALQQQISTHLQALGGRYAEHADDYSLVLLREAKAAGITR
                     VDQIVASNPSGGRAAGETLFLVQGNPGDPAAVRAGVNAAEVRETAVETSLRQLQQQAR
                     EQGAPVPAPAQQHEAPAMGGR"
     CDS             120245..121057
                     /transl_table=11
                     /locus_tag="Smlt0114"
                     /product="conserved hypothetical protein"
                     /note="Similar, but extended at the N-terminus, to
                     Xanthomonas axonopodis pv. citri hypothetical protein
                     xac1163. UniProt:Q8PNB0 (224 aa) fasta scores:
                     E()=4.8e-10, 30.435% id in 230 aa, and similar, but
                     truncated at the N-terminus, to Xanthomonas axonopodis pv.
                     citri hypothetical protein xac1162. UniProt:Q8PNB1 (348
                     aa) fasta scores: E()=1.4e-08, 30.435% id in 276 aa"
                     /note="similarity:fasta; with=UniProt:Q8PNB0; Xanthomonas
                     axonopodis pv. citri.; Hypothetical protein XAC1163.;
                     length=224; id 30.435%; ungapped id 33.816%; E()=4.8e-10;
                     230 aa overlap; query 55-268; subject 1-223"
                     /note="similarity:fasta; with=UniProt:Q8PNB1; Xanthomonas
                     axonopodis pv. citri.; Hypothetical protein XAC1162.;
                     length=348; id 30.435%; ungapped id 34.568%; E()=1.4e-08;
                     276 aa overlap; query 4-253; subject 57-325"
                     /db_xref="EnsemblGenomes-Gn:Smlt0114"
                     /db_xref="EnsemblGenomes-Tr:CAQ43724"
                     /db_xref="UniProtKB/TrEMBL:B2FU72"
                     /protein_id="CAQ43724.1"
                     /translation="MVRLPLMSGLPWVLLLACSACAPAGEYTVPVAPAAKPEAKPETL
                     PAQAGPTERGLPALPEASGSAHSGGRYAALPEPARRVLAQLKCNVESAGNAQVLSIPA
                     QGGQQDFMVTDRSGPRFRYWMRSFSSNGGTTGYLVQLQDCPATTTGMRAYIAQGAAPL
                     QDVTASLLAQAELPDTATMTAYQDRGAGDLFAFIGQLDKVPVVRWVAEADPEQPLADD
                     ARSFDHGNAIHGGFLRWNQDHFEVARTVPAGLWPCDDSPLLPCRGDPFVTGR"
     sig_peptide     120245..120316
                     /locus_tag="Smlt0114"
                     /note="Signal peptide predicted for Smlt0114 by SignalP
                     2.0 HMM (Signal peptide probability 0.993) with cleavage
                     site probability 0.645 between residues 24 and 25"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(120992..122143)
                     /transl_table=11
                     /gene="ampC"
                     /locus_tag="Smlt0115"
                     /product="putative beta-lactamase precursor
                     (cephalosporinase)"
                     /EC_number="3.5.2.6"
                     /note="similarity:fasta; with=UniProt:P45460; Yersinia
                     enterocolitica.; ampC; Beta-lactamase precursor (EC
                     3.5.2.6) (Cephalosporinase).; length=388; id 24.935%;
                     ungapped id 28.657%; E()=1e-08; 385 aa overlap; query
                     1-347; subject 2-374"
                     /note="similarity:fasta; with=UniProt:Q7NC81; Gloeobacter
                     violaceus.; Gll3098 protein.; length=364; id 31.806%;
                     ungapped id 34.302%; E()=9.3e-26; 371 aa overlap; query
                     4-365; subject 6-358"
                     /db_xref="EnsemblGenomes-Gn:Smlt0115"
                     /db_xref="EnsemblGenomes-Tr:CAQ43725"
                     /db_xref="GOA:B2FU73"
                     /db_xref="InterPro:IPR001466"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="UniProtKB/TrEMBL:B2FU73"
                     /protein_id="CAQ43725.1"
                     /translation="MSRPMLRVLLMLISALPFAAVSASQDQANDQTRRLIRQIMLEQR
                     IPGLQIAVVKDGQTVLSEAYGLANVENGVLASRDTRFPLNSATKAFTGVATAQLAQQG
                     QLDLDAPASRYLDDLPPAWRDVRIHQLLAHTSGLPDILDAKGLLGGGSEAQAWAAVTA
                     QPLEAEPGQRFAYNQTNYVLLARIIAKQSGMPYERFLATGQFSSARMARTTFGDSYDL
                     IPDAATMYSLAPRATDAADAPSRLSHWFYDIPPSLWAGGGILTTADDTARWLVALTEG
                     RLLPETALRRMWSAERLADGRAGPWAGGWPVLRASPDLQVAGIGGARSAFVVYPERGV
                     AVVVLTNLVGANPQQFIPRIADFYARDASTPSHERVAPARQQRAVIAGP"
     misc_feature    complement(121061..122050)
                     /gene="ampC"
                     /locus_tag="Smlt0115"
                     /note="HMMPfam hit to PF00144, Beta-lactamase, score
                     1.6e-68"
                     /inference="protein motif:HMMPfam:PF00144"
     repeat_region   121526..121533
                     /rpt_unit_seq="(gc)4"
     sig_peptide     complement(122060..122143)
                     /gene="ampC"
                     /locus_tag="Smlt0115"
                     /note="Signal peptide predicted for Smlt0115 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.467 between residues 28 and 29"
                     /inference="protein motif:SignalP:2.0"
     CDS             122305..122691
                     /transl_table=11
                     /locus_tag="Smlt0116"
                     /product="putative transcriptional regulatory protein"
                     /note="similarity:fasta; with=UniProt:P06555; Bacillus
                     licheniformis.; blaI; Penicillinase repressor (Regulatory
                     protein blaI) (Beta-lactamase repressor protein).;
                     length=128; id 22.951%; ungapped id 22.951%; E()=0.039;
                     122 aa overlap; query 6-127; subject 7-128"
                     /note="similarity:fasta; with=UniProt:Q8PR94; Xanthomonas
                     axonopodis pv. citri.; mecI; Methicillin resistance
                     protein.; length=128; id 75.591%; ungapped id 75.591%;
                     E()=3.2e-31; 127 aa overlap; query 1-127; subject 1-127"
                     /db_xref="EnsemblGenomes-Gn:Smlt0116"
                     /db_xref="EnsemblGenomes-Tr:CAQ43726"
                     /db_xref="GOA:B2FU74"
                     /db_xref="InterPro:IPR005650"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:B2FU74"
                     /protein_id="CAQ43726.1"
                     /translation="MRGKTIGDQELALLQYIDEHAPATVGEVASGYGEARGLARSTVL
                     TMMERLRAKGYLQRRQQDGVYRYQATRGPQSVLQGAVAQFVDNTLQGSVSPFVAYLSQ
                     RQQVSDNELAELEALVAQLQSRRHEG"
     misc_feature    122320..122664
                     /locus_tag="Smlt0116"
                     /note="HMMPfam hit to PF03965, Penicillinase repressor,
                     score 1.1e-37"
                     /inference="protein motif:HMMPfam:PF03965"
     CDS             122695..124692
                     /transl_table=11
                     /locus_tag="Smlt0117"
                     /product="putative transmembrane BlaR protein"
                     /note="similarity:fasta; with=UniProt:Q8PED5; Xanthomonas
                     campestris pv. campestris.; Ankyrin-like protein.;
                     length=570; id 44.254%; ungapped id 46.995%; E()=1.2e-45;
                     583 aa overlap; query 3-568; subject 2-567"
                     /db_xref="EnsemblGenomes-Gn:Smlt0117"
                     /db_xref="EnsemblGenomes-Tr:CAQ43727"
                     /db_xref="GOA:B2FU75"
                     /db_xref="InterPro:IPR008756"
                     /db_xref="UniProtKB/TrEMBL:B2FU75"
                     /protein_id="CAQ43727.1"
                     /translation="MDTTMLIPMLERLGWTSLQTVLLVALVYGLCRALPSLSAATRCR
                     LWWLVSLQAVLGLFWSQPLQLAWLPAPQAVAMTATDVAADIVYPLAPEASAQLLAAMP
                     LPAAEVPAVAWWAVALAALWLSGVLMMALRTFGEWRRCRALLAAAYPCEDEALVQALQ
                     LASDAHGVRRAPRLWMSMQVDAPQLVGPFRPVLLLPAGDNVLQGDALDLALTHELQHL
                     QRRDLQWGLLPALAQHLFFFHPLLRLSVREYAQAREEAVDAAVVGQHGASRQAYGRLL
                     LQLGVAPQPHLGVASAAPSTTSLKRRLLSLQSHRSCPRLLAVALTAVVVVVGVAPMRL
                     VAAPVPPAPPAPPAAPTAVVPPPPKAPEAPPAPASAARVPAEPVAPAPPAEPADMEEP
                     SGPDDADVADVADVDDAAGMDEDHDGTTTTSSITTYGRLDLGKSPREAFVLVDGDSTF
                     ANGGMDDVMVARRQLGKGPALWFRQGDKRYVVRDPMLIQSLQRAYAGAADLGRQQSEL
                     GRQQSALGRQQGDLGKQMGEMGRLQGEEARRLALAAAEAARSAMAAHDINREAAAEAA
                     KAARGATNDAAVAREAAREAAAEARRAMQEVDNETARASRTRAMQRLASQQSELASRQ
                     TTLGSQQAALGERQARVHAQASQQAQQVIARALASGKAERL"
     misc_feature    order(122737..122796,122830..122898,123019..123087,
                     123637..123705)
                     /locus_tag="Smlt0117"
                     /note="4 probable transmembrane helices predicted for
                     Smlt0117 by TMHMM2.0 at aa 15-34, 46-68, 109-131 and
                     315-337"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    123241..123525
                     /locus_tag="Smlt0117"
                     /note="HMMPfam hit to PF05569, BlaR1 peptidase M56, score
                     5.1e-30"
                     /inference="protein motif:HMMPfam:PF05569"
     repeat_region   123269..123280
                     /rpt_unit_seq="(tgc)4"
     repeat_region   123661..123675
                     /rpt_unit_seq="(gtg)5"
     repeat_region   complement(123703..123768)
                     /rpt_family="GC_rich"
                     /inference="nucleotide motif:RepeatScout"
     repeat_region   123804..123811
                     /rpt_unit_seq="(cg)4"
     repeat_region   124653..124660
                     /rpt_unit_seq="(cg)4"
     repeat_region   124721..124728
                     /rpt_unit_seq="(g)8"
     CDS             complement(124759..125073)
                     /transl_table=11
                     /locus_tag="Smlt0118"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q88K30; Pseudomonas
                     putida (strain KT2440).; Hypothetical protein.;
                     length=124; id 33.333%; ungapped id 35.417%; E()=2.7e-05;
                     102 aa overlap; query 6-104; subject 26-124"
                     /db_xref="EnsemblGenomes-Gn:Smlt0118"
                     /db_xref="EnsemblGenomes-Tr:CAQ43728"
                     /db_xref="InterPro:IPR021719"
                     /db_xref="UniProtKB/TrEMBL:B2FU76"
                     /protein_id="CAQ43728.1"
                     /translation="MRLNPLVLLAILPLAACSHAGSSTSHDPAPAPVADAAHECKPEA
                     LDAFTGRTADEATIKKLVADSGARNARVVKPGMAVTMDFRQDRVTVQVDAQNRIERAS
                     CG"
     sig_peptide     complement(125014..125073)
                     /locus_tag="Smlt0118"
                     /note="Signal peptide predicted for Smlt0118 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.697 between residues 20 and 21"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(125140..126063)
                     /transl_table=11
                     /locus_tag="Smlt0119"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PEC8; Xanthomonas
                     campestris pv. campestris.; Hypothetical protein XCC0053.;
                     length=321; id 66.454%; ungapped id 70.034%; E()=5.6e-71;
                     313 aa overlap; query 1-302; subject 10-317"
                     /db_xref="EnsemblGenomes-Gn:Smlt0119"
                     /db_xref="EnsemblGenomes-Tr:CAQ43729"
                     /db_xref="GOA:B2FU77"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:B2FU77"
                     /protein_id="CAQ43729.1"
                     /translation="MAANDARQPPAERSVFAWVEQEIRHKPTGAAVSTPAPAPLRRPE
                     VGGLHRLLGLRSRGGAAPARASAQDRQLPGEEIAPGLFLIESLQPQPIPTAPLSLAFA
                     KREDQHVAARDLLFFDTETTGLAGGTGTRAFMIGAADWHVCPQRGEGLRIRQLLMSTM
                     AAEEAMLATFASWLQPSTVFCSYNGRSYDAPLLKARYRLARQRDPITALDHVDLLYPT
                     RRRYRGTWENCRLSTIERQLLRVVREDDLPGSEAPGAWLRFLRGGDAVNLRRVADHNH
                     QDVVTLALLLQRLVHEEQRERETLALALVGQ"
     repeat_region   125151..125168
                     /rpt_unit_seq="(ccagcg)3"
     CDS             complement(126165..128654)
                     /transl_table=11
                     /gene="lhr"
                     /locus_tag="Smlt0120"
                     /product="putative helicase"
                     /note="similarity:fasta; with=UniProt:Q6H8N2;
                     Halobacterium volcanii (Haloferax volcanii).; lhr;
                     Putative helicase Lhr.; length=918; id 28.453%; ungapped
                     id 32.595%; E()=2.4e-11; 362 aa overlap; query 92-421;
                     subject 71-418"
                     /note="similarity:fasta; with=UniProt:Q8PEC7; Xanthomonas
                     campestris pv. campestris.; ATP-dependent RNA helicase.;
                     length=802; id 88.510%; ungapped id 88.959%; E()=0; 792 aa
                     overlap; query 29-816; subject 1-792"
                     /db_xref="EnsemblGenomes-Gn:Smlt0120"
                     /db_xref="EnsemblGenomes-Tr:CAQ43730"
                     /db_xref="GOA:B2FU78"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018973"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B2FU78"
                     /protein_id="CAQ43730.1"
                     /translation="MAYELAKRTADAEQKLATRDGLPARDGALLSARLQRRYQDRITG
                     SFAIPGREGRYAPIPDSVPPALAAALKARGIEQLYSHQAEAWEASQRGEHVAIVTPTA
                     SGKSLCYTLPVVSAAMQDKAKALYLFPTKALAQDQVAELLELNRAGDLGVKAFTFDGD
                     TPGDARQAIRLHGDIVVSNPDMLHQAILPHHTKWAQFFENLRYIVIDEVHTYRGVFGS
                     HVTNVLRRLKRICAFYGVQPQFILCSATIGNPQAHAEALIEAPVTAITESGAPSGPKQ
                     VLLWNPPVINPDLGLRASARSQSNRIARIAIKSGLKTLVFAQTRLMVEVLTKYLKDIF
                     DHDPRKPPRIRAYRGGYLPTERRETERAMRAGNIDGIVSTSALELGVDIGSLDVVILN
                     GYPGSVAATWQRFGRAGRRQQPALGVMVASSQPLDQYVVRHPDFFAEASPEHARIAPD
                     QPLILFDHIRCAAFELPFRVGDGFGPIDPEVFLEALAETEVIHREGERWEWIADSYPA
                     NAVSLRAVADGNFVVVDRSDGRQQIIAEVDYSAAALTLYEGAIHMVQSTPYQVETLDW
                     EGRKAYVTRTHVDYYTDSIDFTKLKVLDRFDGGVAGRGDSHHGEVHVVRRVAGYKKIR
                     YYTHENIGYGPVNLPDQELHTTAVWWQLPQALLLRAFASKQDALDGFLGAAYALHIVA
                     TVAVMADARDLQKSVGNGDGSWFAIADQSGRGQLRGSEGDPGGVELLQEFVPTVYLYD
                     NFPGGVGLSEPLWQRQAELVQGARELVQRCDCRAGCPACVGPVLAAQEDDETSPRALA
                     LRVLDLFDADACQHVPDVVVTTRDPMELLAP"
     repeat_region   126266..126273
                     /rpt_unit_seq="(gc)4"
     repeat_region   126362..126369
                     /rpt_unit_seq="(cg)4"
     misc_feature    complement(127419..127646)
                     /gene="lhr"
                     /locus_tag="Smlt0120"
                     /note="HMMPfam hit to PF00271, Helicase conserved
                     C-terminal domain, score 1.5e-14"
                     /inference="protein motif:HMMPfam:PF00271"
     misc_feature    complement(127893..128420)
                     /gene="lhr"
                     /locus_tag="Smlt0120"
                     /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
                     score 3.6e-39"
                     /inference="protein motif:HMMPfam:PF00270"
     repeat_region   128556..128563
                     /rpt_unit_seq="(gc)4"
     CDS             128872..129384
                     /transl_table=11
                     /locus_tag="Smlt0121"
                     /product="conserved hypothetical protein"
                     /note="N-terminus to codon 170 is similar to Homo sapiens
                     (Human) rfx1 mhc class ii regulatory factor rfx1 (rfx)
                     (enhancer factor c) (ef-c). UniProt:P22670 (979 aa) fasta
                     scores: E()=0.071, 25.806% id in 155 aa"
                     /note="similarity:fasta; with=UniProt:P22670; Homo sapiens
                     (Human).; RFX1; MHC class II regulatory factor RFX1 (RFX)
                     (Enhancer factor C) (EF-C).; length=979; id 25.806%;
                     ungapped id 27.972%; E()=0.071; 155 aa overlap; query
                     20-170; subject 16-162"
                     /db_xref="EnsemblGenomes-Gn:Smlt0121"
                     /db_xref="EnsemblGenomes-Tr:CAQ43731"
                     /db_xref="UniProtKB/TrEMBL:B2FU79"
                     /protein_id="CAQ43731.1"
                     /translation="MARRGTQGALLAGMLLAGIAQAQQAAPVAVPDPAPVPPVDASAA
                     TTAPISTALPQDNVTTLGEVRALKPEDEPLDLYRFKNPVKFGDNRFSRDWSEPPSPEQ
                     VSMGGGYIMMGVVKGVMAAAKGVNKLTGGPSQIQAAVARPPPELSAEQQRRALRFSQE
                     QNAGDAPPVK"
     sig_peptide     128872..128937
                     /locus_tag="Smlt0121"
                     /note="Signal peptide predicted for Smlt0121 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.850 between residues 22 and 23"
                     /inference="protein motif:SignalP:2.0"
     repeat_region   129327..129334
                     /rpt_unit_seq="(gc)4"
     CDS             129425..130099
                     /transl_table=11
                     /locus_tag="Smlt0122"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q4V0E6
                     (EMBL:CP000050;); Xanthomonas campestris pv. campestris
                     (strain 8004).; Hypothetical protein.; length=223; id
                     56.164%; ungapped id 58.019%; E()=7.6e-44; 219 aa overlap;
                     query 7-220; subject 5-221"
                     /db_xref="EnsemblGenomes-Gn:Smlt0122"
                     /db_xref="EnsemblGenomes-Tr:CAQ43732"
                     /db_xref="UniProtKB/TrEMBL:B2FU80"
                     /protein_id="CAQ43732.1"
                     /translation="MSLRSFCLLAALLPASAFASGIADDGACRNGAFPSEQSRFALAR
                     VVDAPRLYLLGDMDGCPAKGEPACRQRSYVVNGDTVVTGRDLGAYRCAFFPNRVGGSA
                     GWVDRSKLQPLPVAVPSLQDWAGNWKDGDNGLRITVQGGQLHVEGDAYWPSANPTPEQ
                     RPYGPNMGQVEARAAPRGADVEFVEDTCKVRVHSLGEVLIVADNSECGGMNVRFNGVY
                     RRAGSR"
     sig_peptide     129425..129481
                     /locus_tag="Smlt0122"
                     /note="Signal peptide predicted for Smlt0122 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.963 between residues 19 and 20"
                     /inference="protein motif:SignalP:2.0"
     repeat_region   129938..129945
                     /rpt_unit_seq="(gc)4"
     CDS             complement(130159..131967)
                     /transl_table=11
                     /locus_tag="Smlt0123"
                     /product="putative transmembrane protein"
                     /note="similarity:fasta; with=UniProt:Q1N7P1
                     (EMBL:AAQG01000028;); Sphingomonas sp. SKA58.;
                     Hypothetical protein.; length=597; id 39.101%; ungapped id
                     41.228%; E()=1.4e-46; 601 aa overlap; query 11-602;
                     subject 8-586"
                     /db_xref="EnsemblGenomes-Gn:Smlt0123"
                     /db_xref="EnsemblGenomes-Tr:CAQ43733"
                     /db_xref="GOA:B2FU81"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:B2FU81"
                     /protein_id="CAQ43733.1"
                     /translation="MNASAVNLWIAPALALIVVIASVRQPRADTAHPGRRWVVIALQI
                     VVATLLYFCLAPPTRQQPAGGLVVLGVDAGKADSLPASEGPLLLLPEAADVPGAQRVP
                     DLATALRQHPAATLTLVGAGLVARDRDAVLPPDVRWQAAPEPRGWIALQPPADVAPGA
                     RFDVLAQARGAAKAKAELLDPADSVVDRTEVADDGRVQLSGVARAEGRSVFQLRLLDA
                     DGHVVDSVPVPQQTLPSAPLRLLVRAGAPGPELKYLRRWAADAGIRVQVQADTGAGLS
                     IGDGAVSIDAASLTRSDLLLLDERSLAALSAGQLAAVRQALRDGLGVLVRSAGAPSAS
                     ARQRLRDLGLPVQGDGSSHPLELPGDGESAVLAARRGPLAAGTLPTGYGEEADRSSHS
                     AALSSLEALALQAPGSNALLHDRGGQAVGGWRAVGKGRIGLLPLTDSWRWVLAGRDDR
                     HGELWSDVVATLARAQGSGDALWSPQPISWAGERQALCGVQAPLQAFNLRGDSVALIA
                     DGATSALRCAGWWPREAGWQRLQHGDSIVWRYVFDPKDAAALHRQAMIDATTQALASS
                     TSANASVMQPVPGSRWPWWLAFVLCASLLWWLERRR"
     misc_feature    complement(order(130174..130227,131794..131862,
                     131899..131955))
                     /locus_tag="Smlt0123"
                     /note="3 probable transmembrane helices predicted for
                     Smlt0123 by TMHMM2.0 at aa 5-23, 36-58 and 581-598"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(131964..134129)
                     /transl_table=11
                     /locus_tag="Smlt0124"
                     /product="putative transmembrane protein"
                     /note="similarity:fasta; with=UniProt:Q9A4K2; Caulobacter
                     crescentus (Caulobacter vibrioides).; Hypothetical protein
                     CC2829.; length=749; id 46.122%; ungapped id 48.222%;
                     E()=8.4e-101; 735 aa overlap; query 1-717; subject 28-748"
                     /db_xref="EnsemblGenomes-Gn:Smlt0124"
                     /db_xref="EnsemblGenomes-Tr:CAQ43734"
                     /db_xref="GOA:B2FU82"
                     /db_xref="UniProtKB/TrEMBL:B2FU82"
                     /protein_id="CAQ43734.1"
                     /translation="MNTLQHAWQRARRRRALITLLLGLPWALAATVLALRLAGFDTAC
                     VVGTVSLLACAAFATAHVRQLDRQWLQRQLDGSGASEDSADLLFADAATLNPLQQRQR
                     THVLAMLERAMPELRPRWPRGALALCWIAGLAIVVLAFGWPRSGPGSVPVRTPVPGSA
                     AAAGPLRLQSTRLRIDAPAYTGQATLTQNALDAKVAADSRLSWSLRFDRAPDKAWLQF
                     HDGRRLPLSEREGQWQAQDVARMPLLYRVVSEPALAETRLHRLDVVADRAPSVRVLEP
                     TASLVLGTPGQRQWALRFEASDDYGVAAQATLSITTTQGSGENITFVKRSVTLAGSGE
                     ATARRFAHTLDLAALGAQPGNDVIAQLEVRDNHAPTPQTGRSSSVILRLPSAEVALGA
                     ELEGRIKKTLPAYFRSQRQIIIDAEALIRQRRSLAAEDFVKRSDAIGVDQRILRLRYG
                     QFLGEESEGAPKPPPTSDLPTSDAPTADGHDDDHEHDHGAQAGAQDDHGHDHGSTANA
                     DIPPVFGSETDVLSEYGHTHDHAEATTLLDPQTRATLKAALDQMWSAEGELRQGRPEQ
                     ALPFAYKALGFIKQVQQAERIYLARVGPELPPIDESRRLGGDRAGLASRELPLAARTP
                     PDPAIVEAWQRLGDDNGAPDLDALAAWQQRNAAYLPDALDLAAAIEQLRIEPDCGDCR
                     QRLRAQLWRALQRPLPQTMRRSAADAMGQRYLDALEAQP"
     misc_feature    complement(order(133704..133772,133944..134003,
                     134013..134081))
                     /locus_tag="Smlt0124"
                     /note="3 probable transmembrane helices predicted for
                     Smlt0124 by TMHMM2.0 at aa 17-39, 43-62 and 120-142"
                     /inference="protein motif:TMHMM:2.0"
     sig_peptide     complement(134028..134129)
                     /locus_tag="Smlt0124"
                     /note="Signal peptide predicted for Smlt0124 by SignalP
                     2.0 HMM (Signal peptide probability 0.998) with cleavage
                     site probability 0.423 between residues 34 and 35"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(134126..135247)
                     /transl_table=11
                     /locus_tag="Smlt0125"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PE92; Xanthomonas
                     campestris pv. campestris.; Hypothetical protein XCC0089.;
                     length=393; id 45.038%; ungapped id 49.441%; E()=2.6e-29;
                     393 aa overlap; query 2-367; subject 9-393"
                     /db_xref="EnsemblGenomes-Gn:Smlt0125"
                     /db_xref="EnsemblGenomes-Tr:CAQ43735"
                     /db_xref="GOA:B2FH92"
                     /db_xref="InterPro:IPR011933"
                     /db_xref="InterPro:IPR024163"
                     /db_xref="UniProtKB/TrEMBL:B2FH92"
                     /protein_id="CAQ43735.1"
                     /translation="MTLLFPLGLAALAAGLLPLLIHLARRHPYTPLDFAALRWLRAQI
                     RPRQRIRFDDWPLLLVRLLLLAALALLLARPALTGPAPAPTAWTVVAPGLDATALRGT
                     AEAGNWHWLAPGFPAIDEVPPASTASLPSLLRELDAQLPAGTALTVHVPDPLPGLDGA
                     RLQLSREVQWRPQPIQVSEQPSAATLSRLRVHSDASAVVQHWLNALQRAWGRQAPLAP
                     LVADALPERGEIGVWSRTGALPANWQAWLQDGGRVVTAGKPAAEASILLRNTEGTPLL
                     WQQRIGHGVLLSLPGDWDASGNAALRDPQLPRALLLALQPPTAPRLGDARDQAPQRAA
                     LPAATPPLREPTPWLLLAVVLLFALERWMASSARRRVAA"
     misc_feature    complement(135017..135199)
                     /locus_tag="Smlt0125"
                     /note="HMMPfam hit to PF07584, Protein of unknown function
                     (DUF1550), score 9.9e-15"
                     /inference="protein motif:HMMPfam:PF07584"
     CDS             complement(135244..136140)
                     /transl_table=11
                     /locus_tag="Smlt0126"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PE91; Xanthomonas
                     campestris pv. campestris.; Hypothetical protein XCC0090.;
                     length=298; id 66.436%; ungapped id 66.436%; E()=2.8e-73;
                     289 aa overlap; query 6-294; subject 6-294"
                     /db_xref="EnsemblGenomes-Gn:Smlt0126"
                     /db_xref="EnsemblGenomes-Tr:CAQ43736"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR002881"
                     /db_xref="UniProtKB/TrEMBL:B2FH93"
                     /protein_id="CAQ43736.1"
                     /translation="MNAGTPLTLPPELRARLRTLRVRPRLASGASGIGQHASRSRGAG
                     LEFAQYRAYEPGDELRQVDWKLYARSDRFFVRESERESPITVWLLLDATASAGQADRA
                     APQRTRLDHMRGVAACVVELALQQGDRFGLLAINGDGLQLVPAANGARQRDRVHLQLH
                     ALQARGGWPVADRLRPLWERVRPGDLLLAIGDGFDEAGIVLLEQLASARREVALLQIL
                     TADERDFPFGAGHRFRDPETGEELLGDGAAIRTDYLQRFADARNALQSRLQASGIASA
                     TGWLDQPLDQPLQALFGRRGGA"
     misc_feature    complement(135898..136140)
                     /locus_tag="Smlt0126"
                     /note="HMMPfam hit to PF01882, Protein of unknown function
                     DUF58, score 0.0018"
                     /inference="protein motif:HMMPfam:PF01882"
     CDS             complement(136148..137131)
                     /transl_table=11
                     /locus_tag="Smlt0127"
                     /product="putative ATPase, possible regulator"
                     /note="similarity:fasta; with=UniProt:Q8PR48; Xanthomonas
                     axonopodis pv. citri.; moxR; Methanol dehydrogenase
                     regulator.; length=330; id 84.498%; ungapped id 85.276%;
                     E()=7.1e-98; 329 aa overlap; query 1-326; subject 1-329"
                     /db_xref="EnsemblGenomes-Gn:Smlt0127"
                     /db_xref="EnsemblGenomes-Tr:CAQ43737"
                     /db_xref="GOA:B2FH94"
                     /db_xref="InterPro:IPR011703"
                     /db_xref="InterPro:IPR016366"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B2FH94"
                     /protein_id="CAQ43737.1"
                     /translation="MTSPDLDSLLPRLDELRAALARAVVGQNTVVEQLLTGLLAGGHC
                     LLEGAPGLGKTLLVRSLGQALELQFRRVQFTPDLMPSDILGTELLEEDHGTGHRHFRF
                     QQGPIFTHLLLADELNRTPPKTQAALLEAMQERTVSYAGTTYALPAPFFVLATQNPIE
                     QAGTYPLPEAQLDRFLLHVLVDYPSEDEERQVLEQTTGGATDAVPKVMDADAVIALQA
                     AVRQVHVSPDVLAWITRLVRASRPGDGAPAAINQWVKWGAGPRAGQSLVLAAKARALL
                     QGRFAATREDVQALAAPVMRHRLLLSFAAEAEQKRADDVVAALLQAVPFPG"
     misc_feature    complement(136583..137005)
                     /locus_tag="Smlt0127"
                     /note="HMMPfam hit to PF07728, ATPase family associated
                     with various cellul, score 5.9e-11"
                     /inference="protein motif:HMMPfam:PF07728"
     misc_feature    complement(136601..137005)
                     /locus_tag="Smlt0127"
                     /note="HMMPfam hit to PF07726, ATPase family associated
                     with various cellul, score 1.1e-82"
                     /inference="protein motif:HMMPfam:PF07726"
     CDS             complement(137148..137855)
                     /transl_table=11
                     /locus_tag="Smlt0128"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PR47; Xanthomonas
                     axonopodis pv. citri.; Hypothetical protein XAC0119.;
                     length=223; id 81.416%; ungapped id 82.511%; E()=6.7e-78;
                     226 aa overlap; query 1-226; subject 1-223"
                     /db_xref="EnsemblGenomes-Gn:Smlt0128"
                     /db_xref="EnsemblGenomes-Tr:CAQ43738"
                     /db_xref="InterPro:IPR025297"
                     /db_xref="UniProtKB/TrEMBL:B2FH95"
                     /protein_id="CAQ43738.1"
                     /translation="MDRRACLRWLAAAASAAALPAWAQAGPRSSRYDFWFTRLQYDSG
                     DWDVDARMPSNLITSLIDYTSLRVDPQEHVVALADPRMLEAPFCYLAGHTLVEFNAAE
                     RQNFVRYVRNGGFVFVDDCNHDIDGLFATSFEAQMGRLFGPRALQKLPNSHPLYRSFF
                     RFPDGPPATSFELNGWGDDLVHDYLKGIEVDGRLGLLYSNKDYGCEWDYDWRNKRFLA
                     EDNTRFGVNIVMYALNN"
     sig_peptide     complement(137787..137828)
                     /locus_tag="Smlt0128"
                     /note="Signal peptide predicted for Smlt0128 by SignalP
                     2.0 HMM (Signal peptide probability 0.938) with cleavage
                     site probability 0.615 between residues 14 and 15"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(137855..139189)
                     /transl_table=11
                     /locus_tag="Smlt0129"
                     /product="putative modulator of DNA gyrase"
                     /note="similarity:fasta; with=UniProt:Q8PR46; Xanthomonas
                     axonopodis pv. citri.; TldD protein.; length=444; id
                     86.937%; ungapped id 86.937%; E()=8.4e-155; 444 aa
                     overlap; query 1-444; subject 1-444"
                     /db_xref="EnsemblGenomes-Gn:Smlt0129"
                     /db_xref="EnsemblGenomes-Tr:CAQ43739"
                     /db_xref="GOA:B2FH96"
                     /db_xref="InterPro:IPR002510"
                     /db_xref="UniProtKB/TrEMBL:B2FH96"
                     /protein_id="CAQ43739.1"
                     /translation="MSIFTEAQAKAILDKVIALSKADECTAVLAGAIDGNIRFALNNV
                     STSGIVDNTELAVTVAFGKRVGTASINEFDDAALERVVRRAEDLARLAPENPEFMPAI
                     GKQTYRASPTFSESTAAIDPAFRAKVAADSIAPCRGHGLIAAGFLEDGQGFQATANSN
                     GNFAYQRTTNFNYTCTVRTEDGRGSGWVGRNLKDAADFKADQDIRIAMRKATESAEAK
                     ALEPGKYTVILEPAAAAGLISFMMNFFSARSADEGRSFLSKKGGGNKLGEQVYDPRVT
                     MIADPWHPDAPVLPWDNEGLPRERMAIIENGRIANLDYSRFWAQKQGKTAKASPGNLL
                     MSGGDKSTAELVRGTQKGILVTRTWYIRMVDPQTVLLTGLTRDGTFYIENGQIKHPVK
                     NFRFNESPVIMLNNIEELGKPVRVAGDESSYVMMIPPMKLRDFTFTSLSDAV"
     misc_feature    complement(138254..139123)
                     /locus_tag="Smlt0129"
                     /note="HMMPfam hit to PF01523, Putative modulator of DNA
                     gyrase, score 3.3e-12"
                     /inference="protein motif:HMMPfam:PF01523"
     CDS             complement(139211..140791)
                     /transl_table=11
                     /locus_tag="Smlt0130"
                     /product="putative modulator of DNA gyrase"
                     /note="similarity:fasta; with=UniProt:Q9L6I6
                     (EMBL:AF234655;); Streptomyces lincolnensis.; lmbIH;
                     length=483; id 30.120%; ungapped id 32.397%; E()=4.6e-24;
                     498 aa overlap; query 24-516; subject 5-472"
                     /note="similarity:fasta; with=UniProt:Q3BZJ0
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Putative modulator of DNA gyrase
                     precursor.; length=544; id 86.692%; ungapped id 86.692%;
                     E()=2.6e-177; 526 aa overlap; query 1-526; subject 19-544"
                     /db_xref="EnsemblGenomes-Gn:Smlt0130"
                     /db_xref="EnsemblGenomes-Tr:CAQ43740"
                     /db_xref="GOA:B2FH97"
                     /db_xref="InterPro:IPR002510"
                     /db_xref="UniProtKB/TrEMBL:B2FH97"
                     /protein_id="CAQ43740.1"
                     /translation="MPSFFGKVIAAEQLQSSLDLGLKKRLADAALAAARQAGATYCDV
                     RIGRYLRQFVITREDKVQNVVNTESTGVGIRVIVNGAWGFAATNALGTADVAKAAQQA
                     AAIAKANAGVQTAPVQLAKAPGVGEVSWRTPIRKNAMEVPIKDKVGLLLDVNAAAMGA
                     GASFVNSMLFLVNEQKYFASTDGSYIDQDVHRIWAPMTVTAIDKSSGKFRTRSGLSSP
                     MGLGYEYLDGAAAGKVVGPNGVVNYSSSYDMKEDAIAAARQAQEKLKAPSVKPGKYDL
                     VLDPSHTWLTIHESIGHPLELDRVLGYEANYAGTSFATLDKREQHFQYGSELVNIFAD
                     KTQPGSLGAVAYDDEGVKCKRWDLISNGKLVDYQTIRDQAHILGKTESDGCCYADSWS
                     SVQFQRMANVSMAPGKKPLSVPDLIKDVENGIYIIGDGSFSIDQQRYNAQFGGQLFYE
                     IKNGQITRMLEDVAYQIRTPEFWNACTAVADERDYRLGGSFFDGKGQPGQVSAVSHGS
                     STARFNGINVINTARSLG"
     misc_feature    complement(139691..140674)
                     /locus_tag="Smlt0130"
                     /note="HMMPfam hit to PF01523, Putative modulator of DNA
                     gyrase, score 2.3e-48"
                     /inference="protein motif:HMMPfam:PF01523"
     CDS             complement(140876..142507)
                     /transl_table=11
                     /locus_tag="Smlt0131"
                     /product="putative peptidase/modulator of DNA gyrase"
                     /note="similarity:fasta; with=UniProt:Q9L6I6
                     (EMBL:AF234655;); Streptomyces lincolnensis.; LmbIH.;
                     length=483; id 29.116%; ungapped id 31.317%; E()=2.3e-22;
                     498 aa overlap; query 40-532; subject 5-472"
                     /note="similarity:fasta; with=UniProt:Q3BZI9
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Putative modulator of DNA gyrase
                     precursor.; length=542; id 75.092%; ungapped id 75.092%;
                     E()=5.8e-166; 542 aa overlap; query 1-542; subject 1-542"
                     /db_xref="EnsemblGenomes-Gn:Smlt0131"
                     /db_xref="EnsemblGenomes-Tr:CAQ43741"
                     /db_xref="GOA:B2FH98"
                     /db_xref="InterPro:IPR002510"
                     /db_xref="UniProtKB/TrEMBL:B2FH98"
                     /protein_id="CAQ43741.1"
                     /translation="MQRREFLAFSGLGLAGLLLPHSRAIAAEQLLAPVDTAQRRRLAD
                     VALAAARTAKASYCDVRIGRYLNQSVITREHQVGNVTNRESSGVGVRVIVNGAWGFAA
                     THQQTEAAVRAAVEQAAAIARANASIQTRPVQLAPTPSVGEVHWKTPIRRNAMAVPIQ
                     DKVELLLALNAAALNAGADYINSTLFLVNEQKYFASSDGSFIDQDIHRIWLPFTATAI
                     DKASGRFRTRAGLSSPMGMGYEFLDGDARGKVQLPGGITAYRDSYDPVEDAIAAARHA
                     REKLKAPSVKPGKYDLVLDPSNLFLTIHENVGHPLELDRVLGYEANYAGTSFATLDKR
                     DAGFRWGSDIVTFFADKTQPGSLGAVGYDDEGVKTQRWDLVRDGILVDYQATRDEAHI
                     LGRDASHGCSYADSWSSVQFQRMANVSLAPGKQPLSVEDMIKDVENGIWIHGRGSYSI
                     DQQRYNAQFGGQLYYQIKDGKIAGMVEDAAYQIRTPEFWNACTAICDERDFRLGGSFF
                     DGKGQPGQVSAVSHGSSTTRFNGINIINTARSLGA"
     misc_feature    complement(141359..142342)
                     /locus_tag="Smlt0131"
                     /note="HMMPfam hit to PF01523, Putative modulator of DNA
                     gyrase, score 1.1e-54"
                     /inference="protein motif:HMMPfam:PF01523"
     repeat_region   141676..141683
                     /rpt_unit_seq="(cg)4"
     sig_peptide     complement(142430..142507)
                     /locus_tag="Smlt0131"
                     /note="Signal peptide predicted for Smlt0131 by SignalP
                     2.0 HMM (Signal peptide probability 0.999) with cleavage
                     site probability 0.962 between residues 26 and 27"
                     /inference="protein motif:SignalP:2.0"
     repeat_region   142514..142523
                     /rpt_unit_seq="(tc)5"
     repeat_region   142619..142817
                     /rpt_family="R=3"
                     /inference="nucleotide motif:RepeatScout"
     repeat_region   complement(142665..143104)
                     /rpt_family="R=8"
                     /inference="nucleotide motif:RepeatScout"
     repeat_region   complement(142945..143158)
                     /rpt_family="R=3"
                     /inference="nucleotide motif:RepeatScout"
     CDS             143201..143815
                     /transl_table=11
                     /locus_tag="Smlt0133"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q5H6Y2
                     (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.;
                     Hypothetical protein.; length=267; id 56.190%; ungapped id
                     58.416%; E()=7.9e-42; 210 aa overlap; query 1-202; subject
                     56-265"
                     /db_xref="EnsemblGenomes-Gn:Smlt0133"
                     /db_xref="EnsemblGenomes-Tr:CAQ43742"
                     /db_xref="InterPro:IPR010342"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B2FH99"
                     /protein_id="CAQ43742.1"
                     /translation="MSSKPYSEACERNREPIATALDPWMGDRRRVLEIGSGTGQHAAF
                     FAERWPWLRWQPSDHPDHLPGIEAWRAEAALLNLLPPAALQVELPPAPGLSLPQGSTF
                     DAAFTANTLHIMGWEHVQALFAALPPLLRHGALLAVYGPFNYGGRYTSDSNAQFDAWL
                     KARDPRSGIRDVEAVQALAEDNGFTRLRDVAMPANNRLLLWRLG"
     misc_feature    143210..143809
                     /locus_tag="Smlt0133"
                     /note="HMMPfam hit to PF06080, Protein of unknown function
                     (DUF938), score 8.5e-94"
                     /inference="protein motif:HMMPfam:PF06080"
     CDS             complement(143816..145138)
                     /transl_table=11
                     /gene="hipA"
                     /locus_tag="Smlt0134"
                     /product="putative survival protein HipA"
                     /note="similarity:fasta; with=UniProt:P23874
                     (EMBL:M61242;); Escherichia coli.; hipA; Protein hipA.;
                     length=440; id 42.377%; ungapped id 44.787%; E()=4.3e-62;
                     446 aa overlap; query 1-434; subject 1-434"
                     /note="similarity:fasta; with=UniProt:Q395X4
                     (EMBL:CP000152;);/NCIB 9086/R18194)).; Uncharacterized
                     protein related to capsule biosynthesis enzymes- like.;
                     length=446; id 53.687%; ungapped id 54.060%; E()=1.3e-95;
                     434 aa overlap; query 4-435; subject 10-442"
                     /db_xref="EnsemblGenomes-Gn:Smlt0134"
                     /db_xref="EnsemblGenomes-Tr:CAQ43743"
                     /db_xref="InterPro:IPR012893"
                     /db_xref="InterPro:IPR012894"
                     /db_xref="InterPro:IPR017508"
                     /db_xref="UniProtKB/TrEMBL:B2FHA0"
                     /protein_id="CAQ43743.1"
                     /translation="MGTLQVWMNGVEVALWDDVRNGSSRLSYVSQWISSPQSRPLSLS
                     LPLLPDGESHRGNVVNDYFDNLLPDNVAIRNRIRDRFATRGSDTFDLLEAIGRDCVGA
                     VQLLPPARPPEDIQQITCEVLDEAGVATILRQVTTGNLPGAPSRDDAFRISIAGAQEK
                     TGLLLHAGKWCIPTGNTPSTHIFKLPLGIVGNMRADMHQSVENEWLCMHLLSAFDIPV
                     AETQMGRFNDQRALIVERFDRRLSADRRWWLRLPQEDMCQVFGLPAARKYESDGGPGI
                     VPIMDLLRQSEHPEDRAIFFKTQILFWMLAATDGHAKNFSVHLEAGGRFRLTPVYDVL
                     SVYPILGRGPNQLDPRNAQLAMAVHGKNRHRKLHLVRRRHWNETARACGVADGAEPWI
                     KTLIAAVEPAIQQVTRQLPDDFPSNVSEPIFNGLRAAAARLSSMAPEA"
     repeat_region   143997..144004
                     /rpt_unit_seq="(gc)4"
     misc_feature    complement(144143..144391)
                     /gene="hipA"
                     /locus_tag="Smlt0134"
                     /note="HMMPfam hit to PF07804, HipA-like C-terminal
                     domain, score 4.3e-36"
                     /inference="protein motif:HMMPfam:PF07804"
     misc_feature    complement(144422..144682)
                     /gene="hipA"
                     /locus_tag="Smlt0134"
                     /note="HMMPfam hit to PF07805, HipA-like N-terminal
                     domain, score 6.6e-19"
                     /inference="protein motif:HMMPfam:PF07805"
     repeat_region   145005..145012
                     /rpt_unit_seq="(ag)4"
     CDS             complement(145142..145399)
                     /transl_table=11
                     /gene="hipB"
                     /locus_tag="Smlt0135"
                     /product="putative HTH-type transcriptional regulator
                     HipB"
                     /note="similarity:fasta; with=UniProt:P23873
                     (EMBL:M61242;); Escherichia coli.; hipB; HTH-type
                     transcriptional regulator hipB.; length=88; id 27.059%;
                     ungapped id 28.395%; E()=0.037; 85 aa overlap; query 5-85;
                     subject 4-88"
                     /note="similarity:fasta; with=UniProt:Q6MXQ9
                     (EMBL:BX664015;); Serratia marcescens.; Putative
                     transcriptional regulator.; length=99; id 46.479%;
                     ungapped id 46.479%; E()=3.6e-08; 71 aa overlap; query
                     6-76; subject 5-75"
                     /db_xref="EnsemblGenomes-Gn:Smlt0135"
                     /db_xref="EnsemblGenomes-Tr:CAQ43744"
                     /db_xref="GOA:B2FHA1"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="UniProtKB/TrEMBL:B2FHA1"
                     /protein_id="CAQ43744.1"
                     /translation="MDRPLHTVRTAQQLAPLMRAFRRQAGLSQAQLAERLGISRQAVG
                     ALERDPASASFERLMRIWAVLGLEVSLQQRSPQENTSSLEW"
     misc_feature    complement(145184..145348)
                     /gene="hipB"
                     /locus_tag="Smlt0135"
                     /note="HMMPfam hit to PF01381, Helix-turn-helix, score
                     9.9e-13"
                     /inference="protein motif:HMMPfam:PF01381"
     CDS             complement(145561..149274)
                     /transl_table=11
                     /locus_tag="Smlt0136"
                     /product="putative ferredoxin oxidoreductase"
                     /note="similarity:fasta; with=UniProt:Q3BZB0
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Putative ferredoxin oxidoreductase.;
                     length=1247; id 80.192%; ungapped id 81.169%; E()=0; 1247
                     aa overlap; query 2-1237; subject 5-1247"
                     /db_xref="EnsemblGenomes-Gn:Smlt0136"
                     /db_xref="EnsemblGenomes-Tr:CAQ43745"
                     /db_xref="GOA:B2FHA2"
                     /db_xref="InterPro:IPR002869"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR019752"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:B2FHA2"
                     /protein_id="CAQ43745.1"
                     /translation="MPADPTGPAMTSTAQLTSPSSADLLDRDYTLDHKYTRNEGRIYL
                     SGVQALVRLPLMQRLRDAAEGIDSAGFVSGYRGSPLGGFDLELWRARKHLEAAKVKFT
                     PGLNEDLGATMVWGTQQTNLFPGANVQGVFGMWYGKGPGVDRCGDVFKHANAAGTSRY
                     GGVLALAADDHACRSSTLPHGSEDEFVSAMMPVLNPAGVQDILDMGLLGWAMSRYTGR
                     WVGFKTIAETVESSASVQVDPMARRIVLPEDFEMPSGGLNIRWPDPPLDQEMRLHRYA
                     VKAAQAFARANGIDKVVMDAPRARLGIVTTGKSYLDVLQALEYLGLDEAACADIGIRV
                     YKVGMTWPLEPQGIARFAQGLEDIIVVEEKRAFIERQMKEQFFNWPASWGQRPSIVGK
                     YDESGEWILPSTGELTPATIAGVIGRRIQKFFNNESIEQRLQWMQQKEAELALPRASF
                     PRVPHYCSGCPHNTSTQVPEGSRALAGIGCHYMVTWMDRSTDTFTHMGGEGVTWAGQA
                     PFTDTPHVFQNLGDGTYFHSGSLAIRQAVAAGVNITYKILYNDAVAMTGGQPVDGPLS
                     VPDIAKQMRAEGIHTIVVLSDNIGKWTGQREHFPSDVEFHDRSELEEVQKRLREVKGV
                     SILIYEQTCATEKRRRRKRGKLEDPQKRVLINSLVCEGCGDCGKKSFCVSVLPKETEF
                     GRKREIDQSNCNKDYSCVNGFCPSFVTVHGGQPRKGSKRDASTLLDNLPAPTIRGTLE
                     QPWNILITGVGGTGVVTIGALLGMAGHLEGKGATVLDQTGLAQKGGAVTTHIRIARRP
                     DDIHAVRIAAGEADLVLGCDMVVVNDYWALSKVRAGRSQVVLNTYEAMPGTFTTRPDM
                     QFPAADIIAGVRVALGGQEPLLLDATQLATALLGDAIAANLFILGYAWQQGLVPLSFE
                     SLMRAIELNGAAVAMNQQAFAWGRLAVVDPQAVQQAAGLVHNRHTDTESTPGPLHPLP
                     PGEWEGNEWGATAAPRNTGDERELRGLPSHGGDVAFLPLDDARLSRSLDEMIERRAAF
                     LVDYQDAAYANRYRSLVERVRAAEAERIGGSTALTETVARYLFKLMAYKDEYEVARLY
                     TSGDFQRRLQQQFEGDYQLRFHLAPPLFAKKDEQGRLLKKEYGPWMFKAFGLLAKLKF
                     LRGGRLDVFGRTEERRMERQLIADYEATVQLLLDGLEDGRLALAVEIASVPEHIRGFG
                     HVKEAHYEQAKAREAALLAQWRNPKALHIVQVA"
     misc_feature    complement(146458..147024)
                     /locus_tag="Smlt0136"
                     /note="HMMPfam hit to PF01558, Pyruvate
                     ferredoxin/flavodoxin oxidoreductas, score 9.5e-06"
                     /inference="protein motif:HMMPfam:PF01558"
     repeat_region   148376..148385
                     /rpt_unit_seq="(cg)5"
     repeat_region   149002..149011
                     /rpt_unit_seq="(gc)5"
     CDS             149419..150054
                     /transl_table=11
                     /locus_tag="Smlt0137"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q3BZA9
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Putative secreted protein precursor.;
                     length=223; id 50.980%; ungapped id 51.232%; E()=1.7e-36;
                     204 aa overlap; query 9-211; subject 20-223"
                     /db_xref="EnsemblGenomes-Gn:Smlt0137"
                     /db_xref="EnsemblGenomes-Tr:CAQ43746"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:B2FHA3"
                     /protein_id="CAQ43746.1"
                     /translation="MSVPGKILASVLLASGAATAWAAPAMPAPQEFYFDSDLAAAPMV
                     AMQGEGDELVTQLVRLRERGRRAVEATVQLASVASTQGRAELADQLYGEALKEAPAQS
                     SAGRSVRWNYGWDLLRQGKPEAALEQWLSSAGNARSKPSWVPPTYALALWRMGQKQEA
                     VQWYAAAVRTEPSQWSTSANYAQLLPQWREDERASLAEVQQAWAAAPPAWP"
     sig_peptide     149419..149484
                     /locus_tag="Smlt0137"
                     /note="Signal peptide predicted for Smlt0137 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.960 between residues 22 and 23"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(150175..151659)
                     /transl_table=11
                     /locus_tag="Smlt0138"
                     /product="putative ATPase"
                     /note="similarity:fasta; with=UniProt:Q9I5R4
                     (EMBL:AE004500;); Pseudomonas aeruginosa.; Probable
                     ATPase.; length=493; id 49.899%; ungapped id 50.615%;
                     E()=2.5e-85; 495 aa overlap; query 2-493; subject 3-493"
                     /db_xref="EnsemblGenomes-Gn:Smlt0138"
                     /db_xref="EnsemblGenomes-Tr:CAQ43747"
                     /db_xref="GOA:B2FHA4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B2FHA4"
                     /protein_id="CAQ43747.1"
                     /translation="MSELQDLSALIRANTPLIVIETQDEGRIVDLFRQTLMHVWRALH
                     RWSITEGLRRIDLDSEDPPAGPPDASAALQMIRQAGQRGVYLLLDFHPYLGYASHQRA
                     LRDLIQRRHSEPHVLVLIGAKVELPAELEALAVRFNPRLPDANALLKMLREEADAYAR
                     EHGGRRVEVESEAVKKILKNLQGLSLVDARRIARQLIYADGALRDDDLPQLARLKFEL
                     LNRSGHLFFEHDSARFGDVAGANRLKRWINQRRVAFIAGSAPAGLDPPRGMLLLGVQG
                     CGKSMLAKATAAGFGVPLLRLDVGALYNKYHGETEANLRQALASAEQLAPCVLWMDEI
                     EKGLASGGEDGGVSRRVLGHLLTWMAERKAPVFIVATANQVHELPAELLRKGRFDEIF
                     FVDLPSPEVRVELLRLHLGRRQLNADDFALPALAAAANGFSGAEIEQAIVAGLYAAHA
                     EGRPLDTELLMNEIRATRPLSVLMAEQVEALRAWASGRTVSADD"
     misc_feature    complement(150313..150858)
                     /locus_tag="Smlt0138"
                     /note="HMMPfam hit to PF00004, ATPase family associated
                     with various cellul, score 3.9e-51"
                     /inference="protein motif:HMMPfam:PF00004"
     CDS             151783..152412
                     /transl_table=11
                     /locus_tag="Smlt0139"
                     /product="putative Cob/MinD/ParA nucleotide binding
                     protein"
                     /note="similarity:fasta; with=UniProt:Q4V0A3
                     (EMBL:CP000050;); Xanthomonas campestris pv. campestris
                     (strain 8004).; Partition protein.; length=210; id
                     76.442%; ungapped id 76.442%; E()=4e-57; 208 aa overlap;
                     query 1-208; subject 1-208"
                     /db_xref="EnsemblGenomes-Gn:Smlt0139"
                     /db_xref="EnsemblGenomes-Tr:CAQ43748"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B2FHA5"
                     /protein_id="CAQ43748.1"
                     /translation="MKTILVAGSKGGVGKTTVATHLAAYAALQGRATVIADADPQGSS
                     TRWAQRRAGLESAVLPIDVYRKKQWAQKLPDGTETVIIDAPAGALADDIPHFLDAADA
                     VVVPVLPSALDIEAIVGFLNSLAQNPRVHSRKLPVGLVLNRTKPWTQTSQQALQMLAE
                     WPYPVVAQLRDSQSYVVMTGLGRSLFDYRSAQVREHQADWEPLLSWLKL"
     CDS             152462..152938
                     /transl_table=11
                     /locus_tag="Smlt0140"
                     /product="putative phosphoglycerate mutase family protein"
                     /note="similarity:fasta; with=UniProt:Q8PQX6
                     (EMBL:AE011644;); Xanthomonas axonopodis pv. citri.;
                     Hypothetical protein XAC0193.; length=158; id 72.152%;
                     ungapped id 72.152%; E()=5e-42; 158 aa overlap; query
                     1-158; subject 1-158"
                     /db_xref="EnsemblGenomes-Gn:Smlt0140"
                     /db_xref="EnsemblGenomes-Tr:CAQ43749"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:B2FHA6"
                     /protein_id="CAQ43749.1"
                     /translation="MRELILLRHAHAEPATPGQADLDRPLSPVGLAEAEAAGKWLKEN
                     NLLPDCVLCSPARRTRETLEAVLGTIGYVEKRLEDRIYEATPGTLAALVDDRRDLDRV
                     LIVGHNPGLERLVALMTEGTSSDYRGMPPAGIAVLGFPREASIEPGVASLNAFWWP"
     misc_feature    152468..152803
                     /locus_tag="Smlt0140"
                     /note="HMMPfam hit to PF00300, Phosphoglycerate mutase
                     family, score 1.9e-20"
                     /inference="protein motif:HMMPfam:PF00300"
     CDS             152943..153560
                     /transl_table=11
                     /locus_tag="Smlt0141"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PQX5
                     (EMBL:AE011644;); Xanthomonas axonopodis pv. citri.;
                     Hypothetical protein XAC0194.; length=190; id 58.602%;
                     ungapped id 59.890%; E()=1.4e-40; 186 aa overlap; query
                     20-205; subject 9-190"
                     /db_xref="EnsemblGenomes-Gn:Smlt0141"
                     /db_xref="EnsemblGenomes-Tr:CAQ43750"
                     /db_xref="InterPro:IPR007372"
                     /db_xref="UniProtKB/TrEMBL:B2FHA7"
                     /protein_id="CAQ43750.1"
                     /translation="MSLARRSRYLLPALLALGPAWAAVPTPTTLPPVVAEAHRVMRLD
                     TQRSQIGFEVRTRFGQRIEGLFPHFEGRIEILSDGRHQVHLKMFTRSVEIPGKARYTG
                     WMRGEEFFDAGRHPVVEFDSLPYWPETVESGGDINGRLTLRGISHPETLKVEKAECAR
                     PGYDCDVVSRGTVQRGRYGMDSWQLALSDRVTFVLRARLSEAPKP"
     sig_peptide     152943..153008
                     /locus_tag="Smlt0141"
                     /note="Signal peptide predicted for Smlt0141 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.999 between residues 22 and 23"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    153069..153548
                     /locus_tag="Smlt0141"
                     /note="HMMPfam hit to PF04264, YceI like family, score
                     1.6e-15"
                     /inference="protein motif:HMMPfam:PF04264"
     CDS             153557..155605
                     /transl_table=11
                     /locus_tag="Smlt0142"
                     /product="putative phospholipase"
                     /note="similarity:fasta; with=UniProt:Q3BZA4
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Phospholipase precursor.; length=672; id
                     73.824%; ungapped id 75.150%; E()=1.2e-133; 680 aa
                     overlap; query 4-682; subject 4-672"
                     /db_xref="EnsemblGenomes-Gn:Smlt0142"
                     /db_xref="EnsemblGenomes-Tr:CAQ43751"
                     /db_xref="GOA:B2FHA8"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR025202"
                     /db_xref="UniProtKB/TrEMBL:B2FHA8"
                     /protein_id="CAQ43751.1"
                     /translation="MNFLLRVLALATVLLGSGCASLSNAERDRAEAIAVQARSTVVDC
                     QRADRCAQDSPLRALAGRAFTESTPERPRHYATLLDEGEGALVARLNLLRSATRSIDL
                     QTYIFDKDDSARLVIDELLAASRRGVKVRLLIDQLSAISDLQILGALSGAHQNFQLRV
                     YNPTFGKARLNYFDYAGSVLCCFRRFNQRMHNKLLVIDDAIGVVGGRNYQDDYYDWDR
                     EYNFRDRDVLIAGPEARAMAANFDAFWRAHRSVPAERLNDVGRTLLREGVPTLPPASF
                     RRPERVQRVSAEANDTEFVTRSFVDTALPVASVRYVADLPRKHRREKADAPLAGQHVT
                     EPQLDALIASAQKEVILQTPYLVLSKPAQKLFRELRKRPQPPRVVVSSNSLAATDNPI
                     VYALSYKYKRRNMRELGFNIFEYKPFPLDAPVDYRNLLPDPIAAPGGGDEGGRNPLIG
                     GSAAGSNARGGSSSGSDAGSRQGPLNRHSDGAYDNARARRRAAGSEVETRLLRTETRP
                     SFLGSKAVNKPLPVTRKGARMGLHAKSLVVDRRIGVVGTHNFDPRSENYNTEGAVIID
                     DPVFAEELAQSILRDTHPQNSWTVAPRAKPPVLSGLNYSVGKASEALPILDFWPWRYA
                     TDYEFKPGPECPQPLPRQDPDFHRCYVAVGDFPEVNVGPKWLLVRMLTAFGAGLVPIL
                     "
     sig_peptide     153557..153631
                     /locus_tag="Smlt0142"
                     /note="Signal peptide predicted for Smlt0142 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.660 between residues 25 and 26"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    154112..154195
                     /locus_tag="Smlt0142"
                     /note="HMMPfam hit to PF00614, Phospholipase D Active site
                     motif, score 0.0019"
                     /inference="protein motif:HMMPfam:PF00614"
     repeat_region   154868..154875
                     /rpt_unit_seq="(g)8"
     repeat_region   155133..155140
                     /rpt_unit_seq="(gc)4"
     misc_feature    155135..155218
                     /locus_tag="Smlt0142"
                     /note="HMMPfam hit to PF00614, Phospholipase D Active site
                     motif, score 0.0038"
                     /inference="protein motif:HMMPfam:PF00614"
     CDS             155616..156050
                     /transl_table=11
                     /locus_tag="Smlt0143"
                     /product="putative thioesterase"
                     /note="similarity:fasta; with=UniProt:P77781
                     (EMBL:AP009048;); Escherichia coli.; ydiI; Esterase ydiI
                     (EC 3.1.-.-).; length=136; id 53.676%; ungapped id
                     54.074%; E()=3.7e-25; 136 aa overlap; query 4-139; subject
                     2-136"
                     /note="similarity:fasta; with=UniProt:Q3BZA3
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Hypothetical protein.; length=142; id
                     72.857%; ungapped id 72.857%; E()=1.4e-37; 140 aa overlap;
                     query 5-144; subject 3-142"
                     /db_xref="EnsemblGenomes-Gn:Smlt0143"
                     /db_xref="EnsemblGenomes-Tr:CAQ43752"
                     /db_xref="InterPro:IPR003736"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:B2FHA9"
                     /protein_id="CAQ43752.1"
                     /translation="MAQVFREAVSIEQLNALSRNTAIESLGIVFSAAGEDWLQATMPV
                     DERTRQPYGILHGGASVVLAETLGSSAGNLCVDTGKQVCVGLEINANHVRAVRSGTVT
                     GTARALHVGRSTQLWEIRIEDEQGRLVCISRLTLAVVAAGHG"
     misc_feature    155769..156005
                     /locus_tag="Smlt0143"
                     /note="HMMPfam hit to PF03061, Thioesterase superfamily,
                     score 6.6e-21"
                     /inference="protein motif:HMMPfam:PF03061"
     CDS             156143..156961
                     /transl_table=11
                     /locus_tag="Smlt0144"
                     /product="putative transmembrane acetyltransferase"
                     /note="similarity:fasta; with=UniProt:Q4V098
                     (EMBL:CP000050;); Xanthomonas campestris pv. campestris
                     (strain 8004).; Acetyltransferase.; length=267; id
                     70.229%; ungapped id 71.318%; E()=5.7e-68; 262 aa overlap;
                     query 12-269; subject 4-265"
                     /db_xref="EnsemblGenomes-Gn:Smlt0144"
                     /db_xref="EnsemblGenomes-Tr:CAQ43753"
                     /db_xref="GOA:B2FHB0"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:B2FHB0"
                     /protein_id="CAQ43753.1"
                     /translation="MTALRYRARMTSPTPAPRGGVARVCRYLYRVPLLLVHIIVFLPL
                     ILIGMLPPWGELRVGEATFGAKVVNWWQGGLMWIFGFRLVQVGAPLPGAVLFVANHVS
                     WVDICILHSQRMMGFVAKREIASWPLVGWLAARGQTIFHQRGSTESLGGVMQVMADRL
                     REGKAVGVFPEGRTRGGHEVGPFHARIFQAAVETGVPVQPVALVYGAKGDAQTIVAFG
                     PNESFFANFLRLLGEPARRAEVHFLAPIGAQDLEGRRRIAETSRARIVAAMSAG"
     misc_feature    156233..156301
                     /locus_tag="Smlt0144"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0144 by TMHMM2.0 at aa 31-53"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    156380..156754
                     /locus_tag="Smlt0144"
                     /note="HMMPfam hit to PF01553, Acyltransferase, score
                     9.2e-23"
                     /inference="protein motif:HMMPfam:PF01553"
     repeat_region   156541..156548
                     /rpt_unit_seq="(cg)4"
     repeat_region   156924..156933
                     /rpt_unit_seq="(cg)5"
     CDS             156969..158003
                     /transl_table=11
                     /locus_tag="Smlt0145"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PE03
                     (EMBL:AE012114;); Xanthomonas campestris pv. campestris.;
                     Hypothetical protein XCC0180.; length=328; id 66.972%;
                     ungapped id 67.178%; E()=1.1e-89; 327 aa overlap; query
                     16-341; subject 1-327"
                     /db_xref="EnsemblGenomes-Gn:Smlt0145"
                     /db_xref="EnsemblGenomes-Tr:CAQ43754"
                     /db_xref="InterPro:IPR012020"
                     /db_xref="InterPro:IPR022742"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B2FHB1"
                     /protein_id="CAQ43754.1"
                     /translation="MALIPPPVLDAGTPTLHAADYQPPRWLRNPHLQSMLSSSRMRLQ
                     RGLLLLAATGAVSEELILDGGDGVRLQGWHSHVEGREPKGIALLLHGWEGSAESSYMR
                     MAAARMIEQGFDVVRLNFRDHGNTHHLNPGIFHSNLIDEVVHAAGDIAQRWPQLPLVA
                     AGYSLGGNFVLRLALRAPAAGVPLLRVASVCPVLDPALTMESIENGPAMYDWYFRRKW
                     AGSLRRKRDLFPELSDCDDRVLKLDIRALTAWLVERHTSFGSLQAYFDGYSIAGDRLS
                     SLQVPADILMAQDDPVIPYATFSNWQLPGQARLETACWGGHCGFIENWRGDGFSERWV
                     AQRLQRVLQA"
     repeat_region   157107..157118
                     /rpt_unit_seq="(ctg)4"
     repeat_region   157493..157500
                     /rpt_unit_seq="(gc)4"
     CDS             158060..160129
                     /transl_table=11
                     /locus_tag="Smlt0146"
                     /product="putative TPR repeat protein"
                     /note="similarity:fasta; with=UniProt:Q8PQX0
                     (EMBL:AE011644;); Xanthomonas axonopodis pv. citri.;
                     Hypothetical protein XAC0199.; length=710; id 54.928%;
                     ungapped id 55.007%; E()=2.6e-141; 690 aa overlap; query
                     1-689; subject 21-710"
                     /note="similarity:fasta; with=UniProt:Q8PE02
                     (EMBL:AE012114;); Xanthomonas campestris pv. campestris.;
                     Hypothetical protein XCC0181.; length=690; id 54.638%;
                     ungapped id 54.717%; E()=4.3e-141; 690 aa overlap; query
                     1-689; subject 1-690"
                     /db_xref="EnsemblGenomes-Gn:Smlt0146"
                     /db_xref="EnsemblGenomes-Tr:CAQ43755"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B2FHB2"
                     /protein_id="CAQ43755.1"
                     /translation="MQDQIIQALRQNQADQAVQLAQAWTRDEPGQANAHRWLALALQQ
                     QGNAEEAMEALQQALRLAPDDAQLHLQHAGLLLALRQFEGADEALVRTTGLDPNSFSA
                     YLMQAHLAIGRNDFDEAQRISTLAARVEPDHPELLTIDGMVALRRGDADRALALLSAA
                     SKALPDDTRVLYALGFAYLGKDMLAFAEQSFRRVLELNPSLSSLHGLVVQLALRQGNV
                     PAAAEAMQVALQQPEMDVPSMRRLAGELSLRNGQPLQALDYLLPLLETQPEDRQVLQL
                     LLMSWQRLGREDEARARLDAVLDTDDQLHDVWLARLAIEQVGSESAVTAVERWMAAMP
                     AHLPALEARLRLHDMAGEHAQAEAIAERIVSLEPGRVSGETRLVEGLLQRDPAAAVAR
                     VQALIELAPEEHRADLRTWMGEIQDRAGQPQDALRTWLSLQADQAPQRLPLPPQAKSP
                     PSWPDKGSIDGDASSAPIFLWGPPGSGVERVATGLAAASPVLRSDRYTNTPPDDAFQN
                     YNTLQDLASGVLTPERLVQRWREQLPARGLQSDTVIDWLLWWDNALLWALRPQLPQGR
                     LVLVLRDPRDMLLDWVAYGAAAPLAMTSLAEASEWLTRALTQIATLHEDDLYPHVLLR
                     IDQIGNDPQAMAELLGRLFERPMPPAAQLGAPRLPAGHWRNYRDVMSAAFAQLTPVAV
                     RLGYPEE"
     misc_feature    158144..158254
                     /locus_tag="Smlt0146"
                     /note="HMMPfam hit to PF07720, Tetratricopeptide repeat,
                     score 0.089"
                     /inference="protein motif:HMMPfam:PF07720"
     misc_feature    158153..158254
                     /locus_tag="Smlt0146"
                     /note="HMMPfam hit to PF07719, Tetratricopeptide repeat,
                     score 4.5e-08"
                     /inference="protein motif:HMMPfam:PF07719"
     misc_feature    158153..158230
                     /locus_tag="Smlt0146"
                     /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
                     score 0.011"
                     /inference="protein motif:HMMPfam:PF07721"
     repeat_region   158437..158444
                     /rpt_unit_seq="(cg)4"
     misc_feature    158561..158662
                     /locus_tag="Smlt0146"
                     /note="HMMPfam hit to PF07719, Tetratricopeptide repeat,
                     score 0.0022"
                     /inference="protein motif:HMMPfam:PF07719"
     repeat_region   159216..159227
                     /rpt_unit_seq="(ccg)4"
     CDS             160140..160751
                     /transl_table=11
                     /locus_tag="Smlt0147"
                     /product="putative phosphatidylethanolamine-binding
                     protein"
                     /note="similarity:fasta; with=UniProt:Q8PE01
                     (EMBL:AE012114;); Xanthomonas campestris pv. campestris.;
                     Hypothetical protein XCC0182.; length=203; id 78.218%;
                     ungapped id 78.218%; E()=6.3e-66; 202 aa overlap; query
                     1-202; subject 1-202"
                     /db_xref="EnsemblGenomes-Gn:Smlt0147"
                     /db_xref="EnsemblGenomes-Tr:CAQ43756"
                     /db_xref="InterPro:IPR005247"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="UniProtKB/TrEMBL:B2FHB3"
                     /protein_id="CAQ43756.1"
                     /translation="MQLTSHSLTNGAPIDREFAAGDANGFAPDRNPHLAWSGAPAGTR
                     SFLLVCVDPDVPTVPETVGRGDMSVPRDQPRCDFVHWVMADIPATVQEIAAGSCSDGF
                     VVKGKPAPAGPAGSRQGLNDFTGWFAGNPDMAGDYLGYDGPYPPFNDERMHRYFFRVF
                     ALDVASLDLPQRFTAADAYRAMHGHVLAEAALHGTYTLNPALG"
     misc_feature    160155..160736
                     /locus_tag="Smlt0147"
                     /note="HMMPfam hit to PF01161,
                     Phosphatidylethanolamine-binding protein, score 1.5e-07"
                     /inference="protein motif:HMMPfam:PF01161"
     CDS             complement(160836..161459)
                     /transl_table=11
                     /locus_tag="Smlt0148"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PE00
                     (EMBL:AE012114;); Xanthomonas campestris pv. campestris.;
                     Hypothetical protein XCC0183.; length=274; id 31.544%;
                     ungapped id 33.099%; E()=2e-05; 149 aa overlap; query
                     63-207; subject 34-179"
                     /db_xref="EnsemblGenomes-Gn:Smlt0148"
                     /db_xref="EnsemblGenomes-Tr:CAQ43757"
                     /db_xref="InterPro:IPR005184"
                     /db_xref="UniProtKB/TrEMBL:B2FHB4"
                     /protein_id="CAQ43757.1"
                     /translation="MEGRPRGRPSSWSVGPAAGRLPCAALPTHGCCRPAADTTRMHRE
                     IGMKHVPVLIIAALLAMSANVAAASTPSTPSTPSTDQLEAHLWQLVRATNAQGKRIDA
                     LFVRGRAPYTLRFQSGFMSELNLCNHVSNEYRLQGNLLILRNSVQTTALCVDQRLPTQ
                     QKLAGKLMHGEGSAPTLALDDRGALVLRNARGDTAVFEPAALQADGR"
     repeat_region   161224..161250
                     /rpt_unit_seq="(gtgctgggc)3"
     CDS             complement(161464..162291)
                     /transl_table=11
                     /locus_tag="Smlt0149"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q1I8U0
                     (EMBL:CT573326;); Pseudomonas entomophila L48.;
                     Hypothetical protein.; length=271; id 47.893%; ungapped id
                     50.403%; E()=3e-38; 261 aa overlap; query 12-269; subject
                     13-263"
                     /db_xref="EnsemblGenomes-Gn:Smlt0149"
                     /db_xref="EnsemblGenomes-Tr:CAQ43758"
                     /db_xref="InterPro:IPR005184"
                     /db_xref="InterPro:IPR025485"
                     /db_xref="UniProtKB/TrEMBL:B2FHB5"
                     /protein_id="CAQ43758.1"
                     /translation="MNRKLTLLLPLALMAACSQTPAPAGTGGDDVAPAAAKAADQQTL
                     AHLDAQRLQSQHWLLQQATGADGKRIDALFAREDKPVTLDFADGRLSVSNTCNRMGGG
                     YTLADGKLTVSAMASTMMACTDKALMALDEAVSSRLQGELKAEQDADGKLTLTTAKGD
                     VLVFNPEPTAETRYGGAGETVFLEVAAKTEKCSHPLIPDYQCLQVREVKFDDKGLKQG
                     EPGKFENFYGNIEGYTHEDGVRNVVRVKRYEVKNPPADAPSQAYVLDMVVESAIEKK"
     misc_feature    complement(161824..162141)
                     /locus_tag="Smlt0149"
                     /note="HMMPfam hit to PF03724, Domain of unknown function
                     (306), score 1.4e-24"
                     /inference="protein motif:HMMPfam:PF03724"
     repeat_region   complement(162184..162233)
                     /rpt_family="GC_rich"
                     /inference="nucleotide motif:RepeatScout"
     sig_peptide     complement(162220..162291)
                     /locus_tag="Smlt0149"
                     /note="Signal peptide predicted for Smlt0149 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.662 between residues 24 and 25"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(162365..163159)
                     /transl_table=11
                     /locus_tag="Smlt0150"
                     /product="putative transmembrane
                     undecaprenyl-diphosphatase"
                     /note="similarity:fasta; with=UniProt:Q8PDZ9
                     (EMBL:AE012114;); Xanthomonas campestris pv. campestris.;
                     uppP; Undecaprenyl-diphosphatase (EC 3.6.1.27)
                     (Undecaprenyl pyrophosphate phosphatase) (Bacitracin
                     resistance protein).; length=263; id 77.481%; ungapped id
                     77.481%; E()=3e-70; 262 aa overlap; query 1-262; subject
                     1-262"
                     /db_xref="EnsemblGenomes-Gn:Smlt0150"
                     /db_xref="EnsemblGenomes-Tr:CAQ43759"
                     /db_xref="GOA:B2FHB6"
                     /db_xref="InterPro:IPR003824"
                     /db_xref="UniProtKB/Swiss-Prot:B2FHB6"
                     /protein_id="CAQ43759.1"
                     /translation="MSDLLSALLLGILEGLTEFLPISSTGHLLIAQHWLGARSDFFNI
                     VIQAGAIVAVVLVFRQRLLQLATGFNQRGNREYVFKLGAAFLVTAVVGLVVRKAGWSL
                     PETVSPVAWALIIGGVWMLLVEAYTARLPDRDQVTWTVAIGVGLAQVVAGVFPGTSRS
                     ASAIFLAMLLGLSRRAAAAEFVFLVGIPTMFAASAYTFLEMAKAGQLGSEDWADVGVA
                     FLAAAITGFVVVKWLMGYIKSHRFTAFAIYRIALGAALLLWLPSGS"
     misc_feature    complement(order(162371..162430,162458..162526,
                     162563..162631,162689..162754,162791..162847,
                     162875..162928,162986..163039))
                     /locus_tag="Smlt0150"
                     /note="7 probable transmembrane helices predicted for
                     Smlt0150 by TMHMM2.0 at aa 41-58, 78-95, 105-123, 136-157,
                     177-199, 212-234 and 244-263"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(162392..163144)
                     /locus_tag="Smlt0150"
                     /note="HMMPfam hit to PF02673, Bacitracin resistance
                     protein BacA, score 2.1e-100"
                     /inference="protein motif:HMMPfam:PF02673"
     repeat_region   complement(162622..162642)
                     /rpt_family="GC_rich"
                     /inference="nucleotide motif:RepeatScout"
     CDS             163383..164792
                     /transl_table=11
                     /gene="glnA"
                     /locus_tag="Smlt0151"
                     /product="putative glutamine synthetase
                     (glutamate--ammonia ligase)"
                     /EC_number="6.3.1.2"
                     /note="similarity:fasta; with=UniProt:P15124
                     (EMBL:AE017282;); Methylococcus capsulatus.; glnA;
                     Glutamine synthetase (EC 6.3.1.2) (Glutamate--ammonia
                     ligase).; length=469; id 68.803%; ungapped id 68.803%;
                     E()=2.2e-133; 468 aa overlap; query 1-468; subject 1-468"
                     /note="similarity:fasta; with=UniProt:Q8PDZ8
                     (EMBL:AE012114;); Xanthomonas campestris pv. campestris.;
                     glnA; Glutamine synthetase.; length=469; id 90.832%;
                     ungapped id 90.832%; E()=8.1e-176; 469 aa overlap; query
                     1-469; subject 1-469"
                     /db_xref="EnsemblGenomes-Gn:Smlt0151"
                     /db_xref="EnsemblGenomes-Tr:CAQ43760"
                     /db_xref="GOA:B2FHB7"
                     /db_xref="InterPro:IPR004809"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="InterPro:IPR027302"
                     /db_xref="InterPro:IPR027303"
                     /db_xref="UniProtKB/TrEMBL:B2FHB7"
                     /protein_id="CAQ43760.1"
                     /translation="MSVENVEKLIKDNQIEFVDLRFVDMRGVEQHVTFPVSIVEPSLF
                     EEGKMFDGSSIAGWKGINESDMVLLPDTASAYVDPFYADPTIVISCDILDPATMQPYG
                     RCPRGIAKRAEAYLKSSGIAETAFFGPEPEFFIFDSVRFANEMGNTFFKVDSEEAAWN
                     SGAKYDGANSGYRPGVKGGYFPVPPTDTLHDLRAEMCKTLEQVGIEVEVQHHEVATAG
                     QCEIGTKFSTLVQKADELLRMKYVIKNVAHRNGKTVTFMPKPIVGDNGSGMHVHQSLS
                     KGGTNLFSGDGYGGLSQLALWYIGGIFKHAKAINAFANSGTNSYKRLVPGFEAPVMLA
                     YSARNRSASCRIPWVSNPKARRIEMRFPDPIQSGYLTFTALMMAGLDGIKNQIDPGAP
                     SDKDLYDLPPEEEKLIPQVCSSLDQALEALDKDREFLKAGGVMSDDFIDGYIALKMQE
                     VTKFRAATHPLEYQLYYAS"
     misc_feature    163422..163667
                     /gene="glnA"
                     /locus_tag="Smlt0151"
                     /note="HMMPfam hit to PF03951, Glutamine synthetase,
                     beta-Grasp domain, score 1.3e-43"
                     /inference="protein motif:HMMPfam:PF03951"
     misc_feature    163686..164531
                     /gene="glnA"
                     /locus_tag="Smlt0151"
                     /note="HMMPfam hit to PF00120, Glutamine synthetase,
                     catalytic domain, score 1.3e-164"
                     /inference="protein motif:HMMPfam:PF00120"
     CDS             165140..165478
                     /transl_table=11
                     /gene="glnB"
                     /locus_tag="Smlt0152"
                     /product="nitrogen regulatory protein p-ii"
                     /note="similarity:fasta; with=UniProt:Q52905
                     (EMBL:AL591787;); Rhizobium meliloti (Sinorhizobium
                     meliloti).; glnB; Nitrogen regulatory protein P-II.;
                     length=112; id 75.000%; ungapped id 75.000%; E()=1.1e-25;
                     112 aa overlap; query 1-112; subject 1-112"
                     /note="similarity:fasta; with=UniProt:Q3BZ93
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; glnB; Nitrogen regulatory protein P-II.;
                     length=112; id 91.964%; ungapped id 91.964%; E()=7.2e-32;
                     112 aa overlap; query 1-112; subject 1-112"
                     /db_xref="EnsemblGenomes-Gn:Smlt0152"
                     /db_xref="EnsemblGenomes-Tr:CAQ43761"
                     /db_xref="GOA:B2FHB8"
                     /db_xref="InterPro:IPR002187"
                     /db_xref="InterPro:IPR002332"
                     /db_xref="InterPro:IPR011322"
                     /db_xref="InterPro:IPR015867"
                     /db_xref="InterPro:IPR017918"
                     /db_xref="UniProtKB/TrEMBL:B2FHB8"
                     /protein_id="CAQ43761.1"
                     /translation="MKLISAIIRPFKLDEVREALSDAGVSGITVTEVKGFGRQKGHTE
                     LYRGAEYVVDFLPKIKIETVVTDERADAVIEAIQSSAGTGKIGDGKIFVTAVEQVIRI
                     RTGEIGADAL"
     misc_feature    165149..165454
                     /gene="glnB"
                     /locus_tag="Smlt0152"
                     /note="HMMPfam hit to PF00543, Nitrogen regulatory protein
                     P-II, score 1.8e-67"
                     /inference="protein motif:HMMPfam:PF00543"
     CDS             165506..166930
                     /transl_table=11
                     /gene="amtB"
                     /locus_tag="Smlt0153"
                     /product="putative ammonia channel precursor (ammonia
                     transporter)"
                     /note="similarity:fasta; with=UniProt:P69680
                     (EMBL:AE005174;); Escherichia coli O157:H7.; amtB; Ammonia
                     channel precursor (Ammonia transporter).; length=428; id
                     57.447%; ungapped id 58.554%; E()=7.5e-76; 423 aa overlap;
                     query 55-474; subject 11-428"
                     /note="similarity:fasta; with=UniProt:Q8PDZ7
                     (EMBL:AE012115;); Xanthomonas campestris pv. campestris.;
                     amtB; Ammonium transporter.; length=491; id 69.311%;
                     ungapped id 70.789%; E()=5.3e-101; 479 aa overlap; query
                     3-474; subject 16-491"
                     /db_xref="EnsemblGenomes-Gn:Smlt0153"
                     /db_xref="EnsemblGenomes-Tr:CAQ43762"
                     /db_xref="GOA:B2FHB9"
                     /db_xref="InterPro:IPR001905"
                     /db_xref="InterPro:IPR002229"
                     /db_xref="InterPro:IPR018047"
                     /db_xref="InterPro:IPR024041"
                     /db_xref="InterPro:IPR029020"
                     /db_xref="UniProtKB/TrEMBL:B2FHB9"
                     /protein_id="CAQ43762.1"
                     /translation="MRLLTGWQARFHVVWLLMLLSALAAGAWPGNAHAQAQVSPLPSE
                     SVAVEPLQDTAAAAAAPAVAEAAAAYDHGDVAWMLTSTLLVLLMVVPGLALFYGGLVR
                     SKNVLSVLSQILVVFSLVLLLWVAYGYSAVFSAGNPFFGSFTEFAFLKGFTPESVGNT
                     PIKGLPDYLFVAFQSTFAGITTALIVGAFAERIKFRAVLLFSALWFTLSYIPMAHIVW
                     GGGYLGELGAIDFAGGTVVHINAGVAGLVAAWFVGKRLGYGQTALKPHNVPFTYIGAM
                     LLWVGWFGFNAGSAAAADTVASLAFLNTVLATAAAVLGWTLVEAISKGKPSALGAASG
                     AVAGLVGITPACGTVGPLGAIIIGFVAGVVCVWGVTGLKRLLKVDDTADVFGVHGVGG
                     IVGAILTGVFSAQSLGGTKAGLDIAHQVWVQVVSVGLTVVWSAVVTAVILLVVKVVVG
                     LRVTEEAERTGLDVTSHGESAYEA"
     sig_peptide     165506..165607
                     /gene="amtB"
                     /locus_tag="Smlt0153"
                     /note="Signal peptide predicted for Smlt0153 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.996 between residues 34 and 35"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    order(165542..165601,165734..165802,165821..165889,
                     166007..166075,166094..166162,166205..166264,
                     166301..166360,166388..166456,166490..166558,
                     166568..166621,166658..166726,166769..166837)
                     /gene="amtB"
                     /locus_tag="Smlt0153"
                     /note="12 probable transmembrane helices predicted for
                     Smlt0153 by TMHMM2.0 at aa 13-32, 77-99, 106-128, 168-190,
                     197-219, 234-253, 266-285, 295-317, 329-351, 355-372,
                     385-407 and 422-444"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    165731..166921
                     /gene="amtB"
                     /locus_tag="Smlt0153"
                     /note="HMMPfam hit to PF00909, Ammonium Transporter
                     Family, score 9.9e-162"
                     /inference="protein motif:HMMPfam:PF00909"
     repeat_region   166428..166439
                     /rpt_unit_seq="(ccg)4"
     CDS             167154..167900
                     /transl_table=11
                     /locus_tag="Smlt0154"
                     /product="putative N-acetylmuramoyl-L-alanine amidase"
                     /note="similarity:fasta; with=UniProt:Q4UPV6
                     (EMBL:CP000050;); Xanthomonas campestris pv. campestris
                     (strain 8004).; N-acetylmuramoyl-L-alanine amidase.;
                     length=266; id 64.198%; ungapped id 65.272%; E()=2.7e-61;
                     243 aa overlap; query 1-243; subject 8-246"
                     /db_xref="EnsemblGenomes-Gn:Smlt0154"
                     /db_xref="EnsemblGenomes-Tr:CAQ43763"
                     /db_xref="GOA:B2FHC0"
                     /db_xref="InterPro:IPR002502"
                     /db_xref="UniProtKB/TrEMBL:B2FHC0"
                     /protein_id="CAQ43763.1"
                     /translation="MHPIRTVLMLSACLLLAACASAPQETRNPLATWVPSPNQNARTP
                     VIIVIHHTEQKSVQQSLHTLRTANSGGPVSAHYLVGADGHRYQLVADERRAWHAGAGR
                     WGTITDLNSASIGIELDNDGRSPFSAAQIESLIVLLRDLTSRLNIPPRQVIGHADLAP
                     TRKQDPSRFFPWQQLAEVGFGVWPRAADGAAPEGFDAWNALARFGYPLDNREATVAAF
                     HRRFRGRDDLPKTLDAEDARILYSLLLQTP"
     sig_peptide     167154..167219
                     /locus_tag="Smlt0154"
                     /note="Signal peptide predicted for Smlt0154 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.489 between residues 22 and 23"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    167250..167702
                     /locus_tag="Smlt0154"
                     /note="HMMPfam hit to PF01510, N-acetylmuramoyl-L-alanine
                     amidase, score 2.3e-32"
                     /inference="protein motif:HMMPfam:PF01510"
     repeat_region   167704..167711
                     /rpt_unit_seq="(cg)4"
     CDS             167968..169134
                     /transl_table=11
                     /locus_tag="Smlt0155"
                     /product="putative murein degrading transcglycosylase"
                     /note="similarity:fasta; with=UniProt:Q4ZY34
                     (EMBL:CP000075;); Pseudomonas syringae pv. syringae
                     (strain B728a).; MltA:3D precursor.; length=403; id
                     72.340%; ungapped id 73.315%; E()=1.4e-103; 376 aa
                     overlap; query 14-387; subject 15-387"
                     /db_xref="EnsemblGenomes-Gn:Smlt0155"
                     /db_xref="EnsemblGenomes-Tr:CAQ43764"
                     /db_xref="GOA:B2FHC1"
                     /db_xref="InterPro:IPR005300"
                     /db_xref="InterPro:IPR009009"
                     /db_xref="InterPro:IPR010611"
                     /db_xref="InterPro:IPR026044"
                     /db_xref="UniProtKB/TrEMBL:B2FHC1"
                     /protein_id="CAQ43764.1"
                     /translation="MIDSATFVKRRHCILLAAAVLAGCATTAPRTGSEAPTPTMPPAA
                     TYAKAAWSALPPVSNSDLQAGFVAWRSSCTRLKNDAVWAKPCATAAAVSDKDPAAIRQ
                     FLQRDLDAYALRAGGHQADGLITGYYEPIYAGSLTRTDKATVPVYGTPDDLVVVQLES
                     LYPELKGKRLRGRVEGKVLKPYDDAGTIAAQGANAPVLAWLTDPMDLQLLQIQGSGRV
                     RLADGKQVRLAYAEQNGHPYRAVGRWLVDQGQLKKEDVTMDAIRAWARANPARVPELL
                     RSNPSYVFFVRNPDSPEGPRGSLNVPLTAGYSVAVDRSVVPLGSLLWLSTTRPDGTPV
                     VRPVAAQDTGGAIAGEVRADLYWGSGDAAGKLAGDMKQKGNIWMLWPKGAPLPN"
     sig_peptide     167968..168048
                     /locus_tag="Smlt0155"
                     /note="Signal peptide predicted for Smlt0155 by SignalP
                     2.0 HMM (Signal peptide probability 0.998) with cleavage
                     site probability 0.486 between residues 27 and 28"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    168259..168876
                     /locus_tag="Smlt0155"
                     /note="HMMPfam hit to PF03562, MltA N-terminal domain,
                     score 1.3e-110"
                     /inference="protein motif:HMMPfam:PF03562"
     repeat_region   168774..168781
                     /rpt_unit_seq="(cg)4"
     misc_feature    168886..169107
                     /locus_tag="Smlt0155"
                     /note="HMMPfam hit to PF06725, 3D domain, score 1.2e-34"
                     /inference="protein motif:HMMPfam:PF06725"
     CDS             169243..169557
                     /transl_table=11
                     /locus_tag="Smlt0156"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q2SGE7
                     (EMBL:CP000155;); Hahella chejuensis (strain KCTC 2396).;
                     Hypothetical protein.; length=86; id 35.000%; ungapped id
                     35.897%; E()=0.014; 80 aa overlap; query 18-96; subject
                     2-80"
                     /db_xref="EnsemblGenomes-Gn:Smlt0156"
                     /db_xref="EnsemblGenomes-Tr:CAQ43765"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:B2FHC2"
                     /protein_id="CAQ43765.1"
                     /translation="MTYAKHNAKRGAKSAAKKYYKHWAESGLGKGNVLMEARGEKIVR
                     QVEIYGTKMVWADEHAHSDDRFLLADQPVSFLDFDEDDEISAREFEAAWKKAREATGY
                     PV"
     CDS             169665..171710
                     /transl_table=11
                     /locus_tag="Smlt0157"
                     /product="putative TonB dependent transport protein"
                     /note="Similar to ) escherichia coli. feca UniProt:P13036
                     (EMBL:M20981 (774 aa) fasta scores: E()=2.7e-12, 23.547%
                     id in 671 aa, and to ) xanthomonas axonopodis pv. citri.
                     feca UniProt:Q8PPJ6 (EMBL:AE011697 (681 aa) fasta scores:
                     E()=0, 77.827% id in 681 aa"
                     /note="similarity:fasta; with=UniProt:P13036
                     (EMBL:M20981;); Escherichia coli.; fecA; Iron(III)
                     dicitrate transport protein fecA precursor.; length=774;
                     id 23.547%; ungapped id 26.555%; E()=2.7e-12; 671 aa
                     overlap; query 53-681; subject 138-774"
                     /note="similarity:fasta; with=UniProt:Q8PPJ6
                     (EMBL:AE011697;); Xanthomonas axonopodis pv. citri.; fecA;
                     TonB-dependent receptor.; length=681; id 77.827%; ungapped
                     id 77.827%; E()=0; 681 aa overlap; query 1-681; subject
                     1-681"
                     /db_xref="EnsemblGenomes-Gn:Smlt0157"
                     /db_xref="EnsemblGenomes-Tr:CAQ43766"
                     /db_xref="GOA:B2FHC3"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="UniProtKB/TrEMBL:B2FHC3"
                     /protein_id="CAQ43766.1"
                     /translation="MKTPTLVAALAAAPFAPEAFAQSADAALTLGKVQVHQHGEGQLS
                     ARQVLTSVDVLGADQIEDRNVSHSWELLGQMPGIQLTETRQGAESGKVSFRAFNGEGY
                     LNAIKTLIDGIPSNVNSGNQRFIDMLFPLDISYIEVVRGTNDPRYGLHNIGGNVNFGT
                     RQGGSYTDARLAYGSYNTRDAQLAVGREANGFAQNYFVGTQASDGYRDHDTSKKYSLG
                     GKWFFGTLDEGLRVGLTARAYHHEADEPGFMTAEELRTLRRGSELRNGNDGDDRDMRQ
                     IAAHVDLKLSDALTFGTRLYYNRYEDDRRVTFSDLPTGNLPRQRRVWDERQTGLLSTL
                     TWQASPALTVEGGLNYEQQDNGYIRERYAYAEPTDYSQPPARVQNDDRHSFDNWGAYV
                     QAVYQPVEAWKIVPAYRVDRFSGRTHLMNGITARLQDYGSIGQPKLSIIHSLGQTTHV
                     YANWGRTFQVLTGSTAPAYLTPGQAPMQPSTNTGMELGLKFQPFQGAQARLAVWQQDA
                     ENEVSNMPATGTTVTLGKTRRRGVDAQLSLQLGDDWTVWASHAYQEAKITRDDRDAGI
                     SLQGREVAATPRHISNLGVDYRATDALRLGLQARAQGDYYLEERNVAGKFGGFAVLDL
                     SAAYQLTPRFSVDLQLKNVTGRQYAYAWYDSFFWDSARPMFSPAPGRSVFVGLNMKL"
     sig_peptide     169665..169727
                     /locus_tag="Smlt0157"
                     /note="Signal peptide predicted for Smlt0157 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.964 between residues 21 and 22"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    169794..170129
                     /locus_tag="Smlt0157"
                     /note="HMMPfam hit to PF07715, TonB-dependent Receptor
                     Plug Domain, score 5.2e-19"
                     /inference="protein motif:HMMPfam:PF07715"
     repeat_region   169795..169802
                     /rpt_unit_seq="(gc)4"
     repeat_region   170370..170377
                     /rpt_unit_seq="(gc)4"
     misc_feature    170967..171707
                     /locus_tag="Smlt0157"
                     /note="HMMPfam hit to PF00593, TonB dependent receptor,
                     score 2.5e-20"
                     /inference="protein motif:HMMPfam:PF00593"
     CDS             171881..172942
                     /transl_table=11
                     /gene="glnL"
                     /locus_tag="Smlt0158"
                     /product="putative nitrogen regulation protein nr(ii)"
                     /EC_number="2.7.13.3"
                     /note="similarity:fasta; with=UniProt:P0AFB5
                     (EMBL:K02176;); Escherichia coli.; glnL; Nitrogen
                     regulation protein NR(II) (EC 2.7.13.3).; length=349; id
                     36.599%; ungapped id 38.024%; E()=1e-29; 347 aa overlap;
                     query 2-339; subject 5-347"
                     /note="similarity:fasta; with=UniProt:Q3BZ91
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; ntrB; Two-component system sensor
                     protein.; length=351; id 77.419%; ungapped id 77.419%;
                     E()=1.4e-96; 341 aa overlap; query 8-348; subject 8-348"
                     /db_xref="EnsemblGenomes-Gn:Smlt0158"
                     /db_xref="EnsemblGenomes-Tr:CAQ43767"
                     /db_xref="GOA:B2FHC4"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="UniProtKB/TrEMBL:B2FHC4"
                     /protein_id="CAQ43767.1"
                     /translation="MSDPAPPPSLDALGTPLAWAGADGCIAGCNPAFARWLGVSVRRL
                     LGRPLVALEVQGEALAHFLARDERDSLRLNRLALAVPGEAPRFAEGWMSRRDDGGWLL
                     EAHPVDEFPGLDPTQALPSALSAALKGLAHELRNPLAGLKGAAQLLARRAAQRDAGER
                     ELIELIGSEIERLNGLLDQLLSPAPAAPHAELNIHAALERVLRLAESEAGWAVRLQRD
                     YDPSIPEFHGDADRLTQAVWNLVRNAIQAGAGNITLRTRVEHGVRIAEQLHTLALRLE
                     IADDGRGVPEELAEHLFLPLVSGRAEGTGLGLALAQQVAREHRGTLTYRSRPGHTVFT
                     LLLPIVSGAAPAEEAPRDV"
     misc_feature    172244..172447
                     /gene="glnL"
                     /locus_tag="Smlt0158"
                     /note="HMMPfam hit to PF00512, His Kinase A
                     (phosphoacceptor) domain, score 1.8e-13"
                     /inference="protein motif:HMMPfam:PF00512"
     repeat_region   complement(172425..172445)
                     /rpt_family="GC_rich"
                     /inference="nucleotide motif:RepeatScout"
     misc_feature    172562..172900
                     /gene="glnL"
                     /locus_tag="Smlt0158"
                     /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
                     gyrase B-, and HSP90, score 7.7e-32"
                     /inference="protein motif:HMMPfam:PF02518"
     CDS             172935..174383
                     /transl_table=11
                     /gene="glnG"
                     /locus_tag="Smlt0159"
                     /product="putative nitrogen regulation protein nr(i)"
                     /note="similarity:fasta; with=UniProt:P0AFB8
                     (EMBL:D16509;); Escherichia coli.; glnG; Nitrogen
                     regulation protein NR(I).; length=469; id 51.404%;
                     ungapped id 51.965%; E()=1.5e-78; 463 aa overlap; query
                     11-473; subject 6-463"
                     /note="similarity:fasta; with=UniProt:Q4V088
                     (EMBL:CP000050;); Xanthomonas campestris pv. campestris
                     (strain 8004).; Two-component system regulatory protein.;
                     length=476; id 76.299%; ungapped id 77.590%; E()=2.6e-125;
                     481 aa overlap; query 1-479; subject 1-475"
                     /db_xref="EnsemblGenomes-Gn:Smlt0159"
                     /db_xref="EnsemblGenomes-Tr:CAQ43768"
                     /db_xref="GOA:B2FHC5"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR010114"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR025943"
                     /db_xref="InterPro:IPR025944"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B2FHC5"
                     /protein_id="CAQ43768.1"
                     /translation="MSESSSSPQRIWVVDDDRAVRFVLCTALREAGYQVVDFDSAAPA
                     LQALSEGPPPALLFTDVRMPGDDGLVLLDKLKAALPQLPVVVMSAYTDVASTAGAFRG
                     GAHEFLSKPFDLDDAVALAQRVLPAVAPALAAATPAAEAHSDQPPQLVGDTPPMRALF
                     RAIGRLAQAPLAVLITGETGTGKELVANALHRESPRAQGPFVALNTAAIPSELLESEL
                     FGHEAGAFTGAQRRHIGRFEQADGGTLFLDEIGDMPLPLQTRLLRVLAQGEFFRVGGR
                     ELIRVDVRVVAATHQDLEGLVAQGKFRADLLHRLDVVRLQLPPLRERREDIAQLASTF
                     LAAAARKLDTPPKRLTAAALQALREHDWPGNVRELENVCWRMAALAAADTIGVADVDT
                     ALNRTRGRRSSTTSADPGQWEALLAEWARRQLAEGVEGLHAQVRERVDHALLEAALQI
                     THGRRAEAAARLGLGRNTLTRKLGAGRRRGGH"
     misc_feature    172959..173300
                     /gene="glnG"
                     /locus_tag="Smlt0159"
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 3.3e-27"
                     /inference="protein motif:HMMPfam:PF00072"
     misc_feature    173379..174044
                     /gene="glnG"
                     /locus_tag="Smlt0159"
                     /note="HMMPfam hit to PF00158, Sigma-54 interaction
                     domain, score 1.2e-141"
                     /inference="protein motif:HMMPfam:PF00158"
     repeat_region   173402..173409
                     /rpt_unit_seq="(gc)4"
     repeat_region   173518..173525
                     /rpt_unit_seq="(cg)4"
     misc_feature    174240..174362
                     /gene="glnG"
                     /locus_tag="Smlt0159"
                     /note="HMMPfam hit to PF02954, Bacterial regulatory
                     protein, Fis fam, score 2.5e-09"
                     /inference="protein motif:HMMPfam:PF02954"
     repeat_region   complement(174353..174378)
                     /rpt_family="GC_rich"
                     /inference="nucleotide motif:RepeatScout"
     CDS             174477..175046
                     /transl_table=11
                     /gene="sodC1"
                     /locus_tag="Smlt0160"
                     /product="putative superoxide dismutase [Cu-Zn]"
                     /EC_number="1.15.1.1"
                     /note="similarity:fasta; with=UniProt:Q9C0N4
                     (EMBL:AF248049;); bacillisporus).; SOD1; Superoxide
                     dismutase [Cu-Zn] (EC 1.15.1.1).; length=153; id 40.278%;
                     ungapped id 43.609%; E()=1.2e-12; 144 aa overlap; query
                     52-187; subject 11-151"
                     /note="similarity:fasta; with=UniProt:Q3BZ89
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; sodC1; Superoxide dismutase precursor (EC
                     1.15.1.1).; length=200; id 58.549%; ungapped id 60.106%;
                     E()=9e-39; 193 aa overlap; query 1-189; subject 1-192"
                     /db_xref="EnsemblGenomes-Gn:Smlt0160"
                     /db_xref="EnsemblGenomes-Tr:CAQ43769"
                     /db_xref="GOA:B2FHC6"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="InterPro:IPR018152"
                     /db_xref="InterPro:IPR024134"
                     /db_xref="UniProtKB/TrEMBL:B2FHC6"
                     /protein_id="CAQ43769.1"
                     /translation="MRLSFAILPLSAAVLLSACGSAPKKTEPTPPPPTVVSAAKQGEA
                     NIAPASASIVSGRIALMVEPGGIHITGLIGGLQPMQQAGFHIHERGDCSAVDASSAGN
                     HFNPGGAAHGRAGTGKHHLGDMDNLRADAQGRANVDIHLKGVTLGGGAATDIAGRALV
                     VHANADDYRSQPAGNAGVRIACGVIRVVR"
     sig_peptide     174477..174548
                     /gene="sodC1"
                     /locus_tag="Smlt0160"
                     /note="Signal peptide predicted for Smlt0160 by SignalP
                     2.0 HMM (Signal peptide probability 0.997) with cleavage
                     site probability 0.644 between residues 24 and 25"
                     /inference="protein motif:SignalP:2.0"
     repeat_region   174564..174575
                     /rpt_unit_seq="(ccg)4"
     misc_feature    174591..175034
                     /gene="sodC1"
                     /locus_tag="Smlt0160"
                     /note="HMMPfam hit to PF00080, Copper/zinc superoxide
                     dismutase (SODC), score 4.3e-26"
                     /inference="protein motif:HMMPfam:PF00080"
     CDS             175078..175704
                     /transl_table=11
                     /gene="sodC2"
                     /locus_tag="Smlt0161"
                     /product="putative superoxide dismutase"
                     /note="similarity:fasta; with=UniProt:Q2NM35
                     (EMBL:AY880950;); Bombus ignitus.; sod; Sod.; length=151;
                     id 47.260%; ungapped id 53.077%; E()=5.9e-14; 146 aa
                     overlap; query 68-204; subject 9-147"
                     /note="similarity:fasta; with=UniProt:Q3BZ88
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; sodC2; Superoxide dismutase precursor (EC
                     1.15.1.1).; length=215; id 65.865%; ungapped id 68.159%;
                     E()=2.3e-43; 208 aa overlap; query 1-204; subject 1-205"
                     /db_xref="EnsemblGenomes-Gn:Smlt0161"
                     /db_xref="EnsemblGenomes-Tr:CAQ43770"
                     /db_xref="GOA:B2FHC7"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="InterPro:IPR018152"
                     /db_xref="InterPro:IPR024134"
                     /db_xref="UniProtKB/TrEMBL:B2FHC7"
                     /protein_id="CAQ43770.1"
                     /translation="MRLIHTSLFAAIAALGLAACNQQPAAPQAETPPAAPADGATTEP
                     AATPAPAAAPAADATASAELAPTQGNETKGSVTFKVVDGKVHVTGQISGLKPGSEHGF
                     HIHEKGDCSAPDGMSAGGHFNPGKQDHGNVATDPHHGGDMPNIKADDKGVATIDGPVS
                     SNVNIGKGDDFDIIGRGLIVHADADDYKTQPTGNAGARLACAVIQKAQ"
     sig_peptide     175078..175152
                     /gene="sodC2"
                     /locus_tag="Smlt0161"
                     /note="Signal peptide predicted for Smlt0161 by SignalP
                     2.0 HMM (Signal peptide probability 0.999) with cleavage
                     site probability 0.494 between residues 25 and 26"
                     /inference="protein motif:SignalP:2.0"
     repeat_region   complement(175169..175189)
                     /rpt_family="GC_rich"
                     /inference="nucleotide motif:RepeatScout"
     misc_feature    175249..175695
                     /gene="sodC2"
                     /locus_tag="Smlt0161"
                     /note="HMMPfam hit to PF00080, Copper/zinc superoxide
                     dismutase (SODC), score 7e-45"
                     /inference="protein motif:HMMPfam:PF00080"
     repeat_region   175664..175671
                     /rpt_unit_seq="(gc)4"
     CDS             complement(175805..176905)
                     /transl_table=11
                     /locus_tag="Smlt0162"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0162"
                     /db_xref="EnsemblGenomes-Tr:CAQ43771"
                     /db_xref="GOA:B2FHC8"
                     /db_xref="InterPro:IPR006260"
                     /db_xref="UniProtKB/TrEMBL:B2FHC8"
                     /protein_id="CAQ43771.1"
                     /translation="MDTHARSRTNCMLCRLQCAGLTLLAAAVCGLPIMAQAAVPVAAT
                     PTCTVAPAFAAAVAEPEVYDSHISFSNTVKVQVNVDAQGRAHDARVLNGSRNRVLDDA
                     ARQAALSWKYQCTGPGGIAQPVVPVPEPACRLDRLSWADNEPRFSSAVRSSGLRGSAE
                     VWLRPVAGDPAKTEVKIGRSSGDARIDDTLLNAARNWRLTCPPDAPVKHPWISFTQSF
                     NFEPRRQPAATEASEPEPDDVVIANDALLEFGTVAGFVEALPKMKGVDLAPDQSSQPG
                     MTLYNTSLGAIMREIEMTEGRLKPVTMTHWLVMVPPHRTAPAVVRTFKREVIDAKTGK
                     AHMQTDISILCESGPAECAELRRRRDTLLRSP"
     misc_feature    complement(176777..176845)
                     /locus_tag="Smlt0162"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0162 by TMHMM2.0 at aa 21-43"
                     /inference="protein motif:TMHMM:2.0"
     sig_peptide     complement(176795..176905)
                     /locus_tag="Smlt0162"
                     /note="Signal peptide predicted for Smlt0162 by SignalP
                     2.0 HMM (Signal peptide probability 0.997) with cleavage
                     site probability 0.470 between residues 37 and 38"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(176971..177858)
                     /transl_table=11
                     /locus_tag="Smlt0163"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PQV9
                     (EMBL:AE011646;); Xanthomonas axonopodis pv. citri.;
                     Hypothetical protein XAC0212.; length=301; id 68.367%;
                     ungapped id 68.601%; E()=7.2e-80; 294 aa overlap; query
                     1-294; subject 8-300"
                     /db_xref="EnsemblGenomes-Gn:Smlt0163"
                     /db_xref="EnsemblGenomes-Tr:CAQ43772"
                     /db_xref="UniProtKB/TrEMBL:B2FHC9"
                     /protein_id="CAQ43772.1"
                     /translation="MSKPDPAMNALGVLALELAGGEVPRQAVLSAEQAGELADRVGRD
                     LSKLVPQVAELDLVFAAAHFDPAEVLRPGWPIHRRLEELQMRAPGRNQGPRLLAFGTD
                     AQGDVPLPFQADASLVGGGLRVVPFLLTGSDVATTNAVAEALEDTLLANGMAHADTAL
                     MAQNTFGARIEHARYFTVNDLAAMMSMQYDNQGLAALWPLIETAIMAPGEDEWLNAAP
                     EPLLRYTHGEARMALFDPAGWCAHYDHGKNDCDRLKGIYEQFLMRQRQMAAVLEAHGV
                     PVLFVHCEAGQDARELLAR"
     repeat_region   176988..176995
                     /rpt_unit_seq="(cg)4"
     CDS             177952..179247
                     /transl_table=11
                     /gene="fadI"
                     /locus_tag="Smlt0164"
                     /product="putative 3-ketoacyl-CoA thiolase"
                     /EC_number="2.3.1.16"
                     /note="similarity:fasta; with=UniProt:P76503
                     (EMBL:AJ586889;); Escherichia coli.; fadI; 3-ketoacyl-CoA
                     thiolase (EC 2.3.1.16) (Fatty acid oxidation complex
                     subunit beta) (Beta-ketothiolase) (Acetyl-CoA
                     acyltransferase) (Acyl- CoA ligase) (ACSs).; length=436;
                     id 38.303%; ungapped id 39.387%; E()=1.2e-53; 436 aa
                     overlap; query 1-430; subject 5-434"
                     /note="similarity:fasta; with=UniProt:Q3BZ84
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Acetyl-CoA acyltransferase (EC
                     2.3.1.16).; length=431; id 90.487%; ungapped id 90.487%;
                     E()=7.6e-154; 431 aa overlap; query 1-431; subject 1-431"
                     /db_xref="EnsemblGenomes-Gn:Smlt0164"
                     /db_xref="EnsemblGenomes-Tr:CAQ43773"
                     /db_xref="GOA:B2FHD0"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:B2FHD0"
                     /protein_id="CAQ43773.1"
                     /translation="MPGISMPNARPVAILGGVRIPFCRQNTAYSDVGNLGMSVRTLGA
                     LVERFGLHGQQLGEVAMGAVIKHSSDWNLGREATLSSGLSPLTPGITLQRACGTSLDS
                     IITVANKIALGQIESGIGGGSDTTSDVPIVYGKKLRARLLAANRAKSTGDKIRALTSG
                     FKFSELKPEFPGVAEPRTGKSMGDHCEDMAKEWNISRDSQDEWAVSSHKKLAAAYERG
                     FFNDLIAPFRGVERDNILRPDTSLEKLATLKPAFDKVSGRGTLTAANSTPLTDGAAAV
                     LLASEEWARAHGHEPQAYLRDAHVSAVDFVHGEGLLMAPTVAVPEMLKRNGLTLQDFD
                     IYEIHEAFAAQVLCTLRAWESEDYCRNRLGLDAPMGRIDPDKINLLGSSLATGHPFAA
                     TGARVIATAAKQLAERGGGRALVSICTAGGMGVVAIVER"
     misc_feature    177976..178797
                     /gene="fadI"
                     /locus_tag="Smlt0164"
                     /note="HMMPfam hit to PF00108, Thiolase, N-terminal
                     domain, score 3.6e-54"
                     /inference="protein motif:HMMPfam:PF00108"
     repeat_region   178362..178371
                     /rpt_unit_seq="(gc)5"
     misc_feature    178816..179244
                     /gene="fadI"
                     /locus_tag="Smlt0164"
                     /note="HMMPfam hit to PF02803, Thiolase, C-terminal
                     domain, score 1e-35"
                     /inference="protein motif:HMMPfam:PF02803"
     CDS             complement(179367..180662)
                     /transl_table=11
                     /locus_tag="Smlt0165"
                     /product="putative transmembrane HemY porphyrin
                     biosynthesis protein"
                     /note="similarity:fasta; with=UniProt:Q8PDY8
                     (EMBL:AE012116;); Xanthomonas campestris pv. campestris.;
                     hemY; Porphyrin biosynthesis protein.; length=421; id
                     55.122%; ungapped id 55.392%; E()=1.7e-78; 410 aa overlap;
                     query 1-408; subject 1-410"
                     /db_xref="EnsemblGenomes-Gn:Smlt0165"
                     /db_xref="EnsemblGenomes-Tr:CAQ43774"
                     /db_xref="GOA:B2FHD1"
                     /db_xref="InterPro:IPR005254"
                     /db_xref="InterPro:IPR010817"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:B2FHD1"
                     /protein_id="CAQ43774.1"
                     /translation="MKPLQSLVVLLLAVAIGVVAAQWLGADDLNRFGEVTLRYGGYDY
                     HSNLPKVALLSVIAVLVLWLLWSLIAAPFRAWGRYRRKQGRVRLIDGLQAYEHGQWQR
                     AEKLLDGAAKDPEVSAVALANAVRSAQARADGPAGEALLQRLGESDATLQALLRAEQL
                     LARDLPVDAINALDVAAIQPLPPRGLWLRTEALARAGRAHEAYGQLGALRQSKVLPAE
                     SNSELEARLAAQALLEAADVNALAAQWEATPKALRPTPDVVGAYASRAVALNWDEPAL
                     LALEQALDQRWDDELVALYGRLPAERLATRQANLARWRNVHDGSAALHLAQGRVALAQ
                     QQWDAADTFLHEAIAAGAGAPAWEALGELFAQRGEHALAAQCLANALRLQRGEDSVAL
                     VRGSEAPLRATVEEQPIAVQPPVYDANEERDEFGNPRLP"
     misc_feature    complement(180264..180653)
                     /locus_tag="Smlt0165"
                     /note="HMMPfam hit to PF07219, HemY protein N-terminus,
                     score 9e-28"
                     /inference="protein motif:HMMPfam:PF07219"
     misc_feature    complement(order(180444..180512,180585..180644))
                     /locus_tag="Smlt0165"
                     /note="2 probable transmembrane helices predicted for
                     Smlt0165 by TMHMM2.0 at aa 7-26 and 51-73"
                     /inference="protein motif:TMHMM:2.0"
     sig_peptide     complement(180600..180662)
                     /locus_tag="Smlt0165"
                     /note="Signal peptide predicted for Smlt0165 by SignalP
                     2.0 HMM (Signal peptide probability 0.999) with cleavage
                     site probability 0.713 between residues 21 and 22"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(180669..181646)
                     /transl_table=11
                     /locus_tag="Smlt0166"
                     /product="putative uroporphyrinogen III
                     C-methyltransferase HemX"
                     /note="similarity:fasta; with=UniProt:Q8PQV6
                     (EMBL:AE011646;); Xanthomonas axonopodis pv. citri.;
                     Hypothetical protein XAC0215.; length=325; id 52.454%;
                     ungapped id 53.271%; E()=1.8e-53; 326 aa overlap; query
                     1-325; subject 1-322"
                     /db_xref="EnsemblGenomes-Gn:Smlt0166"
                     /db_xref="EnsemblGenomes-Tr:CAQ43775"
                     /db_xref="GOA:B2FHD2"
                     /db_xref="InterPro:IPR007470"
                     /db_xref="UniProtKB/TrEMBL:B2FHD2"
                     /protein_id="CAQ43775.1"
                     /translation="MNETPPVSPPRRPVRWLLPLAGVVVLGVGGYAGWYVWQQQQHEQ
                     EAQAQTMAVQLQGLEATLDALRRDQRATSQRLQDAATTNRVLRDEMLGLSQRSALLEE
                     NLAKLADSANQGRQAVQRDEAELLLTQAAQRLNYADDVEGARRLYAQAATALADLPDS
                     DGLNLRQALVQERDALDALGAGPRVQSLQRLDALARALQGLPSQVTGNAATDTAKPWW
                     QSTLAPFVDITPSRQNGPLTAAERRNADDALQLELTLARAAIERGDRTGRDTALERVE
                     HWAQRRWPDSPALRAQRAELKALRELPLQASNTVLGSTLQQLRTQTDRR"
     misc_feature    complement(180675..181643)
                     /locus_tag="Smlt0166"
                     /note="HMMPfam hit to PF04375, HemX, score 1.6e-05"
                     /inference="protein motif:HMMPfam:PF04375"
     repeat_region   180773..180780
                     /rpt_unit_seq="(gc)4"
     repeat_region   180874..180881
                     /rpt_unit_seq="(gc)4"
     repeat_region   181215..181222
                     /rpt_unit_seq="(gc)4"
     misc_feature    complement(181536..181604)
                     /locus_tag="Smlt0166"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0166 by TMHMM2.0 at aa 15-37"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(181751..182551)
                     /transl_table=11
                     /gene="hemD"
                     /locus_tag="Smlt0167"
                     /product="putative uroporphyrinogen-iii synthase (uros)
                     (uroporphyrinogen-iii cosynthetase) (hydroxymethylbilane
                     hydrolyase [cyclizing])"
                     /EC_number="4.2.1.75"
                     /note="similarity:fasta; with=UniProt:P48246
                     (EMBL:AE004938;); Pseudomonas aeruginosa.; hemD;
                     Uroporphyrinogen-III synthase (EC 4.2.1.75) (UROS)
                     (Uroporphyrinogen- III cosynthetase) (Hydroxymethylbilane
                     hydrolyase [cyclizing]).; length=251; id 30.924%; ungapped
                     id 32.766%; E()=7.6e-11; 249 aa overlap; query 16-255;
                     subject 3-246"
                     /note="similarity:fasta; with=UniProt:Q5GVD1
                     (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.; hemD;
                     Uroporphyrinogen-III synthase.; length=267; id 50.958%;
                     ungapped id 51.550%; E()=6.2e-37; 261 aa overlap; query
                     3-263; subject 7-264"
                     /db_xref="EnsemblGenomes-Gn:Smlt0167"
                     /db_xref="EnsemblGenomes-Tr:CAQ43776"
                     /db_xref="GOA:B2FHD3"
                     /db_xref="InterPro:IPR003754"
                     /db_xref="UniProtKB/TrEMBL:B2FHD3"
                     /protein_id="CAQ43776.1"
                     /translation="MADHTIPTGAAGSEPGWTFISLRPQGQNSALRRAVAGLGGHVVA
                     LPPWRLQRLNGMPVVRQLQRALNCDRVVFTSPAAVAAAASLLPLAEAQRSPWLTVGEG
                     TARALRAQGVGEVHAPQRMDSEGLLALPVLAEARGLRIGLVTAPGGRGLIAAHLQAAG
                     ATIERADVYQRRLLRLPPRTLARLPHSAQPWVLAVSSGEALQHFWQQLPPALQQRLQA
                     QATVVVASERLGDQAHALGLQRVVRAAGPTTAQLVAAAHATLTVPAAT"
     misc_feature    complement(181787..182476)
                     /gene="hemD"
                     /locus_tag="Smlt0167"
                     /note="HMMPfam hit to PF02602, Uroporphyrinogen-III
                     synthase HemD, score 4.5e-07"
                     /inference="protein motif:HMMPfam:PF02602"
     repeat_region   182235..182242
                     /rpt_unit_seq="(gc)4"
     CDS             182596..183063
                     /transl_table=11
                     /locus_tag="Smlt0168"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q3BZ79
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Hypothetical protein.; length=180; id
                     57.396%; ungapped id 58.788%; E()=6.1e-30; 169 aa overlap;
                     query 5-169; subject 11-179"
                     /db_xref="EnsemblGenomes-Gn:Smlt0168"
                     /db_xref="EnsemblGenomes-Tr:CAQ43777"
                     /db_xref="InterPro:IPR012660"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:B2FHD4"
                     /protein_id="CAQ43777.1"
                     /translation="MSVDALTSSLAALQDVLDCMPAVRAMQIQLDGYADGVLRITAPL
                     AANVNDKGNAFGGSLASVLTLSGWALVSLRLRLAGHDAEVYVADSNLRYLAPVYEDLH
                     AHAEAAEATGWDAFLNTFRQRRKARISIIATQPGADGKPAAEFSGRFVAFAKG"
     CDS             183096..183521
                     /transl_table=11
                     /locus_tag="Smlt0169"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PQV2
                     (EMBL:AE011646;); Xanthomonas axonopodis pv. citri.;
                     Hypothetical protein XAC0219.; length=140; id 47.183%;
                     ungapped id 48.201%; E()=6.5e-22; 142 aa overlap; query
                     1-141; subject 1-140"
                     /db_xref="EnsemblGenomes-Gn:Smlt0169"
                     /db_xref="EnsemblGenomes-Tr:CAQ43778"
                     /db_xref="UniProtKB/TrEMBL:B2FHD5"
                     /protein_id="CAQ43778.1"
                     /translation="MRRLIQFLMCSLLLVSAVASADDLSRKQRKLLEETQIAYGATIR
                     WGSMDDAIGYLDPKLRKEKPPTEFELNRYAQLRVSSYRERSSAALEGGLVERRVEIGV
                     INQNTQAERTVMVVERWRWDPEAKRWWQTAGLPDLWKGQ"
     sig_peptide     183096..183158
                     /locus_tag="Smlt0169"
                     /note="Signal peptide predicted for Smlt0169 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.997 between residues 21 and 22"
                     /inference="protein motif:SignalP:2.0"
     CDS             183579..184016
                     /transl_table=11
                     /locus_tag="Smlt0170"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q4V074
                     (EMBL:CP000050;); Xanthomonas campestris pv. campestris
                     (strain 8004).; Hypothetical protein.; length=158; id
                     72.222%; ungapped id 72.222%; E()=2.9e-34; 144 aa overlap;
                     query 1-144; subject 14-157"
                     /db_xref="EnsemblGenomes-Gn:Smlt0170"
                     /db_xref="EnsemblGenomes-Tr:CAQ43779"
                     /db_xref="GOA:B2FHD6"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:B2FHD6"
                     /protein_id="CAQ43779.1"
                     /translation="MNYEELLAFAGRNPMLSAALVGLTVAIIVTEIRRLFRGFKGIKP
                     AELTQLMNAGGTVVVDLSASGDFEKGHIAGSRNAQASAFGPDNKLVANAKQSPVVLVC
                     RSGNASETAAKALKKAGFEKVYVLDGGIPAWQQAELPLVKGRN"
     misc_feature    183621..183674
                     /locus_tag="Smlt0170"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0170 by TMHMM2.0 at aa 15-32"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    183705..183986
                     /locus_tag="Smlt0170"
                     /note="HMMPfam hit to PF00581, Rhodanese-like domain,
                     score 4.6e-15"
                     /inference="protein motif:HMMPfam:PF00581"
     CDS             184116..184634
                     /transl_table=11
                     /gene="secB"
                     /locus_tag="Smlt0171"
                     /product="putative protein-export SecB protein"
                     /note="similarity:fasta; with=UniProt:Q93TF4
                     (EMBL:AF359453;); Pseudomonas fluorescens.; secB;
                     Protein-export protein secB.; length=160; id 43.506%;
                     ungapped id 44.079%; E()=7.4e-22; 154 aa overlap; query
                     7-160; subject 6-157"
                     /note="similarity:fasta; with=UniProt:Q8PQV0
                     (EMBL:AE011647;); Xanthomonas axonopodis pv. citri.; secB;
                     Protein-export protein secB.; length=170; id 84.884%;
                     ungapped id 85.882%; E()=3.6e-54; 172 aa overlap; query
                     1-172; subject 1-170"
                     /db_xref="EnsemblGenomes-Gn:Smlt0171"
                     /db_xref="EnsemblGenomes-Tr:CAQ43780"
                     /db_xref="GOA:B2FHD7"
                     /db_xref="InterPro:IPR003708"
                     /db_xref="UniProtKB/Swiss-Prot:B2FHD7"
                     /protein_id="CAQ43780.1"
                     /translation="MSEEITNGAAAPVDAATGPAFTVEKIYVKDVSFESPNAPTIFND
                     QVQPELQLNLNQQVQRLGENAFEVVLAVTLTCQAGERTAYVAEVKQAGVFGLVGLDPQ
                     SIDVLLGTQCPNILFPYVRQLISDLIQAGGFPPFFLQPINFEGLYAETLRQRQEQGDA
                     PSLADSEPAGNA"
     misc_feature    184116..184583
                     /gene="secB"
                     /locus_tag="Smlt0171"
                     /note="HMMPfam hit to PF02556, Preprotein translocase
                     subunit SecB, score 6.2e-50"
                     /inference="protein motif:HMMPfam:PF02556"
     CDS             184655..185680
                     /transl_table=11
                     /gene="gpsA"
                     /locus_tag="Smlt0172"
                     /product="putative glycerol-3-phosphate dehydrogenase"
                     /EC_number="1.1.1.94"
                     /note="similarity:fasta; with=UniProt:P0A6S7
                     (EMBL:U00039;); Escherichia coli.; gpsA;
                     Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)
                     (NAD(P)H- dependent glycerol-3-phosphate dehydrogenase).;
                     length=339; id 48.358%; ungapped id 48.503%; E()=6.5e-51;
                     335 aa overlap; query 1-334; subject 1-335"
                     /note="similarity:fasta; with=UniProt:Q8PDY0
                     (EMBL:AE012116;); Xanthomonas campestris pv. campestris.;
                     gpsA; Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC
                     1.1.1.94) (NAD(P)H- dependent glycerol-3-phosphate
                     dehydrogenase).; length=341; id 85.294%; ungapped id
                     85.294%; E()=7.8e-97; 340 aa overlap; query 1-340; subject
                     1-340"
                     /db_xref="EnsemblGenomes-Gn:Smlt0172"
                     /db_xref="EnsemblGenomes-Tr:CAQ43781"
                     /db_xref="GOA:B2FHD8"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/Swiss-Prot:B2FHD8"
                     /protein_id="CAQ43781.1"
                     /translation="MSTTADKIAVLGAGSWGTALASLLARHGHPTVLWGRDAAVVEAI
                     DQRHENPRYLPGIPLPDSLRATTDLASAVEGAAWILVVTPSHAFGETVRALAPLRPAG
                     AGVAWATKGFEPGSGRFLHEVAREVLGEDVPLAVVTGPSFAKEVTQGLPTAITVHGDV
                     PEFAQMVAEAMHGPAFRAYTGDDMVGAELGGAMKNVLAVATGVADGMQLGLNARAGLI
                     TRGLNEMLRLAAAIGAKPETLMGLAGLGDLVLTCTGDLSRNRRLGLALGRGQTLQDAV
                     REIGQVVESVQTADEVMRQARRHGIDLPISDRVRAVLHGEQTPEEGLRALLAREQKPE
                     YPDTLFK"
     sig_peptide     184655..184717
                     /gene="gpsA"
                     /locus_tag="Smlt0172"
                     /note="Signal peptide predicted for Smlt0172 by SignalP
                     2.0 HMM (Signal peptide probability 0.676) with cleavage
                     site probability 0.572 between residues 21 and 22"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    184667..185134
                     /gene="gpsA"
                     /locus_tag="Smlt0172"
                     /note="HMMPfam hit to PF02737, 3-hydroxyacyl-CoA
                     dehydrogenase, NAD b, score 0.00014"
                     /inference="protein motif:HMMPfam:PF02737"
     misc_feature    184670..185149
                     /gene="gpsA"
                     /locus_tag="Smlt0172"
                     /note="HMMPfam hit to PF01210, NAD-dependent
                     glycerol-3-phosphate deh, score 4.7e-81"
                     /inference="protein motif:HMMPfam:PF01210"
     misc_feature    184673..185230
                     /gene="gpsA"
                     /locus_tag="Smlt0172"
                     /note="HMMPfam hit to PF03807, NADP oxidoreductase
                     coenzyme F420-depe, score 0.0021"
                     /inference="protein motif:HMMPfam:PF03807"
     misc_feature    184676..185140
                     /gene="gpsA"
                     /locus_tag="Smlt0172"
                     /note="HMMPfam hit to PF02558, Ketopantoate reductase
                     PanE/ApbA, score 0.00039"
                     /inference="protein motif:HMMPfam:PF02558"
     misc_feature    185198..185632
                     /gene="gpsA"
                     /locus_tag="Smlt0172"
                     /note="HMMPfam hit to PF07479, NAD-dependent
                     glycerol-3-phosphate deh, score 3.7e-68"
                     /inference="protein motif:HMMPfam:PF07479"
     CDS             complement(185830..186261)
                     /transl_table=11
                     /locus_tag="Smlt0173"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q1YVV8
                     (EMBL:AAPH01000060;); Photobacterium profundum 3TCK.;
                     Hypothetical protein.; length=130; id 35.135%; ungapped id
                     37.500%; E()=0.00057; 111 aa overlap; query 35-139;
                     subject 18-127"
                     /db_xref="EnsemblGenomes-Gn:Smlt0173"
                     /db_xref="EnsemblGenomes-Tr:CAQ43782"
                     /db_xref="InterPro:IPR027843"
                     /db_xref="InterPro:IPR032710"
                     /db_xref="UniProtKB/TrEMBL:B2FHD9"
                     /protein_id="CAQ43782.1"
                     /translation="MASPAIAHDAEGAKPAQPLPDIALPAPLDRVLRDYEQAWRTGDA
                     RALGALFAEDGFVLQSNQPPVRGRSAIEAAYAGQGSSPLRLRALAYAVEGNTGYIIGA
                     YSYGNNVGDTGKFTLTLKRVGDGPWLIFSDMDNTSAPPRAR"
     CDS             186389..187096
                     /transl_table=11
                     /locus_tag="Smlt0174"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0174"
                     /db_xref="EnsemblGenomes-Tr:CAQ43783"
                     /db_xref="GOA:B2FHE0"
                     /db_xref="InterPro:IPR014453"
                     /db_xref="UniProtKB/TrEMBL:B2FHE0"
                     /protein_id="CAQ43783.1"
                     /translation="MDAAQIRQGHGMKMRITGMAMMAALLAACGQAPEKTGETAPAVA
                     PAPTAEAPAAVATVVEKEPSAEDGVDPSVSDNEGEPEDPSAGGELTCVDNPLATHFFT
                     LVGGNTVDDCGRKDPKVLAAFNALMKSTAAAESADKEIPSLRERLLSGPSGPGELVVL
                     QGEPWWFYTACQAHDCPGTALAMLYSPDQSKMVGRLTARCRVWWLGEPTAEQRAQIEQ
                     RQPLPDAALKEDSALCE"
     CDS             complement(187157..187768)
                     /transl_table=11
                     /locus_tag="Smlt0175"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q3H0P2
                     (EMBL:AAJB01000024;); Nocardioides sp. JS614.; Putative
                     cyclase.; length=342; id 27.097%; ungapped id 28.966%;
                     E()=0.9; 155 aa overlap; query 31-179; subject 17-167"
                     /db_xref="EnsemblGenomes-Gn:Smlt0175"
                     /db_xref="EnsemblGenomes-Tr:CAQ43784"
                     /db_xref="UniProtKB/TrEMBL:B2FHE1"
                     /protein_id="CAQ43784.1"
                     /translation="MTCHRKRMAGLRKPVRLFDNACPPASPLVAPAGNPSAGYGGRSV
                     EALCLPVSTSARFSSHVSARHLCVAAAVCPARSIAMSTPESSRLRTQYVPASADAPSE
                     ALHPHDPHGFIATLDRIGKGAAADGQPWPERHQMPGRRMALADADCALTGLRVALEML
                     LAAERVRQNGPDEEYVGDRVMEGLMMASLSLAAQVSARMRPEG"
     CDS             complement(188012..189055)
                     /transl_table=11
                     /locus_tag="Smlt0176"
                     /product="putative arsenite transmembrane efflux pump
                     transporter protein"
                     /note="similarity:fasta; with=UniProt:Q3SMW8
                     (EMBL:CP000115;); Nitrobacter winogradskyi (strain
                     Nb-255/ATCC 25391).; Arsenite efflux pump ACR3 precursor.;
                     length=351; id 74.336%; ungapped id 74.336%; E()=7.4e-87;
                     339 aa overlap; query 5-343; subject 1-339"
                     /db_xref="EnsemblGenomes-Gn:Smlt0176"
                     /db_xref="EnsemblGenomes-Tr:CAQ43785"
                     /db_xref="GOA:B2FHE2"
                     /db_xref="InterPro:IPR002657"
                     /db_xref="InterPro:IPR004706"
                     /db_xref="UniProtKB/TrEMBL:B2FHE2"
                     /protein_id="CAQ43785.1"
                     /translation="MTSRMNLFERHLTLWVGLCIAVGTLLGHFLPGAFAVLASAEVAK
                     VNLPVAALIWLMIIPMLLKVDFRAMRQLQQHWKGIGVTLFINWAVKPFSMALLGWLFL
                     RHAFADWLPAAQIDSYIAGLILLAAAPCTAMVFVWSNLCRGDANFTLSQVALNDAIMV
                     VAYAPVVALLLGLSAITVPWDTLLLSVGLYILVPVLVAALLRRWILSRGGEARLQRAL
                     RRLGPLSLSALLLTLVLLFGFQGQQIVKQPLVIALIAVPILIQVYFTSGLAYLLNRRL
                     GVAHCVAGPSALIGASNFFELAVATAVGLFGVHSGAALATVVGVLIEVPVMLSVVRIV
                     NRTQAWYERREEH"
     misc_feature    complement(order(188054..188122,188135..188203,
                     188240..188308,188336..188404,188438..188506,
                     188534..188602,188639..188707,188750..188809,
                     188870..188923,188951..189019))
                     /locus_tag="Smlt0176"
                     /note="10 probable transmembrane helices predicted for
                     Smlt0176 by TMHMM2.0 at aa 13-35, 45-62, 83-102, 117-139,
                     152-174, 184-206, 218-240, 250-272, 285-307 and 312-334"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(188315..188908)
                     /locus_tag="Smlt0176"
                     /note="HMMPfam hit to PF01758, Sodium Bile acid symporter
                     family, score 1.5e-32"
                     /inference="protein motif:HMMPfam:PF01758"
     sig_peptide     complement(188942..189055)
                     /locus_tag="Smlt0176"
                     /note="Signal peptide predicted for Smlt0176 by SignalP
                     2.0 HMM (Signal peptide probability 0.987) with cleavage
                     site probability 0.411 between residues 38 and 39"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(189052..189555)
                     /transl_table=11
                     /gene="arsC"
                     /locus_tag="Smlt0177"
                     /product="putative arsenate reductase ArsC"
                     /note="similarity:fasta; with=UniProt:O68022
                     (EMBL:AE004653;); Pseudomonas aeruginosa.; arsC; ArsC.;
                     length=156; id 47.436%; ungapped id 48.052%; E()=3.1e-22;
                     156 aa overlap; query 5-160; subject 3-156"
                     /note="similarity:fasta; with=UniProt:Q1MFA0
                     (EMBL:AM236080;); Rhizobium leguminosarum bv. viciae
                     (strain 3841).; arsC1; Putative arsenate reductase (EC
                     1.20.4.1).; length=176; id 56.250%; ungapped id 57.325%;
                     E()=5.8e-30; 160 aa overlap; query 4-161; subject 8-166"
                     /db_xref="EnsemblGenomes-Gn:Smlt0177"
                     /db_xref="EnsemblGenomes-Tr:CAQ43786"
                     /db_xref="InterPro:IPR023485"
                     /db_xref="UniProtKB/TrEMBL:B2FHE3"
                     /protein_id="CAQ43786.1"
                     /translation="MTRNVLFLCTGNSARSVLAEATLRAWGGDRFSAFSAGSQPNGQI
                     NPFALAQLQAEGMPIEGLRSKSWDEFVDAAPMDLVITVCDAAAAEACPVVFGDFVRSH
                     WGLPDPAAVAGSDADKTAAFALAHAIVKARLRALLALPDSLWSDREALQHALDQIGQL
                     QPTDSMP"
     misc_feature    complement(189139..189549)
                     /gene="arsC"
                     /locus_tag="Smlt0177"
                     /note="HMMPfam hit to PF01451, Low molecular weight
                     phosphotyrosine protein, score 9.6e-24"
                     /inference="protein motif:HMMPfam:PF01451"
     sig_peptide     complement(189499..189555)
                     /gene="arsC"
                     /locus_tag="Smlt0177"
                     /note="Signal peptide predicted for Smlt0177 by SignalP
                     2.0 HMM (Signal peptide probability 0.991) with cleavage
                     site probability 0.985 between residues 19 and 20"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(189593..189922)
                     /transl_table=11
                     /gene="arsR"
                     /locus_tag="Smlt0178"
                     /product="putative ArsR family transcriptional regulatory
                     protein"
                     /note="similarity:fasta; with=UniProt:Q3F8G7
                     (EMBL:AAJL01000008;); Burkholderia ambifaria AMMD.;
                     Regulatory protein, ArsR.; length=111; id 59.813%;
                     ungapped id 62.136%; E()=6.9e-19; 107 aa overlap; query
                     1-107; subject 1-103"
                     /db_xref="EnsemblGenomes-Gn:Smlt0178"
                     /db_xref="EnsemblGenomes-Tr:CAQ43787"
                     /db_xref="GOA:B2FHE4"
                     /db_xref="InterPro:IPR001845"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:B2FHE4"
                     /protein_id="CAQ43787.1"
                     /translation="METSNAIAALTALGHATRLAAFRLLVEAGPAGRMAGDVATALQV
                     PPATLSFHLKELVQAGLVESESQGRHVCYRANFDAMNGLIEYLTHNCCAGSPTEQCMP
                     TAPACKG"
     misc_feature    complement(189731..189880)
                     /gene="arsR"
                     /locus_tag="Smlt0178"
                     /note="HMMPfam hit to PF01022, Bacterial regulatory
                     protein, arsR family, score 6.1e-06"
                     /inference="protein motif:HMMPfam:PF01022"
     CDS             189940..190668
                     /transl_table=11
                     /gene="arsH"
                     /locus_tag="Smlt0179"
                     /product="putative arsenic resistance ArsH-like protein"
                     /note="similarity:fasta; with=UniProt:Q9L9D0
                     (EMBL:AF173880;); Thiobacillus ferrooxidans.; ArsH-like
                     protein.; length=240; id 68.584%; ungapped id 69.196%;
                     E()=1.4e-56; 226 aa overlap; query 5-228; subject 3-228"
                     /note="similarity:fasta; with=UniProt:Q13JU4
                     (EMBL:CP000271;); Burkholderia xenovorans (strain LB400).;
                     Putative arsinic resistance protein ArsH.; length=254; id
                     70.815%; ungapped id 72.687%; E()=2.3e-61; 233 aa overlap;
                     query 10-237; subject 5-236"
                     /db_xref="EnsemblGenomes-Gn:Smlt0179"
                     /db_xref="EnsemblGenomes-Tr:CAQ43788"
                     /db_xref="GOA:B2FHE5"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR014063"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:B2FHE5"
                     /protein_id="CAQ43788.1"
                     /translation="MNKPITSAHLPNLVDASLPQPDHRQLAAADLGPPRILLLYGSLR
                     PQSFSRKLALEAERLLRHLGCETRVFDPHALPMLDSVHPHHPEVQRLREWSQWSEGQV
                     WVSPERHGTVTGVFKNQIDWLPLEDGSVRPTQGRTLALLQVSGGSQSFNTVNTLRVLG
                     RWMRMLAIPNQSSVAKAWQEFDDDGRMKPSPYYDRVVDVMEELVKFTLLTRGRSDYLV
                     DRYSERKGDAHAAALARAAEATAS"
     misc_feature    190039..190566
                     /gene="arsH"
                     /locus_tag="Smlt0179"
                     /note="HMMPfam hit to PF03358, NADPH-dependent FMN
                     reductase, score 2.6e-51"
                     /inference="protein motif:HMMPfam:PF03358"
     CDS             complement(190697..191056)
                     /transl_table=11
                     /locus_tag="Smlt0180"
                     /product="putative transmembrane protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:Smlt0180"
                     /db_xref="EnsemblGenomes-Tr:CAQ43789"
                     /db_xref="GOA:B2FHE6"
                     /db_xref="UniProtKB/TrEMBL:B2FHE6"
                     /protein_id="CAQ43789.1"
                     /translation="MSASSKRPPVDPLFQFLLSTMGGVFVFLFFVAREYLRGLGWLLG
                     SWDPNMGHATEDELISKANRSALLIAAVLLAWAFMGPSPYRHNWEIEVMGIGAGMLLA
                     YVVIIRLAASRVKRLLG"
     misc_feature    complement(order(190721..190789,190817..190870,
                     190961..191020))
                     /locus_tag="Smlt0180"
                     /note="3 probable transmembrane helices predicted for
                     Smlt0180 by TMHMM2.0 at aa 13-32, 63-80 and 90-112"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(191231..192034)
                     /transl_table=11
                     /locus_tag="Smlt0181"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q2G597
                     (EMBL:CP000248;); Novosphingobium aromaticivorans (strain
                     DSM 12444).; Hypothetical protein precursor.; length=268;
                     id 42.424%; ungapped id 43.946%; E()=6.4e-28; 231 aa
                     overlap; query 16-245; subject 20-243"
                     /db_xref="EnsemblGenomes-Gn:Smlt0181"
                     /db_xref="EnsemblGenomes-Tr:CAQ43790"
                     /db_xref="UniProtKB/TrEMBL:B2FHE7"
                     /protein_id="CAQ43790.1"
                     /translation="MAFAGHWHPSTQDCIARSRPIRTSSSPARRVLHAALAMALAVAC
                     SGAASAKGKDKEAPEQRIAAVDELPPDQSVSETVIELAGWVVASKDNQGYPFAIMDKA
                     AAQVLIFGGDGKLRGAAPALFGSAIGDHSAPGVAKLALSAIPGHDRTTPAGRFIGGYG
                     PSDDAGRVLWVDYDSAVSMHPLPPGTPKEKRAQRLATPTPDDNRVTHGCINVSPAFYE
                     QIVQSTFEKGGVFYILPDKDSIAKTFPEFAQSRAAADGDEKKTAQHAGE"
     sig_peptide     complement(191885..192034)
                     /locus_tag="Smlt0181"
                     /note="Signal peptide predicted for Smlt0181 by SignalP
                     2.0 HMM (Signal peptide probability 0.985) with cleavage
                     site probability 0.960 between residues 50 and 51"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(192081..192353)
                     /transl_table=11
                     /locus_tag="Smlt0182"
                     /product="putative transmembrane protein"
                     /note="similarity:fasta; with=UniProt:Q2G598
                     (EMBL:CP000248;); Novosphingobium aromaticivorans (strain
                     DSM 12444).; Hypothetical protein precursor.; length=99;
                     id 38.824%; ungapped id 45.833%; E()=0.3; 85 aa overlap;
                     query 20-91; subject 14-98"
                     /db_xref="EnsemblGenomes-Gn:Smlt0182"
                     /db_xref="EnsemblGenomes-Tr:CAQ43791"
                     /db_xref="GOA:B2FHE8"
                     /db_xref="UniProtKB/TrEMBL:B2FHE8"
                     /protein_id="CAQ43791.1"
                     /translation="MKLTKQHINAARAITVAIVATVSLGACATYKDEFATINSRLDQL
                     DVKVQGAAQSAESANQSAQQANQRLDQIEGRVQQLERAPAGRKPRG"
     sig_peptide     complement(192261..192353)
                     /locus_tag="Smlt0182"
                     /note="Signal peptide predicted for Smlt0182 by SignalP
                     2.0 HMM (Signal peptide probability 0.971) with cleavage
                     site probability 0.380 between residues 31 and 32"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    complement(192264..192332)
                     /locus_tag="Smlt0182"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0182 by TMHMM2.0 at aa 10-32"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(192568..193518)
                     /transl_table=11
                     /locus_tag="Smlt0183"
                     /product="conserved hypothetical protein"
                     /note="N-terminus to codon 150 is similar to the
                     N-terminus to codon 160 of streptomyces griseus subsp.
                     griseus. putative lantibiotic biosynthesis protein.
                     UniProt:Q53IB5 (EMBL:AJ862840 (1105 aa) fasta scores:
                     E()=2.8, 30.769% id in 143 aa"
                     /note="similarity:fasta; with=UniProt:Q53IB5
                     (EMBL:AJ862840;); Streptomyces griseus subsp. griseus.;
                     Putative lantibiotic biosynthesis protein.; length=1105;
                     id 30.769%; ungapped id 31.429%; E()=2.8; 143 aa overlap;
                     query 7-149; subject 18-157"
                     /db_xref="EnsemblGenomes-Gn:Smlt0183"
                     /db_xref="EnsemblGenomes-Tr:CAQ43792"
                     /db_xref="InterPro:IPR018728"
                     /db_xref="UniProtKB/TrEMBL:B2FHE9"
                     /protein_id="CAQ43792.1"
                     /translation="MRALILIASPVALLQAQAAERIVSARHIVVQTDDVTRFFKVLDA
                     NQGRPSADDLQHGYLDAGTDALRSFTDRRIGSMERLARAIQDKPALFAKARTCATALP
                     SIRTRVAAAVDRLGALLPSARFPPVTVLVGRGNSGGVTTEAGVVIGLEALCNADWMQT
                     DIGDRFVHLIAHEYVHVQQPGARVDIEQPTLLYQTLLEGGAEYVAERISGQPANAHLQ
                     RWTQGRECALERAFLQDSMGTDLSRWLYNGPGDDARRGDLGYWIGYRIAHAYVARAAD
                     TRSGVAELLDVQPGNAAALLEASGWQPACGAGGSTQTRMP"
     repeat_region   192697..192704
                     /rpt_unit_seq="(cg)4"
     sig_peptide     complement(193465..193518)
                     /locus_tag="Smlt0183"
                     /note="Signal peptide predicted for Smlt0183 by SignalP
                     2.0 HMM (Signal peptide probability 0.996) with cleavage
                     site probability 0.960 between residues 18 and 19"
                     /inference="protein motif:SignalP:2.0"
     repeat_region   193666..193673
                     /rpt_unit_seq="(tc)4"
     CDS             193725..194300
                     /transl_table=11
                     /locus_tag="Smlt0184"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q5GV20
                     (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.;
                     Hypothetical protein.; length=198; id 56.345%; ungapped id
                     58.730%; E()=2.8e-42; 197 aa overlap; query 3-191; subject
                     2-198"
                     /db_xref="EnsemblGenomes-Gn:Smlt0184"
                     /db_xref="EnsemblGenomes-Tr:CAQ43793"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR026364"
                     /db_xref="InterPro:IPR027385"
                     /db_xref="UniProtKB/TrEMBL:B2FHF0"
                     /protein_id="CAQ43793.1"
                     /translation="MNKNSLLALGLLAALPFAASATDGLSYNYVEGGYVNTDAKGGDA
                     DGWKVKGSVAVHPNFHIFGDYSAQETDKFKNDVDQWRIGAGYNYGIAPNTDLVARVAY
                     QKFDMKHGLDFNGYSTEVGVRTAFNPYVEGYVMAGYEDYTKKHGINPDGEFYGRVGAT
                     AKFNQNWGLSGEVKLAKAGDREWFVGPRFTW"
     sig_peptide     193725..193787
                     /locus_tag="Smlt0184"
                     /note="Signal peptide predicted for Smlt0184 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.970 between residues 21 and 22"
                     /inference="protein motif:SignalP:2.0"
     repeat_region   194340..194351
                     /rpt_unit_seq="(ct)6"
     CDS             194397..195191
                     /transl_table=11
                     /locus_tag="Smlt0185"
                     /product="putative HTH transcriptional regulatory protein"
                     /note="similarity:fasta; with=UniProt:Q92P59
                     (EMBL:AL591789;); Rhizobium meliloti (Ensifer meliloti)
                     (Sinorhizobium meliloti).; PUTATIVE TRANSCRIPTION
                     REGULATOR PROTEIN.; length=296; id 46.032%; ungapped id
                     47.347%; E()=1.8e-31; 252 aa overlap; query 13-259;
                     subject 28-277"
                     /db_xref="EnsemblGenomes-Gn:Smlt0185"
                     /db_xref="EnsemblGenomes-Tr:CAQ43794"
                     /db_xref="GOA:B2FHF1"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="UniProtKB/TrEMBL:B2FHF1"
                     /protein_id="CAQ43794.1"
                     /translation="MGPVAPQCGMGDPSSLAGTGTTYQEHLAPAQLRGHFGQLWQSQL
                     PADADGHITVLPDGCVDILWRDGALFVVGPDRVAAHPALAPGAQVLGARFRPGQALAA
                     LGLPLAGIIGQAVPLADLKGAWANKAAASIGDTAPAQRLQRMAHCLQQHMGAAALDTP
                     AQRAHVLFQALAAGNATLDTLAAHLGLSPRSLRRFSQSQFGYGAKTLERILRLQRFLR
                     HSRALPQHSLAMLAADAGYADQAHLSREARELAGMTASELRLEWGQ"
     CDS             195259..195627
                     /transl_table=11
                     /locus_tag="Smlt0186"
                     /product="putative glyoxalase/bleomycin resistance
                     protein"
                     /note="similarity:fasta; with=UniProt:Q8UF67
                     (EMBL:AE009112;); Agrobacterium tumefaciens (strain
                     C58/ATCC 33970).; Glyoxalase/bleomycin resistance
                     protein/dioxygenase superfamily protein.; length=118; id
                     70.000%; ungapped id 70.000%; E()=1e-28; 110 aa overlap;
                     query 10-119; subject 7-116"
                     /db_xref="EnsemblGenomes-Gn:Smlt0186"
                     /db_xref="EnsemblGenomes-Tr:CAQ43795"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="UniProtKB/TrEMBL:B2FHF2"
                     /protein_id="CAQ43795.1"
                     /translation="MNPAAPHDAERRIDNIEFNVADIARSKRFYGEVFGWHFTDYGTA
                     YTEFDDGRLKGGFVADAPVRAHGGPLVILYCADLADAQQRVVAAGGEVVQAVFAFPGG
                     RRFHFRDLDGYELAVWSDVD"
     misc_feature    195292..195609
                     /locus_tag="Smlt0186"
                     /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
                     resistance protein/Di, score 4.8e-14"
                     /inference="protein motif:HMMPfam:PF00903"
     CDS             195751..196725
                     /transl_table=11
                     /locus_tag="Smlt0187"
                     /product="putative peroxidase"
                     /note="similarity:fasta; with=UniProt:Q2UBB0
                     (EMBL:AP007162;); Aspergillus oryzae.; Predicted
                     iron-dependent peroxidase.; length=315; id 62.215%;
                     ungapped id 62.215%; E()=1e-70; 307 aa overlap; query
                     18-324; subject 8-314"
                     /db_xref="EnsemblGenomes-Gn:Smlt0187"
                     /db_xref="EnsemblGenomes-Tr:CAQ43796"
                     /db_xref="GOA:B2FHF3"
                     /db_xref="InterPro:IPR006314"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="UniProtKB/TrEMBL:B2FHF3"
                     /protein_id="CAQ43796.1"
                     /translation="MNSQPAPITAVNHTLDNEPQQITAPLTHSAAFLVLKVKDDEASI
                     AKAREVLASTDDLIKNTAIREIERTFTCNVAIGHRVWQPLVGTTPPRELQPFREIKGA
                     THTAVSTPGDLLYHIRARTMDLIVAFERNLLMAFGDAVETVDDVAGFRYFDGRDLLDF
                     VDGTANPEGLSLPEATIVGEEDPEHAGGSYVVVQKYLHNLDAWRAQKTEAQEAIIGRT
                     KHDNIELDDAPADAQKSHKTLCTIEDADGEHEILRDNMPFANPGRGEYGTYFIGYTRR
                     LWVIEKMLERMFIGNPAPLHDRILDFSTATTGVTFFAPSRKVLADLGD"
     misc_feature    195805..196707
                     /locus_tag="Smlt0187"
                     /note="HMMPfam hit to PF04261, Dyp-type peroxidase family,
                     score 2e-105"
                     /inference="protein motif:HMMPfam:PF04261"
     repeat_region   196359..196366
                     /rpt_unit_seq="(gc)4"
     CDS             196810..197226
                     /transl_table=11
                     /locus_tag="Smlt0188"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q4BLK2
                     (EMBL:AAEH02000011;); Burkholderia vietnamiensis G4.;
                     Hypothetical protein precursor.; length=154; id 38.028%;
                     ungapped id 41.221%; E()=1.2e-10; 142 aa overlap; query
                     3-136; subject 1-139"
                     /db_xref="EnsemblGenomes-Gn:Smlt0188"
                     /db_xref="EnsemblGenomes-Tr:CAQ43797"
                     /db_xref="UniProtKB/TrEMBL:B2FHF4"
                     /protein_id="CAQ43797.1"
                     /translation="MAMARNTTGARRWWRPLAALFGALALGSAGVSAQEAPAHWMAYA
                     AAVGGQLQQRLQQEQDPQAQRVLEWLQAHPDAPTPLPVSVWIAADGRISKLEFDSLGD
                     TQVDAALRATLQSAPLQAAPPADMRQPLRLGLVLTQ"
     sig_peptide     196810..196908
                     /locus_tag="Smlt0188"
                     /note="Signal peptide predicted for Smlt0188 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.991 between residues 33 and 34"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    196846..196905
                     /locus_tag="Smlt0188"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0188 by TMHMM2.0 at aa 13-32"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(197331..197912)
                     /transl_table=11
                     /locus_tag="Smlt0189"
                     /product="putative transmembrane transporter protein"
                     /note="similarity:fasta; with=UniProt:P0AFK2
                     (EMBL:X12713;); Escherichia coli.; pnuC; Protein pnuC.;
                     length=239; id 25.352%; ungapped id 29.189%; E()=0.0016;
                     213 aa overlap; query 3-187; subject 19-231"
                     /note="similarity:fasta; with=UniProt:Q4KC11
                     (EMBL:CP000076;); Pseudomonas fluorescens (strain
                     Pf-5/ATCC BAA-477).; Nicotinamide mononucleotide
                     transporter PnuC, putative.; length=187; id 47.753%;
                     ungapped id 47.753%; E()=5.2e-29; 178 aa overlap; query
                     6-183; subject 4-181"
                     /db_xref="EnsemblGenomes-Gn:Smlt0189"
                     /db_xref="EnsemblGenomes-Tr:CAQ43798"
                     /db_xref="GOA:B2FHF5"
                     /db_xref="InterPro:IPR006419"
                     /db_xref="UniProtKB/TrEMBL:B2FHF5"
                     /protein_id="CAQ43798.1"
                     /translation="MSGVMLEWTAALCSILGVWLMARRRLAAWPVGLLSVALYGLVFA
                     EAKLYSDTLLQVAFGGFLVYGWLNWRQHAADEGSIRIVPLARGTLLRDLSIGLCGGVA
                     LGAAMHSFTDAALPWLDALLTGLSLVGQWWQARRHVACWWVWIAVDVVYVGAYLFKSL
                     HVTAALYVFFLGLAVFGLRAWSAAAREPQVATR"
     misc_feature    complement(order(197364..197432,197442..197501,
                     197703..197756,197784..197837,197850..197903))
                     /locus_tag="Smlt0189"
                     /note="5 probable transmembrane helices predicted for
                     Smlt0189 by TMHMM2.0 at aa 4-21, 26-43, 53-70, 138-157 and
                     161-183"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(197463..197900)
                     /locus_tag="Smlt0189"
                     /note="HMMPfam hit to PF04973, Nicotinamide mononucleotide
                     transport, score 6.4e-09"
                     /inference="protein motif:HMMPfam:PF04973"
     sig_peptide     complement(197832..197912)
                     /locus_tag="Smlt0189"
                     /note="Signal peptide predicted for Smlt0189 by SignalP
                     2.0 HMM (Signal peptide probability 0.719) with cleavage
                     site probability 0.712 between residues 27 and 28"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(197909..200098)
                     /transl_table=11
                     /locus_tag="Smlt0190"
                     /product="putative TonB dependent receptor protein"
                     /note="similarity:fasta; with=UniProt:Q25C90
                     (EMBL:AB211539;); Sphingomonas sp. A1.; p1;
                     Alginate-binding flagellin.; length=742; id 22.589%;
                     ungapped id 25.110%; E()=2.7e-23; 757 aa overlap; query
                     9-724; subject 16-737"
                     /note="similarity:fasta; with=UniProt:Q8PCQ0
                     (EMBL:AE012166;); Xanthomonas campestris pv. campestris.;
                     Putative siderophore receptor.; length=722; id 49.169%;
                     ungapped id 50.355%; E()=5.7e-132; 722 aa overlap; query
                     6-725; subject 12-718"
                     /db_xref="EnsemblGenomes-Gn:Smlt0190"
                     /db_xref="EnsemblGenomes-Tr:CAQ43799"
                     /db_xref="GOA:B2FHF6"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR010105"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="UniProtKB/TrEMBL:B2FHF6"
                     /protein_id="CAQ43799.1"
                     /translation="MNRCLRPTLLSLALCAALPLHASEADASPDAAATGAERSPTELA
                     AVRVQAGKPKADTSRVNAFGGGSWKDTPASVNVLERDYLDRRQVRSLSELASNDASLG
                     DAYAPVGYYQNVAIRGFALDAATGYRFNGLSIAGEQRLALENVQSVEILKGEAGLAAG
                     VMAPGGIINYIGKRPAEVRTATLGTDSEGSRYVAVDVGHWITPRFGLRLNAAWDSSNS
                     YVEHADGRRNFYSLAADWLIGERGKLEVDANYQTSSQRSVSGYQLLGARDLPRGVDRE
                     HLLGYQPWQRPVDIASTNITALHTYDFNEAWQSRISVGHSRSVIDDNVAFAYGCYYAV
                     LCADGSVPGNYFAPNGDYDVYDYRSPDDTRRNQQARAELRGRFETGSVGHELTVGADY
                     FRRTVDKRPSVNEYVGTSNIHEAPVPVFAPSPKMPGPSAQRLDSRQTAFFALDRISFG
                     DDWQWLAGGRFVRLDERAYDKRGTPQRHSRLSRFLPQTAVVWKATDQLNAYASYVRGI
                     SLGQEAPFWTSNADTFLPSVQSRQLEVGVKYVPVEALTLGAAVFRISQPYQYAKPDSS
                     DVGYTFVEEGTQTHTGLELTANGQLTDALQIVASASVLQARARDTGTPAYEGHQLVNV
                     PKVRASVHLAYALPFVQGLDVTGGWRYAGANVARADGGVRAPDYSVFDAGLRFQHRLR
                     ERAVTWNLSVDNVFNRFYWRDTGSSGGDYYLFPGAPRQARLSVTFAL"
     misc_feature    complement(197912..198646)
                     /locus_tag="Smlt0190"
                     /note="HMMPfam hit to PF00593, TonB dependent receptor,
                     score 4.3e-20"
                     /inference="protein motif:HMMPfam:PF00593"
     repeat_region   198271..198282
                     /rpt_unit_seq="(cg)6"
     misc_feature    complement(199598..199900)
                     /locus_tag="Smlt0190"
                     /note="HMMPfam hit to PF07715, TonB-dependent Receptor
                     Plug Domain, score 5e-15"
                     /inference="protein motif:HMMPfam:PF07715"
     sig_peptide     complement(200033..200098)
                     /locus_tag="Smlt0190"
                     /note="Signal peptide predicted for Smlt0190 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.936 between residues 22 and 23"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(200389..201555)
                     /transl_table=11
                     /locus_tag="Smlt0191"
                     /product="putative aminoglycoside phosphotransferase"
                     /note="similarity:fasta; with=UniProt:Q4BBV8
                     (EMBL:AAEH02000045;); Burkholderia vietnamiensis G4.;
                     Aminoglycoside phosphotransferase.; length=397; id
                     42.623%; ungapped id 43.333%; E()=1.1e-52; 366 aa overlap;
                     query 24-384; subject 27-391"
                     /note="similarity:fasta; with=UniProt:Q8PGT8
                     (EMBL:AE012001;); Xanthomonas axonopodis pv. citri.;
                     Hypothetical protein XAC3528.; length=404; id 50.398%;
                     ungapped id 51.491%; E()=4e-68; 377 aa overlap; query
                     20-388; subject 24-400"
                     /db_xref="EnsemblGenomes-Gn:Smlt0191"
                     /db_xref="EnsemblGenomes-Tr:CAQ43800"
                     /db_xref="GOA:B2FHF7"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:B2FHF7"
                     /protein_id="CAQ43800.1"
                     /translation="MRSLGCDFPHWGCGMTSSSHRVQGLNNDEVAADWPPISAADIAW
                     LRQRYPQLHIGSEPRWHSPRPLSAAAIVNGANGAVFVKRHHHSVRSAACLEEEHHFIA
                     HLAAAGVPVVQVLPAADGHTAAEHGEWTFELHAIGVGEDLYRDAVSWSLLTDVAQARE
                     AGRTLAQLHRAAASYHAPQRSTHVLVARDDLIRADDPIAAIKAGLHERPGLARYLARI
                     PWEAQLQRDVLPWHGGLAERLRDEPRLWAHNDWHVSNLLWRDGQISTVLDFGLASPTS
                     ALFDLATAIERNAVAWLELERGMETVRIDIALALLDGYRQVLPLSAARVHLLADLLPM
                     VHFDFALSEVEYFEGVTGSTANADVAWQPFMLGHPAWFHSAPGQALLQALHAAA"
     misc_feature    complement(200596..201372)
                     /locus_tag="Smlt0191"
                     /note="HMMPfam hit to PF01636, Phosphotransferase enzyme
                     family, score 1.8e-16"
                     /inference="protein motif:HMMPfam:PF01636"
     repeat_region   200991..200998
                     /rpt_unit_seq="(cg)4"
     CDS             complement(201639..202046)
                     /transl_table=11
                     /locus_tag="Smlt0192"
                     /product="putative transmembrane protein"
                     /note="similarity:fasta; with=UniProt:Q7WBY7
                     (EMBL:BX640424;); Bordetella parapertussis.; Putative
                     membrane protein.; length=112; id 42.727%; ungapped id
                     47.000%; E()=4.7e-08; 110 aa overlap; query 12-120;
                     subject 12-112"
                     /db_xref="EnsemblGenomes-Gn:Smlt0192"
                     /db_xref="EnsemblGenomes-Tr:CAQ43801"
                     /db_xref="GOA:B2FHF8"
                     /db_xref="InterPro:IPR008816"
                     /db_xref="UniProtKB/TrEMBL:B2FHF8"
                     /protein_id="CAQ43801.1"
                     /translation="MLSTSTLSFRGLAMALALVAGVAVVSDASAMSRKDKRTLVGAVV
                     GGVAGNLLSNGDPAATVGGAVAGGAIGNLTTSDRRDRRYYDNHRYDDRYDRRYDRGYY
                     RSGYYDRGDDRRWQRERYYDNRYYHDRGRHRGW"
     repeat_region   201720..201875
                     /rpt_family="(CGG)n"
                     /inference="nucleotide motif:RepeatScout"
     misc_feature    complement(201822..201947)
                     /locus_tag="Smlt0192"
                     /note="HMMPfam hit to PF05433, Rickettsia 17 kDa surface
                     antigen, score 3.1e-06"
                     /inference="protein motif:HMMPfam:PF05433"
     misc_feature    complement(201960..202028)
                     /locus_tag="Smlt0192"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0192 by TMHMM2.0 at aa 7-29"
                     /inference="protein motif:TMHMM:2.0"
     sig_peptide     complement(201972..202046)
                     /locus_tag="Smlt0192"
                     /note="Signal peptide predicted for Smlt0192 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.657 between residues 25 and 26"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(202292..204283)
                     /transl_table=11
                     /locus_tag="Smlt0193"
                     /product="conserved hypothetical protein"
                     /note="Codons 360 to the C-terminus are similar to the
                     entire protein of Xanthomonas campestris pv. campestris
                     (strain 8004). hypothetical protein. UniProt:Q4UQH2
                     (EMBL:CP000050 (308 aa) fasta scores: E()=6.7e-36, 44.051%
                     id in 311 aa, and similar to entire protein of Xanthomonas
                     campestris pv. vesicatoria (strain 85-10). hypothetical
                     protein. UniProt:Q3BP31 (EMBL:AM039952 (630 aa) fasta
                     scores: E()=1.9e-33, 43.844% id in 666 aa"
                     /note="similarity:fasta; with=UniProt:Q4UQH2
                     (EMBL:CP000050;); Xanthomonas campestris pv. campestris
                     (strain 8004).; Hypothetical protein.; length=308; id
                     44.051%; ungapped id 45.667%; E()=6.7e-36; 311 aa overlap;
                     query 359-661; subject 1-308"
                     /note="similarity:fasta; with=UniProt:Q3BP31
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Hypothetical protein.; length=630; id
                     43.844%; ungapped id 47.173%; E()=1.9e-33; 666 aa overlap;
                     query 5-662; subject 4-630"
                     /db_xref="EnsemblGenomes-Gn:Smlt0193"
                     /db_xref="EnsemblGenomes-Tr:CAQ43802"
                     /db_xref="InterPro:IPR002477"
                     /db_xref="InterPro:IPR023346"
                     /db_xref="UniProtKB/TrEMBL:B2FHF9"
                     /protein_id="CAQ43802.1"
                     /translation="MAQHDYSRKEVLDIVEQVARQKGLPVDDFMRFAHIETGGTFNER
                     AHNTSSGAKGLFQFVPGSARQYHLTGHEFDPTRNTEAAAQMYQDNLDSMARRNERTGH
                     PYLSGGSTPTGLDLYLAHQQGSAGYGSVQTAIATGTFGVVRNGHGEEINMRRNVLNQI
                     GSDAKALTGHTLAEMRGMNDGDLARTFSSYYIHKYAAISIPEKNIAPQTVAPGQSQAP
                     AAPAQASAAVAAGAATLAATAAAATAPKPGIELHAAYEAGVKYDHVKYAINIPGHALY
                     VPGKTGKNVEQGYIDCSGWVGTLQNRTMDEINQKAGHAVFSKADRIDLGNLGSGGIVR
                     KAFDQSGVLLDRDAILKPGALKEGMIIGLDTARTRHEHWNGIDHIVMVVRDPTTDKLL
                     ISQSSGSKGVHTMPVEDYLKQVKDHPNWKLYASDPLSKARDLLENRTPSHEQAQGKPA
                     AEHKAAATPHAELYKQGAHSEGVRKVQEQLGHLGYVGADGKPLVEDGRFGRNTDAAVR
                     QLQKDNGLVADGIVGAKTLEAIKEARERPLLNDERHPRNPLFIQASKGLELLPAGTFK
                     DRHALESAAAALTKEAHAAGLQRIDTVVPSPNGERLFAVQGTIGDPAASRVAVEARAA
                     SEQSIALSSGAVQGAPNVLHQQQDAQQEQARQAQKAMGV"
     misc_feature    complement(202682..202879)
                     /locus_tag="Smlt0193"
                     /note="HMMPfam hit to PF01471, Putative peptidoglycan
                     binding domain, score 6.8e-20"
                     /inference="protein motif:HMMPfam:PF01471"
     CDS             complement(204396..205457)
                     /transl_table=11
                     /locus_tag="Smlt0194"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q4KE51
                     (EMBL:CP000076;); Pseudomonas fluorescens (strain
                     Pf-5/ATCC BAA-477).; Hypothetical protein.; length=357; id
                     48.583%; ungapped id 49.180%; E()=3.7e-41; 247 aa overlap;
                     query 106-352; subject 113-356"
                     /db_xref="EnsemblGenomes-Gn:Smlt0194"
                     /db_xref="EnsemblGenomes-Tr:CAQ43803"
                     /db_xref="UniProtKB/TrEMBL:B2FHG0"
                     /protein_id="CAQ43803.1"
                     /translation="MRGRRNRPAHVLAPVPGGWGAVSCRPSGPATLTMERRMHHPPEP
                     CWTLPLRPLRAFAACLLVSLSAAACSAADPAPSSSQPGAPVQAADAPRQDVAPMQNTS
                     PDTAVTPPDAPTVMYFTYQVDGDGATSYEVQNGSVATFWFGHTFTLDGTTYYTGFSWD
                     TREHYGKPGEQSPAGPDDRANLAEATFVLAGADAKKPWKFRGQEWTIGALGAYDKADD
                     VDTRRKPLEHRTADGRLLLAVPTSSFDRGISSTGYALLLFNPKRSEDDVDSKVWRYVG
                     SVRTGEDNSAACDEGNVMPCTDSDGELAFAADGNGLPRLTVTFKGTTIEGPGKTRALG
                     AGDAVHYTFDSATQQYVAP"
     CDS             complement(205545..206183)
                     /transl_table=11
                     /locus_tag="Smlt0195"
                     /product="putative LuxR family two component response
                     regulator"
                     /note="similarity:fasta; with=UniProt:Q4KHP5
                     (EMBL:CP000076;); Pseudomonas fluorescens (strain
                     Pf-5/ATCC BAA-477).; DNA-binding response regulator, LuxR
                     family.; length=220; id 45.238%; ungapped id 46.341%;
                     E()=2.9e-26; 210 aa overlap; query 3-209; subject 9-216"
                     /db_xref="EnsemblGenomes-Gn:Smlt0195"
                     /db_xref="EnsemblGenomes-Tr:CAQ43804"
                     /db_xref="GOA:B2FHG1"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="UniProtKB/TrEMBL:B2FHG1"
                     /protein_id="CAQ43804.1"
                     /translation="MSLRIIIADDHPVVRIGTRAVIESSGVGRVVGEADSAQALMALL
                     GSQPCDLLVTDYSMPGSPQADGFAMIGMIRRRFPDLPVLMLSVSNNLAILRMVLDSGV
                     LGLVDKSSSMDELPQAIQAVYRGQPYISRSLRERVEAAGSWRMREGDGKPLSPREVEV
                     LRLLGTGMTVKEISLQLHKSVSTISRQKGDAMLKLGLKGDAELFDYLRDGKI"
     misc_feature    complement(205563..205736)
                     /locus_tag="Smlt0195"
                     /note="HMMPfam hit to PF00196, Bacterial regulatory
                     proteins, luxR fami, score 4.1e-14"
                     /inference="protein motif:HMMPfam:PF00196"
     misc_feature    complement(205824..206177)
                     /locus_tag="Smlt0195"
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 1.7e-26"
                     /inference="protein motif:HMMPfam:PF00072"
     CDS             206193..209858
                     /transl_table=11
                     /locus_tag="Smlt0196"
                     /product="putative two-component sensor/response regulator
                     protein"
                     /note="similarity:fasta; with=UniProt:Q1I798
                     (EMBL:CT573326;); Pseudomonas entomophila L48.; Putative
                     two-component sensor/response regulator protein.;
                     length=1210; id 30.435%; ungapped id 32.140%; E()=9.3e-73;
                     1150 aa overlap; query 44-1154; subject 34-1161"
                     /db_xref="EnsemblGenomes-Gn:Smlt0196"
                     /db_xref="EnsemblGenomes-Tr:CAQ43805"
                     /db_xref="GOA:B2FHG2"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR008207"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="UniProtKB/TrEMBL:B2FHG2"
                     /protein_id="CAQ43805.1"
                     /translation="MATGQAGPRPSRPCQDSRRSTPMRSWAVRGLVLLLAVLVLPVAL
                     AQAVPGLLPLSPLQREYLAAHPSIVVGQYDSGWPPFESLRDGQQVGLGPDYLALLARQ
                     LGVKVEARRYSDWTSVLDAACRGEIDVVMNVGLSADRTQCMVYTAAYGEAPLALVGRP
                     GDLRASNMPDLDGLRVVIEQDFLTGPQVRARFPRAVQLVANSSLAALQMVRDDKADVY
                     IGNAYVATELIARLRLQGVVLLRPSDLPPERMHFGVPNSKQPLAEALDLALAATSQAQ
                     RDALAQRWLPLPQWSASAQLALSQAEKRVLQQPLKIGFAPNAAPLSFADEDGRPSGLA
                     SEYLARLMQAGANLQAQNSHDWYEVREKARRGELQAVMGIPVDSHYLGPDWVYSQPFI
                     SVPNVIVSRHDSPALLGLSDLQDKRVLLSDPERVRGYVLQQAPQARIVAARSAEQAMQ
                     RLIDGEADAYVGNLALVDHLLRTRFPGRLQVAAPAGFNDQLALAVERRHAALATTFDR
                     LLLQMTPREREALRGDWLAVEYHNGIDWRSTLRWGVPLLLVLLTALLVHGIGYWRLRR
                     EVAGRRQLEQRLAEVTDNLPAVVYQARREVDGTLSFPFIAGDLQALFGITRQQAEQDA
                     TMLLERVEEDDRARILQVVEQAAHQFAPLMLEFRLRGDGAGPRWVRTQAQPYAAEAGV
                     VTWSGYWVDASEARAQADALTAAKAEAEQAAEAKSRFLATMSHEIRTPMSGVLGMLEV
                     LAHSPLDAEQKRILGVIEDSAQMLRQILDDILDYSRLEANALRLEPVPQPLRPLLESV
                     CRLLSAQASARGLGLHVQIDPQLAAAHEVDGVRLRQIVFNLLSNAIKFTVRGEVRLQL
                     EVLGPTAEDGSQPLCLSVTDTGIGIAPEQLQHLFAPFTQAGAYIQRDHGGTGLGLSIC
                     QRLVQMMDGELELHSTLGEGTRAEVRLSLVEAGSSDVEALVAEQEQAALLPPALRQAR
                     VLVIEDHPTNQAMMAWRLQQLGVPHVLVGDGQQGLDRLASEHFDLVITDCRMPVLDGF
                     AFTRLLREREGRNGQPRLTVLALTASVLDDDARRCREAGMDEVLAKPLSLATLRAALL
                     RWLPQAQGQRFEEPLAESAAVDDRTLPDLDSLQRRFGSRAVAEQLRDSLLQASAGDLA
                     AVQRALEAGDREAAALHLHRQAGGLGAVGATVLAAQANALVERLQDAAETDPVPLFTA
                     VAAFVARLQQRLQRLAH"
     sig_peptide     206193..206327
                     /locus_tag="Smlt0196"
                     /note="Signal peptide predicted for Smlt0196 by SignalP
                     2.0 HMM (Signal peptide probability 0.829) with cleavage
                     site probability 0.526 between residues 45 and 46"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    206268..206336
                     /locus_tag="Smlt0196"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0196 by TMHMM2.0 at aa 26-48"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    207996..208277
                     /locus_tag="Smlt0196"
                     /note="HMMPfam hit to PF08447, PAS fold, score 9.4e-05"
                     /inference="protein motif:HMMPfam:PF08447"
     repeat_region   208098..208105
                     /rpt_unit_seq="(cg)4"
     misc_feature    208335..208532
                     /locus_tag="Smlt0196"
                     /note="HMMPfam hit to PF00512, His Kinase A
                     (phosphoacceptor) domain, score 4.9e-24"
                     /inference="protein motif:HMMPfam:PF00512"
     misc_feature    208671..209024
                     /locus_tag="Smlt0196"
                     /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
                     gyrase B-, and HS, score 9.6e-40"
                     /inference="protein motif:HMMPfam:PF02518"
     misc_feature    209103..209456
                     /locus_tag="Smlt0196"
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 2.2e-28"
                     /inference="protein motif:HMMPfam:PF00072"
     misc_feature    209586..209837
                     /locus_tag="Smlt0196"
                     /note="HMMPfam hit to PF01627, Hpt domain, score 8.5e-06"
                     /inference="protein motif:HMMPfam:PF01627"
     repeat_region   209639..209646
                     /rpt_unit_seq="(gc)4"
     CDS             complement(209852..210253)
                     /transl_table=11
                     /locus_tag="Smlt0197"
                     /product="putative cytochrome c"
                     /note="similarity:fasta; with=UniProt:P00038
                     (EMBL:AY601642;); Apis mellifera (Honeybee).; cytC;
                     Cytochrome c.; length=107; id 40.741%; ungapped id
                     43.137%; E()=9.4e-13; 108 aa overlap; query 26-131;
                     subject 3-106"
                     /note="similarity:fasta; with=UniProt:Q2GA61
                     (EMBL:CP000248;); Novosphingobium aromaticivorans (strain
                     DSM 12444).; Cytochrome c, class I precursor.; length=149;
                     id 42.149%; ungapped id 43.590%; E()=1.5e-13; 121 aa
                     overlap; query 10-129; subject 29-146"
                     /db_xref="EnsemblGenomes-Gn:Smlt0197"
                     /db_xref="EnsemblGenomes-Tr:CAQ43806"
                     /db_xref="GOA:B2FHG3"
                     /db_xref="InterPro:IPR002327"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="UniProtKB/TrEMBL:B2FHG3"
                     /protein_id="CAQ43806.1"
                     /translation="MRASFLLIAVAVALAATACQRPPAAPAPPEQAQQQAMQRAFELC
                     AGCHTVQPGGIHRFGPNLHGVIGRRAGSLPDYGYSDGMRRADITWSAQTLDAFLQSPT
                     HVVPGTRMYNAFPSAERRALVIAYLQQQSAQ"
     misc_feature    complement(209861..210154)
                     /locus_tag="Smlt0197"
                     /note="HMMPfam hit to PF00034, Cytochrome c, score 2e-12"
                     /inference="protein motif:HMMPfam:PF00034"
     sig_peptide     complement(210200..210253)
                     /locus_tag="Smlt0197"
                     /note="Signal peptide predicted for Smlt0197 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.594 between residues 18 and 19"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(210319..212004)
                     /transl_table=11
                     /locus_tag="Smlt0198"
                     /product="putative electron transfer
                     flavoprotein-ubiquinone oxidoreductase"
                     /EC_number="1.5.5.1"
                     /note="similarity:fasta; with=UniProt:Q9HZP5
                     (EMBL:AE004721;); Pseudomonas aeruginosa.; Electron
                     transfer flavoprotein-ubiquinone oxidoreductase (EC
                     1.5.5.1) (ETF-QO) (ETF-ubiquinone oxidoreductase) (ETF
                     dehydrogenase) (Electron-transferring-flavoprotein
                     dehydrogenase).; length=551; id 59.058%; ungapped id
                     59.817%; E()=7.1e-124; 552 aa overlap; query 14-561;
                     subject 3-551"
                     /note="similarity:fasta; with=UniProt:Q1LP94
                     (EMBL:CP000352;); Ralstonia metallidurans (strain
                     CH34/ATCC 43123/DSM 2839).; Electron transfer
                     flavoprotein-ubiquinone oxidoreductase.; length=561; id
                     76.545%; ungapped id 76.685%; E()=6.8e-169; 550 aa
                     overlap; query 13-561; subject 12-561"
                     /db_xref="EnsemblGenomes-Gn:Smlt0198"
                     /db_xref="EnsemblGenomes-Tr:CAQ43807"
                     /db_xref="GOA:B2FHG4"
                     /db_xref="InterPro:IPR007859"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:B2FHG4"
                     /protein_id="CAQ43807.1"
                     /translation="MQSMSAEANALPPREVMEFDVVIVGAGPAGLATAIRLRQRAIEA
                     GRELSVCVLEKGSEPGAHVLSGAVMDPRALTELFPDWAERGAPLKQKVTRDEFLFLSE
                     TGARSTPNALLPECFHNEGNYIISLGEVTRWLAQQAEALEVAIFPGFAAAEVLYGDNG
                     EVIGVATGDMGIEKDGSIGPAFERGMALHARYTIFAEGARGHLGRQLIARYKLDEGKD
                     PQAYGIGIKELWQIDPAKHEPGLVVHAAGWPLDSDTYGGAFLYHADGGKVAIGYVVGL
                     DYRNPWLSPFEEFQRFKTHPSIRKHLEGGTRIGYGARAITAGGLLSLPKTVFPGGALV
                     GCEAGYLNASRIKGSHAAIKTGMLCADAAFDALAADRQHDELSAYPTAFEASWLFTEL
                     QQAKNFKQWFKKGQTVATLMTGVEQWLLPKLGVRNPPWTLHRTQPDHACLEPAAKHTR
                     IAYPKPDGVLTFDRLSSVFLSSTNHDENQPSHLTLKDPSIPVKVNLAEYAGPEARYCP
                     AGVYEFVGEADSARLQINAQNCVHCKTCDIKDPSQNIVWVTPQGGGGPNYSGM"
     misc_feature    complement(210322..210792)
                     /locus_tag="Smlt0198"
                     /note="HMMPfam hit to PF05187, Electron transfer
                     flavoprotein-ubiquinone ox, score 7.1e-105"
                     /inference="protein motif:HMMPfam:PF05187"
     repeat_region   210340..210351
                     /rpt_unit_seq="(gcc)4"
     repeat_region   210439..210446
                     /rpt_unit_seq="(gc)4"
     misc_feature    complement(210991..211947)
                     /locus_tag="Smlt0198"
                     /note="HMMPfam hit to PF01266, FAD dependent
                     oxidoreductase, score 9.6e-05"
                     /inference="protein motif:HMMPfam:PF01266"
     repeat_region   211785..211792
                     /rpt_unit_seq="(gc)4"
     CDS             212302..213474
                     /transl_table=11
                     /gene="GCDH"
                     /locus_tag="Smlt0199"
                     /product="putative glutaryl-CoA dehydrogenase"
                     /EC_number="1.3.99.7"
                     /note="similarity:fasta; with=UniProt:Q92947
                     (EMBL:AD000092;); Homo sapiens (Human).; GCDH;
                     Glutaryl-CoA dehydrogenase, mitochondrial precursor (EC
                     1.3.99.7) (GCD).; length=438; id 51.862%; ungapped id
                     52.419%; E()=6.3e-72; 376 aa overlap; query 18-390;
                     subject 60-434"
                     /note="similarity:fasta; with=UniProt:Q8PMF7
                     (EMBL:AE011779;); Xanthomonas axonopodis pv. citri.; gcdH;
                     Glutaryl-CoA dehydrogenase.; length=391; id 76.486%;
                     ungapped id 76.486%; E()=4.6e-123; 387 aa overlap; query
                     4-390; subject 5-391"
                     /db_xref="EnsemblGenomes-Gn:Smlt0199"
                     /db_xref="EnsemblGenomes-Tr:CAQ43808"
                     /db_xref="GOA:B2FHG5"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="UniProtKB/TrEMBL:B2FHG5"
                     /protein_id="CAQ43808.1"
                     /translation="MSAMALHPYDLFDVRSLLNEEERAVQESVARFTNERVLPIIGDA
                     FDQARFPDELVPEIASLGLLGATLPTEYGGGGLGAVSYGLICQELERGDSGLRSFVSV
                     QSSLCMYPIYAYGSEEQRQQWLPAMARGELIGCFGLTEAHGGSDPASMKTRAVRDGSD
                     WRISGSKMWITSGPVADLAIVWAQTEDGIQGFVLQKGMAGFTTQEIKHKMSLRASLTG
                     ALFFDDVRVPDSHRLPNVKGLKGPLGCLTQARYGISWGPIGAAIACLDEALGYAKERV
                     LFGRPLAATQSAQIKLAEMARRITTAQLLALQLGRLKEAGQLQPQQVSLAKWNNCRMA
                     IDIARECRDLLGGAGITTEHVAIRHALNLESVITYEGTETVHQLVIGRELTGINAF"
     misc_feature    212356..212694
                     /gene="GCDH"
                     /locus_tag="Smlt0199"
                     /note="HMMPfam hit to PF02771, Acyl-CoA dehydrogenase,
                     N-terminal doma, score 1.2e-20"
                     /inference="protein motif:HMMPfam:PF02771"
     misc_feature    212704..212859
                     /gene="GCDH"
                     /locus_tag="Smlt0199"
                     /note="HMMPfam hit to PF02770, Acyl-CoA dehydrogenase,
                     middle domain, score 1.7e-28"
                     /inference="protein motif:HMMPfam:PF02770"
     misc_feature    213007..213456
                     /gene="GCDH"
                     /locus_tag="Smlt0199"
                     /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
                     C-terminal doma, score 2.3e-36"
                     /inference="protein motif:HMMPfam:PF00441"
     misc_feature    213052..213393
                     /gene="GCDH"
                     /locus_tag="Smlt0199"
                     /note="HMMPfam hit to PF08028, Acyl-CoA dehydrogenase,
                     C-terminal doma, score 7.4e-06"
                     /inference="protein motif:HMMPfam:PF08028"
     repeat_region   213630..213827
                     /rpt_family="R=9"
                     /inference="nucleotide motif:RepeatScout"
     CDS             complement(213882..214361)
                     /transl_table=11
                     /locus_tag="Smlt0200"
                     /product="putative tRNA/rRNA methyltransferase"
                     /note="similarity:fasta; with=UniProt:Q8PDX5
                     (EMBL:AE012116;); Xanthomonas campestris pv. campestris.;
                     TRNA/rRNA methyltransferase.; length=158; id 78.205%;
                     ungapped id 78.205%; E()=9.2e-46; 156 aa overlap; query
                     3-158; subject 2-157"
                     /db_xref="EnsemblGenomes-Gn:Smlt0200"
                     /db_xref="EnsemblGenomes-Tr:CAQ43809"
                     /db_xref="GOA:B2FHG6"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR016914"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:B2FHG6"
                     /protein_id="CAQ43809.1"
                     /translation="MNAAPQFHVILFQPEIPPNTGNVIRLCANTGAQLHLVEPLGFAL
                     EDKQLKRAGLDYHEYSRLQVHPDLDTALARIAPKRLFALSTRASVRYDSVAFEDGDAF
                     LFGPESRGLPQDVLDALPDGRRLRLPMRPDNRSLNLSNTVAVVMYEAWRQHGFAGGA"
     misc_feature    complement(213921..214346)
                     /locus_tag="Smlt0200"
                     /note="HMMPfam hit to PF00588, SpoU rRNA Methylase family,
                     score 3.8e-45"
                     /inference="protein motif:HMMPfam:PF00588"
     CDS             complement(214431..214907)
                     /transl_table=11
                     /locus_tag="Smlt0201"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q8PQU0
                     (EMBL:AE011648;); Xanthomonas axonopodis pv. citri.;
                     Hypothetical protein XAC0231.; length=153; id 49.655%;
                     ungapped id 52.941%; E()=8.8e-15; 145 aa overlap; query
                     6-147; subject 8-146"
                     /db_xref="EnsemblGenomes-Gn:Smlt0201"
                     /db_xref="EnsemblGenomes-Tr:CAQ43810"
                     /db_xref="UniProtKB/TrEMBL:B2FHG7"
                     /protein_id="CAQ43810.1"
                     /translation="MNAKTIAIAIALIAGTAVVSSVQASESIKTLSTVQVRPAADQLA
                     QRAWEQASGIPTLATVEVRPSADQLAERSGYVAAPVAAAMPITTLASVEVRPSLEQRV
                     ALAAELEAQRYAATLAAAATSVANQVIVNLPALQVRPSAADLQALATETAQILLRP"
     sig_peptide     complement(214836..214907)
                     /locus_tag="Smlt0201"
                     /note="Signal peptide predicted for Smlt0201 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.984 between residues 24 and 25"
                     /inference="protein motif:SignalP:2.0"
     repeat_region   215273..215280
                     /rpt_unit_seq="(gc)4"
     CDS             215323..218172
                     /transl_table=11
                     /locus_tag="Smlt0203"
                     /product="putative peptidase"
                     /note="similarity:fasta; with=UniProt:Q49145
                     (EMBL:L43135;); Methylobacterium extorquens.; pqqE;
                     Protease.; length=709; id 28.571%; ungapped id 31.894%;
                     E()=4e-35; 672 aa overlap; query 26-662; subject 51-687"
                     /note="similarity:fasta; with=UniProt:Q3BXW6
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Putative zinc metalloprotease precursor.;
                     length=959; id 51.760%; ungapped id 53.362%; E()=1.6e-180;
                     966 aa overlap; query 5-949; subject 2-959"
                     /db_xref="EnsemblGenomes-Gn:Smlt0203"
                     /db_xref="EnsemblGenomes-Tr:CAQ43811"
                     /db_xref="GOA:B2FHG8"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:B2FHG8"
                     /protein_id="CAQ43811.1"
                     /translation="MSLALRPRTALLAVALSTALGTLVPSHALAAKPAAPAKVDIPYE
                     QFTLPNGLRVIVHTDRKAPIVAVNVWYHVGSKDEPAGRTGFAHLFEHLMFQGSENHDG
                     EFFEPFKQVGATNQNGTTNTDRTNYFENVPTTALDMALWMESDRMGHLVGAIDQAALD
                     EQRGVVQNEKRQGENQPYGQAWDQLNKALYPVGHPYHHGVIGSMNDLNAASLDDVKTW
                     FRTWYGPNNAVLVLAGDIDLATAKEKVGKYFGSIPAGPTMAQPAVNVAKRSADTRETM
                     TDKVPQARIYRAWNVPQVGTTEVDQLQLFAQVLGGAKSSRLSQRLQHQDKLVDSIAAG
                     LSTSQLGSNFVIMATVKQGQDPAKVEKIIDEELDRLIKQGPTAAELERAKTGARAGFI
                     RGIERIGGFGGKADALAECAVFTGDPGCFRTSLANIEKASAADLSRLGAQWLDKGSHT
                     LVIAPGERVALKEDPSQAPKPFNVPAVDPKYSTLPEQVDRKAGVPQTREFPQLKFPAL
                     QRATLKNGTQVILAERHEIPVVQFSYQFPGGFSADQGRKPGTANFTMSLMTEGAGKLG
                     SLAFADAADALGASLDASAGLDSMSVDLSALKENLAPSLALYRDLLREPRFEQGEIDR
                     VKASWIAGIQQEKVNPGAVAMRVLPPLLYGKGHPYAIPFTGSGDEAAINGLTREDLVD
                     FHRDWLRPQNGTLIVVGDTTLAEIVPLLDKQLGDWKAAGDAPQVKAATDVALPKGPRV
                     FLIDQPGAVQANLFASQVVAPSSAATSTRFDIANGVIGGDFTSRLNMNLREDKHWSYG
                     ARSSAINSVGQRPWMASAPVQIDKTGPAMAEMRKEIAAFADGSKPATAAEVNRIRNIQ
                     TLSLPGAYETASAVASTIGSIVQFKRPDDYVLRRKAEIEAMTPAQVQQAAAEIKPQAL
                     TWVVVGDLKQTEAAVRALNLGEVTVIDAEGNPVKK"
     sig_peptide     215323..215412
                     /locus_tag="Smlt0203"
                     /note="Signal peptide predicted for Smlt0203 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.837 between residues 30 and 31"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    215479..215922
                     /locus_tag="Smlt0203"
                     /note="HMMPfam hit to PF00675, Insulinase (Peptidase
                     family M16), score 2.6e-06"
                     /inference="protein motif:HMMPfam:PF00675"
     misc_feature    215947..216483
                     /locus_tag="Smlt0203"
                     /note="HMMPfam hit to PF05193, Peptidase M16 inactive
                     domain, score 4.4e-40"
                     /inference="protein motif:HMMPfam:PF05193"
     misc_feature    217342..217890
                     /locus_tag="Smlt0203"
                     /note="HMMPfam hit to PF05193, Peptidase M16 inactive
                     domain, score 4.7e-28"
                     /inference="protein motif:HMMPfam:PF05193"
     CDS             218385..218702
                     /transl_table=11
                     /locus_tag="Smlt0204"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q3BZ44
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Putative secreted protein.; length=106;
                     id 81.132%; ungapped id 81.905%; E()=2.8e-30; 106 aa
                     overlap; query 1-105; subject 1-106"
                     /db_xref="EnsemblGenomes-Gn:Smlt0204"
                     /db_xref="EnsemblGenomes-Tr:CAQ43812"
                     /db_xref="InterPro:IPR025294"
                     /db_xref="UniProtKB/TrEMBL:B2FHG9"
                     /protein_id="CAQ43812.1"
                     /translation="MRVLLLSSLLLTVTACTWVPIEPAGKATRVLPAGPVPAGCIAKG
                     EVVVTVKSKVGFYNRNPLRVQEELETLARNEAPSAGANAVQAAAAPADGSQRFAAFQC
                     PPR"
     sig_peptide     218385..218429
                     /locus_tag="Smlt0204"
                     /note="Signal peptide predicted for Smlt0204 by SignalP
                     2.0 HMM (Signal peptide probability 0.953) with cleavage
                     site probability 0.811 between residues 15 and 16"
                     /inference="protein motif:SignalP:2.0"
     CDS             218806..219822
                     /transl_table=11
                     /gene="fabH"
                     /locus_tag="Smlt0205"
                     /product="putative 3-oxoacyl-[acyl-carrier-protein]
                     synthase 3"
                     /EC_number="2.3.1.41"
                     /note="similarity:fasta; with=UniProt:P30790
                     (EMBL:M84030;); Rhodobacter capsulatus (Rhodopseudomonas
                     capsulata).; fabH; 3-oxoacyl-[acyl-carrier-protein]
                     synthase 3 (EC 2.3.1.41) (3-oxoacyl-
                     [acyl-carrier-protein] synthase III) (Beta-ketoacyl-ACP
                     synthase III) (KAS III).; length=324; id 26.590%; ungapped
                     id 29.114%; E()=2.5e-10; 346 aa overlap; query 6-343;
                     subject 1-324"
                     /note="similarity:fasta; with=UniProt:Q8PDX2
                     (EMBL:AE012117;); Xanthomonas campestris pv. campestris.;
                     fabH; 3-oxoacyl-[ACP] synthase III.; length=338; id
                     88.462%; ungapped id 88.462%; E()=2.4e-107; 338 aa
                     overlap; query 6-343; subject 1-338"
                     /db_xref="EnsemblGenomes-Gn:Smlt0205"
                     /db_xref="EnsemblGenomes-Tr:CAQ43813"
                     /db_xref="GOA:B2FHH0"
                     /db_xref="InterPro:IPR013747"
                     /db_xref="InterPro:IPR013751"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="UniProtKB/TrEMBL:B2FHH0"
                     /protein_id="CAQ43813.1"
                     /translation="MLFKNVSIAGLAHVDAPHTLTTKEINERLQPTLDRLGIRTDVLG
                     DIAGIHARRLWDNGVLASDAATMAGRKALEDAGINATQVGLLVNTSVSRDYLEPSTAS
                     IVSGNLGVSDECMTFDVANACLAFINGMDIAARMIERGDIDYALVVDGETANLVYEKT
                     LERMTAPDVTADDFRNELAALTTGSGAAAMVMARSELVPDAPRYKGGVTRSATEWNQL
                     CLGNLDRMVTDTRLLLIEGIKLAQKTFTAAKIALGWAVEELDQFVIHQVSQPHTAAFI
                     KNFGIDPKKVMTIFGEHGNIGPASVPIVLSKLKQLGKLKKGDRIALLGIGSGLNCSMA
                     EVVW"
     misc_feature    219547..219819
                     /gene="fabH"
                     /locus_tag="Smlt0205"
                     /note="HMMPfam hit to PF08541,
                     3-Oxoacyl-[acyl-carrier-protein (ACP)], score 1.1e-17"
                     /inference="protein motif:HMMPfam:PF08541"
     CDS             219917..220807
                     /transl_table=11
                     /gene="dhaA"
                     /locus_tag="Smlt0206"
                     /product="putative haloalkane dehalogenase"
                     /EC_number="3.8.1.5"
                     /note="similarity:fasta; with=UniProt:P0A3G3; Rhodococcus
                     sp.; dhaA; Haloalkane dehalogenase (EC 3.8.1.5).;
                     length=293; id 31.879%; ungapped id 33.569%; E()=3e-22;
                     298 aa overlap; query 1-291; subject 1-290"
                     /note="similarity:fasta; with=UniProt:Q3BZ41
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Putative hydrolase of the alpha/beta fold
                     superfamily.; length=300; id 80.808%; ungapped id 82.192%;
                     E()=2.2e-105; 297 aa overlap; query 5-296; subject 4-300"
                     /db_xref="EnsemblGenomes-Gn:Smlt0206"
                     /db_xref="EnsemblGenomes-Tr:CAQ43814"
                     /db_xref="GOA:B2FI26"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR000639"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B2FI26"
                     /protein_id="CAQ43814.1"
                     /translation="MSQLPGYPAHPQRFEVRPGLSMNYLDEGPRDGEVVVMVHGNPSW
                     SYYWRTLVAGLSDTYRCIVPDHIGMGLSDKPDDSRYEYTLQSRVDDLDALLKHLGITG
                     PVTLAVHDWGGMIGFGWALSHHDQVKRLVVLNTAAFPMPAAKKMPWQIALGRHWKIGE
                     WIIRTFNAFSSGASWLGVERKMPADVRRAYVSPYNSWANRISTIRFMQDIPLSPADKA
                     WSLLERAGKALPSFADRPAFLGWGLRDFVFDHHFLKGFQAALPQAQVHAFEDAGHYVL
                     EDKHEVLVPEIRAFLDKNPI"
     misc_feature    220091..220783
                     /gene="dhaA"
                     /locus_tag="Smlt0206"
                     /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
                     score 1e-20"
                     /inference="protein motif:HMMPfam:PF00561"
     repeat_region   220891..220920
                     /rpt_family="R=14"
                     /inference="nucleotide motif:RepeatScout"
     CDS             complement(220922..221353)
                     /transl_table=11
                     /locus_tag="Smlt0207"
                     /product="putative ferredoxin"
                     /note="similarity:fasta; with=UniProt:Q3BZ40
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Putative ferredoxin.; length=127; id
                     55.556%; ungapped id 55.556%; E()=5.4e-26; 126 aa overlap;
                     query 1-126; subject 1-126"
                     /db_xref="EnsemblGenomes-Gn:Smlt0207"
                     /db_xref="EnsemblGenomes-Tr:CAQ43815"
                     /db_xref="InterPro:IPR005358"
                     /db_xref="UniProtKB/TrEMBL:B2FI27"
                     /protein_id="CAQ43815.1"
                     /translation="MQHPCMTCGACCTQYRVAFHWMESDEVTPGGVPHQLTEVLDPHR
                     LCMRGTHSKPVRCVALDAQIGVYSRCTIHPNRPSVCREVDASWEYGKASPQCDKARIA
                     YGLDPLTPADWRWRDDADNDDDHPDDNGNSPSSPPQAPVAA"
     misc_feature    complement(221051..221347)
                     /locus_tag="Smlt0207"
                     /note="HMMPfam hit to PF03692, Uncharacterised protein
                     family (UPF0153), score 7.9e-20"
                     /inference="protein motif:HMMPfam:PF03692"
     CDS             221458..223116
                     /transl_table=11
                     /locus_tag="Smlt0208"
                     /product="putative AMP-binding protein"
                     /note="similarity:fasta; with=UniProt:Q3BZ39
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; AMP-binding protein.; length=553; id
                     77.758%; ungapped id 78.467%; E()=1.2e-156; 553 aa
                     overlap; query 1-550; subject 1-551"
                     /db_xref="EnsemblGenomes-Gn:Smlt0208"
                     /db_xref="EnsemblGenomes-Tr:CAQ43816"
                     /db_xref="GOA:B2FI28"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:B2FI28"
                     /protein_id="CAQ43816.1"
                     /translation="MNRPCNIAARLPELARERPDQIAIRCPGRRGAGNGMAAYDVTLD
                     YRQLDARSDAMAAGLAGYGIGRGVRTVVMVRPSPEFFLLMFALFKLGAVPVLVDPGID
                     RRALKQCLDEAQPEAFIGIPLAHVARLVLRWAPSAARLVTVGRRLGWGGTTLAALERA
                     GAKGGPMLAATDGEDMAAILFTSGSTGVPKGVVYRHRHFVGQIQLLGSAFGMEAGGVD
                     LPTFPPFALFDPALGLTSVIPDMDPTRPAQADPVRLHDAIQRFGVTQLFGSPALMRVL
                     AKHGRPLPTVTRVTSAGAPVPPDVVATIRSLLPADAQFWTPYGATECLPVAVVEGREL
                     ERTRAATEAGAGTCVGSVVAPNEVRIIAIDDAPLADWSQARVLAVGEVGEITVAGPTA
                     TDSYFNRPQATAAAKIRETLADGSTRVVHRMGDVGYFDAQGRLWFCGRKTQRVETARG
                     PLYTEQVEPVFNTVAGVARTALVGVGAAGAQVPVLCVELLRGQSDSPALQEALRAHAA
                     ARTPEAGLQHFLVHPAFPVDIRHNAKIGREKLAVWASAELEKRA"
     misc_feature    221587..222873
                     /locus_tag="Smlt0208"
                     /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
                     4e-56"
                     /inference="protein motif:HMMPfam:PF00501"
     repeat_region   221766..221773
                     /rpt_unit_seq="(gc)4"
     repeat_region   222798..222805
                     /rpt_unit_seq="(cg)4"
     CDS             223113..224105
                     /transl_table=11
                     /locus_tag="Smlt0209"
                     /product="putative NAD(P)H dehydrogenase"
                     /note="similarity:fasta; with=UniProt:Q9R1J0
                     (EMBL:AF100198;); Mus musculus (Mouse).; Nsdhl;
                     Sterol-4-alpha-carboxylate 3-dehydrogenase,
                     decarboxylating (EC 1.1.1.170).; length=362; id 33.735%;
                     ungapped id 35.783%; E()=2.4e-28; 332 aa overlap; query
                     2-323; subject 28-350"
                     /note="similarity:fasta; with=UniProt:Q8PDW5
                     (EMBL:AE012118;); Xanthomonas campestris pv. campestris.;
                     cdh; NAD(P)H steroid dehydrogenase.; length=337; id
                     82.067%; ungapped id 82.067%; E()=1.8e-104; 329 aa
                     overlap; query 1-329; subject 2-330"
                     /db_xref="EnsemblGenomes-Gn:Smlt0209"
                     /db_xref="EnsemblGenomes-Tr:CAQ43817"
                     /db_xref="GOA:B2FI29"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B2FI29"
                     /protein_id="CAQ43817.1"
                     /translation="MKILVTGGGGFLGQALCRGLVERGHQVLAFNRSHYPELQVMGVG
                     QIRGDLADPQAVLHAVAGVDAVFHNGAKAGAWGSYDSYHQANVIGTDNVIAACRAHGI
                     GRLVYTSTPSVTHRATHPVEGLGADEVPYGEDFQAPYAATKAIAEQRVLAANDASLAT
                     VALRPRLIWGPGDQQLVPRLAERARQGRLRLVGDGSNKVDTTYIDNAALAHFLAFEAL
                     APGAACAGKAYFISNGEPLPMRELVNQLLAAVGAPRVDKAISFKTAYRIGAICERLWP
                     LLRLRGEPPLTRFLAEQLCTPHWYSMEPARRDFGYVPQVSIEEGLRRLKASSAA"
     misc_feature    223116..223868
                     /locus_tag="Smlt0209"
                     /note="HMMPfam hit to PF04321, RmlD substrate binding
                     domain, score 4.4e-05"
                     /inference="protein motif:HMMPfam:PF04321"
     misc_feature    223119..223919
                     /locus_tag="Smlt0209"
                     /note="HMMPfam hit to PF02719, Polysaccharide biosynthesis
                     protein, score 0.00064"
                     /inference="protein motif:HMMPfam:PF02719"
     misc_feature    223119..223901
                     /locus_tag="Smlt0209"
                     /note="HMMPfam hit to PF05368, NmrA-like family, score
                     0.00041"
                     /inference="protein motif:HMMPfam:PF05368"
     misc_feature    223119..223808
                     /locus_tag="Smlt0209"
                     /note="HMMPfam hit to PF01370, NAD dependent
                     epimerase/dehydratase f, score 2.2e-26"
                     /inference="protein motif:HMMPfam:PF01370"
     misc_feature    223122..223901
                     /locus_tag="Smlt0209"
                     /note="HMMPfam hit to PF01073, 3-beta hydroxysteroid
                     dehydrogenase/i, score 1e-60"
                     /inference="protein motif:HMMPfam:PF01073"
     misc_feature    223125..223745
                     /locus_tag="Smlt0209"
                     /note="HMMPfam hit to PF07993, Male sterility protein,
                     score 2.5e-11"
                     /inference="protein motif:HMMPfam:PF07993"
     CDS             224187..224342
                     /transl_table=11
                     /locus_tag="Smlt0210"
                     /product="putative transmembrane protein"
                     /note="similarity:fasta; with=UniProt:Q8NL44
                     (EMBL:AE011648;); Xanthomonas axonopodis pv. citri.;
                     Hypothetical protein XAC0239.; length=52; id 97.959%;
                     ungapped id 97.959%; E()=6.1e-13; 49 aa overlap; query
                     1-49; subject 1-49"
                     /db_xref="EnsemblGenomes-Gn:Smlt0210"
                     /db_xref="EnsemblGenomes-Tr:CAQ43818"
                     /db_xref="GOA:B2FI30"
                     /db_xref="InterPro:IPR009760"
                     /db_xref="UniProtKB/TrEMBL:B2FI30"
                     /protein_id="CAQ43818.1"
                     /translation="MLHYAIIFFVIAIIAAVLGFSGIAGAATNIAWILFVVFLILAVI
                     SMFRKRG"
     sig_peptide     224187..224264
                     /locus_tag="Smlt0210"
                     /note="Signal peptide predicted for Smlt0210 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.996 between residues 26 and 27"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    224190..224333
                     /locus_tag="Smlt0210"
                     /note="HMMPfam hit to PF07043, Protein of unknown function
                     (DUF1328), score 7.5e-24"
                     /inference="protein motif:HMMPfam:PF07043"
     misc_feature    order(224190..224258,224268..224327)
                     /locus_tag="Smlt0210"
                     /note="2 probable transmembrane helices predicted for
                     Smlt0210 by TMHMM2.0 at aa 2-24 and 28-47"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(224419..225633)
                     /transl_table=11
                     /gene="ddlA"
                     /locus_tag="Smlt0211"
                     /product="putative D-alanine--D-alanine ligase A
                     (D-alanylalanine synthetase A) (D-ala-D-ala ligase A)"
                     /EC_number="6.3.2.4"
                     /note="similarity:fasta; with=UniProt:P0A6J8
                     (EMBL:M58467;); Escherichia coli.; ddlA;
                     D-alanine--D-alanine ligase A (EC 6.3.2.4)
                     (D-alanylalanine synthetase A) (D-Ala-D-Ala ligase A).;
                     length=364; id 64.286%; ungapped id 64.286%; E()=4.3e-84;
                     364 aa overlap; query 41-404; subject 1-364"
                     /note="similarity:fasta; with=UniProt:Q2P8P8
                     (EMBL:AP008229;); Xanthomonas oryzae pv. oryzae (strain
                     MAFF 311018).; D-alanine-D-alanine ligase A.; length=367;
                     id 75.549%; ungapped id 75.549%; E()=1.8e-100; 364 aa
                     overlap; query 41-404; subject 1-364"
                     /db_xref="EnsemblGenomes-Gn:Smlt0211"
                     /db_xref="EnsemblGenomes-Tr:CAQ43819"
                     /db_xref="GOA:B2FI31"
                     /db_xref="InterPro:IPR000291"
                     /db_xref="InterPro:IPR005905"
                     /db_xref="InterPro:IPR011095"
                     /db_xref="InterPro:IPR011127"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:B2FI31"
                     /protein_id="CAQ43819.1"
                     /translation="MRTVDPRHAWMDFWFICASRGGPMKVHAMGPRNAQDIAFPMART
                     RVGIIFGGKSSEHEVSLQSAKNILDALDRERFEPVLVGIDKQGQWHLSQPDTFLINAD
                     DPSLIALHRSGQSLAVRPGAEQAQLQPSDAASALGQIDVVLPIVHGPLGEDGALQGLL
                     RMINLPFVGSPVLGSAVAMDKDVTKRLLRDAGLQVAPWLCIRRHEAAEVDADAVIAQL
                     GLPLFVKPANQGSSVGVSKVKDAAGFAEALALALRYDHKVLVESAVVGREIECAVLGN
                     EHPQASVCGEVVVHDEFYAYDTKYINANGADVVVPADIDAATQARIRQIARQAYQTLE
                     CAGMARVDVFLTADGEIVINEVNTLPGFTRISMYPKLWGASGVDYTTLITRLIELALE
                     RHEADRGLQSAV"
     misc_feature    complement(224470..225096)
                     /gene="ddlA"
                     /locus_tag="Smlt0211"
                     /note="HMMPfam hit to PF07478, D-ala D-ala ligase
                     C-terminus, score 2.1e-114"
                     /inference="protein motif:HMMPfam:PF07478"
     misc_feature    complement(224473..225102)
                     /gene="ddlA"
                     /locus_tag="Smlt0211"
                     /note="HMMPfam hit to PF08443, RimK-like ATP-grasp domain,
                     score 0.00041"
                     /inference="protein motif:HMMPfam:PF08443"
     misc_feature    complement(224545..225102)
                     /gene="ddlA"
                     /locus_tag="Smlt0211"
                     /note="HMMPfam hit to PF02655, ATP-grasp domain, score
                     0.0039"
                     /inference="protein motif:HMMPfam:PF02655"
     misc_feature    complement(224548..225096)
                     /gene="ddlA"
                     /locus_tag="Smlt0211"
                     /note="HMMPfam hit to PF02222, ATP-grasp domain, score
                     3.5e-08"
                     /inference="protein motif:HMMPfam:PF02222"
     misc_feature    complement(225097..225504)
                     /gene="ddlA"
                     /locus_tag="Smlt0211"
                     /note="HMMPfam hit to PF01820, D-ala D-ala ligase
                     N-terminus, score 4.3e-59"
                     /inference="protein motif:HMMPfam:PF01820"
     repeat_region   complement(225680..225847)
                     /rpt_family="R=8"
                     /inference="nucleotide motif:RepeatScout"
     repeat_region   complement(225693..225890)
                     /rpt_family="R=3"
                     /inference="nucleotide motif:RepeatScout"
     repeat_region   225879..225910
                     /rpt_unit_seq="(cggcagcc)4"
     CDS             225949..226584
                     /transl_table=11
                     /locus_tag="Smlt0212"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q3BZ35
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Hypothetical protein.; length=214; id
                     71.564%; ungapped id 72.249%; E()=1.8e-47; 211 aa overlap;
                     query 1-210; subject 1-210"
                     /db_xref="EnsemblGenomes-Gn:Smlt0212"
                     /db_xref="EnsemblGenomes-Tr:CAQ43820"
                     /db_xref="InterPro:IPR003033"
                     /db_xref="UniProtKB/TrEMBL:B2FI32"
                     /protein_id="CAQ43820.1"
                     /translation="MALSLLKSLKPVAGRALQIALNRALALDPDTRHALASLDGRHID
                     LTLEAPVLAMRISVDGDQLRVGPVDAQEADLAVRSSLAGVLAQLPLLANARRGDNNGK
                     GRVRVAGDAELARRLQQLAKGFDPDWQQPFVSVFGEVLGVQVANTLRSALQHARQGAI
                     DLAHSAAEFITEESRDVVPRAELDAFHDDVDVLRDDVERLGARVQRLRGAA"
     misc_feature    225994..226569
                     /locus_tag="Smlt0212"
                     /note="HMMPfam hit to PF06843, Protein of unknown function
                     (DUF1243), score 7.5e-61"
                     /inference="protein motif:HMMPfam:PF06843"
     CDS             226581..228236
                     /transl_table=11
                     /gene="ubiB"
                     /locus_tag="Smlt0213"
                     /product="putative ubiquinone biosynthesis protein"
                     /note="similarity:fasta; with=UniProt:P0A6A0
                     (EMBL:M87049;); Escherichia coli.; ubiB; Probable
                     ubiquinone biosynthesis protein ubiB.; length=546; id
                     45.438%; ungapped id 46.542%; E()=1.8e-83; 548 aa overlap;
                     query 4-549; subject 6-542"
                     /note="similarity:fasta; with=UniProt:Q3BZ34
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; ubiB; Ubiquinone biosynthesis protein
                     UbiB.; length=557; id 84.173%; ungapped id 84.936%;
                     E()=1.5e-176; 556 aa overlap; query 1-551; subject 1-556"
                     /db_xref="EnsemblGenomes-Gn:Smlt0213"
                     /db_xref="EnsemblGenomes-Tr:CAQ43821"
                     /db_xref="GOA:B2FI33"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR010232"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:B2FI33"
                     /protein_id="CAQ43821.1"
                     /translation="MKAVLRASRIGRVILRYRLDDLLQGTPAERWLRLAKPFVPRASA
                     SIASQSRGARLRLALQDLGPIFVKFGQILSTRRDLVPPDVANELTLLQDRVKPFDGET
                     ARRIVEDALGLPVSEAFASFDTEPLASASIAQVHAATLADGRQVVVKVLRPGIEKQID
                     ADIALLNSLAALVERTHPRADKIRPREVVAEVENTLAAELDLQREGANASVLRRFWEN
                     SDDLYVPEVIWSHTAERALTLERVWGIPSDDIAALDKAGIDRKALAAKGVRVFYTQVF
                     RDNFFHADAHAGNIWVDTDPARRANPRFIALDFGIMGQLSQEDQYYLAENFMAIFNRD
                     YRRIAELHVQARWMPDHVRIDDLEAAVRSVCEPYFTRPLSQISLAEVLMKLFRVAQRY
                     QLTLQPQLILLQKTLLNIEGVGRQLDPQIDIWAVAKPVLAKILRERYSPRRVVRELGK
                     RLPEIMTHAPDMPRLVHAWLTQQVEGRHELAMRSRDLVALDASLQRLQKRAVGAITGV
                     GLLAIAALMYVLQPPGWYWGDVPAWSWLSGAVGVVALARAWWR"
     misc_feature    226905..227264
                     /gene="ubiB"
                     /locus_tag="Smlt0213"
                     /note="HMMPfam hit to PF03109, ABC1 family, score 2.2e-46"
                     /inference="protein motif:HMMPfam:PF03109"
     repeat_region   227282..227289
                     /rpt_unit_seq="(gc)4"
     misc_feature    order(228081..228140,228168..228227)
                     /gene="ubiB"
                     /locus_tag="Smlt0213"
                     /note="2 probable transmembrane helices predicted for
                     Smlt0213 by TMHMM2.0 at aa 501-520 and 530-549"
                     /inference="protein motif:TMHMM:2.0"
     repeat_region   228216..228223
                     /rpt_unit_seq="(gc)4"
     CDS             complement(228289..229074)
                     /transl_table=11
                     /locus_tag="Smlt0214"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q0TKS5; ;
                     length=257; id 31.890%; ungapped id 32.271%; E()=2.1e-26;
                     254 aa overlap; query 4-255; subject 1-253"
                     /db_xref="EnsemblGenomes-Gn:Smlt0214"
                     /db_xref="EnsemblGenomes-Tr:CAQ43822"
                     /db_xref="InterPro:IPR030887"
                     /db_xref="UniProtKB/TrEMBL:B2FI34"
                     /protein_id="CAQ43822.1"
                     /translation="MRLIIRGALPCALLLAVCSAHAGVDRVTVQLDHADYSDGFGKRD
                     VQTVDVAGRSGGSRWHLGLAHGERDYGSRRFSGNRMQGSLHHRWSPRLSTRTAVTASN
                     DDPVFVNRQVNQDIQWKVTPQTVLSVGGKYAQYHAGAHVSGWSVGASHYFPRVTASLR
                     HERHRQSNGPDGHGTTLSLRLKDGQGRGSTQLWLGSGTSGYTAESDPLLLREHDARRA
                     FLRRSQPLGEHLVLDVGIGKTWHRTRLDSFQSVQSHLGLGYHW"
     sig_peptide     complement(229009..229074)
                     /locus_tag="Smlt0214"
                     /note="Signal peptide predicted for Smlt0214 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.995 between residues 22 and 23"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(229079..229660)
                     /transl_table=11
                     /locus_tag="Smlt0215"
                     /product="putative hexapeptide transferase"
                     /note="similarity:fasta; with=UniProt:Q0TKS4; ;
                     length=146; id 55.714%; ungapped id 55.714%; E()=7e-25;
                     140 aa overlap; query 48-187; subject 2-141"
                     /note="similarity:fasta; with=UniProt:Q1RFI3
                     (EMBL:CP000243;); Escherichia coli (strain UTI89/UPEC).;
                     Putative transferase (EC 2.7.7.-).; length=174; id
                     58.025%; ungapped id 58.025%; E()=2.6e-31; 162 aa overlap;
                     query 26-187; subject 8-169"
                     /db_xref="EnsemblGenomes-Gn:Smlt0215"
                     /db_xref="EnsemblGenomes-Tr:CAQ43823"
                     /db_xref="GOA:B2FI35"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="UniProtKB/TrEMBL:B2FI35"
                     /protein_id="CAQ43823.1"
                     /translation="MAEALSTLAPHTDPDAEVSPRATLHGAVRIGAGSRICDGAHVQG
                     PVSIGRDCLIGNNALLRGPLCIGDGTRIGFASELKNARLGNQVSIGPQCFIADSRIDD
                     RVYLGALVRTSNHRLDGATVTVHIGDTVIDSQRDKLGAWIGEGAALGVGVIILPGRIV
                     APGSQFGPRITVERNLPPGRYRLLQSLHSQPLE"
     misc_feature    complement(229139..229192)
                     /locus_tag="Smlt0215"
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (three rep, score 1e+02"
                     /inference="protein motif:HMMPfam:PF00132"
     misc_feature    complement(229193..229246)
                     /locus_tag="Smlt0215"
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (three rep, score 1.4"
                     /inference="protein motif:HMMPfam:PF00132"
     misc_feature    complement(229370..229423)
                     /locus_tag="Smlt0215"
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (three rep, score 0.15"
                     /inference="protein motif:HMMPfam:PF00132"
     misc_feature    complement(229457..229510)
                     /locus_tag="Smlt0215"
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (three rep, score 9"
                     /inference="protein motif:HMMPfam:PF00132"
     misc_feature    complement(229511..229564)
                     /locus_tag="Smlt0215"
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (three rep, score 41"
                     /inference="protein motif:HMMPfam:PF00132"
     misc_feature    complement(229565..229618)
                     /locus_tag="Smlt0215"
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (three rep, score 17"
                     /inference="protein motif:HMMPfam:PF00132"
     CDS             complement(229671..230810)
                     /transl_table=11
                     /locus_tag="Smlt0216"
                     /product="putative transmembrane glycosyl transferase"
                     /note="similarity:fasta; with=UniProt:Q5VJB2
                     (EMBL:AY438014;); actinomycetemcomitans).; aagC; AagC.;
                     length=411; id 30.178%; ungapped id 32.692%; E()=6.3e-14;
                     338 aa overlap; query 1-322; subject 18-345"
                     /note="similarity:fasta; with=UniProt:Q0TGD1; ;
                     length=398; id 62.533%; ungapped id 62.533%; E()=1.7e-92;
                     379 aa overlap; query 1-379; subject 1-379"
                     /db_xref="EnsemblGenomes-Gn:Smlt0216"
                     /db_xref="EnsemblGenomes-Tr:CAQ43824"
                     /db_xref="GOA:B2FI36"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:B2FI36"
                     /protein_id="CAQ43824.1"
                     /translation="MKTLLFLAMCAFILVRICVQASRRPSTRLYSIDAIVPAYNEAPC
                     LERSLASLLENPYVARVICVNDGSTDNTAQVLDALQARWPGRLVAVHQANTGKGGALM
                     HGLQHATAEQVFLTDADTHIDPRSHGLGHLLAEIERGADAVGGVPSSSLQGAGFLPHV
                     RASLKLPMIVIKRSFQQWLGGAPFIVSGSCGLFRTSVLRKVGFSDRTRVEDLDMSWSL
                     VAQGYRVRQSIRCVVYPQECNTLVEEWRRWRRWIVGYAVCMRLHRRLLLTRFGIFSIL
                     PMMLLALAGIMLSLQVWFGAARLHGPGGLALSVMPLFWTGIVMLLAVISAIHHRRAWL
                     VPAAAFSMLYVLLAYAIWLFHGLAGLFTGREPVRDKPTRYPHVVE"
     misc_feature    complement(order(229749..229817,229836..229904,
                     229947..230015,230217..230285))
                     /locus_tag="Smlt0216"
                     /note="4 probable transmembrane helices predicted for
                     Smlt0216 by TMHMM2.0 at aa 176-198, 266-288, 303-325 and
                     332-354"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(230205..230714)
                     /locus_tag="Smlt0216"
                     /note="HMMPfam hit to PF00535, Glycosyl transferase
                     family, score 6.8e-26"
                     /inference="protein motif:HMMPfam:PF00535"
     sig_peptide     complement(230742..230810)
                     /locus_tag="Smlt0216"
                     /note="Signal peptide predicted for Smlt0216 by SignalP
                     2.0 HMM (Signal peptide probability 0.974) with cleavage
                     site probability 0.486 between residues 23 and 24"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(230810..231421)
                     /transl_table=11
                     /locus_tag="Smlt0217"
                     /product="putative N-acetyl glucosamine deacetylase
                     (LmbE-like)"
                     /note="similarity:fasta; with=UniProt:Q0TKS2; ;
                     length=223; id 48.780%; ungapped id 50.251%; E()=2.9e-33;
                     205 aa overlap; query 5-203; subject 19-223"
                     /db_xref="EnsemblGenomes-Gn:Smlt0217"
                     /db_xref="EnsemblGenomes-Tr:CAQ43825"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="InterPro:IPR024078"
                     /db_xref="UniProtKB/TrEMBL:B2FI37"
                     /protein_id="CAQ43825.1"
                     /translation="MTLNILAIGAHPDDIELGCGGSLAKLARAGSRIHALVLSRGGRG
                     CHAGIDRSDESHRALHRLGVAEVIQQDFPDTRFPTCRNDIIASIEQVCTLIEPDRIYT
                     MCGEDHHQDHRTVHEASIIACRHIPQILCYESPSTLPQFAPQVFEDISAQLELKIHAL
                     REHASQGDRHYMQESHLRCHAQFRGQQIGIGPSEGFLPYRLVL"
     misc_feature    complement(231053..231406)
                     /locus_tag="Smlt0217"
                     /note="HMMPfam hit to PF02585, GlcNAc-PI de-N-acetylase,
                     score 3.8e-32"
                     /inference="protein motif:HMMPfam:PF02585"
     CDS             231554..232174
                     /transl_table=11
                     /locus_tag="Smlt0218"
                     /product="putative o-methyltransferase"
                     /note="similarity:fasta; with=UniProt:Q00719
                     (EMBL:M93958;); Streptomyces mycarofaciens.; mdmC;
                     O-methyltransferase mdmC (EC 2.1.1.-).; length=221; id
                     33.880%; ungapped id 37.349%; E()=2.4e-09; 183 aa overlap;
                     query 38-204; subject 38-219"
                     /note="similarity:fasta; with=UniProt:Q1JXV1
                     (EMBL:AAEW02000014;); Desulfuromonas acetoxidans DSM 684.;
                     O-methyltransferase, family 3.; length=195; id 61.538%;
                     ungapped id 61.538%; E()=4.3e-41; 195 aa overlap; query
                     12-206; subject 1-195"
                     /db_xref="EnsemblGenomes-Gn:Smlt0218"
                     /db_xref="EnsemblGenomes-Tr:CAQ43826"
                     /db_xref="GOA:B2FI38"
                     /db_xref="InterPro:IPR002935"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B2FI38"
                     /protein_id="CAQ43826.1"
                     /translation="MDAASWRAQRKMALELSELKNELAHFGAENDAREVERGRRMLNI
                     TPDTGEFLAVLVRFGTARRVLEIGTSNGYSTLWLAESAAAIDGHVTTLEYAEDKAAMA
                     RDTFARSGLADRITLVHDDAGPWLAEAADASIDLLFLDSDRGQYAGWWPQLRRVLRPG
                     GLLVVDNATSHAGEMEPLRTLLESDANFSTSLVPVGNGELLAVRNA"
     misc_feature    231581..232168
                     /locus_tag="Smlt0218"
                     /note="HMMPfam hit to PF01596, O-methyltransferase, score
                     1.2e-13"
                     /inference="protein motif:HMMPfam:PF01596"
     CDS             232351..233091
                     /transl_table=11
                     /gene="truC"
                     /locus_tag="Smlt0219"
                     /product="putative tRNA pseudouridine synthase C"
                     /EC_number="5.4.99.-"
                     /note="similarity:fasta; with=UniProt:P0AA41
                     (EMBL:U29581;); Escherichia coli.; truC; tRNA
                     pseudouridine synthase C (EC 5.4.99.-) (tRNA-uridine
                     isomerase C) (tRNA pseudouridylate synthase C).;
                     length=260; id 39.407%; ungapped id 41.150%; E()=5.5e-29;
                     236 aa overlap; query 18-243; subject 2-237"
                     /note="similarity:fasta; with=UniProt:Q3BZ32
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; truC; Pseudouridylate synthase (EC
                     4.2.1.70).; length=238; id 82.895%; ungapped id 83.260%;
                     E()=5.4e-78; 228 aa overlap; query 18-244; subject 8-235"
                     /db_xref="EnsemblGenomes-Gn:Smlt0219"
                     /db_xref="EnsemblGenomes-Tr:CAQ43827"
                     /db_xref="GOA:B2FI39"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:B2FI39"
                     /protein_id="CAQ43827.1"
                     /translation="MSTEPDTLAAVETETAPLQLLHLDERLAVVNKPAGLMVHDSKLA
                     RGEDDFLADRLREQLGRPIFLVHRLDRATSGCLLLAFDRETASALGKALMGGEVLKDY
                     LTVCRGWPAELAWQVDHDLDGGPGKPVKKPAVTDFQRLATGELSVPVGEFTRSRYALL
                     RCQPQTGRFRQIRRHLKHLSHHMIGDTSHGDGRHNRIFRMQGVHRMLLHAERLRFPHP
                     EGGNVDVSAPLDREFQKALDLFGWQVDL"
     misc_feature    232426..232884
                     /gene="truC"
                     /locus_tag="Smlt0219"
                     /note="HMMPfam hit to PF00849, RNA pseudouridylate
                     synthase, score 5.1e-26"
                     /inference="protein motif:HMMPfam:PF00849"
     CDS             complement(233168..233716)
                     /transl_table=11
                     /locus_tag="Smlt0220"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q2P8Q3
                     (EMBL:AP008229;); Xanthomonas oryzae pv. oryzae (strain
                     MAFF 311018).; Hypothetical protein XOO0319.; length=192;
                     id 72.515%; ungapped id 72.515%; E()=8.8e-41; 171 aa
                     overlap; query 9-179; subject 16-186"
                     /db_xref="EnsemblGenomes-Gn:Smlt0220"
                     /db_xref="EnsemblGenomes-Tr:CAQ43828"
                     /db_xref="InterPro:IPR018637"
                     /db_xref="UniProtKB/TrEMBL:B2FI40"
                     /protein_id="CAQ43828.1"
                     /translation="MYRRKLRMTRSAPALPSLLRRAALLLALAVASVPALAAPPTDGD
                     INRLLSASRAQSMIDTMLPQIEAMQQQQFQQVAAQRQLNAQQQEQLKRIQARTSQTLR
                     QALSWQQLRPMYVDLYKKTFSKEDVLAMAEFYESAAGQSLLDKTPALMQNVMVAIQAR
                     MQPLFADLQKDLEAIVNEPEKK"
     repeat_region   233501..233512
                     /rpt_unit_seq="(ctg)4"
     sig_peptide     complement(233606..233716)
                     /locus_tag="Smlt0220"
                     /note="Signal peptide predicted for Smlt0220 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 1.000 between residues 37 and 38"
                     /inference="protein motif:SignalP:2.0"
     CDS             233715..234260
                     /transl_table=11
                     /locus_tag="Smlt0221"
                     /product="putative peptidyl-tRNA hydrolase"
                     /note="similarity:fasta; with=UniProt:Q4V049
                     (EMBL:CP000050;); Xanthomonas campestris pv. campestris
                     (strain 8004).; Peptidyl-tRNA hydrolase.; length=143; id
                     80.420%; ungapped id 80.420%; E()=1.2e-37; 143 aa overlap;
                     query 39-181; subject 1-143"
                     /db_xref="EnsemblGenomes-Gn:Smlt0221"
                     /db_xref="EnsemblGenomes-Tr:CAQ43829"
                     /db_xref="GOA:B2FI41"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="UniProtKB/TrEMBL:B2FI41"
                     /protein_id="CAQ43829.1"
                     /translation="MGRPAYPQPRRRRRVRYLIGGIRRAMRTPTRGCRYNARMGSGPV
                     TINAQLEIPDGEIVERFVRASGAGGQNVNKVSTAVELRFDVANSPSLPEPLRTRLLAR
                     RDRRMTGEGVLVIDAQRFRTQDRNREDARERLAAFIQAGLSVPKPRKATKPTLGSKLR
                     RLDAKRGRAQIKRGRSSRDWE"
     misc_feature    233841..234239
                     /locus_tag="Smlt0221"
                     /note="HMMPfam hit to PF00472, Peptidyl-tRNA hydrolase
                     domain, score 3.2e-28"
                     /inference="protein motif:HMMPfam:PF00472"
     repeat_region   234215..234222
                     /rpt_unit_seq="(gc)4"
     CDS             234307..234867
                     /transl_table=11
                     /locus_tag="Smlt0222"
                     /product="putative acyltransferase"
                     /note="similarity:fasta; with=UniProt:Q3BZ29
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Putative acyltransferase.; length=209; id
                     65.591%; ungapped id 65.946%; E()=5.9e-49; 186 aa overlap;
                     query 1-186; subject 25-209"
                     /db_xref="EnsemblGenomes-Gn:Smlt0222"
                     /db_xref="EnsemblGenomes-Tr:CAQ43830"
                     /db_xref="GOA:B2FI42"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:B2FI42"
                     /protein_id="CAQ43830.1"
                     /translation="MPQVKPNAFLRWLARCTLRMGGWKVTGTLPDIPRLVFIIAPHSS
                     NWDGLWGMAAKIALGMKVKVLGKASLFWWPLGPLLHKLGVIPLDRSSPQGTVGQAVDL
                     LRNNEKMWFAITPEGTRKAVKEWKAGFLKIARMADVPILAAYFHYPEKTIGIGPLFQP
                     TGDDAADMAAIREFYRPWIGKTRGTV"
     misc_feature    234370..234744
                     /locus_tag="Smlt0222"
                     /note="HMMPfam hit to PF01553, Acyltransferase, score
                     3.7e-07"
                     /inference="protein motif:HMMPfam:PF01553"
     CDS             234979..237135
                     /transl_table=11
                     /gene="dcp"
                     /locus_tag="Smlt0223"
                     /product="putative peptidyl-dipeptidase Dcp (dipeptidyl
                     carboxypeptidase)"
                     /EC_number="3.4.15.5"
                     /note="From codon 40, similar to Escherichia coli. Dcp
                     UniProt:P24171 (EMBL:X57947 (680 aa) fasta scores:
                     E()=5.1e-144, 54.357% id in 677 aa, and entire protein is
                     similar to Xanthomonas oryzae pv. oryzae. Dcp
                     UniProt:Q5H622 (EMBL:AE013598 (722 aa) fasta scores:
                     E()=0, 82.361% id in 720 aa"
                     /note="similarity:fasta; with=UniProt:P24171
                     (EMBL:X57947;); Escherichia coli.; dcp;
                     Peptidyl-dipeptidase dcp (EC 3.4.15.5) (Dipeptidyl
                     carboxypeptidase).; length=680; id 54.357%; ungapped id
                     54.357%; E()=5.1e-144; 677 aa overlap; query 41-717;
                     subject 2-678"
                     /note="similarity:fasta; with=UniProt:Q5H622
                     (EMBL:AE013598;); Xanthomonas oryzae pv. oryzae.; dcp;
                     Peptidyl-dipeptidase.; length=722; id 82.361%; ungapped id
                     82.706%; E()=0; 720 aa overlap; query 1-717; subject
                     1-720"
                     /db_xref="EnsemblGenomes-Gn:Smlt0223"
                     /db_xref="EnsemblGenomes-Tr:CAQ43831"
                     /db_xref="GOA:B2FI43"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR024080"
                     /db_xref="UniProtKB/TrEMBL:B2FI43"
                     /protein_id="CAQ43831.1"
                     /translation="MSRTVVLAAAISLALAACSGKESTPVSDAQKAPAQQPAEASTNP
                     LLSASTLPFQAPQFDKIKDSDYLPAFEEGMRQHLADVRKIADSSEPATFDNTIVAMER
                     SGETLTRVSRIFFGLVQADTNDARQKIQEEVAPKLAAHQDEINLDPKLFARVKSIYDQ
                     RDTLELDPVQKRLVEHYYDGLVRAGAQLSDADKASLRKLNVEETTLSTQFHTRLVAAT
                     AAAAVVVDDKAKLAGLDEDAINNAANAAKERKLDGKFLLPLQNTTQQPVLGSLSDRDQ
                     RAAVLKASETRAERGDANDTRQTVQRLAQLRAQKAKLLGFDTFADYQLGDQMAKTPAA
                     ALKLLTDTVPAATAKARAEAGEIQKVIDAQKGGFQVAASDWDFYAEQVRKAKYDLDES
                     QIKPYFELDNVLQNGVFYAATQLYGITFKPRTDIPTYNPDMKVYEVFDKDGTSLALFY
                     TDYFKRDSKSGGAWMDVFVEQDGLTGAKPVVYNVCNFTKPAAGQPALISFDDVTTMFH
                     EFGHALHGMFSNVKYPSIAGTATSRDFVEFPSQFNEHWALDPKVFANYAKHYKTGEAM
                     PQELVDKILKARSFNQGYATTEYLSAALLDLAWHTQKADAPLQDVGAFEASALKKFKV
                     DLPQVPPRYRTTYFDHIWGGGYSAGYYAYFWAEVLDHDAYQWFTEHGGLTAANGQEFR
                     DKILSRGNSVELSTLYRDFRGKDPSVEPLLKFRGLK"
     sig_peptide     234979..235038
                     /gene="dcp"
                     /locus_tag="Smlt0223"
                     /note="Signal peptide predicted for Smlt0223 by SignalP
                     2.0 HMM (Signal peptide probability 0.999) with cleavage
                     site probability 0.372 between residues 20 and 21"
                     /inference="protein motif:SignalP:2.0"
     repeat_region   235431..235438
                     /rpt_unit_seq="(cg)4"
     misc_feature    235777..237129
                     /gene="dcp"
                     /locus_tag="Smlt0223"
                     /note="HMMPfam hit to PF01432, Peptidase family M3, score
                     1.3e-163"
                     /inference="protein motif:HMMPfam:PF01432"
     repeat_region   236026..236033
                     /rpt_unit_seq="(gc)4"
     repeat_region   237251..237463
                     /rpt_family="R=8"
                     /inference="nucleotide motif:RepeatScout"
     repeat_region   complement(237297..237463)
                     /rpt_family="R=8"
                     /inference="nucleotide motif:RepeatScout"
     repeat_region   237445..237462
                     /rpt_unit_seq="(gctgtt)3"
     repeat_region   237451..237502
                     /rpt_family="R=14"
                     /inference="nucleotide motif:RepeatScout"
     CDS             complement(237515..237961)
                     /transl_table=11
                     /locus_tag="Smlt0224"
                     /product="putative 3-dehydroquinate dehydratase"
                     /note="similarity:fasta; with=UniProt:P96750
                     (EMBL:U88628;); Corynebacterium pseudotuberculosis.; aroQ;
                     3-dehydroquinate dehydratase (EC 4.2.1.10)
                     (3-dehydroquinase) (Type II DHQase).; length=146; id
                     31.298%; ungapped id 35.965%; E()=0.67; 131 aa overlap;
                     query 7-129; subject 17-138"
                     /note="similarity:fasta; with=UniProt:Q4UP12
                     (EMBL:CP000050;); Xanthomonas campestris pv. campestris
                     (strain 8004).; 3-dehydroquinate dehydratase.; length=146;
                     id 59.310%; ungapped id 59.722%; E()=2e-27; 145 aa
                     overlap; query 5-148; subject 2-146"
                     /db_xref="EnsemblGenomes-Gn:Smlt0224"
                     /db_xref="EnsemblGenomes-Tr:CAQ43832"
                     /db_xref="GOA:B2FI44"
                     /db_xref="InterPro:IPR001874"
                     /db_xref="UniProtKB/TrEMBL:B2FI44"
                     /protein_id="CAQ43832.1"
                     /translation="MSIFIIRGPEAAGALIRTAMPLPAPVLKSLVHRAIDAGTSVAIR
                     ACGSEQELLDALRVADHSRGEVTLLDPGACANSLRLQRLLPYLHNAYVEVHDDGAVAE
                     SCLPAGVGQRLGIAAGYGAQSYVLALDIALDHLGLAEQANRVHVGT"
     CDS             complement(237965..238366)
                     /transl_table=11
                     /locus_tag="Smlt0225"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q2P8S4
                     (EMBL:AP008229;); Xanthomonas oryzae pv. oryzae (strain
                     MAFF 311018).; Hypothetical protein XOO0298.; length=142;
                     id 34.815%; ungapped id 37.600%; E()=0.00011; 135 aa
                     overlap; query 1-129; subject 1-131"
                     /db_xref="EnsemblGenomes-Gn:Smlt0225"
                     /db_xref="EnsemblGenomes-Tr:CAQ43833"
                     /db_xref="UniProtKB/TrEMBL:B2FI45"
                     /protein_id="CAQ43833.1"
                     /translation="MTLLVIRHASSSVPRPQLPAQLNGHRVLCSDCASLSEVRQCLCQ
                     SQARSADWVLLDVGVADEAQWQAEGGALQAALERLPAQYIELQAPSEPGLESRLQLQH
                     GPAAVVIDQRSQQAGYPLSLAIVGRRLAQEG"
     repeat_region   238412..238419
                     /rpt_unit_seq="(gc)4"
     CDS             238543..239169
                     /transl_table=11
                     /locus_tag="Smlt0226"
                     /product="putative peptidase"
                     /note="similarity:fasta; with=UniProt:Q6AS39
                     (EMBL:CR522870;); Desulfotalea psychrophila.; Related to
                     signal peptidase I.; length=214; id 33.520%; ungapped id
                     35.088%; E()=3.3e-15; 179 aa overlap; query 20-197;
                     subject 16-187"
                     /db_xref="EnsemblGenomes-Gn:Smlt0226"
                     /db_xref="EnsemblGenomes-Tr:CAQ43834"
                     /db_xref="GOA:B2FI46"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019756"
                     /db_xref="InterPro:IPR019758"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:B2FI46"
                     /protein_id="CAQ43834.1"
                     /translation="MDAVARPPFSDRALAWLKKEALPLLVMLGLLAAARDTLANHYVV
                     PSGSMQPTLQPGDRVVVDMRAYGLRLPFTSRELMSTGTPQRGEVAVFDSPADGTRLIK
                     RVAAVAGDHVQLYEGHLTINGQPLQTADLQDVEAFGERRASLDLDMGGGPDIADLVVP
                     DGKVLVLGDHRGNSFDGRFFGFVDADKVYGRAVAVYYRRGDGFEWQRL"
     misc_feature    238669..238914
                     /locus_tag="Smlt0226"
                     /note="HMMPfam hit to PF00717, Peptidase S24-like, score
                     2e-19"
                     /inference="protein motif:HMMPfam:PF00717"
     CDS             239294..240550
                     /transl_table=11
                     /locus_tag="Smlt0227"
                     /product="putative MFS family transporter"
                     /note="similarity:fasta; with=UniProt:Q146V4
                     (EMBL:CP000270;); Burkholderia xenovorans (strain LB400).;
                     Major facilitator superfamily (MFS) transporter.;
                     length=406; id 50.254%; ungapped id 50.510%; E()=4.9e-59;
                     394 aa overlap; query 24-416; subject 13-405"
                     /db_xref="EnsemblGenomes-Gn:Smlt0227"
                     /db_xref="EnsemblGenomes-Tr:CAQ43835"
                     /db_xref="GOA:B2FI47"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B2FI47"
                     /protein_id="CAQ43835.1"
                     /translation="MTGETAAAVEGRPSTLDTGTDTRIQQGTPAFRRTALALFLAGFS
                     TFGLLYTVQPLLPEFSRHFGVSAAGSAMSLSLTTGTLAVAMLLAGLLSDAVGRRPLMI
                     VALLASAMLSLCTALVDDWTTLLVLRTLLGLALSGVPAVAMTYLVEEMDSRALGLAMG
                     LYIGGNAIGGMSGRLLAGIIADHWGWRWGIGVVSIIAVASTVLLWLQLPPSRHFHARR
                     GGLRQLPSRWRTLFADPGLPWLFATSFVLMGVFVTLYNYLGYHLLAPPYHLSQTVVGL
                     IFSVYLVGTFSSAWMGQQATRYGRGRILSISFALIGAGIALLAMPWLSTMALGIALVT
                     FGFFGGHSVASSWVGSRAGAMRAEASALYLFAYYLGSSVLGGVGGLAYAAWDWLGVCA
                     FAAVLTLIGGGIVWALQQRAPQPVTA"
     misc_feature    order(239396..239464,239501..239569,239588..239656,
                     239666..239734,239753..239821,239849..239917,
                     239999..240067,240095..240163,240200..240259,
                     240269..240337,240374..240442,240452..240520)
                     /locus_tag="Smlt0227"
                     /note="12 probable transmembrane helices predicted for
                     Smlt0227 by TMHMM2.0 at aa 35-57, 70-92, 99-121, 125-147,
                     154-176, 186-208, 236-258, 268-290, 303-322, 326-348,
                     361-383 and 387-409"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    239405..240442
                     /locus_tag="Smlt0227"
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 1.2e-44"
                     /inference="protein motif:HMMPfam:PF07690"
     repeat_region   240523..240530
                     /rpt_unit_seq="(gc)4"
     repeat_region   complement(240609..240697)
                     /rpt_family="R=0"
                     /inference="nucleotide motif:RepeatScout"
     CDS             complement(240680..241513)
                     /transl_table=11
                     /locus_tag="Smlt0228"
                     /product="putative LysR family transcriptional regulator"
                     /note="similarity:fasta; with=UniProt:Q4IUJ4
                     (EMBL:AAAU03000012;); Azotobacter vinelandii AvOP.;
                     Regulatory protein, LysR:LysR substrate binding domain.;
                     length=308; id 46.642%; ungapped id 47.170%; E()=2.8e-39;
                     268 aa overlap; query 1-267; subject 27-292"
                     /db_xref="EnsemblGenomes-Gn:Smlt0228"
                     /db_xref="EnsemblGenomes-Tr:CAQ43836"
                     /db_xref="GOA:B2FI48"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:B2FI48"
                     /protein_id="CAQ43836.1"
                     /translation="MSQPPLSQQIRQLEDLIGARLFVRSHRRVQLTPAGELLQERARA
                     IVQQVEAAVDEVQRAQRGEQGELHIGLTRATPLSPQIPRSILHYRQQYPQVRLQLSEM
                     NTLQQIDALLDGSLDVGIIRKRALPPELVAHSLFVDPLALIVHAGHPALHRLSKQGTL
                     SLRDFAQEPFVAFRRSAGAGIHDHMIALCAAAGFTPRIVQEAGEASTLISLAAAGLGA
                     AILPSSCDHIRVEGSRFVALADAGAHSEVQLAWHRERVTPLIRNFATLLRGAFADRVD
                     C"
     misc_feature    complement(240698..241336)
                     /locus_tag="Smlt0228"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 1.1e-47"
                     /inference="protein motif:HMMPfam:PF03466"
     repeat_region   241336..241343
                     /rpt_unit_seq="(gc)4"
     misc_feature    complement(241406..241513)
                     /locus_tag="Smlt0228"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 2.3e-09"
                     /inference="protein motif:HMMPfam:PF00126"
     repeat_region   complement(241707..241868)
                     /rpt_family="R=8"
                     /inference="nucleotide motif:RepeatScout"
     repeat_region   241847..241901
                     /rpt_family="R=14"
                     /inference="nucleotide motif:RepeatScout"
     CDS             complement(241927..242895)
                     /transl_table=11
                     /locus_tag="Smlt0230"
                     /product="putative LysR family transcriptional regulator"
                     /note="similarity:fasta; with=UniProt:Q8PQR7
                     (EMBL:AE011650;); Xanthomonas axonopodis pv. citri.; rbcR;
                     Transcriptional regulator.; length=318; id 80.126%;
                     ungapped id 80.126%; E()=4e-96; 317 aa overlap; query
                     6-322; subject 2-318"
                     /db_xref="EnsemblGenomes-Gn:Smlt0230"
                     /db_xref="EnsemblGenomes-Tr:CAQ43837"
                     /db_xref="GOA:B2FI49"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:B2FI49"
                     /protein_id="CAQ43837.1"
                     /translation="MTTRPSPSPRFSYKSDRLKPLRAFCQTVRLGSVSRAAEALFVSQ
                     PAISLQLQALERELGVPLFERSGRRLVPSREGQLLYEMAQPLVENLDGLEARFRDKVR
                     GLDAGELNIAANSSTILYLLPKIVERFRLHHPDVRLTLHNAISADGTDLLREDAADLA
                     IGSMTDVPADLSYAPAYRFEQVLIAPHDHPLASGGELELADIARYPLVLPPKRQITYR
                     LVDQVFQRHRIAYTVALEVGGWEVIKQYVAMGMGISIVPALCLNEADHERLAARSMKR
                     WFPERSYGVIVRRGKALSAQARAFIELIQPELFSPRDYDQSGHSER"
     misc_feature    complement(241969..242592)
                     /locus_tag="Smlt0230"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 9.7e-55"
                     /inference="protein motif:HMMPfam:PF03466"
     misc_feature    complement(242665..242844)
                     /locus_tag="Smlt0230"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 5.3e-22"
                     /inference="protein motif:HMMPfam:PF00126"
     CDS             243005..244627
                     /transl_table=11
                     /gene="mls"
                     /locus_tag="Smlt0231"
                     /product="putative malate synthase"
                     /EC_number="2.3.3.9"
                     /note="similarity:fasta; with=UniProt:P95329
                     (EMBL:AF013216;); Myxococcus xanthus.; mls; Malate
                     synthase (EC 2.3.3.9).; length=541; id 55.288%; ungapped
                     id 56.121%; E()=1.1e-112; 539 aa overlap; query 1-536;
                     subject 1-534"
                     /note="similarity:fasta; with=UniProt:Q8PDU8
                     (EMBL:AE012119;); Xanthomonas campestris pv. campestris.;
                     mls; Malate synthase.; length=540; id 82.810%; ungapped id
                     83.117%; E()=1.2e-181; 541 aa overlap; query 1-540;
                     subject 1-540"
                     /db_xref="EnsemblGenomes-Gn:Smlt0231"
                     /db_xref="EnsemblGenomes-Tr:CAQ43838"
                     /db_xref="GOA:B2FI50"
                     /db_xref="InterPro:IPR001465"
                     /db_xref="InterPro:IPR006252"
                     /db_xref="InterPro:IPR011076"
                     /db_xref="UniProtKB/TrEMBL:B2FI50"
                     /protein_id="CAQ43838.1"
                     /translation="MSAVASAVPTPASKATPGIALATRVAGQDTVLPAPLLALLVSLH
                     RAVEPGRQARLQARRERQAFFDQGGLPDFREDTTAIRSGDWRVAPLPAALQDRRVEIT
                     GPTDPKMVINALNSGAKVFMADFEDSTSPTWRNLLAGQQSLAAAVRGDLEFTAANGKH
                     YTLRPYDEQAVLIVRPRGWHLDEKHVRIDGQFIAGGLFDAAVFAFHNARTLQAKDRGP
                     YFYLPKLQSMEEAALWETALSHIEGMLGLPHGQIKVTVLIETLPAVFEMDEILHALRD
                     RIVGLNCGRWDYIFSYLKTFRRHADRVLPERGQVTMTQPFLKAYSELLIQTCHRRGAH
                     AMGGMAAQIPINNDAAANEQAMARVRADKLREVTAGHDGTWVAHPALIPVAMAIFDEH
                     MPGANQHSVLRQDVRVGRDELIARPPGTITRAGFEGNVEVCVRYLAAWLDGNGCVPIH
                     HLMEDAATAEISRSQLWQWLHTPGQQLDDGTAIDLALLDSTLSQLPARLGDTAALPGG
                     TRIGEAITLLGELSRSDELTDFLTLPAYARID"
     misc_feature    243056..244624
                     /gene="mls"
                     /locus_tag="Smlt0231"
                     /note="HMMPfam hit to PF01274, Malate synthase, score
                     8.3e-262"
                     /inference="protein motif:HMMPfam:PF01274"
     CDS             244693..245994
                     /transl_table=11
                     /gene="aceA"
                     /locus_tag="Smlt0232"
                     /product="putative isocitrate lyase"
                     /EC_number="4.1.3.1"
                     /note="similarity:fasta; with=UniProt:P51066
                     (EMBL:AE008895;); Salmonella typhimurium.; aceA;
                     Isocitrate lyase (EC 4.1.3.1) (Isocitrase) (Isocitratase)
                     (ICL).; length=434; id 69.746%; ungapped id 71.564%;
                     E()=2.4e-112; 433 aa overlap; query 2-424; subject 3-434"
                     /note="similarity:fasta; with=UniProt:Q3BZ17
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; aceA; Isocitrate lyase (EC 4.1.3.1).;
                     length=431; id 90.741%; ungapped id 91.375%; E()=3.3e-151;
                     432 aa overlap; query 2-433; subject 3-431"
                     /db_xref="EnsemblGenomes-Gn:Smlt0232"
                     /db_xref="EnsemblGenomes-Tr:CAQ43839"
                     /db_xref="GOA:B2FI51"
                     /db_xref="InterPro:IPR006254"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018523"
                     /db_xref="UniProtKB/TrEMBL:B2FI51"
                     /protein_id="CAQ43839.1"
                     /translation="MSKLPTAEQIQHDWDTNPRWEGIQRNYSAADVVRLRGTVHIEHS
                     LARLGAEKLWASLHEREFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQM
                     YPDQSLYPADSVPAVVKRINNTLLRADQLHHAEGKDDIDFLQPIVADAEAGFGGVLNA
                     FELMKAMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVP
                     TLLVARTDAEAADLLTSDIDGNDRPFTTGERTVEGFYKTRNGLDQAISRGLAYAPYAD
                     LVWCETGKPDLEFARRFAEAIHAKFPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGS
                     YGYKFQFITLAGFHALNYGMFNLAHGYARRQMSAFVELQEAEFEAAERGFTAVKHQRE
                     VGTGYFDAVTQAIQQGQSSTTALTGSTEEEQFHGGRSERAA"
     misc_feature    244711..245964
                     /gene="aceA"
                     /locus_tag="Smlt0232"
                     /note="HMMPfam hit to PF00463, Isocitrate lyase family,
                     score 4.1e-237"
                     /inference="protein motif:HMMPfam:PF00463"
     CDS             246412..247452
                     /transl_table=11
                     /locus_tag="Smlt0233"
                     /product="putative cyclic nucleotide-binding and GGDEF
                     domain regulator"
                     /note="similarity:fasta; with=UniProt:Q3BZ16
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Putative cyclic nucleotide-binding
                     protein.; length=352; id 56.897%; ungapped id 57.558%;
                     E()=1.2e-75; 348 aa overlap; query 1-346; subject 1-346"
                     /db_xref="EnsemblGenomes-Gn:Smlt0233"
                     /db_xref="EnsemblGenomes-Tr:CAQ43840"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018488"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:B2FI52"
                     /protein_id="CAQ43840.1"
                     /translation="MTGRGAAENSDVTSGIARVAMAEIVHALLSDAEVALFARFARPR
                     KLHAGQWLFQRGHRGERMYVILEGQIELDFGEDLVIKTLGQQEFFGELGLLVGDHPRS
                     ASARALVDCEVLELGPADFHRLVESDPGLVAYFLRRTIMRVLTNEQALISQLRRRNHD
                     LETALDNLYITTHQLTHTRELVRTDELTGLHNRRGLTLYLQECRADGSGLPQALLLID
                     CDRFKQINDRHGHQAGDRVLQSMGNILRSMAGEQDLACRLGGDEFCLILRRGNYEIVQ
                     HAAEFILSAVHGLLERSHGTPHVSLVSIGASLLDPDAGWSEWYASADRALYQAKRDGG
                     NCLRWADAVDSP"
     misc_feature    246538..246801
                     /locus_tag="Smlt0233"
                     /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding
                     domain, score 5.1e-22"
                     /inference="protein motif:HMMPfam:PF00027"
     repeat_region   246724..246731
                     /rpt_unit_seq="(gc)4"
     misc_feature    246943..247419
                     /locus_tag="Smlt0233"
                     /note="HMMPfam hit to PF00990, GGDEF domain, score
                     1.1e-45"
                     /inference="protein motif:HMMPfam:PF00990"
     CDS             247470..250007
                     /transl_table=11
                     /locus_tag="Smlt0234"
                     /product="conserved hypothetical protein"
                     /note="similarity:fasta; with=UniProt:Q3BZ15
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Putative membrane protein.; length=837;
                     id 50.613%; ungapped id 50.988%; E()=4e-144; 816 aa
                     overlap; query 7-819; subject 13-825"
                     /db_xref="EnsemblGenomes-Gn:Smlt0234"
                     /db_xref="EnsemblGenomes-Tr:CAQ43841"
                     /db_xref="GOA:B2FI53"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="InterPro:IPR030966"
                     /db_xref="UniProtKB/TrEMBL:B2FI53"
                     /protein_id="CAQ43841.1"
                     /translation="MNGDNGTSAPHNQQLRALLFTDLCDSLLLVERIGDVAAAELFQE
                     HDRLVLALQQRWNGQLIDRSDGLFMLFERPIDALGFALDYQRGLQPLGQRHEIHLQAR
                     AGLHVGDVLTWENSAEAVRAGAKAIEVEGLAKPTAARLMQLARPGQILLSAVAESIVR
                     RSSGSLGAMAEGLQWRSFGRWRFKGVSQPAEVYGVQAAGMPAPGRLRHTAKARRDLPL
                     WRRPLAMAAQAAVLLAAVLGVWLLTRPQPAIAFAERDWVVLGGLHNLTGNRLLDDALD
                     QAFRISLEQSRYVNVVSDDRVSRTLEMMRKPPDRGVRERGDAAAVAVRTGARLVFVPS
                     ATDVGGRTRFSVEVLEPSTLRTLAVVSADAKAGAVLAAVDDVSRQLRDRLGEEPALIQ
                     RDSQSLPEVTTGSMDALRAFALGQKRYSRGDFNGAMAFFGQAIEVDPEFALAWLGQAR
                     CRFAMMNYRDARRLLAEADRRSGHLTPRERLYVQNWALQISDPDRATDGWARMAELYP
                     DYMPASYNAGLNLFHENRLAEALALSRRVAQSRVELPEIAQDQYGRALLASERYAEAD
                     IAFSRAAGNGWEGALMRQATVAAARSEFEKANALLARIDPGNFHAGNFATTIALDQGD
                     VEGAIKLAEQGRMLAGQRQGMDRYNFDMPLAVAYMMAGRRSKALMVARVAATAPFAEL
                     SGEPAVEVVDRLVAAHAAALLALRLGDAAPAKAVQARMNALQDLPDSSVLRQYVTLLA
                     GRMMQHEGRPQAGLDLLVPLLKKQPRLQVRLAVRDLALEAGLKDVAQEQTRWLRDRPG
                     FAYAEAQCSFCLQALNVVDVRRLMAAPAIEAADTMASMPQRSVRGEP"
     repeat_region   248028..248039
                     /rpt_unit_seq="(agcc)3"
     misc_feature    248691..248792
                     /locus_tag="Smlt0234"
                     /note="HMMPfam hit to PF07719, Tetratricopeptide repeat,
                     score 0.0027"
                     /inference="protein motif:HMMPfam:PF07719"
     CDS             250456..251598
                     /transl_table=11
                     /locus_tag="Smlt0236"
                     /product="putative processing protein"
                     /note="Codons 70 to 355 are similar to codons 75 to 365 of
                     Rhizobium leguminosarum bv. trifolii. tfxb UniProt:P42724
                     (EMBL:L06719 (373 aa) fasta scores: E()=5e-06, 24.579% id
                     in 297 aa, and similar to entire protein of Xanthomonas
                     campestris pv. vesicatoria (strain 85-10). hypothetical
                     protein. UniProt:Q3BZ13 (EMBL:AM039952 (386 aa) fasta
                     scores: E()=1.6e-90, 61.538% id in 377 aa"
                     /note="similarity:fasta; with=UniProt:P42724
                     (EMBL:L06719;); Rhizobium leguminosarum bv. trifolii.;
                     tfxB; Trifolitoxin-processing protein tfxB.; length=373;
                     id 24.579%; ungapped id 26.740%; E()=5e-06; 297 aa
                     overlap; query 69-350; subject 74-361"
                     /note="similarity:fasta; with=UniProt:Q3BZ13
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Hypothetical protein.; length=386; id
                     61.538%; ungapped id 62.534%; E()=1.6e-90; 377 aa overlap;
                     query 1-374; subject 10-383"
                     /db_xref="EnsemblGenomes-Gn:Smlt0236"
                     /db_xref="EnsemblGenomes-Tr:CAQ43842"
                     /db_xref="GOA:B2FI54"
                     /db_xref="InterPro:IPR000415"
                     /db_xref="InterPro:IPR020051"
                     /db_xref="InterPro:IPR029479"
                     /db_xref="InterPro:IPR030965"
                     /db_xref="UniProtKB/TrEMBL:B2FI54"
                     /protein_id="CAQ43842.1"
                     /translation="MVQPTEQIRFEFEGLLRGGDGLVRTLAWEALAPHLDGPVVLDAA
                     AQALLGSLSPSAWTTLEAGEACSPAMDLLIASGLVLTRGQDDDVAARDERLRATHWHP
                     LAAVMHAFSRWEDVDAVRNMRESQIETASQMRRTLGPPPPHAAAADAGLVPLPPQQSN
                     DFDALLARRVTCRNFDVTRSLPLSLLSQMLQRAFGSSSCQREGDDLVFLKKNVPSGGG
                     LHPVEAYVLVRNVDGLAAGMYLYRAQGHGLMPVDCPVAIDRDFVMSMVGQQHWFADAH
                     VLVVLAPRFNRTYWKYRQHGKSYRVVAMEAGHLSQTLYLAATDAGLGAFITAAINEKP
                     IERALGLDTINEGVLAVCGFGWRASRMTTSELDPAGTIWNLEDRAG"
     CDS             complement(251620..253635)
                     /transl_table=11
                     /locus_tag="Smlt0237"
                     /product="putative biotin carboxylase"
                     /note="similarity:fasta; with=UniProt:Q3BZ11
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; accC; Biotin carboxylase (EC 6.3.4.14).;
                     length=675; id 70.118%; ungapped id 70.958%; E()=8.5e-169;
                     676 aa overlap; query 1-671; subject 1-673"
                     /db_xref="EnsemblGenomes-Gn:Smlt0237"
                     /db_xref="EnsemblGenomes-Tr:CAQ43843"
                     /db_xref="GOA:B2FI55"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:B2FI55"
                     /protein_id="CAQ43843.1"
                     /translation="MTEHAPMKPVAMFTKVLIANRGEIACRVIATCRRLGIATVAVYS
                     DADRNARHVRLADEAIHIGPAAARESYLRGDALLDAARTTGAQAIHPGYGFLSENADF
                     ADACAAAGITFIGPPASAIRAMGDKSAAKALMAKAGVPLPPGYHGDQQAPDFLRTQAD
                     AIGYPVLIKASAGGGGKGMRKVERSEDFVDALASCQREAASAFGNDHVLVEKYVERPR
                     HIEIQVFGDSHGDAVYLFERDCSVQRRHQKVLEEAPAPGMSAERRAAMGKAAVDAARA
                     VGYEGAGTVEFIAGPDGDFYFMEMNTRLQVEHPVTEYITGTDLVEWQLRVASGQPLPL
                     RQEQLAIHGHAIEARLYAEDADRGFLPSTGTLRRLRLPIPSAHVRVDTGVEEGDSITP
                     YYDPMIAKLIVWDVDRDAALRRMSQALADCQVVGVTTNAGFLRRLVNTDSFAHARLDT
                     ALIEREQAALSAVGDTDDALWQLAAVAAVAGTAGASTDARDPHSPWQAQDGWRLGASA
                     PRVLPLQQGERKHTLKVWAQADGWRVQRDDAAPVQVIGTADAQHLTVQLGERRWSLQL
                     LRDGDQLYLFGADGQHRFTLHDPVGESDHAVADAGSLLAPMPGKIVATLVAAGTEVKR
                     GTPLVVLEAMKMEHTLQAPADGTVKGYRAKAGDQVGDGAVLVDFEAA"
     misc_feature    complement(251632..251835)
                     /locus_tag="Smlt0237"
                     /note="HMMPfam hit to PF00364, Biotin-requiring enzyme,
                     score 1.7e-18"
                     /inference="protein motif:HMMPfam:PF00364"
     repeat_region   252165..252172
                     /rpt_unit_seq="(cg)4"
     misc_feature    complement(252274..252597)
                     /locus_tag="Smlt0237"
                     /note="HMMPfam hit to PF02785, Biotin carboxylase
                     C-terminal domain, score 5.6e-47"
                     /inference="protein motif:HMMPfam:PF02785"
     misc_feature    complement(252616..253260)
                     /locus_tag="Smlt0237"
                     /note="HMMPfam hit to PF02786, Carbamoyl-phosphate
                     synthase L chain,, score 1.8e-101"
                     /inference="protein motif:HMMPfam:PF02786"
     misc_feature    complement(252727..253263)
                     /locus_tag="Smlt0237"
                     /note="HMMPfam hit to PF01071, Phosphoribosylglycinamide
                     synthetase,, score 0.0012"
                     /inference="protein motif:HMMPfam:PF01071"
     misc_feature    complement(252727..253260)
                     /locus_tag="Smlt0237"
                     /note="HMMPfam hit to PF02222, ATP-grasp domain, score
                     0.0025"
                     /inference="protein motif:HMMPfam:PF02222"
     repeat_region   252808..252817
                     /rpt_unit_seq="(cg)5"
     misc_feature    complement(253264..253602)
                     /locus_tag="Smlt0237"
                     /note="HMMPfam hit to PF00289, Carbamoyl-phosphate
                     synthase L chain,, score 2.8e-48"
                     /inference="protein motif:HMMPfam:PF00289"
     CDS             complement(253644..255254)
                     /transl_table=11
                     /locus_tag="Smlt0238"
                     /product="putative acyl CoA carboxyltransferase"
                     /note="similarity:fasta; with=UniProt:Q8PDU0
                     (EMBL:AE012121;); Xanthomonas campestris pv. campestris.;
                     accD; Acyl-CoA carboxyltransferase beta chain.;
                     length=536; id 88.806%; ungapped id 88.806%; E()=3.7e-186;
                     536 aa overlap; query 1-536; subject 1-536"
                     /db_xref="EnsemblGenomes-Gn:Smlt0238"
                     /db_xref="EnsemblGenomes-Tr:CAQ43844"
                     /db_xref="GOA:B2FI56"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:B2FI56"
                     /protein_id="CAQ43844.1"
                     /translation="MTVLNSQLQPGSDTFEANRAAMQAVVDDLHATLARTALGGSEAA
                     RAKHTARGKLLVRDRIDALLDPGSAFLEIAPLAAHGMYEDAVPAAGVVAGIGRVSGVE
                     CVIVANDATVKGGTYYPMTVKKHLRAQEIAEQNHLPCIYLVDSGGAFLPLQDEVFPDR
                     DHFGRIFYNQANLSAQGIPQIACVMGSCTAGGAYVPAMSDETVIVREQGTIFLGGPPL
                     VKAATGEVVTAEELGGADVHTRISGVADHMADNDLQALARVRAIIAQLNWRKPEPAMA
                     VQASEEPLLPAHELYGVIPADTRKPYDVREVIARLVDGSRFDEFKPRYGATLVTGFAH
                     LNGYPIGIIANNGILFSESALKGAHFIELCTQRNIPLVFLQNITGFMVGRKYEQGGIA
                     KDGAKLVMAVACARVPKFTVVIGGSFGAGNYGMCGRAYSPNFLWMWPNARIGVMGGEQ
                     AASVLATVKRDGIEAKGGQWPAAEEDAFKAPIRDQFEQQGHPYYASARLWDDGVIDPA
                     DTRRVLALALSASLNAAPQQTRFGVFRM"
     misc_feature    complement(253653..255131)
                     /locus_tag="Smlt0238"
                     /note="HMMPfam hit to PF01039, Carboxyl transferase
                     domain, score 1.5e-221"
                     /inference="protein motif:HMMPfam:PF01039"
     repeat_region   253761..253768
                     /rpt_unit_seq="(gc)4"
     repeat_region   254870..254877
                     /rpt_unit_seq="(gc)4"
     repeat_region   255118..255125
                     /rpt_unit_seq="(gc)4"
     CDS             complement(255265..256428)
                     /transl_table=11
                     /locus_tag="Smlt0239"
                     /product="putative acyl CoA dehydrogenase"
                     /note="similarity:fasta; with=UniProt:Q3BZ09
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; acdA; Acyl-CoA dehydrogenase.;
                     length=387; id 84.974%; ungapped id 84.974%; E()=1e-127;
                     386 aa overlap; query 1-386; subject 1-386"
                     /db_xref="EnsemblGenomes-Gn:Smlt0239"
                     /db_xref="EnsemblGenomes-Tr:CAQ43845"
                     /db_xref="GOA:B2FI57"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="UniProtKB/TrEMBL:B2FI57"
                     /protein_id="CAQ43845.1"
                     /translation="MHVPSLNFDLGEDIDLLRQSVAHFAAAEVAPLAAEADASNQFPL
                     ALWPKLGEQGLLGLTVEEAYGGTGMGYLAHVVAMEEISRASGGIGLSYGAHSNLCVNQ
                     LRKNGNEEQKQRFLPGLCDGSLVGALAMSEPGAGSDVVSMKLRADKRGDRYVLNGNKM
                     WITNGPDADVLVVYAKTDMDAGAKGITAFLVEKGMKGFSTSQKLDKLGMRSSPTCELV
                     FQDCEVPEENVLGQVGGGVRVLMSGLDYERVVLSGGPLGLMAAAMDVVMPYVHERHQF
                     GEAIGSFQLIQAKIADMYVGLGACRAYVYAVARACDQGRTTRQDAAGAILYAAEKATW
                     LTGQAIQILGGNGYINEYPTGRLWRDAKLYEIGAGTSEIRRMLIGRELFQRTL"
     misc_feature    complement(255280..255729)
                     /locus_tag="Smlt0239"
                     /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
                     C-terminal doma, score 1.8e-53"
                     /inference="protein motif:HMMPfam:PF00441"
     misc_feature    complement(255313..255684)
                     /locus_tag="Smlt0239"
                     /note="HMMPfam hit to PF08028, Acyl-CoA dehydrogenase,
                     C-terminal doma, score 1.6e-06"
                     /inference="protein motif:HMMPfam:PF08028"
     repeat_region   255500..255507
                     /rpt_unit_seq="(gc)4"
     misc_feature    complement(255895..256050)
                     /locus_tag="Smlt0239"
                     /note="HMMPfam hit to PF02770, Acyl-CoA dehydrogenase,
                     middle domain, score 2.4e-28"
                     /inference="protein motif:HMMPfam:PF02770"
     misc_feature    complement(256060..256398)
                     /locus_tag="Smlt0239"
                     /note="HMMPfam hit to PF02771, Acyl-CoA dehydrogenase,
                     N-terminal doma, score 1e-41"
                     /inference="protein motif:HMMPfam:PF02771"
     CDS             256589..257197
                     /transl_table=11
                     /locus_tag="Smlt0240"
                     /product="putative TetR family transcriptional regulator"
                     /note="similarity:fasta; with=UniProt:Q4V029
                     (EMBL:CP000050;); Xanthomonas campestris pv. campestris
                     (strain 8004).; Transcriptional regulator acrR family.;
                     length=205; id 70.297%; ungapped id 70.297%; E()=7.8e-48;
                     202 aa overlap; query 1-202; subject 1-202"
                     /db_xref="EnsemblGenomes-Gn:Smlt0240"
                     /db_xref="EnsemblGenomes-Tr:CAQ43846"
                     /db_xref="GOA:B2FI58"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011075"
                     /db_xref="InterPro:IPR015893"
                     /db_xref="UniProtKB/TrEMBL:B2FI58"
                     /protein_id="CAQ43846.1"
                     /translation="MAYKRSALMEERLAGARERILLATRELVATGGWRNAPVTAVATQ
                     AGVSTGLIYRHFPSKAELFVEVLNAAVAHEVAIMERIASGPEVASERLRLAITAFVRR
                     ALAGPGLAHAFIVEPVDPDVEAERMRGRRAFGDVFLRLVEEGVAAGELPAQDAHVAAA
                     CLVGAFTEAMVGPTAPSREAHRDEDALVDAICSFCLRAIGAR"
     misc_feature    256646..256786
                     /locus_tag="Smlt0240"
                     /note="HMMPfam hit to PF00440, Bacterial regulatory
                     proteins, tetR family, score 3.5e-14"
                     /inference="protein motif:HMMPfam:PF00440"
     repeat_region   complement(257233..257275)
                     /rpt_family="R=8"
                     /inference="nucleotide motif:RepeatScout"
     CDS             257402..257920
                     /transl_table=11
                     /locus_tag="Smlt0241"
                     /product="putative transmembrane-anchored cytochrome c"
                     /note="similarity:fasta; with=UniProt:P00123; Chlorobium
                     limicola f.sp. thiosulfatophilum.; Cytochrome c-555
                     (Cytochrome c555).; length=86; id 41.463%; ungapped id
                     42.500%; E()=2.9e-07; 82 aa overlap; query 92-172; subject
                     6-86"
                     /note="similarity:fasta; with=UniProt:Q3BZ01
                     (EMBL:AM039952;); Xanthomonas campestris pv. vesicatoria
                     (strain 85-10).; Putative cytochrome c precursor.;
                     length=172; id 84.884%; ungapped id 84.884%; E()=4.4e-54;
                     172 aa overlap; query 1-172; subject 1-172"
                     /db_xref="EnsemblGenomes-Gn:Smlt0241"
                     /db_xref="EnsemblGenomes-Tr:CAQ43847"
                     /db_xref="GOA:B2FI59"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="UniProtKB/TrEMBL:B2FI59"
                     /protein_id="CAQ43847.1"
                     /translation="MRNYDLEFLKRFSMVIALLATITLGLILLAAYIHTRIPPEVSPT
                     AAKRTEQRISPTGAVYAGSTGAAAQAAAKAAALAKAASQVAYGGTKDGKVIFDNLCTA
                     CHTTGVGMAPTLDHSHWDKRIAQGKDTLYKHAIEGYTGPDGGIMPPKGGNPALTEEQI
                     HATVDWMLGNLK"
     sig_peptide     257402..257491
                     /locus_tag="Smlt0241"
                     /note="Signal peptide predicted for Smlt0241 by SignalP
                     2.0 HMM (Signal peptide probability 0.912) with cleavage
                     site probability 0.509 between residues 30 and 31"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    257435..257503
                     /locus_tag="Smlt0241"
                     /note="1 probable transmembrane helix predicted for
                     Smlt0241 by TMHMM2.0 at aa 12-34"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    257666..257914
                     /locus_tag="Smlt0241"
                     /note="HMMPfam hit to PF00034, Cytochrome c, score
                     2.9e-06"
                     /inference="protein motif:HMMPfam:PF00034"
     CDS             257964..259676
                     /transl_table=11
                     /locus_tag="Smlt0242"
                     /note="C-terminus is similar to the C-terminus of
                     Xanthomonas axonopodis pv. citri. nuclease. UniProt:Q8PQP8
                     (EMBL:AE011652 (609 aa) fasta scores: E()=2.4e-110,
                     64.155% id in 438 aa"
                     /note="similarity:fasta; with=UniProt:Q8PQP8
                     (EMBL:AE011652;); Xanthomonas axonopodis pv. citri.;
                     Nuclease.; length=609; id 64.155%; ungapped id 64.450%;
                     E()=2.4e-110; 438 aa overlap; query 131-568; subject
                     172-607"
                     /db_xref="EnsemblGenomes-Gn:Smlt0242"
                     /db_xref="EnsemblGenomes-Tr:CAQ43848"
                     /db_xref="GOA:B2FI60"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR016202"
                     /db_xref="UniProtKB/TrEMBL:B2FI60"
                     /protein_id="CAQ43848.1"
                     /translation="MERPNGMAEPREGGRVDCWSTALPNATEKARAARDSRLTVDSTR
                     RSPQSPRSFSVCRRRLCRPRPKPRASLGFRISRLVCAPLPWSRPSMRRRSLALALSLL