LOCUS       AM426600               33385 bp    DNA     linear   PLN 05-FEB-2008
DEFINITION  Vitis vinifera contig VV78X055120.13, whole genome shotgun
            sequence.
ACCESSION   AM426600
VERSION     AM426600.2
DBLINK      BioProject:PRJEA18357
KEYWORDS    .
SOURCE      Vitis vinifera (wine grape)
  ORGANISM  Vitis vinifera
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
REFERENCE   1
  AUTHORS   Velasco R.
  JOURNAL   Submitted (19-DEC-2006) to the INSDC. Velasco R., Genetics and
            Molecular Biology, istituto agrario "San Michele all'Adige", Via
            Edmondo Mach, 1. San Michele all'Adige (Tn), 38010, ITALY.
  REMARK    revised by [3]
REFERENCE   2
  AUTHORS   Velasco R., Zharkikh A., Troggio M., Cartwright D.A., Cestaro A.,
            Pruss D., Pindo M., FitzGerald L.M., Vezzulli S., Reid J.,
            Malacarne G., Iliev D., Coppola G., Wardell B., Micheletti D.,
            Macalma T., Facci M., Mitchell J.T., Perazzolli M., Eldredge G.,
            Gatto P., Oyzerski R., Moretto M., Gutin N., Stefanini M., Chen Y.,
            Segala C., Davenport C., Dematte L., Mraz A., Battilana J.,
            Stormo K., Costa F., Tao Q., Si-Ammour A., Harkins T., Lackey A.,
            Perbost C., Taillon B., Stella A., Solovyev V., Fawcett J.A.,
            Sterck L., Vandepoele K., Grando S.M., Toppo S., Moser C.,
            Lanchbury J., Bogden R., Skolnick M., Sgaramella V.,
            Bhatnagar S.K., Fontana P., Gutin A., Van de Peer Y., Salamini F.,
            Viola R.
  TITLE     The first genome sequence of an elite grapevine cultivar (Pinot
            noir Vitis vinifera L.): coping with a highly heterozygous genome
  JOURNAL   PLoS One 2(12), e1326-e1326(2007).
REFERENCE   3  (bases 1 to 33385)
  AUTHORS   Velasco R.
  JOURNAL   Submitted (04-MAY-2007) to the INSDC. IASMA, Genetics and Molecular
            Biology Department, Via Edmondo Mach, 1 38010 S. Michele all'Adige
            (TN) - ITALY
COMMENT     NOTE: This is a 'working draft' sequence. The true order of the
            contigs
            and the gap size among them are not known. The actual genome
            coverage is
            11X, 7X sequenced by Sanger method and 4X by pyrosequencing.
            Sequencing
            effort has been performed by IASMA, Myriad Genetics and 454 Life
            Science.
            The gene prediction has been performed by FGENESH program in
            collaboration
            with Softberry, while the identified genes has been annotated by
            similarity search and their function has been described using Gene
            Ontology terms (www.geneontology.org).
FEATURES             Location/Qualifiers
     source          1..33385
                     /organism="Vitis vinifera"
                     /chromosome="19"
                     /cultivar="Pinot Noir"
                     /mol_type="genomic DNA"
                     /clone="ENTAV 115"
                     /db_xref="taxon:29760"
     CDS             join(4515..4685,5213..5269)
                     /locus_tag="VITISV_007001"
                     /product="hypothetical protein"
                     /note="weakly similar to EMBL:AP006619"
                     /db_xref="UniProtKB/TrEMBL:A5AGY9"
                     /inference="similar to DNA sequence:EMBL:AP006619"
                     /protein_id="CAN71284.1"
                     /translation="MAMASQRRRPFQRPPLSIRPPLSASENLPISDTRVPIDEVRSSN
                     QVPMDDGSMSSSQKLLDLDYTLPLAHEVVRE"
     CDS             join(7447..7899,7979..8058,8108..8208,8296..8657,
                     8941..9291,9424..9955,10833..10879)
                     /locus_tag="VITISV_007002"
                     /product="hypothetical protein"
                     /note="GO:0004803 GO:0003677"
                     /note="weakly similar to EMBL:DP000011"
                     /db_xref="InterPro:IPR024752"
                     /db_xref="InterPro:IPR027806"
                     /db_xref="UniProtKB/TrEMBL:A5AGZ0"
                     /inference="similar to DNA sequence:EMBL:DP000011"
                     /experiment="confirmed by EST"
                     /protein_id="CAN71285.1"
                     /translation="MYAAYAAILVSVYHHSNYLERSISNEGDYERHALMERLTLMDNE
                     DCYNQLRMGKDAFARLVTILRGTGRLRNNAHSNVEEQVAKFLHIVGHNLRNRTMKFYF
                     KRSSETISRHFHQVLRAIISLDDVFLKQPDGLKCPQEIKDNTKFWPYFKDCIGAIDGS
                     HFRVKVSNDVVQRYRGRNSHMFYLVGKDLRQTSRILDNALVRDFDKLIVPQGKYYLAD
                     AGFQLKTGFLTPYRSTRYHLKEYSVHQPENAREVFNLRHSSLRNAIERAFGVLKKRFP
                     IIASGTEPHYPVDTQSDIILACCILHNYLMGVDPDERLIAEVDKELFSEEAEFESMME
                     HSAGFEVHKSVSEKRNLTWIDEMDNFLVDRLMEQMHKGQKIGEVFTKTAYAMVAREIG
                     ENFELSCNSEHIKNRMKTFKKNFYAAQEVLQNGSGFGFNESTQMIEATTEVWTTYTKA
                     HPGASQLRHKPIRNYDKLSILLGKDRATGSLAAGAKERQLRWAQEQNLDDTIPLGSSQ
                     HGIRDETFAYVENEATTETSFSSADASVSAPKSNKETKKRKAKYADIVSEELRSIRVG
                     MDAVVAALDRSNLQNYTEEQLFEEIAKVGGMSDVSHMKAYQALTGDVSAARAFLACPI
                     DRRRGKAELVKQFSKLW"
     CDS             join(12558..12569,15769..15868,18757..18857,19819..19931,
                     20058..20157,20257..20403,20903..20963,21052..21149,
                     21231..21373,21488..21571,22482..22571,22683..22737)
                     /locus_tag="VITISV_007003"
                     /product="hypothetical protein"
                     /note="GO:0008943 GO:0004365 GO:0016491 GO:0051287
                     GO:0006096 GO:0006006"
                     /note="highly similar to EMBL:AC006341"
                     /db_xref="GOA:A5AGZ1"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /db_xref="UniProtKB/TrEMBL:A5AGZ1"
                     /inference="similar to DNA sequence:EMBL:AC006341"
                     /protein_id="CAN71286.1"
                     /translation="MESQVSCIGFNSNADSLKVQTTIFGTPCIGNSSSLQLSFGRIGR
                     LVLRVATSRDDIDVVAVNDPFVDAKYMAYMFKYDSTHGVFKGTIKVLDESTLEINGKQ
                     IKVTSKRDPSEIPWGDYGIDYVVESSGVFTTTEKASAHIKGGAKKVVISAPSADAPMF
                     VVGVNETSYKPSMNIVSNASCTTNCLAPLAKVVHEEFGIVEGLMTTVHATTATQKTVD
                     GPSMKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSVVDLTC
                     RLKKSATYEDVKAAVKYASEGPLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSA
                     SFMKLVAWYDNEWGYSNRVLDLIEHMALVAASK"
     CDS             join(23791..24052,24727..24814,24849..24982,26825..26931,
                     27225..27476)
                     /locus_tag="VITISV_007004"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A5AGZ2"
                     /protein_id="CAN71287.1"
                     /translation="MERGITCKKGRVEGRVGGIEKEEVMDTCKDLFLFMHMPPSYLLE
                     YEASRRSKIQEEENDEEERRSNGEEEPLGAHLSSSLPPPSWASLFITSTTIPDFYEDQ
                     YYSTINVFISNNNYKRDGGEAVRVAEPLVQGRVREQPQLRRRVPGTSTSSGAAAEAFA
                     GVPLPLVKTPMPLLTWHSLFAYTVLRVISELPAPGSEDFAGEEPGADLVCERRNIFVS
                     SNRTHPCNGESSNEQGGANTRTRHEQTRMNCLSCSFLLETLGTPCQSSETSGGPSGDG
                     EDVE"
BASE COUNT        10885 a         5350 c         6008 g        11109 t
ORIGIN      
        1 aaattaatta ttttagaaat taaaatttat tgatcgatca ctactaattt agttttgatt
       61 tattgaaatt actttctagt twagtwcata gtgaaaagwt gmasyasact gamcaakaat
      121 gtgtragata attaagaata tataacttta aattattmtt tttcattatt tggtttattg
      181 tgttatatat gctytcattg cttttacaca acttattaag ttaagtcatc atcratgact
      241 aattattttt ccattgattt taactctttc tctatgataa tatttcttca actctataaa
      301 ggcgaggtct ttatgacaat gttttatgac ttgttacttt gatgaaactc ttgtctcatt
      361 aattgcacaa cattgatgac aaacattgtt aatactatat caggtgatag aaacccaatt
      421 aaaggctcca taaaagctta tattatgtca ctagtagtat ttgatttcat gtgaatgaca
      481 ctttatacga tgataaatcc agaaaaatct tgtaagacca acttggtccc ccagggtaaa
      541 aaaatcgtat ggatgtacat tataaaacca gaagttttat ttagtgacta gtatacctat
      601 acacttaaaa ggtagaatga catgttgtgt ggattatcat tttaatgaga caattttctc
      661 accgttaaag agagaagagc tagttccaga agaatgacgt gaaattattt ggaatgcatt
      721 gactttgaat tatcttgatc ctcgtaccaa atcaacgtga actagaagtt caaaggatca
      781 ttcatttgca taatcttgca aatcaattac cagatgcatt cattgataca aagaaagtga
      841 caaactcata tatcctggct gcaaatactc cagcacggat tgatgtccct gtaggacagt
      901 taacaaatga atctaagata cgcttgaagc atggtagact tgccagctca aaggacagtt
      961 aacaaataaa tctgagatac acttgaagcg tggtagactt gttggctcaa aggacaatta
     1021 acaaatgaat ctaagataca cccgaagcgt ggtagacttg ttagctcaaa aggatgtaac
     1081 tccctggaag aggataaccc aagaaaaact tggcactcta gaagagacca tcaaaacgac
     1141 tgatcagttt aaaattgata aatctatagg cctagaagag gcacaaataa tgtagaaagc
     1201 ctttgaagag gcacatattg aacaaaaagc ccctaaagag gcacatattg aacaagaagc
     1261 ctttgaagag gcacatattg aacaagaagc ctttgaagag gcacatattg aactagaagc
     1321 ccccaaagag gcacaggtac ctaaaaagtg tgagatccca gtaagttatg tatacatggg
     1381 aggaaaatgg gatcgaaata atattattat taacaatatt tttgctttcc aagtggtctc
     1441 caatatcata agaaattatg aagatcttga accacgaaat gtggaagaat gccaacatag
     1501 aaatgattag ccaaaatgga aagaagccat gcaggcagag ttaaactcat taacaaaatg
     1561 agaagttttt ggacctgtag tccatacacc tgaagatgta aaacctgttg ggtacaaatg
     1621 agtatttgta caaaaacgca atgagaataa tgagatcata agatataaag tgtgattagc
     1681 agcacaaggt ttctcgtaga gatttgatat tgactacgag gaacatactc tcctgtcatg
     1741 aacacaatca catttcgttt cttaattagt ttggtagtcc cagaaggact agatatgcgt
     1801 ctcatggatg ttattacaac atatttatac ggatccatgg ataatgatat atgcatgaaa
     1861 atccctgaag gatttaaatt gcctgaaaca aattgtataa agcctcgtaa catgtactca
     1921 atccagttac aacgatcctt gtatggatta aagtaatctg gacgcatgtg gtacaatcgc
     1981 cttaaaaaat acttgttaaa agaaaggtat atgaataacc ctatatgccc atgtatcttc
     2041 attaagaaat cagaaaccaa atttacaatt attgcaatgt atgttgatga cttaaatctt
     2101 gttggaactc ctgaagagct cacaagaaca acaaattact tgaaaaaaga atttgagatg
     2161 aaagatattg gaaaaacaaa tttttgtctc agcctgcaga tagatcattt tccaaatgga
     2221 gttttaatac atcaatcaat atatattaag aaagttttga agcattttat cgttactctg
     2281 gcatcagaac aacgttttct tctgcaataa acaagatctc ttcattcgga gagtcggtct
     2341 aacatggaga tatagaatga ggacatgttg tgccaccaaa tgaaaaagaa accaagatac
     2401 aataagatga tagcctagag aaggaattag ggcgttaagc gtggaagatt tttttattct
     2461 gagctcattt ttcaaggaaa tatagaatag taggaacatt tgaataaatt tgattcttta
     2521 tcagatcata aaaacccatt gacccccttt cacggacaag agattgttag tgagcacctc
     2581 agtcagaggc actcactcac ttgttctgag cggatcccac attagcccca atacgttggt
     2641 ctcatggata aagcgcatca tttaagttct ccaatggttg tccgatcact tgatgtgaaa
     2701 aatgattcat tttgtccttg taaaaaagat gaagaattac ttgatcttga agtaccatat
     2761 cttagtgtta ttggtgcact tatgtatctt gccaattgta cacatctaga cattgctttt
     2821 tctgtcaatt tattagcaaa atacaattct gctccaactc gaagatattg gaatggtatc
     2881 caacatatat tgcgttatct tcgtggaact actaatatga gtctatttta ctcaaggaaa
     2941 tcaaagtaat aattgcttgg ttatgcagat gcaggatatc tttcagatcc acataaaagt
     3001 aggtcacaaa catggtacgt gtttaattac aatgatactg ctatttcatg gagatctgtc
     3061 aaacaaacac taatgaccac atcatcaaat caataagaaa tattggcaat tcatgaagca
     3121 agtcgtgaat gcatatgact aagatctatg atccagcata ttcgggaatc atgtggactc
     3181 tcctctatca aaggtgaccc gacaatatta tttgaagata atgtttcatg cattgcatag
     3241 attaaagaat gatacattaa gggtgatgga attaagcata tattgcccaa gtcttttgct
     3301 ttcattaact tcagaaaagt gatgaaattg ccattcgacg aataaaatca agtggcaatt
     3361 tagtagatct attcacaaag gcattgtcaa ttgcaatact caagaagttc atcggaatac
     3421 gcagactcaa atatctccat gttgtgctat tagagaaaat ataatcatgt ctacatgaag
     3481 gggaactaat tgataaaaat gttattacgc tgcactcttt tttcctttgt ctaggttttg
     3541 tcccattggg ttttactgac aaggttttta atgaggtagt tgtagtaata caaaagaata
     3601 gtgtactctt tttccttcat tagggttttt cttagtaagg ttttaatgag acatattttt
     3661 atgatcatcc aagggggagt gttataaaat atgagatttt gtactactat ggtaacttgt
     3721 gcatgatcat tcataaatat cttttgtaac tccctataaa agggagagac ccgtaatgaa
     3781 atttaagaga gttttcttat gcattctatt atctctttct tgctttcttc ttctctcact
     3841 ttgttttaca acagtaaata attaatagag taggtaggat gaaatgaacc taaaatgtat
     3901 tttctcaaat atgctattta gaggaaagtt tttcaaaata tcattttcat tctcatcctc
     3961 aaatgaacta aatgacatgg catagcaaaa aggcaatttt aaaagttata tcaattaatt
     4021 tataattttt ttaaatataa taatgttgtg ttggtttaga aattagaaaa taaaaaaata
     4081 aaatttagag tatgctattt tttttatctt taaaaaaaat aataaaaaaa ttccacaata
     4141 tatatatata tatatatata tatatatata tttctatata taaaatgaga agcgatgatc
     4201 caatcctttt tgatagccaa tgctccattc ctacacattt tgtcaactta taggctatgt
     4261 ttggttcccg gaaaatgcta aggaaaggaa aaaaaataca agggaaaatg atttttttta
     4321 gtttggatga catggaaaat acaatggaaa aaaaaaatga aggaaaatat taaagaaaat
     4381 attataatat tttcctcact attttcctta aaaaataatg tggaaaatat aagagaaaaa
     4441 gagcagggaa aagaggagga aaattttgtc ggctcttgtt caccgaagct tcatctctaa
     4501 cttcctcttc gtcaatggct atggcttctc aacgtcgtcg accctttcaa cggccaccac
     4561 tatcaatccg accacctttg agtgcctctg aaaacctacc aatttcagac acccgagttc
     4621 ccattgatga agtgcgttct tcaaatcaag ttcccatgga tgacggatcc atgtcttcaa
     4681 gtcaggtatg aattgaactc ttttctctta acctcacatc atctctgtgt ttgatgttgg
     4741 tttaatttta tgatctcttt ccctcattca gccttttcca tacaactgac tagaaattag
     4801 ggtttaaggt ttccaatggg aattgcgagt ttgtttggat tgatatttgc tttttattta
     4861 ttttttcccc cttcaaatga gggtttgaat tcgatttgag ttatttctta gggctttatg
     4921 gaccaatgat ttcaggtttc agaatgggga ttttgaatat tattagggtt ttgattctct
     4981 ttattgttaa ttgcaacttt gaatgttaat atgaagaaat gataatttgt aattttgggt
     5041 atcatgtgtt gttgttatta gccttccgat aagattgaaa atgtttatta cttatttatt
     5101 gtcagtaata tatgattttc cgggaaacac gaggttgaat tgggaattca aaaggcgtaa
     5161 ggatagggtt ggactaattc tcatgaactt ctcatctatt gtgggacctt agaaattgct
     5221 ggacttggat tatacactgc cattagctca tgaagtcgta agggagtaga cgtacacaac
     5281 ccaactgcat gttctctggt ggaggttctg ggacctttca cttgattgaa aaataaataa
     5341 ataaattcat tatgctccat taatttttag ttgcgaaaga ttcaaggaga ctatagcttg
     5401 tgattttttt ccttctcatt gatgtcttga tctttatgaa ttgtgctaat ttatcttacc
     5461 tattctattt acttgatatt gctaacttta catatgtatt tgattgtact aagcataaaa
     5521 atggcattta cccattttgc ttaattcttt tttatatcta aattgttagg aaattattgc
     5581 atcctatgaa atcaatctta aataaccaag tctggaatct taagccactg gtttagggtg
     5641 tgagggctac aatgaattgt ttagacaacc cgaaaaccaa ttagacaaca ggcagaagta
     5701 ggagaacagg aactacaatg aagaaagaac ttatgtattt tctatgttaa tttctttact
     5761 tctggaagga agttccaatg cagcagcatc tagctagcta gataaaatgg caaaaattca
     5821 tgatgacatc caagacgatt ttacaagaac taatataaga actaatataa gcaagagcca
     5881 acataaagga ccttytgtca gtttggtttg aactcatgtg aaccttacgt cctattcatg
     5941 atggsacctc aacttttcct ctgcaatact tccaaatttt ctagtctaag gcctcaaatc
     6001 attggtgaag caaatctcct tcccttttcc ggctaacaac attaatttcc tgttcatctg
     6061 atacaagttt tttagtcttt catttataca acttgatgac ttctaaacct tttttctttt
     6121 tggtctgtca ataggatgac aaaaatatgt gacacaacaa gactgattta ggttttacaa
     6181 tccaacatta catgttgtta aaactccaat tcttagagta tgcatattga atttcccctc
     6241 tcaacatgca gattggggtc caatgtgagc aggggtgtta gcctaatgca cattaaggag
     6301 tctttcccta accctagtaa cccttattta gaagtaacat ttgggtagct gcaacaccca
     6361 agtgggtaaa ttagttgcaa ccaacaggta gttttgtggg actagcattt gggtgccaag
     6421 atgggtaaaa aaatgtgtgc atatgttagt atcatgaagt tccaaatagg taggataggt
     6481 ttatcataga tgttcagtca tttgtaaatt ttaactgcca atataaggga ttgcacaatt
     6541 gcactaatct tattcaggtt gaccatgaag aagttgggaa ataacatgaa cacatactac
     6601 tgaaataatg aaaaggagta tgaactgttt gatattctga aaagacttca tttaaacatg
     6661 cacttgggaa atataagttc accctttcca aaaacctgaa aactcaatct gcacttgttg
     6721 gtgactcttt cgaggaattg taatacagtc acactctgtt ttggttatca agaatataat
     6781 ctcttcttsc ccccatgtat ataaaagctt cattttataa aaaacaggct tctttaatct
     6841 aatagcttaa attcttagat aataatccat atgtatcaag cctacccatg ctaaaggccc
     6901 taacaacatg ctaaaatccc attcttcatg taaatatagg aggcctgcag caatctcctt
     6961 gaggatcctg aacctctgtc ctcaatctcc ttgaggaaat tttctttaca gcaacttctt
     7021 ctctagtctt tggcagcaac ttctacattc ttgatggatt aaatgtagct cacaaagcca
     7081 cacacgtatt cactctaagc ctagcccatt aagtacaatt tttaaaaact gttcaacatt
     7141 aagtaaaaag gtccaattaa tttagtgtct tgattcatag aaccaggtag ttttgtctcc
     7201 ttgttccaac attatatagc agagccatgt tgcaattaac atcaagaaaa taactagtgg
     7261 gcagaaacat cccttaattt tcatgcaata ttttcctcga aattttcata gctagaaatc
     7321 ataatacttc aattcctctt actttaccta atgactttac taaatcattc ctcttacttt
     7381 gctatcatgt agacttataa tgaagaatga caaagactta gaagatgggc tgcaacttgt
     7441 gtagctatgt atgctgcata tgcggcaatt cttgtttcag tttatcatca ctcaaactat
     7501 ttggagagat caatctctaa tgaaggagat tatgaacgac atgctttgat ggaaagactt
     7561 acactaatgg ataatgaaga ttgttataat caactacgta tgggaaagga tgcattcgca
     7621 agactagtaa ccattcttcg gggaacaggt cgtcttagaa ataacgcaca tagtaatgta
     7681 gaagaacaag ttgccaaatt ccttcacatt gttggtcata atttaaggaa tagaactatg
     7741 aaattttatt tcaagcgttc tagtgaaact attagtcgcc actttcatca agttcttaga
     7801 gctataatat ctttagatga tgtcttctta aagcagcctg atggattaaa gtgccctcaa
     7861 gaaatcaagg acaataccaa attttggccc tactttaagg taaacttact tatctaacaa
     7921 acatcattag aatattattt atatttcaaa ataaactaat aattttgttt ttttatagga
     7981 ttgcataggg gcgattgatg ggtcacattt tcgtgtaaaa gtgtcaaatg atgttgtgca
     8041 aaggtatcga gggcgaaagt actatccaac acaaaatgtt ttagcagcat gttcctttga
     8101 cttgaagttc acatatgttt tacctggttg ggaaggatct gcgtcagact tcgagaatcc
     8161 tagataatgc attagtgaga gattttgata aattgattgt tccacaaggt aattattggt
     8221 aattagataa taacataatt tattagctca agtgactatt actaataaca aagatccttt
     8281 gtctatgctt cttaggtaaa tattatttgg ctgatgcggg ttttcagcta aaaactggat
     8341 ttcttacccc atatagaagc actcgttacc atttaaaaga gtatagtgtt catcaaccag
     8401 aaaatgctcg agaggttttc aaccttcgac actcgtcctt gagaaatgca attgaaagag
     8461 catttggtgt tttgaagaaa agatttccaa taatagctag tgggacagag ccacattacc
     8521 ctgttgacac acaatctgat attatactag catgttgtat cctccataac tatctcatgg
     8581 gtgttgatcc agatgaaaga ttaatagcag aggtcgataa agagcttttt agcgaagaag
     8641 cggaatttga atcaatggtc ttgagtttag ctgaaaaatg caaggaagga gaaatcttaa
     8701 gggagaaaat agccatggat atgtggaaag attacaatag aaaccgttga tgagttcttt
     8761 tattttatgg ttcttttctt gtatagtttt ttgtgtttca tattaagtac gatgattgta
     8821 tttagaacta taactcctct agttaaaatc acactttgaa tgagttacaa agaagttatt
     8881 attatatctc ctcctcttga cttttcattt taaacatata tatatgtatt attatttcag
     8941 atggaacata gtgcaggctt tgaagtacac aaaagtgtaa gtgaaaaaag aaacttgact
     9001 tggattgatg aaatggacaa ctttttggtt gatcgattaa tggagcagat gcataaaggg
     9061 caaaagatag gagaagtctt caccaagaca gcttatgcaa tggttgcgcg agaaattggg
     9121 gaaaattttg aattgagttg taactctgag cacataaaaa atagaatgaa aacttttaaa
     9181 aaaaactttt atgctgctca agaagtttta caaaatggta gtggatttgg tttcaatgaa
     9241 tcaactcaaa tgatcgaagc taccacggaa gtatggacta cttacactaa ggtgagttaa
     9301 ttattatttt tgagttatta gaaataaaat ttttgcatgt aatgtagagt tataaaattc
     9361 taatagacat tatcacaatt gaactcgagt tttgttaata tttgtttttt atgatgttaa
     9421 aaggcacacc caggagcatc tcagctcaga cacaaaccta ttagaaatta tgataagttg
     9481 tccattcttc ttggaaaaga tcgagcaaca ggaagtcttg ctgcaggtgc aaaagaaaga
     9541 caacttcgtt gggcccagga acaaaatttg gatgacacaa ttccattagg atcatcacaa
     9601 catgggatca gagatgaaac atttgcttat gttgaaaatg aagcaacaac tgagacatct
     9661 ttctcatctg cagatgcatc tgtttctgca ccaaagtcaa acaaagaaac aaaaaagcga
     9721 aaagcaaaat atgctgacat tgtaagtgaa gaattaagat caattagagt tggaatggat
     9781 gcagttgttg cggctcttga tagaagcaac cttcaaaact atacagaaga gcaattgttt
     9841 gaagagattg ctaaggttgg aggcatgagt gatgtatctc atatgaaagc atatcaagct
     9901 cttacgggtg atgtgagtgc agctcgagcc ttccttgctt gtccaattga taggcgtaag
     9961 ctttggttgt cagttaaatt tggacctact ttttttgatg cctaatttga gatagagatt
    10021 atttttattt ttagttttac ttttgttttg gggctatacg tgaagttttg atatcaaaac
    10081 tcatggatga tagttgacta ttagaaattg atctattata tttttagact tatgaagact
    10141 ttttttattc atctatattt tcaaatctac agctactttt accttagttt tgatacgcgt
    10201 tttggttttg gtttgagaat tgagaacctt ttccgggggt ggtttagaag cagctggttg
    10261 agattctgat tcattttact tttccagctc agcatccatg tggtttcttt gcgtttcaga
    10321 taaagttttt gcttcttart atttggaata ttcaggaatc tttcggtatt tggatagaga
    10381 atgcctttta attaaactgt tatataactg aattgttgaa tatgaycaat atgcattgta
    10441 ttttcargaa tgctgataat tgtttccttc ttcgtacagt cattttgaat aagcattaca
    10501 gcctttttct gggraagaga ccmagaatca tgctttgctt ttgaagtagt tttttgttct
    10561 cctttgagtt tctcctttac atcatggaat gagatgtcaa agtgacatgg ggtaggaagc
    10621 ttcatatcac ctgttcctgt tcttttaggg ccttctctat attttctttt tttctttttt
    10681 cttttttttt ttcttctttt tccttttgtt gttgttgttg ttgttgctgt cgtgatgtcc
    10741 ttgagaaatc cctcgtttgt tggatcatat ttgaaggaaa cctgaagctt attcagaatt
    10801 gtgatgtctt tttgtatgga attctgtttc aggtagaggt aaggccgaat tggtcaaaca
    10861 attttcaaaa ctgtggtaat cttgcaaaga ttttatatat ataacctaga tatcatggaa
    10921 tctttgaacc aggtttaact acattcctgt ttgactcagt actggtttaa ctgcaatttt
    10981 ctatacctcg actggccatt caataaaaga caatggaaaa tgatactttt tagaacattt
    11041 ctgaggyatt tcttcttcaa acacaattgg tatacaccac aaccatccac tgagtgctga
    11101 tattgattat ttaccctatc attggttttt gaaaaatttc acgaaaattg caaagaaaaa
    11161 ataaaattaa tatattattt ttatttactt tttctttcat atcttttatg attaaccaac
    11221 atgaaaaaat tcattttatt tgtattgctt tgtcctttcc ttattattta acatagcttc
    11281 atatcatgtt aatttgtaag aaaagtgtga ataatttgtt gctagattta ggagcggkaa
    11341 aatsatttag cagatgtaaa atgggcctca gctcttaatt ttgaatttta tattttatat
    11401 agtagttttt tatttttaca ttatatgaac atattttatt tytaaatttt gattccgaaa
    11461 atccttttga attttttaag agctttttat tagctataaa tgtttccttg aaaataaaaa
    11521 atagtkatta ctcgtatatt ttatttgtat tacatgaaga aaagtttata cataaatttt
    11581 ataattatta ataaataaaa taatagcaaa gactttttat gagcaatgtt ttatgtcgaa
    11641 atattcacrt ttttcaacag tttttttatt ggattaattt attattattc aacaaattga
    11701 taaycattta agacaaattg ttgattttat tttccttcca tttttcctta cttttttatt
    11761 tgtggttaac caaacaaaag aaaatgaatt ctwttttttt tttcccttga attttccatg
    11821 gataaccaaa caagtgaaaa aaaattatat tcctttcctt acctttttct ttccttccat
    11881 ttttcctctc aattttcttt cyctcgcatt ttccgggaac caaacagagc cataaggttt
    11941 agttcaaaag tcagcatgga cttctatcac ttaaagacga agagatgcct ataatgaacc
    12001 tcacgattaa aaaaacaaac tcaacatgat ttcataacca ttgatatcag acactggcct
    12061 agcttaattc agatgcatca aatttataaa ttatatcaaa agcaatttca aactaccata
    12121 tgacatagga tgaatgaagt acctgtctct ctttttcagt tcaacctctt tggcctgaag
    12181 ttccttctcc tttgcctttg tgtcctacag ttgaatgcaa aagaattaaa aacttgaaat
    12241 gcatgtttac acagaattta cagataacaa aatgtaatat ataacttaat tttttttaaa
    12301 aaagaaacat ctttgtcaac tttgatcaag aggaatatca actgttgcac cacgataacc
    12361 aggaggttca gggggtggtg aaaggctaga gttgtctgca gggggacact accaggattc
    12421 tggcaatcgc attacacgat tggtggtgca aaataatgaa cctcttacac acatggcatc
    12481 atgtgatttt tggtttctta aaatgacacg tgtgggggcc caagtgaacc tactttcata
    12541 tgtttcatta aatctcaatg gaatcacagg taagacaagc aaatattctg agatctgaca
    12601 gatttggtag tgtttggaga ccacccatca gacctaaccc gaaaaggcca ccttcctaaa
    12661 cacgtgatac tattgtttcc acctaaccaa acaccccaaa ttcgagaaag tgaaagaaaa
    12721 ttcacaacgg acaaacaacg cgttgccttc aagctgtgtg ggccgcgcgt actttcttag
    12781 atttgaccgt ccagcaaacc cctcttcttt gactctcttg ggtccgtcca actattatac
    12841 atatataaac aatttttttt tatttctatt ttaaattttt tttttgtttg atgtaaaata
    12901 aaataattta gcatgtgatt caaataattt gttttatttt gacataaaaa tcaacgtcta
    12961 atttaataaa taattgtatt atttaaaaga ataaaatctt catttgcctg ttttttctta
    13021 actaaagatt catattcata aatagttttc ttttttatat tttatattta atgtattttt
    13081 attttaattt aaaaaataat attattgtca ctaaatttat ttattttatt acttgtattt
    13141 tttcatggat acattctttg atgtaggtgt tcaaaaaatc aatttaataa tttaatttaa
    13201 atcattaaat aaattaaata tattcgataa aataatttaa taatatgatt taaagttaaa
    13261 ataataaata agtaaaatta attaacctat ttttaaattt atatatttat tttttatttt
    13321 tattcttata atttataagg ttaaatacga ttcatttaaa tttttaaaat aaattttaat
    13381 ttaatattaa ttaaatttta agtcaacaac ttaaatataa tttaatttaa aataaattta
    13441 aattattaaa taataaatat taaattttat caaacacttt atttcgtata agaaatttga
    13501 ctcacggtgt aagcatcttc aataaaataa gttcaatttt ttttgttatt taagtaactt
    13561 aagtcatcca tggaagttgc taattattat aataagaaaa tattattagg gtggagaaaa
    13621 ataataataa taaacaagcg cacgtttgaa aagggctctt ccaagcagtc ttctattttt
    13681 ttaaaataaa aataagcttt tttgagaatt tgttttaaaa ataagatttt ttaaaaatca
    13741 ttattggagt aacaaattta atttccatta aaataaaaaa taaaaaacag aaaagttatt
    13801 acatttttgt tgtccaaatg ggtaaaaata aaataaaaat aaatttaaaa tggaaactgt
    13861 ttcgtttttg ctgtttccag attttttgtt tggtatcttt ctattttgga agtgtttgaa
    13921 tttgatattt gagaaatgtt ttaaaaaata aagaatatta ggaaggctcc aaacgtgtcc
    13981 aacgtggctt acgagggctg agccaactgt cattttcgac atggccacat cacgttaaaa
    14041 ctccacctag gctgctgcgt gaagcgtctt acacacacat agaaacctcc gctcatttct
    14101 ttcagccctt tttcatttta aaaagcttcc tctatatata gtcatatctc tctccctttc
    14161 tctctctctc taaatataaa gaggtatata tttgttaatg gtagcgttgc catttcacac
    14221 tctctaaagg tcatacacct aacagaggaa gaagccttcc tttttctcta gggttttctt
    14281 tctttctttc tttctttctt ggcctttact tcaatccaag agaccagagg agaagaggaa
    14341 gagttccatt cggttttgta atggcgctct attctctctt cagatccgcg ccttccgccg
    14401 ccgccgccgc cgccgctact gtggtggatt cttctcgtcc ttctgatcga tgcaaggttg
    14461 agtttctctg atccggatgt gcttgttttt tgttttttgg tttggaggaa atcgaaaaga
    14521 aaaaaataag aaacttgttt tggacgattt ggaaggtttt gttttgatgt ggtagttgtt
    14581 ttgtttttgt ggtttkgttc tcacctacca caagtcaaat ttggtggtga atgttatttc
    14641 cttttggttg ctgagaaagt ggaccgagga ggctgtgttt tggatttgaa tcttctgttt
    14701 tcacgagttg atcttttgat tttctggtct accaaacgtc agagtttggt ggcagatata
    14761 gtatgttttt tcgttgctca tttttttttt ttttttggct ttgaaaggaa atacatgtaa
    14821 aaaaaaatgg tttttgggca ttgaatgaag ttgttttcaa attttttaat aggcttgaat
    14881 gaattgcttt ctttatataa gaatgatata attttgtgat tttctctacc accaaacggt
    14941 aatgtgattt ttgttgattc taatctgttt ctggtttgtg aggaaatttt gaaaaaaaaa
    15001 aaataactag aaaagagcct ggattttgaa gaactgactg gaaattgtcc gtctttggat
    15061 gaaattttta tttttattat tattttaatt ttcttgacca ccaaacgcca aatttggtcg
    15121 tacatgtttt tgttaatcat tgtatgtttt tgtttgaaac ggaggaatgg tttaataaca
    15181 atataatata tagaagtgaa aaactcacct ctgttaaagc cagcatttaa aaattttctt
    15241 cctcttcctc agttcactaa ccaaatggag tgtgctattt ttgtttcaca aatctggtga
    15301 agctatcttt tgctctttct tctaacaggg aattgcattg taaaataagc caaaagaact
    15361 gtgtgtttgt tgaatttgtt ctaccaaata gttgtgttac gattggttga ttagagcttt
    15421 tattttatct tgttggaaaa aattgaaaaa tttagatttg aacatgcttt tcgtttgttt
    15481 cctacattat ctcagctgcc aattggagcc tacagctctg ttattattta cagcattgga
    15541 ttcaaactgt cttacatgtg ttttcctccc gtttactggg caaccaaatg gagcaaagtt
    15601 tgtatgaagt ttttgctgtt tctttctcag catcactaaa accttctttt agtctaatgt
    15661 tttggttcaa cactataatt ttgggcttgc tctctcctta attttgtagg tttctttttt
    15721 tttttttttt ccccatatat cttacgtgga tttatatgtt tgttgaaggt gtcttgcatt
    15781 ggtttcaata gcaatgcgga ctcactgaag gttcagacca ccatatttgg tactccttgt
    15841 attggaaatt catcttcctt acagttgagt aatagatttt tttgtttaat gtctatttat
    15901 atgggagtgt tgtggttgga tggtgtaatt gacttgtgat atgttctctg tctaaactat
    15961 acaggaaatg cagtgccagg agtctccagc ccatcaaagc cacagccaca gaattgcctc
    16021 ctacagttca aagtaagaac tacatattca tgtttagttt ttatgtgata ctctttcaat
    16081 ttggataatt agctgtatta gttgatattc ttgagtgttt tgtgtagagt catggagcag
    16141 tgggcagaca aagattggaa tcaatggtgt gttttcttac cagttgtgcc tatttgacat
    16201 aagaagaaaa attatgctct gtttcactta tttttgttcc ttgacctttc cattgtttct
    16261 tcctaagtat tcttcagccc ttattagttt tgtattagaa atcaaacaac ctcttaaaaa
    16321 gtacagcagt tttttaatag gcttattatg tgatttggaa tgtaatttga aacttctgtt
    16381 ttacactgat tcatgatttg ggtttatctc ctgtatatag ggatagaatt atgatatttt
    16441 tatcttatac aggagttgag ttcaatatgc ttatttcacc ttataacagt atgcttgtaa
    16501 agcagagaag aaatactttt atgcacatat ttataaatta gtattgttgc cttgatgttt
    16561 attgtgtcct ttttaccatg aaagccacta gtgaatgaaa ttcaaagtct gaggatctca
    16621 gtgggtccct ttatttatag tgagccctct ttgttgtccc tagttcatgg cttgtcagtc
    16681 ccaaaccatg cgaagggctt gaaatattgt ttgagttcca tgctcgtgat tgattatatt
    16741 atattttaat tgtagtggaa tattgatagt ttaaaatttt gcaaccaagc tctcttatat
    16801 aattgctgtt tgaaagagtt aattgattaa tgaaaactgt agtaaatttc ataagttggc
    16861 caaggaatcc ttgatgcttt acttgctttg caacttagct aggattaaat accctgattt
    16921 gtcaaaaaga agaagaagag atgctttcat ttttagtctt aaggttatgt gacttcacaa
    16981 tgattgatca gttttaatta atctggaagt tctttatttt ctccaattat tctgacaata
    17041 ctctgagaat attgtcttcc tgattttatt ttaattactt tttccatggg atgaagttct
    17101 cttaaaaatg atgcaaggtt cttagttaat tagtgaatat atttactggg aagatcctag
    17161 gttgactgct gatgtgaata tgctgtgctt gtggatgaat atgttttagg gattgctttt
    17221 ttgatgggta attcccgcgc gcgccccccc tctccccccc ttttttcttg tccccactgg
    17281 gacttgaacc tggaacttcc cataaatcca ccccaacact gtgccacttg agccaggcct
    17341 caagggctgt tttaggattg ttcctacaat ctcctgagag gagttcatga tctattagtt
    17401 gtagatgtac tcttgtatgg cttgtatatc catattatcg gcttggttat gactaccgta
    17461 tagttttgtt ctaaaaccat aggtaatttg ttaattgata aattttgttc agttgctgaa
    17521 aggttgatta atctcgattc ttgtgcttga ttgtagcaca tggtccactc tctggaagga
    17581 cttgattgat tttgcccaaa caaaaaaaaa caaaagggaa tctgggtata ttgtgcttga
    17641 aactttggaa tatttctttt caagccgtat tcagtatggg tgcctcgctc atttagagtc
    17701 ttgtgcttca aactttagaa cgcttatttc cattcatttc aatcacaatc cttacttcaa
    17761 tttacagtgc gtttggtagt aattttagga agtttttcta acctttataa cacttggaaa
    17821 ttttcatcct tcaagtatta aaaatgctag aaacacttcc cacaatcact gcaaaatgca
    17881 ctcttaatct gataatgttg atttggggac aaaaatggaa agaaaaatgg cttgagttcc
    17941 tacttctttt aggtgctgcc atcctagatg taattggtag atccattctt actgttaaac
    18001 tacttgctgg gttgtgaggc agagcatctt aacaaagcta ctcttctgag ttaggaaggc
    18061 caactaattc atcctttagt ctcatgcaac tagtcaattg tagttaagtt agttgagtga
    18121 aattttttaa aataaaatat tgactgcttg tataaagcaa tggttgaaca ctcgcatagg
    18181 ggaacawttt ttccccttgc ttgatggagg catatgttgc atcacctttt gtctctttat
    18241 aaacttcctt tcagtgaatg agtgtggatc agcttgccaa tacaaagttg atgatctttt
    18301 cattacagag aaagaatcac tacctgagat attttaattt ggatgtaaga tcttgcaggc
    18361 tgataggacy gttatgtggt tctttatcct tggttatgtt ttcataatca tgcttatgat
    18421 ttagaaatat tgttaattac aaactgtgga tttactttat ttgtgctagt gcacagtttg
    18481 ttggccattg gtttgcaaat ttttcaaatt tgttttgctc atggatcttt cttcttaaat
    18541 atttttcggc tgcttgaaaa ctaaatggct attacatctt acaattattg gtcaatatgc
    18601 caactaatta ggtaggtaac ttttcctttg cttacccagc gagaggtgaa tttaatatgg
    18661 tctaatattc atcatattgt ctcagtgcga ccctgcaaaa tatagctctg tggtgatcat
    18721 tgtgatgata atgtcttagt tgttaaactc atgcaggttt tggtcgaatt ggaaggttgg
    18781 ttttacgagt agcaacctct agggatgata ttgatgtggt agcagtcaat gatccatttg
    18841 ttgatgccaa atacatggta aggatttgca attagcctgt cttcttgcag atcacctctt
    18901 tagaaaattt ttggatgatg aatttttggc cactattgta taatccagtt cgtgtttgtg
    18961 ttaggtgtta tgcccttatg tggtaatatc acaattatca tgtttgcttt tcatcagtgt
    19021 atgataattt tttttttatt gattgatgaa agaaatgtga tattttctca gtggcttgaa
    19081 atggaacagt atttgttgca aataagtttg ttcttatttg atctaaattt tccaatgagt
    19141 taatcacaag ggttagaacc tatttttctg gatttggtta tggtccttca ggtttggtac
    19201 ttgtactgta ataaaacaac atggttgaaa aattgtggat atatggaaaa tgattgtaaa
    19261 ctcttgtttc tctcaagcaa atatttttgg acgtgtaagc accatgatta ctttattatt
    19321 tcccatgcaa tctggaagaa atattatggt tatacattaa gattctaagt tcaaagtaca
    19381 agaattaaac aatatatatt agtagtaata catgtagaga agcttttgta aaatagtaaa
    19441 atatggactt gtctagcaat ttttattttt catatgaagc aagaactaca aaaatatccc
    19501 ttcgactagt atattggatt gataccttga aacgattttc gttgtcgtta ggttggctga
    19561 gcgcctcatc tagagcttga aatattcaat tatcactact atctagctct gtatttgtaa
    19621 taagctcgtt ctttttaaac tccaacacaa tgacgtggtt ttttccatgt caacgtactc
    19681 aacactcaca gtgctttaag cattgtggca caccttaatt gtatggtagt ttaggattct
    19741 tgagctagtt gttaggatcc ttcaacttta gagagaagga atggtagtga tatgttggtt
    19801 ttcgtttatt ttacgcaggc ttacatgttc aagtatgatt ctactcatgg agttttcaag
    19861 ggaaccatca aggtattgga tgagtccact ttggaaatca atggcaagca gataaaagtt
    19921 acaagcaaaa ggtatcctaa ccttagtttt tgactgggat tttagtggtt gtagtagcaa
    19981 tacatgcttt agtgctaaca taataccaca tggttttact gaagaaacat tgacatcaaa
    20041 atgtatgtat atgtcaggga cccatcagaa atcccttggg gtgattatgg gattgattat
    20101 gttgttgaat cttctggagt tttcacaaca accgagaagg cttctgcaca cataaaggtt
    20161 cgttggtata tgttgtggac tttatattag ttcttctaaa cactctcttg ccaccccact
    20221 gtgctgaagt cagtgattgt cgtctttata atgcagggtg gtgccaagaa agtggtaatt
    20281 tcagctccat cagctgatgc accgatgttt gtggtaggag taaatgagac ttcatacaag
    20341 ccaagcatga atattgtttc taatgcaagc tgtaccacca attgccttgc tcctcttgcc
    20401 aaggtttgat agcttattga actttctgtt ttgcaaatga ttggctacag taatttttta
    20461 tgatgagaaa tggttagcta atgcctgact tcatttatct attttaataa aaactacggc
    20521 tatgtttggt tcctgggaaa tttgaggtaa aatgtaagag aaagaaaata gagaggaaaa
    20581 gtagaaggaa aataagaaat aaatttaaaa tgaataaatt atttttatat gctacttcaa
    20641 actcattttt cttattttga ctctttgata taaagattag caaatttgaa aatgcataag
    20701 ttttttacta actttaatta ttttttattt tcttttgtat tttcggtatt acaactaaac
    20761 atgagaaaat aatttttttt tcttcccttg tacttttcga caaccaaacg taacctacat
    20821 gttttcttct gccaacttaa tgaaaaccct cacttcatca tttctttttt caacttgtcc
    20881 taaacctggt tatgctttac aggttgttca tgaggaattt ggtatcgttg agggtttaat
    20941 gacaactgtg catgccacta caggtttctc cttctccctc tatttgacat gtgcctgaca
    21001 catgcttttg tattaattta gtaacatggt tatgctcttt ttgatgttca gccacacaga
    21061 agaccgtgga tgggccttca atgaaggatt ggcgaggggg ccgaggtgct tcacaaaata
    21121 tcatcccaag ctccactggt gctgcaaagg tatgagatgg atttaattca catggaagta
    21181 gaatcccata aagttgtaca aggtgtgatt ttgactgttt ggtatcatag gctgttggaa
    21241 aagtccttcc agaactcaac ggaaagctca ctggaatggc cttccgcgtc ccaacaccta
    21301 atgtctctgt tgtggactta acttgtcgac ttaagaagag tgctacatat gaagatgtca
    21361 aagcagccgt aaagtatact ctctctctct ctctctctct ctctatctat ctatctatct
    21421 atcatgccca agtatgattt atcccaaaat attaaaatta tctttctctt tgaatttcca
    21481 actaaaggta tgcctcagag gggccattga agggtattct tggatacacg gatgaggatg
    21541 ttgtctccaa tgattttgtt ggtgactcaa ggtagaattc tcaatctcat aatcacttga
    21601 tgtaatcgga attaatattg agtatacttt ctgggctcca tagaacggat agtgaccttg
    21661 tgtttctaaa aacaaaggag aaatttagga cttcctgaca acgtttgcaa aatcggtcct
    21721 taaaaatagt tctaaattgt tttttggaac aaaattctaa ttgagaatct aaatatcgaa
    21781 aatagatttc tttccttatt ctacacgaag gtacttcaca ttttgtttga atgccaaagt
    21841 tgtcagagta tttttcatat tttcattaat tttctaccta tataaaaaaa aaaaaaaatt
    21901 cactcatttc ccaaaacact actaaaaaca cttgaaagca tcttaagttt gttttaaaaa
    21961 atatgttttt agaacaaatc ctcataactg attttactct aatcttgcaa acatgatttc
    22021 tgttctttag aacagaaaat tgttttcaag aatggtttgg aaactggtcc caagggtttg
    22081 ctcggcaatg tttttgaaaa aatgcttaca attagttttt gaaaatagtt gagagttgtt
    22141 ttcaggaaca aacttctatt tgaaaattat aatatatgaa aaacaatttt ttcaccctat
    22201 tcttcgcact taatatcaca gtaaaagttc tcgaccttat ctctatgttt ccaattgtct
    22261 cttgaaatat tctattaaaa aaatcttgaa tattttctca aaaatcacct tgctttcaaa
    22321 atcttatttc caaactgagc tagcttttgt ggttacctca gtcaaccaac taccattacc
    22381 cttcttgaat tcccaggatc gaacctgatt tattttatct acattttcaa agcatcattt
    22441 ggtggatcac catttttata tgttctctgc tttatttaca ggtcaagtat atttgatgca
    22501 aaggccggga tagggctgag tgcttccttc atgaagctcg ttgcatggta tgacaacgaa
    22561 tggggataca ggtacaacac ggctctctct ctctttctca cacacacagc atgcaagcct
    22621 cagagcttcc aggtggtgct aatgtgatga tacataatgg ttattttcgg tttttcttac
    22681 agcaaccgag tgctggacct catagagcac atggcattgg tggcggccag caaatgagaa
    22741 caagaaacta gtagaggttt gccaaacctg catcttctcc aatttttatg cctgcaatga
    22801 atatgcttga aagagtagga gttcataggt ggtttggcca aactatgaaa taatgaatga
    22861 gatttgaaca ttaacctgta tgagttgatg gataagtggt attttttctt gattggtggt
    22921 atctttttga tacaaattaa ggtataaagc aataggacct agttggataa gtggtatgcg
    22981 atagggacct agttggatta gtggtatttc ttcttgattg gtatcgcatc caaacccaag
    23041 acattgatgc gatatttaag tgccatgttt ttattttatg cttgaaaggt aaatgtgaaa
    23101 gtctcttcga ttacagtatg caatgttttg tcatgatcgt catctgtcca tcatttaaga
    23161 aaatgagaat caaatgttgt ctgtatcttc ttttatcttc gtcttcttct gttgtatatc
    23221 tctccattca gtctctttga atgagtcagt tcttggtttt cacaggtttt ctccaaattc
    23281 tttgttttaa tttttccatt ctttaaattt tgtatttttt tttccaattt tttttaaata
    23341 tattaagaga aaaaaaaaag aagaaaaatc aagaaaaacc tccatctatt attgttaata
    23401 atttattatg gaagatttgt caaaggaatt gaacccaaaa atatgtttct taacacaaac
    23461 acttcaaatt ttaaaaattt tgctttattt atttataaat tatttctaat aatttttatt
    23521 aaataattaa aaaaattaca gattatctac ctagtattaa ttatttggtg cagtaaggtt
    23581 gttttttaag cttaaagatg aattatctaa ataatgattt ttagaacata tctataaagt
    23641 gtgatgtcaa atgtaagggt tatgtaattt gattgaacat gtaaatgaaa tgacaaaaac
    23701 ttaatccaag gaggggattt taaaattcta tgaaaataat atcaagaaag aaagatattt
    23761 tgagaagaca acccgaggct tgaattgaaa atggaaaggg gaataacgtg taagaaaggg
    23821 agggttgagg gaagagtagg tggcattgaa aaggaagagg tgatggacac ttgtaaagac
    23881 ctctttctat tcatgcatat gccgccatcc taccttctcg aatatgaagc atctcgaaga
    23941 tctaaaattc aagaagaaga aaatgacgaa gaagaaagaa gaagcaatgg agaagaagag
    24001 ccccttgggg ctcacctttc ctcctccctt cctcctcctt catgggcctc tcgtgagtct
    24061 ccctttcctt ctttacgtgt ctggaaatgt agagaaaatt agagttttgt cttgtacttt
    24121 ttctttttct agatttttat tatttggaaa tagacttcat gagtccacgt cttgaatttc
    24181 aatttaaata gagaaaataa ggttttattt gataattgtt tgacaattag aaaatagaga
    24241 aaatagaaat agggtgttag ttgtttaaaa cataatcaaa cgtagaatga ttaaaaatat
    24301 aacataatta tttttagaat atatttaaat atatagaaat aaattaaaaa tatttaatgt
    24361 tcctaaaaaa tcatttttaa aaagtagttt tttagaattg ttttttaaaa cactttttaa
    24421 acagtttcta agagtctgtt tagaaagtat ttttgaaaaa aattagatgt ttgacaaatt
    24481 ttaagaaata tttttaaaat tataaaaact cagttttagt actttttttt tttagaaata
    24541 ttttatgggt gattcttaca tactttactt ttcttaagag aacagctcga ttagaaatac
    24601 tgtgaaatgt aatctaaaac aagtttttgt tgttttaaaa acaaattttt attttatttt
    24661 atttagaata ttgtgagtaa catttggaaa acataattta aaaatatatt aaatttaatt
    24721 ttatagtttt tataacaagc acaactattc ccgattttta tgaagaccaa tattattcaa
    24781 ctataaatgt ttttatttcc aataataatt acaagtaatc acttatattt cttttactat
    24841 aaatgcagaa gagacggagg cgaggctgtg cgagtcgcag agccactggt tcaggggcgt
    24901 gtgcgtgagc aaccacaact gcgccgtcgt gtgcccggaa cgagcacttc gtcgggggcc
    24961 gctgccgagg ctttcgccgg aggtgcttct gtactcgcaa ctgttaaatt aagagcctct
    25021 gtattaccac tactactaca ataaagagac tcttctatcc ttctgttggt gaaagtagtt
    25081 ttctgttttt caaaatagaa aacagttgtt taacctaaaa atttcggttt tatgtttttt
    25141 ctaactactt ttgtgctttt aagaattatt ttgaaaaatt attttctcca ttttttcata
    25201 cattttacaa taaaattata aaattgggtt ccaaagatta aatacaaatt aatttttaaa
    25261 ttttattgct atcatgatgt cagcttacta aggattgtaa catgtttcat aaatttttaa
    25321 ccaaaaaaat atggttttta gaatttgttc tcaaaatatg atttttcaaa aataatgttg
    25381 tgaaccccgc attttcatat gatgcattcc cactcgatga cgtaactcac tttttaatta
    25441 atttggtgaa aatatgattt ttagaaaaga gttggagtca tcacttattt ttgttttatt
    25501 tttaaaggga aaaaaagaaa aatcttaagt gtgactcctt atttggaaaa gacatatctg
    25561 caaaaattaa atttggatcc gggggtcaag ttacttattg ggaaggtaca gtaaagatcg
    25621 tagcacccct ctaagcccct aaaaatgagt ctatactaaa taaggtgaag caaacatgac
    25681 aattaattag gaaatcaata gatactaatg aaatgatcaa ataataaaat aaatcatgta
    25741 tgagaataag taaagtggga gtgagagcgt accttgatag caagtaatag tgcgctataa
    25801 tggaaacaag gttagcccaa gtataaaatt atcacatgca tatcaaagag caagacaaag
    25861 atcaaacaat attcattaag cataaaaaat cagaaaagat catatgtagg gcccccacca
    25921 aagcccaatt tattttgcat caattaatcc tacaaattcc attattttgg aattatgaaa
    25981 attgtcttca tgcttattag aaattaaaga aaacagaaaa ttattttaaa atcaaagaaa
    26041 atatgtgaaa gcgcttacct gaaaggaaat gtagcaagtt tatttaaaaa cagaattttt
    26101 agtaacttaa aaccctaatg aagaatgaaa agtgatagaa ttaaaaatta tttgataaac
    26161 tgaagtttta aaaattatat ttaggaattg aagttttgga aattaaattt gaaaaaaatt
    26221 gacgttttga aaattaattg agaattggag ttttgaaaat tagttttaag aattggtgtt
    26281 ttgaaaatta atttagaaag aaattggaat tttgaaaatt atttgagaat tgaaattttg
    26341 aggattaaat tcataaatta gagttttgaa gattaaatta aagaattgaa gttttgaaaa
    26401 ttgattttga aagaaaacaa agttttgaaa attaattgaa aattggagtt ttaaaaatta
    26461 aatataagaa ttggagtttt gaaaattaaa tttgaaagaa aatggagttt tgaaaattat
    26521 tgagaattgg agtttcaaaa attatttgag aattgaaatt ttgaggatta aatttggaag
    26581 attggaattt tgaaaattaa atttgaaaat tggagttttg gaaaatttat ttgaaaaacc
    26641 ggaattttaa gaatcattta aaagagattt tgcgaaaatc aaactttgat acgtgaggat
    26701 aaagaataat ttttcaccat gagggttgtc ttgattttta atcatcttcc caatgtcaat
    26761 ggtttgcata tgccataact ggatccatac attgaagggt attatttatt ctgaaaattt
    26821 gaagtgcccc tgccacttgt gaaaactccc atgccactat tgacttggca ttcactattt
    26881 gcttacaccg tgcttcgtgt tattagtgag ctaccagctc ctggaagtga agtaatgaag
    26941 ccccacttct ccatgaaatg caccaatttg ctgcctattt atacctggta gcacataagt
    27001 cactcatgca ggactttgct ccacctccca aagagcagca accctgaaat ccttgcaagc
    27061 aatcacattt cccaacttcc tttctcacca catctagaac tgagtcaatc agcttcgccc
    27121 ccgccctcct ttccctttag tgtagtgacc tttagacata tacgggtcaa aagcgagttg
    27181 aaaaggtgag ccatcatatg actcgaccgg cccatgattc ctaggacttt gctggggaag
    27241 aacctggagc tgatctagtg tgtgagcgaa gaaacatatt cgtcagcagc aatcggaccc
    27301 atccttgtaa tggtgagtct agtaatgagc agggtggagc caacactcga acacgccatg
    27361 agcaaactcg catgaattgc ctttcttgta gtttccttct cgaaactctg ggcacgccgt
    27421 gccagagtag tgaaacttca gggggtccct ccggtgatgg tgaggatgtg gagtaggatg
    27481 aggaagaatc cgtagattga tggaagaaaa cgaaatgaga gtgttaggaa aaaatgcagc
    27541 tggaggctgc tcccaagagg atgtagttgc agaagaggaa gactttgtgg gtgtggtagt
    27601 gtgattatgt gattgggctt gattggttgc ggatggagag acccattttg agggtttctg
    27661 acgaaattca atggcgggca gcggattcca ataagtgagt gttggattgt ggtggtggag
    27721 atgagagaga gagagaggaa gtgatcgagc caacacaatc acttgatatt tcgacattct
    27781 tggtagataa ttaacccatg gctccaaaag ccttagaaga attccatgct gcatagggcc
    27841 accttttgga ggccacacac gaccaccttt tggatgccac cataaacaaa ggaaaagaaa
    27901 acaaggatgg aagtagagta aggactgaaa ataaataaat aacaaaagga aaacaagctg
    27961 ataacgatac ggagactcat ttttaggtga catccatggg ttaagggcgg gtggaattga
    28021 caaaaataaa agtcatgatt ttcgagcatc aaactcaaat gaaacaaaga caataattct
    28081 aacaatacca aagcaaagaa gatgaaacaa ctatggcaca gtcaatgcaa ctcagttaaa
    28141 tatgctcttt gattcgcacc tgggagtctt gaatgctctg cttttactcc cgggaatcct
    28201 gggaatccct ctttcttttg ttttctcttc ttaatccctt tgctctgtat ctctctattt
    28261 ttctataaaa aaaacgtcat ctcttctctt ctaagctcct catcttgctc tgtttttaga
    28321 tgtctcattt ttctattaac ttcctcatgc tctgtttttc tttcacttcc caatcccatc
    28381 ctccacccgt tccattgttc ttggttcaac gaaaatgtca ccaccctcaa ccaccaccat
    28441 ggcaagttgg tgacgtcctt ggccacctca tgggaggttg tcccccactt ttccaaaaaa
    28501 aaaaaatcca gctcactccc gagtagctaa tgaggggtct acaaatatgc ccctcttcgg
    28561 tagagttcac gagtgtaagg aatatgaaca ctagagtgaa tagtgagtga aatgaagtga
    28621 actctaccaa agaaaaaaaa gacctctaaa ggtacataag tagaacacaa acttcctcaa
    28681 accaataaaa gaacaaaagg ggttctaaaa tcctaagaga aaggtagctg ttagagtgcc
    28741 tctaaagctg cgttatggat ccagactccc tctaagatat ctccaaaagt gactcgaaga
    28801 tcgatgtcaa agttgaataa cggtcgaacc accttagaga tagagatgaa catatataga
    28861 agaaaaactt cacatgcacc atacaagagc gtgaagtgag ggacaccaat gatataatca
    28921 aaacataagc tataagctca aagagctata tcacacacaa tggaaaagga caaactatgg
    28981 aaaatcacga ttttgaatgc ttgaaatgtg gctttgaaag cctagactga gacgaacgat
    29041 tttgaacaac tactaaacta tggctttgaa tgcctaactg tgagcaatgg ctctgaacgt
    29101 gaaactgaga aatgtctctg aacaccaaac tgaaaacatg gctctaaacg ccaaattgaa
    29161 gacatgactt tgaaccttta actaaaaaca tggttctgaa caccaaactg aagacatgac
    29221 tctgaacgcc taaaaatgat gaaagtgact ttgaatgcct aaaactggaa gaaataactt
    29281 tgaacgccta aaactggaaa atatggctct aaacgcctac gaaggaaaat ggtggctctg
    29341 aacgcctaaa gggtgaaaat gactctagat catgagctta tggctctaaa tgctaagaat
    29401 gactctggtt cataaataag aagaacgaat ctgggtcgtg agctcagggc tttaaatgct
    29461 aagaatgact ctgggtcata aataaaaaga acgactttgg gttatgacct tagggctttg
    29521 aatgctaata atgactttgg gtcataaata agaaaaatga ctttgggttg tgaactcaag
    29581 gctctgaatg ctaagaatga ctctgagtca taagtaagaa gaacgactct ggttcgtgag
    29641 ctcagggctt tgaatgctaa gaatgactct gggtcataaa taagaagaac gactctgggt
    29701 tgtgagctca aggctctgaa tgctgagaat gactctggat aataaataag aataacaact
    29761 ctgggtctta atgagaataa cgactctgag tcatgagctc agggctctaa atgctaagaa
    29821 taactctggg tcataaataa gaagaacaaa tatgagttgt aagctcaggg ctttgaatgc
    29881 taagaatgac tctgggtcat aaatgagaag aacgattctg ggtcgtgagc tcagggctct
    29941 aaaagctaag aatgactcta agtcatgagc ttagggctct aaatgctaaa aatgaatttg
    30001 ggtcataaat aagaagaacg aatctagatc atgaactcag ggctctaaat gttaagaatg
    30061 actctggatc ataaataaga agaacaactc taagtcatga gttcaaggct ctgaatgcta
    30121 agaatgaatt tgggtcataa ataagaagat cgactttggg tcttgagttc agggctctga
    30181 atgctaagaa tgactatggg tcataaataa gaaaaacgac tctgggttgt gagcttaggg
    30241 ctctgaatgc taagaatgac tatgggtcat aaataggaag aacgactcta ggtcatgagc
    30301 tcagggcttt gaatactaag aatgactcta ggtcataaat aagaagaaca actctaggtc
    30361 gtgagctcat ggttctgaat gttaagaatg actcctggtc ataaataaga agaacaactc
    30421 taggttgtga gctcaaggct ctgaatgcta agaatgactc tgggtcataa ataagaagaa
    30481 cgattttcga ttgtgagctc agggctttga atgctaagaa tgactctggg tcataaataa
    30541 taagaacgac tctgggtcgt gagctcaggg ctctgaatgc taagaatgac tctgggtcat
    30601 acataaaaag aatgactctg ggttgtgagc tcagggcttt gaatgttaag agtgactctg
    30661 ggtcataaat aagaagaacg aatctaggtc gtgagctcaa gactctaaat gctaagaatg
    30721 actctgggtc ataaatgaga agaacgactc ttggtcatga gctcagggct ttgaatgcta
    30781 agaatgactc tgggacataa ataagaagaa tgactctagg ttgtgagctc cagggctcta
    30841 aacatctaaa gcgaagaaga tgaatttgaa tgctaaacta aaagaaaacg acaactctaa
    30901 atgctaacaa tgtggctctg aacgctgaac taaaagaaaa taacaactct aaatgctagg
    30961 aatgtggctc tgaacgctga actaaaggaa aatggtggct cttaatacta ggttgactaa
    31021 tgtctttgaa tgccaaactg aagaaatatg gtggcatctg aatgctaagc tggccaatgg
    31081 atctgaatac caaactgaaa aaacacggcc ctgaacgtca aactgaagat gtagttctga
    31141 acgttaaact gaaaatgcag ttctgaacgc ctaactgaaa aaggtgatgg ctctgaatgc
    31201 cgaactgaag acatgactct gaaagtcgaa ttgcaagggg atgatgaagg tgaatatgcc
    31261 ccagtgtggc gtgttgccac aactctcgat ccacaaatca taaagcctga aaaagtatca
    31321 taataatctg gatttctcta gctcaaaata ctctgctaga ggaacccatc atcgtctcaa
    31381 aggaatgatc tactggggag tcttaagaaa aatagtccac tggggcaact atcaccatgt
    31441 caacataaca atctactaaa gagtcataag taatgagata gtagaaccca atggtcaagc
    31501 tcctctgaag gctcatctca acataactca tcgatactgt gaccaataat gcgaataaat
    31561 atcccttagc tgaataacga aaacggtaac aactctatga gaagacaatc atctccacaa
    31621 cataaaaggg gaaatatgcc ccagtacaac aactagtaca tctggtccgt cctgatgaat
    31681 aaaaaataac tcaatgggga tgtataagaa atctgacacg tactccacta aaatgatgat
    31741 atgggagtct atgtgcttga gataactcca tcacagaatc acgacaatat caaaaagtat
    31801 gagcctgact gagtgactca agaaatgctc cactaatcat cgtaaaataa aagcagatca
    31861 tcaactcgac atgtatctcg taaatgggta tgatcatgca aatcaatgga gatctacaaa
    31921 tctcaaccaa aacggaaata taccctagta tggcatcaga tatgtggtag gtcagaaaat
    31981 tagatggcac ctaatcatcc atcaccgggt gtgtaatcct agttatccat gtcgacaact
    32041 aaataagatc cgcatatcaa agaagcgtga tgatatctaa atgtcgaaaa gtatgagctt
    32101 gattgaatag cccaaaagag actccactgg gggatcatga taagataaca atagactatc
    32161 aactcgacat gcatctcgtg agtgatgagg atcatgtgac tccatgaaga tctacaaatc
    32221 tcaaccgaaa gggaaatatg ctccggtatg acatcaaacg tatggtagat tggaaaatcg
    32281 gacaaactca aatcatccat cgtcaaatgc gtgatcccaa tcatccaaat ccacagctaa
    32341 aatgaatcca catatcaaaa gacgtctctc agaagaagaa gcatgaggac atctaaatat
    32401 aaaaaagtgt gggtctgact gaatggccta agagaggctc cactagggaa tcatgataag
    32461 ataacaatag accatcatct cgacatgtat cttgtgagtg atgagaatca tatgactcta
    32521 tgaagatcta aaaatctcaa ccgaaaggaa aatatgcccc aatatgacat caaatgtatg
    32581 gttgatcgga aatcggacaa cctcaaatca tccatcatca aatgtgtgat cccaataatc
    32641 caaatccaca gctaaaatga atccacatat taaaaggcat ctcttagaag aagaagcatg
    32701 aggacatcta aatatcaaaa agtgtgggcc tgactgaatg ggccaagaaa ggctccacta
    32761 ggggatcatg ataagataat ggtagaccat caactcaaca tgcatctcgt gagtgatgag
    32821 gatcatgtga ctctatgaag atctacaaat ctcaaccaaa agggaaatat gccctagtat
    32881 gacatcaaat gtatggtaga tcaaaaaaat cggacaacat cggatcatcc atcatcaaat
    32941 gtgcaatcct agtcatctat atccacaact gaatcgggtc caaacatcaa agaggtgtct
    33001 cccaaaagaa gaagcatgat gatatataaa tatcaaccaa atctcaaata cctatccaag
    33061 taagggttgt cgaagacaac atttgatccc atggcctcag ggtggtctta agacatggga
    33121 cgtaatgtag gctagagtga taaggtaata aaaatgaagg gaaactaggc ccaaataccc
    33181 aatgataaaa aaaaacccat gctctcatgt ataaaatgca aaatgtatag aaaaacttgt
    33241 gagccatgga cctaagggtg cctaatgtga atataatatc aataatgaga caatgaagca
    33301 aatcaaacta ataatgagat acgcaagaat gatgcaaggg aaatatcaaa cctagaatag
    33361 gctagtgtaa gaaatgaaca agagg
//