LOCUS       AM236080             5057142 bp    DNA     circular BCT 06-FEB-2015
DEFINITION  Rhizobium leguminosarum bv. viciae chromosome complete genome,
            strain 3841.
ACCESSION   AM236080
VERSION     AM236080.1
DBLINK      BioProject:PRJNA344
            BioSample:SAMEA1705944
KEYWORDS    complete genome.
SOURCE      Rhizobium leguminosarum bv. viciae 3841
  ORGANISM  Rhizobium leguminosarum bv. viciae 3841
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
REFERENCE   1  (bases 1 to 5057142)
  AUTHORS   Crossman L.C.
  JOURNAL   Submitted (21-FEB-2006) to the INSDC. Crossman L.C., Pathogen
            Sequencing Unit, The Wellcome Trust Sanger Institute, Hinxton,
            Cambridge, Cambridgeshire, CB10 1SA, UNITED KINGDOM.
REFERENCE   2
  AUTHORS   Young J.W., Crossman L.C., Johnston A.W.B., Thomson N.R.,
            Ghazoui Z.F., Hull K.H., Wexler M., Curson A.R.J., Todd J.D.,
            Poole P.S., Mauchline T.H., East A.K., Quail M.A., Churcher C.,
            Arrowsmith C., Cherevach A., Chillingworth T., Clarke K.,
            Cronin A., Davis P., Fraser A., Hance Z., Hauser H., Jagels K.,
            Moule S., Mungall K., Norbertczak H., Rabbinowitsch E., Sanders M.,
            Simmonds M., Whitehead S., Parkhill J.
  TITLE     The genome of Rhizobium leguminosarum has recognizable core and
            accessory components
  JOURNAL   Genome Biol. 7(4), R34-R34(2006).
   PUBMED   16640791
FEATURES             Location/Qualifiers
     source          1..5057142
                     /organism="Rhizobium leguminosarum bv. viciae 3841"
                     /strain="3841"
                     /mol_type="genomic DNA"
                     /country="United Kingdom"
                     /db_xref="taxon:216596"
     CDS             complement(join(5056183..5057142,1..72))
                     /transl_table=11
                     /gene="hemE"
                     /locus_tag="RL4742"
                     /product="putative uroporphyrinogen decarboxylase"
                     /EC_number="4.1.1.37"
                     /db_xref="EnsemblGenomes-Gn:RL4742"
                     /db_xref="EnsemblGenomes-Tr:CAK10225"
                     /db_xref="GOA:Q1MA15"
                     /db_xref="InterPro:IPR000257"
                     /db_xref="InterPro:IPR006361"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MA15"
                     /protein_id="CAK10225.2"
                     /translation="MSDTGRKIMRVLSGESLSPPPLWLMRQAGRYLPEYRETRAKAGS
                     FLDLCYTPEHAVEVTLQPIRRYGFDAAILFSDILVIPDAMKRNVRFTEGHGPEMDPID
                     EAGIGSLNGEEVVDYLRPVLETVRRLREELPAETTLLGFCGAPWTVATYMIAGHGTPD
                     QAPARLFAYKHARAFEHLLMLLADVSADYLVAQIDAGADAVQIFDSWAGVLGEKEFEA
                     FAIRPVARMIASVKSRRPHARIIAFAKGAGYQLKTYRQKTGADAIGLDWSVPLAFAAE
                     LQKDGPVQGNLDPMRVVAGGRALEEGIDDILQHLGNGPLIFNLGHGITPQADPEHVRL
                     LVDRVRGGA"
     CDS             474..1295
                     /transl_table=11
                     /locus_tag="RL0001"
                     /product="conserved hypothetical protein"
                     /product="Hypothetical UPF0085 protein R00001."
                     /db_xref="EnsemblGenomes-Gn:RL0001"
                     /db_xref="EnsemblGenomes-Tr:CAK05489"
                     /db_xref="GOA:Q1MNF6"
                     /db_xref="InterPro:IPR005177"
                     /db_xref="InterPro:IPR026565"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MNF6"
                     /protein_id="CAK05489.1"
                     /translation="MENRTNFFHLHLISDSTGETLISAGRAASAQFRSAQPIEHVYPL
                     IRNRKQLLPVLQAIDDAPGIVLYTIVDRELASLIDERCIEMGVASVNVLEPVMNAFQI
                     YLGAPSRRRVGAQHVMNAGYFARIEALNFTMDHDDGQMPDDYNDADVVIIGISRTSKT
                     PTSIYLANRGIKTANIPIVYGVPLPESLFVASKPLIVCLIATTDRISQVRENRVLGVT
                     QGFDREHYTDRAAISEELKYARSLCARHNWPLIDVTRRSIEETAAAIVALRPKLR"
     CDS             1329..1928
                     /transl_table=11
                     /locus_tag="RL0002"
                     /product="putative septum formation protein"
                     /db_xref="EnsemblGenomes-Gn:RL0002"
                     /db_xref="EnsemblGenomes-Tr:CAK05490"
                     /db_xref="GOA:Q1MNF5"
                     /db_xref="InterPro:IPR003697"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MNF5"
                     /protein_id="CAK05490.1"
                     /translation="MTPKLILASSSPFRRMLMENAGLSFEAHAARIDERAVEAPLENA
                     GAKPDAVALVLARAKAEEVSSRFPDSLVIGSDQTMSLGDSVFHKPTDLADAASHLQAL
                     SGVTHRLNSAVAIVSDGVVLWEHLAHAQLTMRPLTVEFIARHLARVGERALSSVGAYQ
                     LEGEGIQLFEKIEGDYFTILGLPMLPLLKKLRELGAIDG"
     CDS             1921..2778
                     /transl_table=11
                     /locus_tag="RL0003"
                     /product="putative shikimate dehydrogenase"
                     /db_xref="EnsemblGenomes-Gn:RL0003"
                     /db_xref="EnsemblGenomes-Tr:CAK05491"
                     /db_xref="GOA:Q1MNF4"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR011342"
                     /db_xref="InterPro:IPR013708"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022893"
                     /db_xref="UniProtKB/TrEMBL:Q1MNF4"
                     /protein_id="CAK05491.1"
                     /translation="MGDSRETFGPKAFVTGFPIKHSRSPLIHGYWLKTLGLLGSYRAH
                     EVTPEAFADFIHSLKDGSSGFTGGNVTIPHKELAFRLADKPDALSQELGASNTLWRED
                     GALHATNTDGRGFIANLDERHPGWDRHGTAVVFGAGGASRAIIQAVRDRGFKEIHVVN
                     RTVERARELADRFGPRVQAHPAGALVEVMKGAGLFINTTSLGMDGEPAPQLDFSPLAA
                     DAVVTDIVYVPLKTPILAQAEEQGFPIVDGLGMLLHQAVPGFEKWFGQRPIVDAPLRA
                     LIIADMEAH"
     CDS             2778..3389
                     /transl_table=11
                     /locus_tag="RL0004"
                     /product="putative dephospho-CoA kinase"
                     /db_xref="EnsemblGenomes-Gn:RL0004"
                     /db_xref="EnsemblGenomes-Tr:CAK05492"
                     /db_xref="GOA:Q1MNF3"
                     /db_xref="InterPro:IPR001977"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MNF3"
                     /protein_id="CAK05492.1"
                     /translation="MLKIGLTGSIGMGKSTAAKLFADAGIPVNDSDAVVHDLYAGEAA
                     PLVNAAFPGTMKDGAVDRRELGRQLALDPDGFKCLEAIVHPLVRKRETEFLKRQRATG
                     ADMVLLDIPLLFETGAEARVDVVVVVSTDPQIQRQRVLAREGMTEEKFDMILSRQTPD
                     AEKRRRADYLIDTSHSIATTRERVFEIVADLKTRIAKGDFRNA"
     CDS             3382..4104
                     /transl_table=11
                     /locus_tag="RL0005"
                     /product="putative DNA polymerase subunit"
                     /db_xref="EnsemblGenomes-Gn:RL0005"
                     /db_xref="EnsemblGenomes-Tr:CAK05493"
                     /db_xref="GOA:Q1MNF2"
                     /db_xref="InterPro:IPR006054"
                     /db_xref="InterPro:IPR006309"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:Q1MNF2"
                     /protein_id="CAK05493.1"
                     /translation="MREIIFDTETTGLDNRADRIIEIGGIELFNHFPTGNTIHIFINP
                     GDQKVHPDALAVHGITDEFLKDKQPFAEVAEQILTFFGDAKWIAHNATFDMGFINAEF
                     ARIGLPPILPERVLDTLSMARRKHPMGPNSLDALCRRYGIDNSHRTKHGALLDSELLA
                     EVYIEMIGGRQAALGLGMVGKSNQAARGEMGMEDDVVIAALLERPRPLAPRLSQTEEQ
                     AHEALVAKLGEKSVWAKYANLD"
     CDS             complement(4172..4654)
                     /transl_table=11
                     /gene="secB"
                     /locus_tag="RL0006"
                     /product="putative SecB protein export protein"
                     /db_xref="EnsemblGenomes-Gn:RL0006"
                     /db_xref="EnsemblGenomes-Tr:CAK05494"
                     /db_xref="GOA:Q1MNF1"
                     /db_xref="InterPro:IPR003708"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MNF1"
                     /protein_id="CAK05494.1"
                     /translation="MADDNNSNGAANPTLSILAQYTKDLSFENPGAPRSLQARDKAPT
                     ININVNVNANPLSDTDFDVVLSLNAEAKDGDKTVFHAELTYGGVFRVAGFPQEHMLPV
                     LFIECPRMLFPFARQIIADVTRNGGFPPLMIDPIDFTQMFAQRVAEEQARAKVQAVPN
                     "
     CDS             complement(4756..5271)
                     /transl_table=11
                     /locus_tag="RL0007"
                     /product="putative transmembrane FxsA-family protein"
                     /db_xref="EnsemblGenomes-Gn:RL0007"
                     /db_xref="EnsemblGenomes-Tr:CAK05495"
                     /db_xref="GOA:Q1MNF0"
                     /db_xref="InterPro:IPR007313"
                     /db_xref="UniProtKB/TrEMBL:Q1MNF0"
                     /protein_id="CAK05495.1"
                     /translation="MTDMRFSILPAFILLLPFAEIAGFVVVGQAIGLWLTLVLVMLGF
                     VLGVVLLRRQGIGILRRMSSEGRNGVMPGRDLLRPAMNVIASLLLIIPGFLTDIIAIL
                     ILIPPVRDLVWRAIAKRFVVVNAKGGSSSGPQPDFRDRKPNSKVVDLEEEDYHREPDR
                     NSPWSGRHLGD"
     CDS             5394..6098
                     /transl_table=11
                     /locus_tag="RL0008"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0008"
                     /db_xref="EnsemblGenomes-Tr:CAK05496"
                     /db_xref="GOA:Q1MNE9"
                     /db_xref="InterPro:IPR007379"
                     /db_xref="InterPro:IPR016985"
                     /db_xref="InterPro:IPR032710"
                     /db_xref="UniProtKB/TrEMBL:Q1MNE9"
                     /protein_id="CAK05496.1"
                     /translation="MSSNDFITLFFLVAAVLIFFQLRSVLGRRTGNEKPPRDLYTPRD
                     AAPAEAADAGKVVTLPRRDATTEDEDRFAAIDAFAAPGTPLNESLRALNKADPAFSPK
                     EFLNGARMAYEMIVMAYADGDRKTLKNLLSREVYDGFDAAIGEREARGEKVKSTFVGI
                     DKAEITHAETKGSEAQITVRIASQLISATYDKADVLIEGDAENVAEVNDVWTFARDTR
                     SRDPNWKLVATESEHE"
     CDS             6091..7209
                     /transl_table=11
                     /gene="mltA"
                     /locus_tag="RL0009"
                     /product="putative membrane-bound lytic murein
                     transglycosylase a precursor"
                     /db_xref="EnsemblGenomes-Gn:RL0009"
                     /db_xref="EnsemblGenomes-Tr:CAK05497"
                     /db_xref="GOA:Q1MNE8"
                     /db_xref="InterPro:IPR005300"
                     /db_xref="InterPro:IPR009009"
                     /db_xref="InterPro:IPR010611"
                     /db_xref="InterPro:IPR026044"
                     /db_xref="UniProtKB/TrEMBL:Q1MNE8"
                     /protein_id="CAK05497.1"
                     /translation="MSDHASDFVLQAISFDTLEGWKDDDPSGLFEVMRSCRRQITDVK
                     PYRTGSLGLSSEDLLPLLAAAEDFTPSSPASARAFFETHCRPFLIRRNDGNSGFVTAF
                     YEPDIDVSERPDEIFRFPFYRRPDDLIDLDDANRPAGLDKAYAFGRLHEGHVTAYPDR
                     RAIDQGFLEGRGLEIAWAKSKVDVFFVHVQGAARLRYQDGRIGRITYAAKAGHAFSAI
                     GKLLIERGEIDRAEISMQAIRAWLARNPERVDEVLWHNRSYIFFRDAPVADPQAGPIA
                     AAKVPLLAGRSLAVDRTIHTFGFPFFIRAESLTHLDQGRPFRRLMLALDTGSAIVGPA
                     RGDIFTGSGDIAGESAGTVRNQADFVILIPNAAAGRFD"
     CDS             7209..7775
                     /transl_table=11
                     /locus_tag="RL0010"
                     /product="putative Smr domain protein"
                     /db_xref="EnsemblGenomes-Gn:RL0010"
                     /db_xref="EnsemblGenomes-Tr:CAK05498"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="UniProtKB/TrEMBL:Q1MNE7"
                     /protein_id="CAK05498.1"
                     /translation="MARDRKLSADERILWGKVARSTRPMPGKAGALTELDAFLAEAEA
                     AAEREQEKRTPATPTPLQPTAPSMAKPSAGVHHPLEKPVKRKIAKGRLALEARIDLHG
                     LVQSEAHTILLDFLIRAHERSMRHVLVITGKGSSMGSDGALKRAVPLWFSKPEFRYLI
                     SSYESAAQHHGGEGALYIRLSRRHGERP"
     CDS             7772..8149
                     /transl_table=11
                     /locus_tag="RL0011"
                     /product="putative transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0011"
                     /db_xref="EnsemblGenomes-Tr:CAK05499"
                     /db_xref="GOA:Q1MNE6"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="UniProtKB/TrEMBL:Q1MNE6"
                     /protein_id="CAK05499.1"
                     /translation="MTPFGEAVRRLRARKGVSQKEMAEALNVSPAYLSALEHGKRGLP
                     TFDLLQRIAGYFNIIWDEAEELFLLARSSDPRVVIDTSGLPPEYTEFANRLARRIRNL
                     DSAEIGRLSALLENGGKGDGKAS"
     CDS             8285..10720
                     /transl_table=11
                     /gene="gyrB1"
                     /locus_tag="RL0012"
                     /product="putative DNA gyrase subunit B"
                     /db_xref="EnsemblGenomes-Gn:RL0012"
                     /db_xref="EnsemblGenomes-Tr:CAK05500"
                     /db_xref="GOA:Q1MNE5"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR011557"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="InterPro:IPR013759"
                     /db_xref="InterPro:IPR013760"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018522"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q1MNE5"
                     /protein_id="CAK05500.1"
                     /translation="MSDTSATENGVSTEYGADSIKVLKGLDAVRKRPGMYIGDTDDGS
                     GLHHMVYEVVDNAIDEALAGHADIVTVTLNPDGSVTVTDNGRGIPTDIHTGEGVSAAE
                     VIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSVWLKLKIRRHDKIHEMSFTHGVA
                     DAPLKVTGDAPNETGTEVSFMPSTDTFTMTEFDYGTLEHRLRELAFLNSGVRILLTDK
                     RHSDIKQEELRYDGGLEAFVAYLDRAKKSLVDKPVAIHGEKDGITVEVAMWWNDSYHE
                     NVLCFTNNIPQRDGGTHMAGFRAALTRQVVSYADSSGITKREKVTLQGEDCREGLTAV
                     LSVKVPDPKFSSQTKDKLVSSEVRPVVESLVNEALNTWFEEHPSEAKILVGKVVEAAA
                     AREAARKARELTRRKGALDIASLPGKLADCSERDPTKSEVFLVEGDSAGGSAKQGRSR
                     ENQAILPLRGKILNVERARFDKMLSSQEIGTLITALGTGIGKDEFNVEKLRYHKIIIM
                     TDADVDGAHIRTLLLTFFFRQMPQLIERGHLYIAQPPLYKVSRGKSVQYLKDEKALEE
                     YLISQGLEDASLRLGSGEVRAGQDLREVILDALRMRALLDNLHSRYNRSAVEQAAIAG
                     ALNAELASDPARALALANEVAGRLDIIAEETERGWRGDVTTDGGLRLERMVRGVRELV
                     VLDMALIGSSDARHIDQLTARLKEIYQTPPSLHRREGDIEISGPRALLDAIFASGRKG
                     LTMQRYKGLGEMNAEQLWETTLDPNVRSLLQVRVNDATDADGLFARLMGDEVEPRREF
                     IQDNALSVANLDI"
     CDS             complement(10828..11427)
                     /transl_table=11
                     /locus_tag="RL0013"
                     /product="putative oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:RL0013"
                     /db_xref="EnsemblGenomes-Tr:CAK05501"
                     /db_xref="GOA:Q1MNE4"
                     /db_xref="InterPro:IPR000415"
                     /db_xref="InterPro:IPR029479"
                     /db_xref="UniProtKB/TrEMBL:Q1MNE4"
                     /protein_id="CAK05501.1"
                     /translation="MTKSNHRESDYPIDPMFLDRWSPRAFTGEIIEEAQLLGLLDAAH
                     WAPSSANHQPWRFIYGLKGSEHWEIFVALLNDSNQEWARNASALIFVVSRAFTGAAGS
                     TEEKPSYTHSFDAGAAWGHLAIQARLSGLYAHGMGGIKHEEIRQAFAIPEGYRVEAGV
                     AIGRLADKSVLSERNQAREFPSQRKPLSEVAFNGRFVAN"
     CDS             complement(11473..11769)
                     /transl_table=11
                     /locus_tag="RL0014"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0014"
                     /db_xref="EnsemblGenomes-Tr:CAK05502"
                     /db_xref="InterPro:IPR014543"
                     /db_xref="UniProtKB/TrEMBL:Q1MNE3"
                     /protein_id="CAK05502.1"
                     /translation="MEFEMHLSKAVVRTEHASRYLQQLCKHWSHKFSVDFDPLKGRVP
                     FSETAEVTFAADDAALTMTLSVADSSQQERMQHVIDDHLKRFAFREELDIVWTN"
     CDS             11922..12887
                     /transl_table=11
                     /locus_tag="RL0015"
                     /product="putative glutathione-S-transferase"
                     /db_xref="EnsemblGenomes-Gn:RL0015"
                     /db_xref="EnsemblGenomes-Tr:CAK05503"
                     /db_xref="GOA:Q1MNE2"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR016639"
                     /db_xref="UniProtKB/TrEMBL:Q1MNE2"
                     /protein_id="CAK05503.1"
                     /translation="MRMLVNGKWTEDWQPVQAKDEKGGFVRQTSSFRNWVTPDGSAGP
                     TGEAGFAASAGRYHLYVAYICPWASRTLIGRKLKGLEDIISVSVVEPLLGKQGWRFGD
                     YPGATEDHVNGVTYMHEIYTRAAPDFTGRATVPILWDKQKTTIVNNESADILRMLNSG
                     FGGLAKNPIDLYPAVRCTEIEAFNDRIYPDLNNGVYRAGFATTQIAYEEAFADVFACL
                     DWVEQQFEGRTFLFADHPTESDIRLFVTLVRFDVAYHGIFKCNLRRLSDYANLRAFCR
                     RMLDWPGIGETVNLDHIKRGYYSIESLNPTKIIPSGPDLAEIFRA"
     CDS             13031..13873
                     /transl_table=11
                     /locus_tag="RL0016"
                     /product="putative FAA hydrolase family protein"
                     /db_xref="EnsemblGenomes-Gn:RL0016"
                     /db_xref="EnsemblGenomes-Tr:CAK05504"
                     /db_xref="GOA:Q1MNE1"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="UniProtKB/TrEMBL:Q1MNE1"
                     /protein_id="CAK05504.1"
                     /translation="MKLMRVGEAGSEKPALLDADGKIRDLSGHVADIGGEAIGPAGLA
                     KIAAIDPKSLPELVPGRIGACVAGTGKFICIGLNYSDHAAETGATVPPEPIIFMKATS
                     AIVGPNDNVIIPRGSEKTDWEVELGVVIGKTAKYVTEAEALDYVAGYCVSNDVSERAF
                     QTERSGQWTKGKSCDTFGPIGPWLVTKDEIPEPQNLGMWLTVNGQKMQNGSSKTMVYG
                     VAFLVSYLSQFMSLHPGDVISTGTPPGVGMGLKPPRYLKSGDVVELGIEGLGTQKQTF
                     VADR"
     CDS             14079..15356
                     /transl_table=11
                     /locus_tag="RL0017"
                     /product="putative PHB depolymerase"
                     /note="Codons 60 to the C-terminus are similar to codons
                     255 to the C-terminus of Azospirillum brasilense PHB
                     depolymerase phaZ UniProt:Q92TD3 (EMBL:SME591782) (603 aa)
                     fasta scores: E()=3.2e-80, 57.471% id in 348 aa, and
                     entire protein is similar to Rhizobium meliloti
                     (Sinorhizobium meliloti) Hypothetical protein SMc02770
                     UniProt:Q92TD3 (EMBL:SME591782) (424 aa) fasta scores:
                     E()=7.2e-138, 76.000% id in 425 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0017"
                     /db_xref="EnsemblGenomes-Tr:CAK05505"
                     /db_xref="InterPro:IPR009656"
                     /db_xref="InterPro:IPR010915"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q1MNE0"
                     /protein_id="CAK05505.1"
                     /translation="MFYQLYELNHAAMAPFRAAADIMRFAYANPLNPFSHTPFGRTMA
                     ASLEMFERTTRRYGKPEFGLKQTTIGDKTVSVREEVVWSRPFCNLLHFARNAPAARGN
                     DPRILIVAPMSGHYATLLRGTVEALLPSADIYITDWIDARMVPMTEGTFDFDDYIDYV
                     IEMLHFLGHDTHVVAVCQPSVPVLAAAAVMEEARDPLSPASMTLMGGPIDTRINPTAV
                     NKLAQERSLQWFSDNVIMNVPWPQPGFVRPVYPGFLQLSGFMSMNLDRHLVAHKEFFM
                     HLVKNDGEPERHRDFYDEYLAVMDLTAEFYLQTVEEVFIKHSLPKGELMHRGKRVDPT
                     AIRNVALLTVEGENDDISGVGQTMAAQTICVNIPEDMRMHYLQPDVGHYGVFNGSRFR
                     REIAPRIIDFVRQHSRSAVKPQIPRVIKGGRTG"
     CDS             15502..15936
                     /transl_table=11
                     /locus_tag="RL0018"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:RL0018"
                     /db_xref="EnsemblGenomes-Tr:CAK05506"
                     /db_xref="GOA:Q1MND9"
                     /db_xref="InterPro:IPR021273"
                     /db_xref="UniProtKB/TrEMBL:Q1MND9"
                     /protein_id="CAK05506.1"
                     /translation="MNQSALLRPDWTPATIALMILGFMVFWPLGLAMLAYIIFGDRLR
                     GFKRDVNEATDGFFASCRRPHGRHRPHFSTGNVAFDDWRKAELDRMEEERRKLDEMRE
                     EFDSYLRELRRAKDQEEFDRFMRDRRNAKRDDNGPVAEYQTP"
     CDS             16044..16802
                     /transl_table=11
                     /locus_tag="RL0019"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0019"
                     /db_xref="EnsemblGenomes-Tr:CAK05507"
                     /db_xref="InterPro:IPR002725"
                     /db_xref="UniProtKB/TrEMBL:Q1MND8"
                     /protein_id="CAK05507.1"
                     /translation="MFSLLKTRSKARKPAPPEMRTLDVAGRLMPLTIKQHDRATRITL
                     RIEPGGRALKMTVPKGLAAREVNAFLDRHQGWLLTKLAKFSTDTGLRDGGEILLRGVS
                     HRIQHSGSLRGLTEAVSIDGRPVLRVSGMPEHVGRRIAAFLKKEARADLARLATMHAA
                     TIRAPIRSISMKDTRSRWGSCSSEGNLSFSWRIVMAPPSVIDYLAAHEVAHLKEMNHG
                     PHFWALCRKLCPGMEEAKSWLKRHGSQLHAIDFD"
     CDS             16969..17637
                     /transl_table=11
                     /locus_tag="RL0020"
                     /product="putative N-(5'-phosphoribosyl)anthranilate"
                     /db_xref="EnsemblGenomes-Gn:RL0020"
                     /db_xref="EnsemblGenomes-Tr:CAK05508"
                     /db_xref="GOA:Q1MND7"
                     /db_xref="InterPro:IPR001240"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MND7"
                     /protein_id="CAK05508.1"
                     /translation="MRPDIKICGLKTPEAVDRALKRGATHIGFIFFEKSPRYIEPDLA
                     AKLAEPARGKAKIVAVVVDPTNDELDEIVSLLKPDMLQLHGNESPEHVLTIKALYGLP
                     VMKVFSVRTADDLKRVEAYIGIADRFLFDAKAPKGSELPGGNGISFDWSLLSWLDGSV
                     DYMLSGGLNKDNVAEALFVTKAPGIDVSSGVETAPGVKSVAKIDEFFDAVEKANAPMM
                     ASGS"
     CDS             17640..18860
                     /transl_table=11
                     /gene="trpB"
                     /locus_tag="RL0021"
                     /product="putative tryptophan synthase beta chain"
                     /EC_number="4.2.1.20"
                     /db_xref="EnsemblGenomes-Gn:RL0021"
                     /db_xref="EnsemblGenomes-Tr:CAK05509"
                     /db_xref="GOA:Q1MND6"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR006653"
                     /db_xref="InterPro:IPR006654"
                     /db_xref="InterPro:IPR023026"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MND6"
                     /protein_id="CAK05509.1"
                     /translation="MNETPKPNSFRSGPDEDGRFGIYGGRFVAETLMPLILDLQDEWN
                     RAKNDPAFQAELKHLGAHYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINN
                     CIGQILLAKRMGKTRIIAETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFR
                     MKLLGAEVKPVTAGSGTLKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPEMVRDFQS
                     VIGIEAKEQMLAAEGRLPDLVIAAVGGGSNAIGIFHPFLDDPSVKIVGVEAGGKGLQG
                     DEHCASITAGSPGVLHGNRTYLLQDSDGQIKEGHSISAGLDYPGIGPEHSWLNDTGRV
                     DYVPIMDHEALEAFQTLTRLEGIIPALEPSHAIAEVIKRAPTMGKDEIILMNLSGRGD
                     KDIFTVGKILGMGL"
     CDS             18864..19703
                     /transl_table=11
                     /gene="trpA"
                     /locus_tag="RL0022"
                     /product="putative tryptophan synthase, alpha subunit"
                     /product="Tryptophan synthase alpha chain (EC 4.2.1.20)."
                     /db_xref="EnsemblGenomes-Gn:RL0022"
                     /db_xref="EnsemblGenomes-Tr:CAK05510"
                     /db_xref="GOA:Q1MND5"
                     /db_xref="InterPro:IPR002028"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018204"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MND5"
                     /protein_id="CAK05510.1"
                     /translation="MTARMDKRFAELKAEGRPALVTYFMGGDPDYDTSLGIMKALPEA
                     GSDIIELGMPFSDPMADGPAIQLAGQRALKGGQTLKKTLQLAADFRKTNDATPIVMMG
                     YYNPIYIYGVEKFLDDALLAGIDGLIVVDLPPEMDDELCIPAIRKGINFIRLATPTTD
                     EKRLPKVLKNTSGFVYYVSMNGITGSALPDPSLVSGAVERIKQHTKLPVCVGFGVKTA
                     EHAKVIGGSADGVVVGTAIVNQVATSLTHDGKATADTVQAVATLVRGLSTGTRSARLV
                     AAE"
     CDS             19845..20750
                     /transl_table=11
                     /locus_tag="RL0023"
                     /product="putative acetyl-coenzyme A carboxylase carboxyl
                     transferase subunit"
                     /product="Acetyl-coenzyme A carboxylase carboxyl
                     transferase subunit beta (EC 6.4.1.2) (ACCase beta
                     chain)."
                     /db_xref="EnsemblGenomes-Gn:RL0023"
                     /db_xref="EnsemblGenomes-Tr:CAK05511"
                     /db_xref="GOA:Q1MND4"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR000438"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MND4"
                     /protein_id="CAK05511.1"
                     /translation="MNWITNYVRPRINSMLGRREVPENLWIKCPETGEMVFHKDLEGN
                     KWVIPASGYHMKMPAKARLADLFDNGEFESLPQPKVAQDPLKFRDSKKYSDRLRDSRL
                     KTEQEDTILAGVGKVQGLKLVAVVHEFNFIGGSLGMAAGEAIVKAFERATAEKCPLVM
                     FPASGGARMQEGILSLMQLPRTTVAVDMLKESGQPYIVVLTNPTTGGVTASYAMLGDI
                     HLAEPGAEIGFAGKRVIEQTLREKLPEGFQTAEYLLEHGMVDMVVKRHDIPETLARLL
                     KILTKKPVSAANDMNGGAIALAASA"
     CDS             20778..22130
                     /transl_table=11
                     /gene="folC2"
                     /locus_tag="RL0024"
                     /product="putative FolC bifunctional protein [Includes:
                     Folylpolyglutamate synthase (EC 6.3.2.17)
                     (Folylpoly-gamma-glutamate synthetase) (FPGS)"
                     /product="Dihydrofolate synthase (EC 6.3.2.12)]."
                     /db_xref="EnsemblGenomes-Gn:RL0024"
                     /db_xref="EnsemblGenomes-Tr:CAK05512"
                     /db_xref="GOA:Q1MND3"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="InterPro:IPR018109"
                     /db_xref="UniProtKB/TrEMBL:Q1MND3"
                     /protein_id="CAK05512.1"
                     /translation="MIPRGQTAVSEAAQEIDKLMGLHPKGFDLSLDRITRLLDVLGNP
                     HRKLPPVIHVAGTNGKGSVTAFCRALLEAGGYSAHVHTSPHLVNWHERYRIGVKGGRG
                     QLVDDAVFAEAVRRVADANAGQHITVFEILTAVTFILFSEHPADAAIIEVGLGGRFDA
                     TNVISDPAVSVIMPISLDHQPYLGDRVELIAAEKAGIMKPGFPVVIGHQEYDAALDVL
                     MSTAERLHCPSAVFGQDFMAHEEYGRLVYQDEFGLADLPLPRLPGRHQYANAAAAIRA
                     VKAAGFTVTETMMEKAMSSVEWPGRLQRLSEGRLLSHAPAGAEIWIDGGHNPGAGEVI
                     AEAMANFEERQSRPLFLIIGMINTKDPVGYFKAFAGLVEKVFCVPIRGSEAMIDPVIL
                     SNAAYDAGLVAEPMSTVGDALEAIKAVADPEALPPRILVGGSLYLVGDVLADNGTPPK
                     "
     CDS             complement(22203..22523)
                     /transl_table=11
                     /locus_tag="RL0025"
                     /product="putative thioredoxin"
                     /note="Similar to entire protein of Rhodobacter
                     sphaeroides (Rhodopseudomonas sphaeroides) Thioredoxin
                     (TRX) trxA (104 aa) fasta scores:E()=1.7e-21, 57.692% id
                     in 104 aa, and similar, but truncated at the N-terminus,
                     to Agrobacterium tumefaciens (strain C58/ATCC 33970)
                     Thioredoxin C-1 trxA (133 aa) fasta scores: E()=1.1e-35,
                     91.509% id in 106 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0025"
                     /db_xref="EnsemblGenomes-Tr:CAK05513"
                     /db_xref="GOA:Q1MND2"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:Q1MND2"
                     /protein_id="CAK05513.1"
                     /translation="MATVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEI
                     AVEMEGKVKVAKLNIDENPELAAQFGVRSIPTLAIFKGGEVADISVGAKPKTALSNWI
                     SSAA"
     CDS             complement(22599..26150)
                     /transl_table=11
                     /locus_tag="RL0026"
                     /product="putative ATP-dependent UvrD family DNA helicase"
                     /db_xref="EnsemblGenomes-Gn:RL0026"
                     /db_xref="EnsemblGenomes-Tr:CAK05514"
                     /db_xref="GOA:Q1MND1"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR014151"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MND1"
                     /protein_id="CAK05514.1"
                     /translation="MSDVTALPNDDDPGAWIGWTTIQQAIASDPLRSAWVSANAGSGK
                     THVLTQRVIRLLLSGARPSAILCLTYTKAAASEMSNRVFERLAEWVVLDDEDLSRRIT
                     QIEGMAPDGLKLAEARRLFAKALETPGGLKIQTIHAFCEALLHQFPLEANVAGHFSVL
                     DDRAAVALLSDARRALLTATAPDEDSALAEAFAYVLNLGDESGLENLLGDIVANRNAI
                     RRFTAAAEQQGGVEMVLRKRLGLAVGDTEDRIEAQYWPLPELSGSVLELYLSLADQKG
                     GAKAQEVAYGLRLAGRERDDARRAQFLEKIFLTVKGEPKADSQFFVKAMLAEAPQLAE
                     AIAIARAHVAASRDRLKLMRMYGATHAALVLADRLNHDYEELKKQRSQLDFEDLITRT
                     ADLLTKSGVGPWIHYKLDRGIDHILVDEAQDTSPIQWSVIQSLAEDFFSGESARPIVR
                     TLFAVGDEKQSIYSFQGARPERFSEESDRTRRRVSDSGQSFSSVRLPLSFRSTADVLE
                     AVDHIFKTPENARGLSALGEPVVHRSSRIGHPGAVDLWEMIAPEAVVKEEDWTAPFDA
                     TPESAPAAILARRIAHSIGTLVGRETIVDKGKERLIEAGDILVLVRKRDAFVNALTRA
                     LKRRGDIPVAGADRLVLTSHIAVQDLLALGRFLLLPEDDLSLAAVLKSPLFDLSEDDI
                     FAIAALRGDNESFWSHLRSFAADGTELFRAAVERLELFLRQSRSLSVHDFYARVLGSY
                     GGRRQFLARLGTEVSDILDEFLTFTLDHESSGLPGLQSFISTLELEAPVMKREQDKGR
                     NEVRIMTVHASKGLEAPIVFLVDGGSKAFTHTHLPKLRLIETRPDEPPMPVWVPVSDL
                     ANSLTQDDAARIQMLAEEEYRRLLYVAMTRAADRLVVCGYRGVRVNNDTWHMMISTAL
                     HDDHPHVEATTFSGSDGEWPGIKWRVPRVERSFERIDRSQERGSEETLPDGLLRPLPP
                     QAELPRPLSPSGAGTIIDEDEGGLLVVSPLFGEKEHSDRSLEKGRLIHRMLQALPEIP
                     LAERPDAASRYAERAARFWPEVERRKLVDSVLKLLDEEGLQAVLGAQAQPEVSIMGTL
                     TLEDRRYAVSGRIDRLAVLADRVVILDYKTNRVPPATEEAIPFAHRAQLAIYREILTP
                     LYPDKLIDCMLVYTENASLYTLSEKALGLALAAVKTK"
     CDS             complement(26143..29334)
                     /transl_table=11
                     /locus_tag="RL0027"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0027"
                     /db_xref="EnsemblGenomes-Tr:CAK05515"
                     /db_xref="InterPro:IPR014153"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MND0"
                     /protein_id="CAK05515.1"
                     /translation="MAERQQPRILTIPAGLPFLKMLATTLCDGRLTPLFRHEADDPLS
                     LAKVTIYLPTRRAVRVLRSEFVDLLGGRSAILPVIRPLGETDDDSGYFDEVLPATIDL
                     AQPLSNTARLLELARLILAWRNKLPEIVRHIHSDSPLVAPASPADAIWLARNLAELID
                     SIETEDLDWSELSKLDTGDYAAWWQLTAEFLQIASAFWPQRLSELGKSSPARHRNAIL
                     RAEASRLSATKPAGPIIIAGSTGSVPATADLIAAVAHLPEGVIVLPGLDLSMPERHWQ
                     MVAPEPAPGQHANPASRSHPQYGLSVLLKRLKLTRADVTLLDRPEADLERRAEILSRA
                     LAPAEATSDWGAWKNDLPAGALTSAFSDISLIEAANEREEATAIAIALRLALERPGQD
                     SESRAALITPDRNLARRVMAELSRFGILADDSAGTPLSAMPQGTLLQLLLEAALRPGD
                     PVAIVSLLKHPLARFGLERGALISATEALELLALRGGVAEVDISTLEPLLAHQLAEQA
                     LDRHAPQWRKALSPEAADAAYDLARRVAQATEPLASALMRHRPEDRGRTTRFTLSEWA
                     ERTGRSLEAVAVDPQGNLADLWSNEAGDALAALLGEVIDTDGQMEADGPQWIDIMAAL
                     AAGHAVKPRALSHPRLFIFGTLEARLQSVDTLILGGLNEGTWPGQTANNPFIPRMMKT
                     EIGLEPPERRIGQLAHDFEMANGTRHLIYSRALRQGSTPTVASRWLQRLLALGGEAFE
                     AELKGRGNRFLQWAALIDRGEAQAPAQRPSPKPPLALQPKSYSFSEVGRLRRDPYAIY
                     ARRILRLDPVDPFNRDPGAAERGTLYHKIIDRFIREAHIAGTPDAAAAMEHVLSELFD
                     MEKLPPHIDAVWRPRFRAVARAFLEWEAGRRHGILKTLTEVRGGMELEPINIRLTGVA
                     DRIDITGPHSADIIDYKTGYNPSPAQARVLLDPQLALEAAALSAGAFRDAGSLVPQEL
                     LYVRLRPGSRFQVDTVNNESSARSDKAKSAMDLAAESIDQLVKFVGLLQSSERGFTSR
                     LIPAQQFDFGGDYDHLARVSEWSTAETEESGDE"
     CDS             complement(29338..30069)
                     /transl_table=11
                     /locus_tag="RL0028"
                     /product="putative nucleotidyltransferase protein"
                     /db_xref="EnsemblGenomes-Gn:RL0028"
                     /db_xref="EnsemblGenomes-Tr:CAK05516"
                     /db_xref="GOA:Q1MNC9"
                     /db_xref="InterPro:IPR025877"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q1MNC9"
                     /protein_id="CAK05516.1"
                     /translation="MTIRQAMVLAAGLGTRMRPITDTIPKPLVKIDGKPMIDYALDSL
                     VAAGVERAVVNVHHFADQMLDHLGKYHGLDIVISDERDALMNSGGGLAKGLRLLNRDN
                     IFVMNADLFWIGEQQGRPTNLQRLAGFFNAERMDMALLCVGIEDTTGHNGKNDFSLAA
                     DGQLTRYRDDPSNPVVYAGAIVMNPSLLDDAPKDAFNLNIYFDKAIARGRLFGMVLEG
                     HWLTVGTPEAIGEAEETIRRLRAFA"
     CDS             complement(30083..31600)
                     /transl_table=11
                     /locus_tag="RL0029"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0029"
                     /db_xref="EnsemblGenomes-Tr:CAK05517"
                     /db_xref="GOA:Q1MNC8"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR003442"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR012180"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MNC8"
                     /protein_id="CAK05517.1"
                     /translation="MTTGDAISLFLKDEAATIRLGEDLALALKAGDCLALSGDLGAGK
                     SSLARAILRAMADDEGLEVPSPTFTLVQSYDLRIAVSHFDLYRLGDPAELTELGFDEA
                     LQNGICLVEWPEMAQSELPAERIALTLAHEGSGRRATIEAAGAQNTRIRRVLAIRDFL
                     DTAGYPAAKRRFLTGDASLRAYEAIYPKAENQRIILMDWPPLAEGPPVLDGKPYPKVA
                     HLAENAYPFVAIADALRKDGFAAPEVYKVDYNKGILLIEDLGSEGVLDAHGQPVIERY
                     RESVACLARLHALKFPQHIPVGKRHVHHIPDFDRTAMKMEVRLVLDWHLPWKRQGAPA
                     TEVERTEYLAIWDALIDELATAEKNLLLRDFHSPNIIWRERESGIRKIGLIDFQDAMI
                     GPTAYDLASIVQDARVTIEPGLFRQLMDDYLGLRRAQGSFDEDGFMRAWAIMSAQRNC
                     KLAGLWVRLLQRDGKPGYLKHMPRTLSYLNVALEHETLAPLRDWCTRAGIGQSES"
     CDS             complement(31597..34182)
                     /transl_table=11
                     /locus_tag="RL0030"
                     /product="putative two-component sensor histidine kinase
                     transcriptional regulatory protein"
                     /note="Similar, but truncated at the N-terminus, to
                     Caulobacter crescentus Sensor protein divL (769 aa) fasta
                     scores: E()=1.4e-66, 31.950% id in 795 aa, and entire
                     protein is similar to Agrobacterium tumefaciens (strain
                     C58/ATCC 33970) Two component sensor kinase (AGR_C_44p)
                     (881 aa) fasta scores:E()=0, 70.905% id in 795aa"
                     /db_xref="EnsemblGenomes-Gn:RL0030"
                     /db_xref="EnsemblGenomes-Tr:CAK05518"
                     /db_xref="GOA:Q1MNC7"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="UniProtKB/TrEMBL:Q1MNC7"
                     /protein_id="CAK05518.1"
                     /translation="MSELKSSLPGQADDGARADRRPLMAGQGYKSATAHEAAKQEHGP
                     LARFLKSCAAGTALATLARPALAQAEQQAAATAHLFTSSQVVGVSVVIGVISAALLST
                     LWLVRQRGNLENESREIRSALSDAQQRISQYQALIADKNRRIVIWDGNARPELLGQLP
                     PETGAPQDGEFLAFGLWLKSRSASELEKAIDRLRDEAQSFDMVVETIRDEILEAQGRV
                     SGGRAFVRFVALNNLRAELAELRIERDRLMTSISAFQTMLDAIDMPAWQRDPVGRLTW
                     VNQAYGEAVEARSPQQAINEGREMLTTVARERIRATTTPESPFHDKISTVVRGNRTFF
                     DVVDVRVPGGSAGIAIDVSDIEAVRAELERTLKSHAETLDHLATPVAIFDGDRRLQFY
                     NQAFVALWELDIAFLEGRPDNSELLERLRAAKKLPDQLNWKSWKEAALSVYRALDTQS
                     DLWHLPNGQTLRVFATAHPQGGATWVFENLTEQVDLETRYNTLVKVQGETIDHLSEGV
                     AVFGPDGRIRLSNPAFRALWGITETEAKPGTHIRALGEACTPSYDRPDGWKTFAELIT
                     SFDDERRSGQGTLELFSGLVLDYAVIPLPNAQTMLTFVNMTDSVRAERALTEKNEALR
                     KADELKNDFVQHVSYELRSPLTNIIGFTDLLRTPGVGPLTERQAEYIDHISTSSSVLL
                     TLVNDILDLATVDAGIMRLNYADIDLNDLLDDVSMQIADRLHESGVALEITAPAYLGS
                     IVADPQRLKQILLKLLSNAANFSPEGTSISLECHREGTDFVFAVSDRGPGISPDMIAT
                     VFDRFATGAKSGKRGGAGLGLSIVDSFVSLHHGDVTIDSEPGKGTTVVCRIPSVDVPH
                     SAAAE"
     CDS             complement(34386..35786)
                     /transl_table=11
                     /locus_tag="RL0031"
                     /product="putative S-adenosyl-L-homocysteine hydrolase"
                     /db_xref="EnsemblGenomes-Gn:RL0031"
                     /db_xref="EnsemblGenomes-Tr:CAK05519"
                     /db_xref="GOA:Q1MNC6"
                     /db_xref="InterPro:IPR000043"
                     /db_xref="InterPro:IPR015878"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020082"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MNC6"
                     /protein_id="CAK05519.1"
                     /translation="MSTEKDYVVADIGLADFGRKEITIAETEMPGLMSCRTEFGQTKP
                     LKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAASGVPVFAI
                     KGESLEDYWVYTDKIFQWADGGLSNMILDDGGDATMYILLGARAEAGEDVLSHPHSEE
                     EEILFAQIKKRLAASPGWFTKQRDAIKGVTEETTTGVNRLYQLSQKGLLPFPAINVND
                     SVTKSKFDNKYGCKESLVDGIRRGTDVMMAGKVAVVCGYGDVGKGSAASLSGAGARVK
                     VTEADPICALQAAMDGYEVVLLEDVVSSADIFITTTGNKDVIRIDHMRAMKDMAIVGN
                     IGHFDNEIEVAALRNLKWTNVKPQVDLIEFPKGNRIILLSEGRLLNLGNATGHPSFVM
                     SASFTNQTLAQIELFTKPDQYSNQVYILPKHLDEKVARLHLDKLGVKLTELSEEQAAY
                     IGVSPKGPFKSDHYRY"
     CDS             complement(35943..36218)
                     /transl_table=11
                     /locus_tag="RL0032"
                     /product="putative PTS phosphocarrier protein HPr"
                     /db_xref="EnsemblGenomes-Gn:RL0032"
                     /db_xref="EnsemblGenomes-Tr:CAK05520"
                     /db_xref="GOA:Q1MNC5"
                     /db_xref="InterPro:IPR000032"
                     /db_xref="InterPro:IPR001020"
                     /db_xref="UniProtKB/TrEMBL:Q1MNC5"
                     /protein_id="CAK05520.1"
                     /translation="MTSLSRELLIINKRGLHARASAKFVQMVETFDAAITVSKDGMTV
                     GGTSIMGLMMLAASPGSSVVVSASGSQAEEALEALDQLIQNRFGEEM"
     CDS             complement(36228..36629)
                     /transl_table=11
                     /locus_tag="RL0033"
                     /product="putative PTS phosphotransferase system component
                     IIA"
                     /product="PTS system, mannose-specific IIAB component
                     (EIIAB-Man) (Mannose-permease IIAB component)
                     (Phosphotransferase enzyme II, AB component) (EC 2.7.1.69)
                     (EIII-Man)."
                     /note="Similar to the N-terminus to codon 135 of
                     Escherichia coli mannose-specific IIAB component, manX,
                     PTS system (322 aa) fasta scores: E()=3.7e-05, 30.645% id
                     in 322 aa, and similar to entire protein of Agrobacterium
                     tumefaciens (strain C58/ATCC 33970 PTS system, IIA
                     component (133 aa) fasta scores: E()=1.8e-40, 85.714% id
                     in 133 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0033"
                     /db_xref="EnsemblGenomes-Tr:CAK05521"
                     /db_xref="GOA:Q1MNC4"
                     /db_xref="InterPro:IPR004701"
                     /db_xref="UniProtKB/TrEMBL:Q1MNC4"
                     /protein_id="CAK05521.1"
                     /translation="MIGLVLVTHGKLAEEFRHAVEHVVGPQKFIETVCIGPEDDMDQR
                     RQDILEAVSGADDGHGVVILTDMFGGTPSNLAISVMSSGHTEVIAGVNLPMLIKLAGV
                     RGENNMEKALVEASEAGRKYINVASRVLSGK"
     CDS             complement(36780..37232)
                     /transl_table=11
                     /locus_tag="RL0034"
                     /product="putative PTS phosphocarrier protein HPr"
                     /db_xref="EnsemblGenomes-Gn:RL0034"
                     /db_xref="EnsemblGenomes-Tr:CAK05522"
                     /db_xref="GOA:Q1MNC3"
                     /db_xref="InterPro:IPR011104"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MNC3"
                     /protein_id="CAK05522.1"
                     /translation="MTEAGFNVHATAIVVGKTGLLFSGPSGWGKSMLAFTCMTEARRL
                     GLFTALVADDQVLLSAEAGAVIATCPPSITGLIELRGTGIVHQDHIPKATMHYAVLPG
                     SATGENRIPPEGEMVSLAADFSLPALRLLTGVCSPLAILMAKVPDIGR"
     CDS             complement(37229..39019)
                     /transl_table=11
                     /locus_tag="RL0035"
                     /product="putative two-component regulator sensor
                     histidine kinase transcriptional regulator"
                     /product="Sensor protein chvG (EC 2.7.3.-) (Histidine
                     kinase sensory protein exoS)."
                     /db_xref="EnsemblGenomes-Gn:RL0035"
                     /db_xref="EnsemblGenomes-Tr:CAK05523"
                     /db_xref="GOA:Q1MNC2"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR025908"
                     /db_xref="InterPro:IPR025919"
                     /db_xref="UniProtKB/TrEMBL:Q1MNC2"
                     /protein_id="CAK05523.1"
                     /translation="MAQLVQERDLDDAEGVSTRRVRGRRWSHPFTLIRRIFGNAVFSS
                     LTRRILFFNLVALVVLVGGILYLNQFREGLIDARAESLLTQGEIIAGAVSASASVDTN
                     SITIDPQKLLELQAGQSITPVPNDEDLEFPIDPEKVAPVLRRLISPTRTRARIFDADA
                     NLLLDSRHLYSRGQVLRFDLPPVEEEKQTWSEWFATLFNKALQPGNLPLYKEAPGGDG
                     SIYPEVMNALTGVRGAVVRTTEKGELIVSVAVPIQRFRAVLGVLLLSTQAGDIDNIVH
                     AERLAIMRVFGVATLVNVLLSLVLSSTIANPLRRLSAAAIRVRRGAKTREEIPDFSAR
                     QDEIGNLSIALREMTTALYDRIDAIESFAADVSHELKNPLTSLRSAVETLPLARSDDS
                     KKRLMDVIQHDVRRLDRLISDISDASRLDAELARVDAGSVDMEVLLRDLIEVSRQVRS
                     TKKQVEIEYAIERKPNVKTRFVVNGHDLRIGQIIANLIENARSFVPEKGGKITVRLVR
                     TRSRCVTTIEDNGPGIQAENIDRIFERFYTDRPEAEGFGQNSGLGLSISRQIAEAHGG
                     SLRAENITDAESGHILGARFILSLPIGAAA"
     CDS             complement(39204..39938)
                     /transl_table=11
                     /locus_tag="RL0036"
                     /product="putative two-component response regulator
                     transcriptional regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:RL0036"
                     /db_xref="EnsemblGenomes-Tr:CAK05524"
                     /db_xref="GOA:Q1MNG3"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="UniProtKB/TrEMBL:Q1MNG3"
                     /protein_id="CAK05524.1"
                     /translation="MPTIALVDDDRNILTSVSIALEAEGYKVETYTDGASALDGLLAR
                     PPQLAIFDIKMPRMDGMELLRRLRQKSDIPVIFLTSKDEEIDELFGLKMGADDFITKP
                     FSQRLLVERVRAVLRRASSREAAAAGTSPTGAPKNGAVQQARSLERGQLVMDQERHTC
                     TWKGEAVTLTVTEFLILHSLAQRPGVVKSRDALMDAAYDEQVYVDDRTIDSHIKRLRK
                     KFKMVDTDFDMIETLYGVGYRFREAA"
     CDS             40276..41886
                     /transl_table=11
                     /gene="pckA"
                     /locus_tag="RL0037"
                     /product="putative phosphoenolpyruvate carboxykinase"
                     /product="Phosphoenolpyruvate carboxykinase [ATP] (EC
                     4.1.1.49) (PEP carboxykinase) (Phosphoenolpyruvate
                     carboxylase) (PEPCK)."
                     /EC_number="4.1.1.49"
                     /db_xref="EnsemblGenomes-Gn:RL0037"
                     /db_xref="EnsemblGenomes-Tr:CAK05525"
                     /db_xref="GOA:Q1MNG2"
                     /db_xref="InterPro:IPR001272"
                     /db_xref="InterPro:IPR008210"
                     /db_xref="InterPro:IPR013035"
                     /db_xref="InterPro:IPR015994"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MNG2"
                     /protein_id="CAK05525.1"
                     /translation="MEMFGVHNPAIELATVGLGGAASVRYNFSAAALYEEAIRRGEAE
                     LTAQGALRAITGQHTGRSPRDKFVVRDINTDGEIWWDNNKPISPEHFAVLRDDMLAHA
                     AGKELFVQDLVGGAEEGHALPTRVVTEFAWHSLFIRNLLIRPDTAALSSFVPKLTIID
                     LPSFKADPARHGCRSETVIACDLTNGLVLIGGTSYAGEMKKSVFTVLNYLLPAKGVMP
                     MHCSANVGPDGDAAVFFGLSGTGKTTLSADPARTLIGDDEHGWSENGIFNFEGGCYAK
                     TIRLSAEAEPEIYATTQRFGTVLENVVLNESREPDFNDGSLTENTRCAYPMDFIPNAS
                     KTGRAGHPKTIIMLTADAFGVMPPIARLTPDQAMYHFLSGYTAKVAGTEKGVVEPEAT
                     FSTCFGAPFMPRHPAEYGNLLKELIGRHGVQCWLVNTGWTGGAYGTGKRMPIKATRAL
                     LAAALSGELGQVEFRADTNFGFAVPVSVHGVDGSILDPRSTWADKAAYDAQAEKLVSM
                     FIANFAKFENHVDGGVRDAAPGVKVAAE"
     CDS             41993..42436
                     /transl_table=11
                     /locus_tag="RL0038"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0038"
                     /db_xref="EnsemblGenomes-Tr:CAK05526"
                     /db_xref="GOA:Q1MNF8"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="UniProtKB/TrEMBL:Q1MNF8"
                     /protein_id="CAK05526.1"
                     /translation="MASDALYIDDRITIAGWELTEQFVLAGGPGGQNVNKVSTAVQLF
                     FNIANSPSLNDRVKTNAIKLAGRRLSKDGVLMIEASRFRSQDRNREDARDRLKELILE
                     AAKPPPPPRKKTRPTKGSVERRLKEKSGRSEVKKMRGRPGGGSGE"
     CDS             42438..43049
                     /transl_table=11
                     /locus_tag="RL0039"
                     /product="putative alkylated DNA repair protein"
                     /db_xref="EnsemblGenomes-Gn:RL0039"
                     /db_xref="EnsemblGenomes-Tr:CAK05527"
                     /db_xref="GOA:Q1MNG1"
                     /db_xref="InterPro:IPR004574"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR027450"
                     /db_xref="UniProtKB/TrEMBL:Q1MNG1"
                     /protein_id="CAK05527.1"
                     /translation="MPELLSGIRHLPGYLDRARQEALVEVIRTVVAEAPLYVPAMPGT
                     GKPMSVRMTNCGPLGWVTDKERGYRYQPTHPATGRPWPDMPQQLLDIWNDVSGYDKPP
                     EACLVNFYSDEARMGLHQDKDEQDLKAPVVSISLGNSCLFRVGGLSRNDRTLSFKLSS
                     GDLVVLGGEGRLCFHGVDRIHPATSTLLKNGGRINLTLRRVNP"
     CDS             complement(43056..44051)
                     /transl_table=11
                     /gene="coaA"
                     /locus_tag="RL0040"
                     /product="putative pantothenate kinase"
                     /product="Pantothenate kinase (EC 2.7.1.33) (Pantothenic
                     acid kinase) (Rts protein)."
                     /db_xref="EnsemblGenomes-Gn:RL0040"
                     /db_xref="EnsemblGenomes-Tr:CAK05528"
                     /db_xref="GOA:Q1MNG0"
                     /db_xref="InterPro:IPR004566"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MNG0"
                     /protein_id="CAK05528.1"
                     /translation="MSIATEIIGVPETLDHFQSESYSPYHFFSSEQWAKFRADTPLTL
                     TSDEVKRLRSMGDPIDLDEVRRIYLSLSRLLSAHVESSQMLFEQRNRFLSLSDVTKTP
                     FVIGIAGSVAVGKSTTARILKELLGRWPSSPKVDLVTTDGFLHPNAVLQREKLMQRKG
                     FPESYDTGAILRFLSAIKAGRPDVKAPSYSHLVYDVLPDEYKIVDRPDILIFEGINVL
                     QSRDLPAGGKIVPMVSDFFDFSIYIDAAEDEIHNWYVTRFMRLRETAFRDPNSYFHRY
                     ASISDAEALEIAEDLWANINLKNLRQNILPTRPRADLILKKGKDHLIEQVALRKL"
     CDS             complement(44048..44371)
                     /transl_table=11
                     /locus_tag="RL0041"
                     /product="putative histidine biosynthesis bifunctional
                     protein"
                     /db_xref="EnsemblGenomes-Gn:RL0041"
                     /db_xref="EnsemblGenomes-Tr:CAK05529"
                     /db_xref="GOA:Q1MNF9"
                     /db_xref="InterPro:IPR008179"
                     /db_xref="InterPro:IPR021130"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MNF9"
                     /protein_id="CAK05529.1"
                     /translation="MSGFSLSDLESIVAERSKAPPEQSWTAKLVAGGQPKAAKKLGEE
                     AIEAVMAAVTGDRDNLTYEAADVLYHLLVVLKIAEIPLENVMAELERRTAQSGLKEKA
                     SRQSS"
     CDS             complement(44389..45177)
                     /transl_table=11
                     /gene="hisF"
                     /locus_tag="RL0042"
                     /product="putative imadazole glycerol phosphate synthase
                     sununit"
                     /db_xref="EnsemblGenomes-Gn:RL0042"
                     /db_xref="EnsemblGenomes-Tr:CAK05530"
                     /db_xref="GOA:Q1MNF7"
                     /db_xref="InterPro:IPR004651"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q1MNF7"
                     /protein_id="CAK05530.1"
                     /translation="MTLKARVIPCLDVKDGRVVKGVNFLNLVDAGDPVEAAKAYDAAG
                     ADELCFLDITASSDNRETIFDVVSRTADQCFMPLTVGGGVRTIADIRKLLLCGADKVS
                     INSAAVSNPDFVTEAADKFGDQCIVVSIDAKRRRTQAVGGDNLSAWEIYTHGGRNATG
                     IDAVEFAQKMVARGAGELLVTSMDRDGTKVGYDLELTRAIADAVRVPVIASGGVGDLD
                     DLVAGVKEGHANAVLAASIFHFGTYSVSEAKHYMSKCGIDMRLD"
     CDS             complement(45178..45924)
                     /transl_table=11
                     /gene="hisA"
                     /locus_tag="RL0043"
                     /product="putative imidazole-4-carboxamide isomerase"
                     /db_xref="EnsemblGenomes-Gn:RL0043"
                     /db_xref="EnsemblGenomes-Tr:CAK05531"
                     /db_xref="GOA:Q1MNC1"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR006063"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR023016"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MNC1"
                     /protein_id="CAK05531.1"
                     /translation="MILFPAIDLKGGQCVRLKLGDMQQATVYNTDPAAQARSFEDQGF
                     EWLHVVDLDGAFAGHSANGDAVEAILKATDNPVQLGGGIRTLDHIEAWLSRGLRRVIL
                     GTVAVRNPDLVIEACRKFPDHVAVGIDAKGGKVAVEGWAEASELGIIELARKFEGAGV
                     AAIIYTDIDRDGILAGINWSSTLELADAVSIPVIASGGLASLDDIRRMLEPDARKLEG
                     AISGRALYDGRIDPKEALALIKAARAKETA"
     CDS             complement(45931..46488)
                     /transl_table=11
                     /locus_tag="RL0044"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:RL0044"
                     /db_xref="EnsemblGenomes-Tr:CAK05532"
                     /db_xref="GOA:Q1MNC0"
                     /db_xref="UniProtKB/TrEMBL:Q1MNC0"
                     /protein_id="CAK05532.1"
                     /translation="MIHDSFPANDGSSRRQNGVSAGDIAEAVLEFYIEGEDDLIGLLA
                     YALYERQKRDFVLSHRKRNAGRSPDEAELAAVNSNYLSTDLRNTLRDRASQILSSYAE
                     TYVEAMEPQIRLTAVNSDALRQVRSIEKSIKRRLGFWRQVRAGFAVTLLLLLLFGAAA
                     IAAVFFQSDIVDAWNALMVPTTLRM"
     CDS             complement(46485..46676)
                     /transl_table=11
                     /locus_tag="RL0045"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:RL0045"
                     /db_xref="EnsemblGenomes-Tr:CAK05533"
                     /db_xref="UniProtKB/TrEMBL:Q1MNB9"
                     /protein_id="CAK05533.1"
                     /translation="MRSMPASRKSGKVFYTLRPSREGLPPFSDIKLPGGTVIRRVDEA
                     IHRKALSNAAKALKERLDR"
     CDS             complement(46921..47571)
                     /transl_table=11
                     /gene="hisH"
                     /locus_tag="RL0046"
                     /product="putative imadazole glycerol phosphate synthase
                     subunit"
                     /db_xref="EnsemblGenomes-Gn:RL0046"
                     /db_xref="EnsemblGenomes-Tr:CAK05534"
                     /db_xref="GOA:Q1MNB8"
                     /db_xref="InterPro:IPR010139"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q1MNB8"
                     /protein_id="CAK05534.1"
                     /translation="MRVAIIDYGSGNLRSATKAFERAAHEAGIDAHIDLTDRAEDVAA
                     ADRIVLPGVGAYADCRRGLDAVPDMAEVLIEAVEKKARPFLGICVGMQLMSSRGLEKT
                     VTHGFGWIPGNVVEMTPDDPALKIPQIGWNTLDLKRQHPLFEGIPTGSQGLHAYFVHS
                     YHLAAENTEDVIATADYGGPMTAFVGRDNMVGAQFHPEKSQKLGLALIANFLRWNP"
     CDS             complement(47574..48059)
                     /transl_table=11
                     /locus_tag="RL0047"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:RL0047"
                     /db_xref="EnsemblGenomes-Tr:CAK05535"
                     /db_xref="GOA:Q1MNB7"
                     /db_xref="InterPro:IPR024399"
                     /db_xref="UniProtKB/TrEMBL:Q1MNB7"
                     /protein_id="CAK05535.1"
                     /translation="MTSSYIFLTPPGGTSATADETRTIRDGFTLLGFLFPWIWLLAHR
                     LWLHAAAAFLLQGIGGALMDEPGLGPAGAAILLGVNMLVGLEGQNFRVRNLAAKGWNE
                     DALIAADTIGTAEQVYFSDRAAIAASDDAAAPDWQNKARPNGQHGNATSLGLFGFDGG
                     R"
     CDS             complement(48082..48690)
                     /transl_table=11
                     /gene="hisB"
                     /locus_tag="RL0048"
                     /product="putative histidine biosynthesis bifunctional
                     protein hisB"
                     /EC_number="4.2.1.19"
                     /note="Similar to C-terminus from codon 160 of Escherichia
                     coli. hisB HIS7_ECOLI (EMBL:E64967) ( Histidine
                     biosynthesis bifunctional protein hisB [Includes:
                     Histidinol-phosphatase (EC 3.1.3.15)) fasta scores: id
                     48.990% dehydratase (EC 4.2.1.19) (IGPD)]. id in ungapped
                     id, and to entire protein of Agrobacterium tumefaciens
                     (strain C58/ATCC 33970). hisB HIS7_AGRT5 (EMBL:AE007946) (
                     Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)
                     (IGPD).) fasta scores: ungapped id 89.286% length=198 id
                     in E(), and to entire protein of Burkholderia multivorans.
                     hisB HIS7_BURML (EMBL:AB091436) (
                     Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)
                     (IGPD).) fasta scores: ungapped id 54.124% length=195 id
                     in E()"
                     /db_xref="EnsemblGenomes-Gn:RL0048"
                     /db_xref="EnsemblGenomes-Tr:CAK05536"
                     /db_xref="GOA:Q1MNB6"
                     /db_xref="InterPro:IPR000807"
                     /db_xref="InterPro:IPR020565"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MNB6"
                     /protein_id="CAK05536.1"
                     /translation="MAETAASRTGSVSRKTNETSISVSVNLDGTGKSTISTGVGFFDH
                     MLDQLSRHSLIDMEIDAKGDLHIDDHHTVEDTGIAIGQAISKALGDRRGITRYASIDL
                     AMDETMTKAAVDLSGRPFLVWNVAFSAPKIGTFDTELVREFFHALAQNAGITLHILNH
                     YGANNHHIAETCFKAVARALRTATEIDPRQAGRVPSTKGTLV"
     CDS             48847..49374
                     /transl_table=11
                     /gene="hslV"
                     /locus_tag="RL0049"
                     /product="putative heat-shock ATP-dependent protease"
                     /product="ATP-dependent protease hslV (EC 3.4.25.-) (Heat
                     shock protein hslV)."
                     /db_xref="EnsemblGenomes-Gn:RL0049"
                     /db_xref="EnsemblGenomes-Tr:CAK05537"
                     /db_xref="GOA:Q1MNB5"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR022281"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MNB5"
                     /protein_id="CAK05537.1"
                     /translation="MTTIITVRKGGKVVMAGDGQVSLGQTVMKGNARKVRRIGKGEVV
                     AGFAGATADAFTLLERLEKKLEQYPGQLMRAAVELAKDWRTDKYLRNLEAMMLVADKS
                     ITLAITGNGDVLEPEHGTTAIGSGGNFALAAALALMDTDKSAEEIARRALDIAADICV
                     YTNHNVVVELLDAEG"
     CDS             49361..49873
                     /transl_table=11
                     /locus_tag="RL0050"
                     /product="putative acetyltransferase"
                     /product="putative Mutant AAC6'-IbY166A
                     6'-N-acetyltransferase."
                     /db_xref="EnsemblGenomes-Gn:RL0050"
                     /db_xref="EnsemblGenomes-Tr:CAK05538"
                     /db_xref="GOA:Q1MNB4"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR019432"
                     /db_xref="UniProtKB/TrEMBL:Q1MNB4"
                     /protein_id="CAK05538.1"
                     /translation="MPKAEPYAFRPLAVADLPLLAEWLESRHVRRWWSDPAKALASME
                     KHIDAASVSCFMVTLSGKDFAFIQAADLDEVDDEALAGQPKGTYGIDQFIGIEELAGK
                     GHGPAFMIGFCNMLFAKGAQRILVDPHPDNAFAIRAYTKAGFQGLGETTTNYGRALLM
                     ALDRQENDTQ"
     CDS             49870..51177
                     /transl_table=11
                     /gene="hslU"
                     /locus_tag="RL0051"
                     /product="putative ATP-dependent heat shock protease
                     component"
                     /db_xref="EnsemblGenomes-Gn:RL0051"
                     /db_xref="EnsemblGenomes-Tr:CAK05539"
                     /db_xref="GOA:Q1MNB3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004491"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MNB3"
                     /protein_id="CAK05539.1"
                     /translation="MTTFSPREIVSELDRYIIGQHDAKRAVAIALRNRWRRQQLDPSL
                     RDEVMPKNILMIGPTGVGKTEISRRLAKLAGAPFIKVEATKFTEVGYVGRDVEQIIRD
                     LVEVGIGLVREKKRAEVQAKAHVSAEERVLDALVGTTASPATRENFRKKLRDGELDDK
                     EIDIEVADAGSGMGGFEIPGMPGANIGVLNLSEMFGKAMGGRTKKVRTTVKASYSDLI
                     RDESDKLIDNEVIQREAVRSTENDGIVFLDEIDKIAARDGGMGAGVSREGVQRDLLPL
                     VEGTTVSTKYGPVKTDHILFIASGAFHVSKPSDLLPELQGRLPIRVELRPLNKDDFRR
                     ILTETEASLIRQYRALMETESLSLEFTDDAIDALADVAVHLNSSVENIGARRLQTVME
                     RVLDDISYNAPDRGGTAVTIDAAYVREHVGDLAQNTDLSRFIL"
     CDS             51470..52417
                     /transl_table=11
                     /locus_tag="RL0052"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0052"
                     /db_xref="EnsemblGenomes-Tr:CAK05540"
                     /db_xref="InterPro:IPR009842"
                     /db_xref="UniProtKB/TrEMBL:Q1MNB2"
                     /protein_id="CAK05540.1"
                     /translation="MRRLLTSLMIAVALVNSAPAFAMQTVPAGNRHAEQPDIPGASIR
                     RTKGTKSSFDLKYEKVHELLATDRELMSKIRKVSSAYGINPIHVVGAIVGEHTYNVDA
                     YDRLQAYYVKAASYAGESFRFAYDGESVDEFVARPQFAECKSKSDSYTLWSCREDVWE
                     TDFRGKTVGGTSFPNNRFSAVFFQPFYAGQTFGLGQVNPLTALMLSDLVTRVSGYPKL
                     NEKNAGAVYRAIMDPDISLAFVAASIRRSIDDYKEIAGMDISGNPGLTATLYNVGNSR
                     QRAAALAAKNRGAGATVWPEENYYGWLINDKLDELKGLL"
     CDS             52466..53878
                     /transl_table=11
                     /locus_tag="RL0053"
                     /product="putative cytochrome P450 protein"
                     /product="Cytochrome P450 4A3 precursor (EC 1.14.15.3)
                     (CYPIVA3) (Lauric acid omega-hydroxylase) (P450-LA-omega
                     3)."
                     /db_xref="EnsemblGenomes-Gn:RL0053"
                     /db_xref="EnsemblGenomes-Tr:CAK05541"
                     /db_xref="GOA:Q1MNB1"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002401"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:Q1MNB1"
                     /protein_id="CAK05541.1"
                     /translation="MDMRPDPFVPPAPLPRTVPPSRLEIIRIILRNPLELWGEPSYTL
                     PWIRTNFFGQRTLIVNDPGLIKHVLVDNANNYRMSDVRQLVLRPILRDGLLTAEGPVW
                     KRSRKAVAPIFTPRHAQGFAGQMLRQSEDYARKYEGAGEAGAIFDISTDMTELTFAIL
                     ADTLFSGEIVTSSGHFADDVNELLHRMGRVDPMDLMRAPSWVPRVTRIGGQKVLEKFR
                     AIVRNTMDMRLAKMKADRSSAPEDFLTLLLEQAGPDGLTKEEIEDNILTFIGAGHETT
                     ARALAWTLYCVSNSPHIREGMEEEIDAVLATGAKPVEWLDMMPQTRAAFEEALRLYPP
                     APSINRAAISDDFWTSPKGERVELEAGVTVLVMPWTLHRHELHWDRPRAYMPERFLPE
                     NRASIGRFQFLPFGAGPRVCIGATFALQEAVIALAVLMHRYRFDSTDQTNPWPVQKLT
                     TQPKNGLPMRVTPRIISTKA"
     CDS             53965..56136
                     /transl_table=11
                     /gene="glcB"
                     /locus_tag="RL0054"
                     /product="malate synthase G"
                     /product="Malate synthase G (EC 2.3.3.9) (MSG)."
                     /db_xref="EnsemblGenomes-Gn:RL0054"
                     /db_xref="EnsemblGenomes-Tr:CAK05542"
                     /db_xref="GOA:Q1MNB0"
                     /db_xref="InterPro:IPR001465"
                     /db_xref="InterPro:IPR006253"
                     /db_xref="InterPro:IPR011076"
                     /db_xref="InterPro:IPR023310"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MNB0"
                     /protein_id="CAK05542.1"
                     /translation="MSRVDKNGLAIETVLHDFLVEEVLPGLAVDADKFFADFSAIVHD
                     LAPKNCALLAKRDELQVKIDDWYRRHGAPADMDEYQSFLREIGYLLPEGSDFQVSTQN
                     VDPEIASIAGPQLVVPVMNARYALNAANARWGSLYDALYGTDAIPESDGAEKGKSYNP
                     KRGEKVIAWVRDFLDTSAPLQDCRWKDVGSFAVKDGALVVRSIDGEQAMLTDGKHFAG
                     YRGDAAAPTHILLKNNGIHIEIVIDAATTIGKADPAHISDVWLESAITTIMDCEDSIA
                     AVDAEDKVVVYRNWLGLMKGDLQEEVAKGGTSFIRTLNPDLQYAGPDGAAFEVHRRSL
                     MLVRNVGHLMISPAILDRDGNEVPEGIMDAAITGLIALYDIGPSGRRKNSRTGSMYVV
                     KPKMHGPEEVAFAVEIFSRVEDALGLPRNTIKMGIMDEERRTTVNLKECIRAARERVV
                     FINTGFLDRTGDEIHTSMEAGPMIRKGDMRQAAWISAYENWNVDIGLECGLAGHAQIG
                     KGMWAMPDLMAAMLEQKIAHPKAGANTAWVPSPTAATLHATHYHRVNVARVQQGLKDR
                     ARAKLSDILSVPVAVRPNWTPEEIQRELDNNAQGILGYVVRWVDQGVGCSKVPDINNV
                     GLMEDRATLRISAQHMANWLHHKVVTEAQIIETMRRMAAVVDRQNASDPAYQPMAGNF
                     DDSIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAKHTA"
     CDS             complement(56207..56890)
                     /transl_table=11
                     /locus_tag="RL0055"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0055"
                     /db_xref="EnsemblGenomes-Tr:CAK05543"
                     /db_xref="GOA:Q1MNA9"
                     /db_xref="InterPro:IPR005490"
                     /db_xref="UniProtKB/TrEMBL:Q1MNA9"
                     /protein_id="CAK05543.1"
                     /translation="MRIRNAFPVFGLLATLALAGCSTTSDSASVDDKGAGPTVQTAQI
                     FNDAYGLTKDAGYSLPAIPIDRVKPQFRRQVVSYQTTERPGTIIVNTRERFLYYILAN
                     GKAMRYGIGVGKQGFAWAGTAYVAWKQEWPNWHPPKEMAVRRPDLAKYVEDGMGPGLS
                     NPLGARAMYLFNEDGKDTLFRLHGTPEWASIGTAASSGCIRLMNQDVIDLYSRVRPGK
                     GTSKVVVIQ"
     CDS             57070..57564
                     /transl_table=11
                     /locus_tag="RL0056"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0056"
                     /db_xref="EnsemblGenomes-Tr:CAK05544"
                     /db_xref="InterPro:IPR009394"
                     /db_xref="UniProtKB/TrEMBL:Q1MNA8"
                     /protein_id="CAK05544.1"
                     /translation="MTILSVYNNNPLIDGRQSDRAMMVRRGTQILLHEMRHAVLPELP
                     LASGRRADLITLSEKGEIWIIEIKTSIEDFRVDRKWPEYRLHCDRLFFATHQDVPLEI
                     FPEECGLFLSDGYGAHMIREAPEHRMAPATRKSVTLNFSRAAAQRLMMAEWANGKPFT
                     VDDV"
     CDS             complement(57585..58163)
                     /transl_table=11
                     /gene="actR"
                     /locus_tag="RL0057"
                     /product="putative two-component response regulator
                     transcriptional regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:RL0057"
                     /db_xref="EnsemblGenomes-Tr:CAK05545"
                     /db_xref="GOA:Q1MNA7"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:Q1MNA7"
                     /protein_id="CAK05545.1"
                     /translation="MTEQNHDNFAASDEDHIGPDASLLIVDDDGPFLRRLARAMETRG
                     FQVETAESVAEGVAKSRGRPPKYAVVDLRLGDGNGLDVIEAIRQRRDDTRIIVLTGYG
                     NIATAVTAVKLGAVDYLAKPADADDVFSALTQRPGEKAELPENPMSADRVRWEHIQRV
                     YEMCERNVSETARRLNMHRRTLQRILAKRAPK"
     CDS             complement(58232..59560)
                     /transl_table=11
                     /gene="actS"
                     /locus_tag="RL0058"
                     /product="putative two-component regulator sensor
                     histidine kinase transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0058"
                     /db_xref="EnsemblGenomes-Tr:CAK05546"
                     /db_xref="GOA:Q1MNA6"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="UniProtKB/TrEMBL:Q1MNA6"
                     /protein_id="CAK05546.1"
                     /translation="MIDKPGMIDKTEGYTLEDRHNSRRLRLQTLVRLRWLAVGGQALT
                     VFIVAFWLKFPLPLVASSSLIAALAWVNFYLTIRYPPTHRLEPPAAFALLGFDLLQLC
                     ALLFITGGLANPFAALVCVPVIISFASQPIRYSTALIGVAMVCITVLAFSPFPLPWFD
                     GVEINVHNVMQFGVWCSIASTMAFAAFYAYRVSMEASQLADALAATELVLQREKHLSQ
                     LDGLAAAAAHELGTPLATISVVAKEMERELKDDDRFREDVMLLRSQSERCRDILRRLT
                     TLSSEGEAHMRRLPLSSMIEEIVAPHREFGIRLELIEKCPRKGEPVTDRNAGIMYGLG
                     NLIENAVDYAREKVIVTVEHDHDKVLIVIEDDGNGYAPDILTRIGEPYVTKRQKEDTA
                     GGLGLGLFIAKTLLERSGASLIFENRDPESAGARIRIEWPRMLIDANSTK"
     CDS             complement(59583..62048)
                     /transl_table=11
                     /gene="helO"
                     /locus_tag="RL0059"
                     /product="putative ATP-dependent helicase protein"
                     /db_xref="EnsemblGenomes-Gn:RL0059"
                     /db_xref="EnsemblGenomes-Tr:CAK05547"
                     /db_xref="GOA:Q1MNA5"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR010225"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR013689"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MNA5"
                     /protein_id="CAK05547.1"
                     /translation="MTISASLPELPVSHVLPVVAAALEKQKRAVLSAPPGAGKTTLVP
                     LYLLGQAWRGDGKIILLEPRRLAARAAASRMASLIGEQVGETVGYRMRLDNRISAATR
                     IEVVTEGVFARMILDDPELTGVSVVIFDEFHERSLDADFGLALALDVQSALREDLRIL
                     VMSATLDVERVAALLDHPPVIESLGRSFPIDIRYQDRPGGERIEDAVTRAILDAHANE
                     TGSILAFLPGQAEITRTVERLQGRFGAETLIAPLYGNLSQKEQDAAIRPASQGMRKIV
                     LATSIAETSITIDGVRIVIDSGLQRLPVFEASTGITRLETVRVSRASADQRAGRAGRT
                     EPGTAVRLWHQGQTAALPAFTPPQILSSDLSGLVLDLAHWGVQDPASLAFVDQPPETT
                     LREARVLLGQLGALDKDGALTARGKVMRDLALPPRLAAMVVSAGEAGQARDAAMIAVL
                     LTEQGLGGTSVDIEERLRRFKVERGERAEASRRLAGRLASGLDRGAATAPALAGQLLL
                     HAFPDRIALQRGGRGRFVMANGRGAELPETERLAGSQMLVIADLTGRAAQARVLAAAE
                     VTRGDIEAELPGEIKTGDQIFFDRQSRQIRARRATRLGAIVFEETPLPRPSGAAVTQA
                     LVEGVRELGLDQLSFSKEAVQLRERIGFLHRTIGEPWPDVSDDALLSRLDEWFAPFQT
                     EARGLSEISAAGLSNGLMSLVPHELQRDLSRLAPTHFEAPTGQRHPIQYEGEEPVLTI
                     RVQELFGLKQHPAIAGGRLPLLLELTSPAHRPIQTTRDLPGFWAGSWKDVRADMRGRY
                     PRHPWPERPEDALPTTRAKPRGT"
     CDS             complement(62045..62992)
                     /transl_table=11
                     /locus_tag="RL0060"
                     /product="putative ornithine cyclodeaminase"
                     /product="Ornithine cyclodeaminase (EC 4.3.1.12) (OCD)."
                     /db_xref="EnsemblGenomes-Gn:RL0060"
                     /db_xref="EnsemblGenomes-Tr:CAK05548"
                     /db_xref="InterPro:IPR003462"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023401"
                     /db_xref="UniProtKB/TrEMBL:Q1MNA4"
                     /protein_id="CAK05548.1"
                     /translation="MLVLDEEQTRAALPWPELIEAIARMFQSECVMPVRHHHEMEVPH
                     EESATLLLMPAWVPGRYAGVKTVSVFPGNVRRGLPAIFGTYLLSSGATGEMLAAIDGG
                     ELTARRTAAASALAARHLARADAEELLVCGTGRLSLNLMLAHGTTRPIKRYRVWGRNG
                     QAAEKIAAEARALGLNAEAVADAEAAARTADIISCATLSSAPLISGEWLKPGAHLDLV
                     GAFKPSMRESDDAAIRRASVYVDTRAGAIAEAGDIVQPLKSGVLKEGDIRAELAELVS
                     GAHGGRSHDAEITLFKSVGAALEDLAGAILAYKTVTGQK"
     CDS             complement(70180..71670)
                     /transl_table=11
                     /locus_tag="RL0061"
                     /product="putative alpha-amylase family protein"
                     /db_xref="EnsemblGenomes-Gn:RL0061"
                     /db_xref="EnsemblGenomes-Tr:CAK05549"
                     /db_xref="GOA:Q1MNA3"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR015902"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q1MNA3"
                     /protein_id="CAK05549.1"
                     /translation="MKQTMSTWPKHPVIYEINTWVWLGEVSRKYQRPVNLSSVPADEW
                     DRIASFGLDAVWLMGVWERSPAGIEISMQNERLLEDFRRALPDFTPEDNVGSPYCVRR
                     YVVDDHLGGPQGLAVARSMLHERGLRLILDFVPNHVAPDHLWVRDQPGYFVQGSDDDA
                     RNDPASFATVGSKVFARGRDPFFPAWPDVLQLNTFSPALRETVVETIAEIAGQCEGVR
                     CDMAMLVLNTIFERTWGDHAGAKPDDDYWSTIIPTIKSRYPEFKFIAEAYWDLEWELQ
                     QQGFDYCYDKKLYDRMEHGDAESVRQHLLADSTYQEKMVRFIENHDEPRAAAAFPLEK
                     ARAAAVAMLTLTGAKLLHEGQFEGATTRLPIFLGRRPVASVDCDLSAFYARLLTAIHG
                     DVFKNGEWRLCETSGWSDNQSCRNILSWCWAKGEARCLIVINFSETASQALVHVPWDE
                     LRGKEWRLDDVLSEDCYDRNGSEIRDVGLHVDLWPWKSSLFELRAR"
     CDS             complement(71667..74426)
                     /transl_table=11
                     /locus_tag="RL0062"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0062"
                     /db_xref="EnsemblGenomes-Tr:CAK05550"
                     /db_xref="GOA:Q1MNA2"
                     /db_xref="InterPro:IPR004888"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR031335"
                     /db_xref="UniProtKB/TrEMBL:Q1MNA2"
                     /protein_id="CAK05550.1"
                     /translation="MDKKLASARTGAETKRLAEARDRGINWKKWGPYLSERQWGTVRE
                     DYSETGDAWNFFTHDHARSRAYRWGEDGIAGISNDKQNLCFALALWNGKDPILKERLF
                     GLTNNEGNHGEDVKEYYFYIDSTPTHSYMKYLYKYPQAVFPYADLVETNGRRSRNEFE
                     YELLDTGVFDDDRYFDVFVEYAKAAPEDILVKITAFNRGPDAANLHLLPTLWFRNDWA
                     SWIAETSRAARKPNLRQIEAAAGQSTVAATDSVGGAFLLSCEGDVPLLFTENETNAER
                     LFPGQRNESLYVKDGINNFVVQGDQNAVNPERQGTKVAAHYRMTIAPGQSATVRLRLS
                     AAKTAQARTAQNGFGKEFDQTLAERLQEADEFYSSLTPSSVSPDAANVMRQAIAGMLW
                     SKQFYFFDGDNWLDEHHSNPLHAGYRHTRNSDWFHMLNEDVISMPDKWEYPWYAAWDL
                     AFHTLPIAIVDPDFAKDQLKLMLRGVYLHPNGQMPAYEWNFGDVNPPVHAFATLFLHR
                     TEQALRGETDVQFLREAFNKLVLNFTWWVNRKDRFGKNVFEGGFLGLDNIGIFDRSAP
                     LPTGGHLEQADGTAWMALFSQNMMELAVELAVHDPTYEDMVVKFAEHFYYIAGAMNQP
                     DKGGMWDEEDGFYYDLLRLPDGSGTRLKVRSMVGLLPLCAATVMEPWQRERIPRAMEQ
                     LAQRMRRMPELQQNIHVTGPGHYGVSDRGMFALVNSERLRRILSRMLDENEFLSSYGI
                     RSLSKVHERDPYVFQVQGQEYRVDYLPSESNTGMFGGNSNWRGPVWMPVNVLIIRALQ
                     NFYLYYGDNFKIECPTGSGKLMNLFEVSKEIADRLGRIFLRDEHGRRAVYGGTEKFQT
                     DPHWRDLVLFYEYFHGDNGAGLGASHQTGWTGLIAKTIQLYGLLDPQKALEVGKQAAF
                     TQNPK"
     CDS             complement(74746..76002)
                     /transl_table=11
                     /locus_tag="RL0063"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0063"
                     /db_xref="EnsemblGenomes-Tr:CAK05551"
                     /db_xref="GOA:Q1MNA1"
                     /db_xref="InterPro:IPR006664"
                     /db_xref="InterPro:IPR006665"
                     /db_xref="InterPro:IPR019207"
                     /db_xref="InterPro:IPR029046"
                     /db_xref="UniProtKB/TrEMBL:Q1MNA1"
                     /protein_id="CAK05551.1"
                     /translation="MFSTQIKMLERREYDRARRKLSESTPGHRGIARQFFLAVAFVVA
                     ANAPSWSQEDEAKHYSKEAMQQALQTRDQYDVYGLRFGVGKSTLQPGAETLLDDIATA
                     LKNFPDWSLRIVGHTDASGNAETNERLSLERANAIKAALVERGVNTDRLLAAGAGQTR
                     PIASNETAEGKALNRRVELVRLTDSAEAKKLLKGMSDYLAAQKTISFAYDANLQVVTN
                     SEQKLGLTSSGTVVLSRPDKVHTTRSGGFVEIEALFDGKTLTLLGKNLNKYTQVDIPG
                     TVDHLIDELKDRYGLPLPAADLLMTNSYDELMQGVYDSKDLGSGVINGAECDSLAFRK
                     DEVDFQIWVAQGAQPYPCRLVITSRMVKGGPEYSVQVRDWKSGDELMPGDFGFKNPTN
                     AEKVNIKDIQSNLGDLPGNFVRGDGK"
     CDS             complement(76906..78225)
                     /transl_table=11
                     /locus_tag="RL0064"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0064"
                     /db_xref="EnsemblGenomes-Tr:CAK05552"
                     /db_xref="InterPro:IPR016883"
                     /db_xref="InterPro:IPR019282"
                     /db_xref="UniProtKB/TrEMBL:Q1MNA0"
                     /protein_id="CAK05552.1"
                     /translation="MPETLSTDADLDRLPTDDDLSRLQFTTVLYYLHCTNPDNGLVRD
                     KTEPNAPASIAAIGMALATIPVVVERGVLIREFAAKITRNRLRYLMACPQGPEPDSSG
                     YKGFFYHFLDIETGRRVWQCELSTIDSAFLFAGALTVATYFDRDTADEAEIRGLATAL
                     YERADWNWARDGGATLTHGWRPESGFIPYRWRGYDEGLLLYIIGLGSPTHPLPPESYA
                     AYTESYEWRNIYGRELLYSGPLFTHQLSHMWIDFRGIRDAFMREHDTDYFENTRHATY
                     VQQEYAIRNPMNFAGYGEHCWGFTACDGPGWGKRTTEGVDREYFDYIARGAPFGPDDG
                     TIAPWVAVASLPFAPEIVVPTVRNFARMNLGMTRLYGFKPSFNQTYAVEKSPTGWWVS
                     PHHFGIDQGPVVLMIENYRTGLLWSIMRRCRPIVTGLRRAGFSAGWL"
     CDS             complement(78231..82121)
                     /transl_table=11
                     /locus_tag="RL0065"
                     /product="putative glycosyl transferase"
                     /note="Similar to codons 1550 to the C-terminus of
                     Rhizobium meliloti (Sinorhizobium meliloti) Protein ndvB
                     (2832 aa) fasta scores: E()=1.1e-136, 40.078% id in 1290
                     aa, and similar to codons 1420 to the C-terminus of
                     uncultured Acidobacteria bacterium Putative cyclic beta
                     1'-2' glucan synthetase (1308 aa) fasta scores: E()=0,
                     45.589% id in 1308 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0065"
                     /db_xref="EnsemblGenomes-Tr:CAK05553"
                     /db_xref="GOA:Q1MN99"
                     /db_xref="InterPro:IPR005196"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR009342"
                     /db_xref="InterPro:IPR010383"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR033432"
                     /db_xref="UniProtKB/TrEMBL:Q1MN99"
                     /protein_id="CAK05553.1"
                     /translation="MATSTADAPRHDSIAELNPSSAVALLSNDRYSVLVTAAGAGYGM
                     WQGLDITRWREDSTRDCWGQFCYVRDLTDNDLWSIGRQPLFRPSNIYEHAFHGNRAEL
                     SCHAGDIEIASKICVAPDVDVEVRMLTVTNHGTRERTLELTSYAEVCLYNRSADMAHP
                     GFAKLFVETQFDEATGALFARRRPRAAGEKATWAVHVSSSNLQPAQAAQYETDRLRFL
                     GRGRTTANPVAFDAGASLSGTTGPVLDPIFCLRRTVRLAPGADARIAFVTGAADDQSA
                     VQLIAKRYAEIDAVEQAFSDASRRYESELQTLGLKPGDISLFNRLAGSVIFANPAMRQ
                     ATDLQRDRWDRAALWAHGISGDLPIVLVRANSDRHHALVRQVTMAHDFARRRGLRFDL
                     ILVDEGGSASAKRLAEKLQSGPQAEMIGKPGGIFILSEPDTGNDHLATIAAAARVVLL
                     GSGGELGDQLNRLSPARSPLSPTFTTRLNEQPAAPLPKPAEDLQYWNGLGGFTADGHE
                     YVVRVDALKPQAPTLPPAPWTNVIANPHFGCLTTEAGLGYTWAENSQMNRLTPWSNDP
                     VTDAPGEVLYLRDEETGDIWTPTPLPLGPGAVVTVRHGQGYSRYTSFSRHLSQELTVS
                     VAPNDPVKIMRLRLSNEDTRVRHVTAIYFAEWVLGTQREQTAARVVCERDARSGAIVA
                     RNPWAGDFAGRLAFAAASQPARSTTSDRTEFLGQYGSVFQPAALGRTDLAERFGPLLD
                     PCAALMVDISLRPNESREIVFVLGQAADLDEVSRLVHEHTDLERAAASLSAVCRQWDD
                     ILNSIQVSTPDTGVNLMMNRWLVYQVLACRMWARTSNYQSGGAYGFRDQLQDVMALVY
                     SVPSEARSHILRSAARQFEEGDVQHWWHPPSGVGVRTRITDDLYFLPLVVHHYVSTTG
                     DVQLLDETVPFITSPVLRDDQEEDFNQPATSEQSGTVYEHCVRALEHGYRLGSHGLPL
                     MGTGDWNDGMNKVGAGGKGESVWNGWLYLTVLKSFAEISASRGDQSRAAWCRERVEAL
                     RIALEANAWDGGWYRRAYFDDGTPLGSSLNDECQIDAIPQAWAVISGEADAERASQAM
                     RAVHDRLVRQEDRLIKLFDPPFDDGVLQPGYIKGYVPGIRENGGQYTHAATWVVWATA
                     LQGDGDLALKLWNLINPIYHGATKDQVERYKVEPYAVAADIYGAPPHTGRGGWTWYTG
                     SASWLYRVALEAILGFRQEGRFLRFEPCVPAGWPAYEIAYRYGSATYRIHFDNSKGIG
                     RGVQSVTLDGELVANESVPLAQDARTHDVHVIIG"
     CDS             complement(82152..84617)
                     /transl_table=11
                     /locus_tag="RL0066"
                     /product="putative xylulose-5-phosphate phosphoketolase"
                     /EC_number="4.1.2.9"
                     /db_xref="EnsemblGenomes-Gn:RL0066"
                     /db_xref="EnsemblGenomes-Tr:CAK05554"
                     /db_xref="GOA:Q1MN98"
                     /db_xref="InterPro:IPR005593"
                     /db_xref="InterPro:IPR018969"
                     /db_xref="InterPro:IPR018970"
                     /db_xref="InterPro:IPR019789"
                     /db_xref="InterPro:IPR019790"
                     /db_xref="InterPro:IPR023962"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q1MN98"
                     /protein_id="CAK05554.1"
                     /translation="MVSLKTARDAKVALHAKMATGGPLSTEELQSIDAYWRASNYLSV
                     GQIYLLDNPLLKEPLRREHIKPRLLGHWGTSPGLNMLYVHLNRVIKRDDLEMIYVIGP
                     GHGGPSLVAHAYLEGTYSEVYPNISQDAEGMKRLFKQFSFPGGIPSHVAPETPGSIHE
                     GGELGYALSHAYGAAFDNPNLIVACVVGDGEAETGPLATGWHGNKFLNPARDGCVLPI
                     LHLNGYKIANPCFLARIPRDELRKFFEGMGYTPYFVEGSDPENVHQQLAGVLDTAVAD
                     IQEIWATARTKGKIKRPMWPMIIFRTPKGWTCPPEIDGKKCEDYWRAHQVPMGDMDKP
                     EHIRILQEWMKSYRPEELFDDSGRFKPGLAALAPVGQRRMSDNPHANGGLLLRDLKMP
                     DFRDYAVSVPSPGQTHTEAARVMGKFLRDIMKMNMDSKNFRLFSPDENNSNRWQDVLE
                     VTDRCYMADIYPEDDHLSPDGRVMEVLSEHQCQGWLEGYLLTGRHGFFSCYEAFIHII
                     DSMFNQHAKWLKVCNDIPWRRSVASLNYFLSSHVWRQDHNGFSHQDPGFIDHVVNKKA
                     DVVRIYLPPDANTLLSVTDHCLRSRNYVNVVVAGKQPAPQWLTMDQAIKHCSEGLGIW
                     EWASNDKGSEPDVVMACCGDVPTLETLAAVELIREHLPELKVRVINVVNLMKLQPPSE
                     HPHGLPDRDFDALFTKNKPIIFAFHGYPWLIHRLTYRRTNHGNLHVRGYKEEGTTTTP
                     FDMVVLNEMDRFHLVEDVIDRLPQLGARAAYFKQAIREKLVEHRQYIEKYGDDMPAIS
                     GWKWGSKAQPKTRQRTSTEGDNA"
     CDS             complement(84994..85662)
                     /transl_table=11
                     /locus_tag="RL0067"
                     /product="putative CBS domain protein"
                     /db_xref="EnsemblGenomes-Gn:RL0067"
                     /db_xref="EnsemblGenomes-Tr:CAK05555"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR007055"
                     /db_xref="InterPro:IPR017080"
                     /db_xref="UniProtKB/TrEMBL:Q1MN97"
                     /protein_id="CAK05555.1"
                     /translation="MLVKDVMITKVVGVSPDNSVRRAAEIMLANHVSGVPVIDDAGRL
                     VGIISEGDLLRRTELGREATAELGTSALTAEEKATAYVRSNAWRVADVMSCDPIVVEG
                     DTSLARVSALMQEHHIKRLPVMRDGVLVGIVSRADLLKAIVTADQDETASGDEAIRRS
                     IATRLSENADLLGKDTTVTVTDGVAHLWGTIDTEECKKAARVAAESVRGVRRVVEHFS
                     EDRR"
     CDS             complement(85775..87463)
                     /transl_table=11
                     /locus_tag="RL0068"
                     /product="putative component of ABC transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0068"
                     /db_xref="EnsemblGenomes-Tr:CAK05556"
                     /db_xref="GOA:Q1MN96"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MN96"
                     /protein_id="CAK05556.1"
                     /translation="MDTQQIPFKVTAVRFVRAVKVFMSSEVGGKAALMFAGLVALFLA
                     LSGLNVANSYVGRNFMTAIANRQTPEFMRQAIFYIGVFAAFTIVAVVSRFIEERLALL
                     WREFLTRRAVSLYLADRAYYHLDVSGQLTHPDQRIAEDMRVFTVTTLSFILMILNSSL
                     TIIAFSGVLWSISPLLFAVAVVYAACGSYLTIALGRPLIKLNYDQLDKEASFRSGLIQ
                     VRENAEGIMLAHCEEQQGFRLLRRLDDAVANFRKVTAINRNVGFFTTGYNWLIQIIPA
                     LIIAPAYIRGNIDFGVITQSGAAFAMLVGAFSLVITQFQSISTFAAVVARLSSLMEAI
                     ERAGTPADAGIEVVEGKERLAYEQLTLLHATNSVPIVKDVSISIPLGTRVLITGPARD
                     AQAALFRATAGISFKGSGRIIRPAADDILFLPQRPYLPTGTLRQILVRNERAGKIPDD
                     RIVQFLRELNLEHVLEQAGGLNTEQNWEILLSPQEQQLLAFINILIAAPQFAFLDRLD
                     ATLGLERLHTIMQMLSESSITYINNAETAALRDYHDAVLECGEDGGWVWTVNRA"
     CDS             complement(87586..89265)
                     /transl_table=11
                     /gene="celD"
                     /locus_tag="RL0069"
                     /product="putative cellulose biosynthesis protein"
                     /db_xref="EnsemblGenomes-Gn:RL0069"
                     /db_xref="EnsemblGenomes-Tr:CAK05557"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q1MN95"
                     /protein_id="CAK05557.1"
                     /translation="MTYGVLGADMRIDIIDTIAGFEAVRENWDQVFMEDPDAQHFLSW
                     IWMKNYLSRRRRWFILALRERDPEAPYVAFFPLRLITHLNEKTGLFYDEIIMAGNFAA
                     DYTGFIVRPDYEHHAIAGFASFLKHQNWTDLKLEYFSGPAGRREKMIEALQGPEVMFR
                     DSSPKNSENIDNTICPIVPLPASFDDYLEQRMSSQTRQKLRRFLRKVEGDDVYRITMA
                     TAETIDRDLDILFNLWRIKWSARKGTERTERLIITTREMLMDSFNCGNLEVPVFWHGD
                     QPLGALANIIDRQKKAILFYITGRDENWKTPSPGLILHGYCIRRAIEHGFKTYDFLRG
                     NEPYKYMFGVEERRISCTLFRTRNGQNLHGVLNPRSIRFVYEQALDMYRNGARSKAEI
                     AFNQVLQSAPGHTGAEFGLANLLFDRGKLTEAQAAYKVLVEQAPDPTPIQMRLGDTQL
                     ALHQYDQAAETFRQIGEIGPHLIQAHYKRGIALAASKRLAEAEAVFAAIQEVHSDDPT
                     ALDYVAKASAALERIRVSAEPAPCKTDAVPETIARWNRGRQLSERRRPRLH"
     CDS             complement(89508..89999)
                     /transl_table=11
                     /locus_tag="RL0070"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0070"
                     /db_xref="EnsemblGenomes-Tr:CAK05558"
                     /db_xref="UniProtKB/TrEMBL:Q1MN94"
                     /protein_id="CAK05558.1"
                     /translation="MAAMSDVLLRVGRLNYVWTNTESLLIYIIAHLLRVEKDAAIVVF
                     LTLNTTRARIDLIERLSKLASTSPSDRKAILSAMSRLKKESKTRNKYNHCIYSFDEKG
                     DISSTQLMRLVEDDKQIRYGKIEQMDAREIEHLEKSIAEIVAISRTLWAFIHASPQIS
                     GEL"
     CDS             complement(90117..91466)
                     /transl_table=11
                     /gene="toaE"
                     /locus_tag="RL0071"
                     /product="putative HlyD family secretion protein"
                     /product="Hypothetical protein expD2."
                     /db_xref="EnsemblGenomes-Gn:RL0071"
                     /db_xref="EnsemblGenomes-Tr:CAK05559"
                     /db_xref="GOA:Q1MN93"
                     /db_xref="InterPro:IPR003997"
                     /db_xref="InterPro:IPR010129"
                     /db_xref="UniProtKB/TrEMBL:Q1MN93"
                     /protein_id="CAK05559.1"
                     /translation="MGRKNRETTGPVQLEWYSDVPRSIRVHSIVGLTVLFTSFGGFGF
                     WAATAPLASAVIAQGSFVATGNNKIIQHLEGGIIKEMRVSEGDTVKEGDILLTLDPTA
                     SRSNERMLQLRRLRLEAVVARLRAEAQGLRQFQLPDIVTKEAGDPDINAIIQSQNVVF
                     HSKQIKLEEQLNLIGKNIASLEFRFVGYRGQRESFERQLSLLTEERDSKARLVKVGYM
                     RKTDLLAIERAIADAMGDIARLNGELNESEAEIAKFRQEAVIAVNSNKQAALDALETA
                     ETDLDSVREQMREAAGVLERTTIRSPVSGTVVRSYFHTAGGVITTGKPIMEILPSHVP
                     LILEAKVLRTSIDQLHEGETASIRLTALNRRTTPVLQGKVFYVSADSIEENAGASVKD
                     VYIVRVGIPDSEIARVHNFHPVPGMPAEVLIQTSERTFFEYLSKPITDSMSRAFKER"
     CDS             complement(91472..93769)
                     /transl_table=11
                     /gene="toaD"
                     /locus_tag="RL0072"
                     /product="putative ATP-binding component of Type I protein
                     secretion system"
                     /note="Similar, but truncated at the N-terminus to
                     Agrobacterium tumefaciens (strain C58/ATCC 33970) ABC
                     transporter, nucleotide binding/ATPase protein (690 aa)
                     fasta scores: E()=3.5e-164, 82.138% id in 683 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0072"
                     /db_xref="EnsemblGenomes-Tr:CAK05560"
                     /db_xref="GOA:Q1MN92"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010128"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MN92"
                     /protein_id="CAK05560.1"
                     /translation="MNQISKQIFAAGSALDLRSGTIPSAAPSEATMTDVCVSAIDEAV
                     ENLRRLSGAAASSPDRPKKTSEAAANEAADIGRASATQAPLPEKMVVPEAKVETAPPV
                     AVAQGLATAKTPEAPARPQIEARVSPEQPKEKIELKSSPTMPFAKTIEGESGPISENN
                     RRMRAGGGGNGKDSDPGGGGGGGGGSGGGFHKRSEPVNFAASLSRGMAAVRHNMVVVM
                     MFTIAINVLLLAIPLYLFQISDRVLTSRSVDTLVMLSIAVIGAVLLQAFMDSVRRFIL
                     MRTAVELEVQLGAPILSAAARASLHGSGKDYQTLQDLQLLRGFLTSGTLIAFLDAPLM
                     PFFVVVVYFVHPHLGIIIMVCCAVLFVIAYLNQKFTARQFAESNGYLSRANFHLDSMS
                     RNSQIINAMAMIPEAVKMWGRETAGSLKSQVEAQDRNIIFSGISKACRMITQVTLLGW
                     GAHLSLSGELTGGMVIAASIISGRALAPIEGAIEGWNQFNRSAAAYSRIKGLLLNSPL
                     NFPRLRLPNPEGRLDVERILFVPPPQKKVILNGISFSLRKGESLAIIGNSGSGKTTLG
                     KMLVGSIVPTSGNVRLDLMDLRNWDQRQFGESIGYLPQDVQLFPGTIKANICRMRDDV
                     DDHQIYDAAVLADVHELIAGFPQGYETIVAADGAPLSGGQKQRIALARAFFGNPKFVV
                     LDEPNSNLDTQGEAALAKALIHAKKQGITTVTITQRPALLQCVDKILVLKDGTVAMFG
                     ERIEVLQALSKNNGNNGQQAPRIEG"
     CDS             complement(93795..95831)
                     /transl_table=11
                     /locus_tag="RL0073"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0073"
                     /db_xref="EnsemblGenomes-Tr:CAK05561"
                     /db_xref="UniProtKB/TrEMBL:Q1MN91"
                     /protein_id="CAK05561.1"
                     /translation="MHIEKISEIIAHFIGLFEMTTDEMRLRTNYAEGAGPGADGPALP
                     DQDAFTAAFSSDLQLKDYDPGINYKSGSYEIEFGPARHFGRVFEESLEKLAAIAGKDI
                     PLPHFGDPTDIVLTDEPELTVFAGPGSAISHVLQVNALYDDDYLDMTDGVHAPRDTSF
                     VIERLADFSTKAEIFTPFASLHRTDTYDGALKVAEDLEVYIQNAQNTEDSGTTSLGTD
                     ATHEFVRLDPGVNDTVYINGKAETDIPVLDDFLPDRGLAKLPEEPDDSNTSVEQDDPS
                     GTSLEVTAGANLVVNVASVINTGVITSVTAVMGNYHQVDAISQAFVYSDNDEIASTLH
                     SSDRSGEAAETIAKNIALFEHSTFEASSHADTDATEPTFPNSWRVSVIDGDVSFVQWI
                     EQYQFVTDNDTMTVITSGSETTVLTGGNTSINFSSFFGMGMQYDLVIIGGNVLDINSI
                     TQISLLYDNDWVRAEDGVDPGADIQTGDNLIWNFASIHNVGTDSPFAAMPDYMAATQK
                     AIEDRDPNMPEGLSFDVNFQGYAGLNVLYITGNLYDMTIIKQVSILGDSDDVTLAAST
                     ILENNPDATVTIDTGSNAVVNIAEIVDYDSFGQTTYLAGQLYSDAILIQGGLVEHDTT
                     QPQPADDRLANEVIAFFDNDDPAGGDCADGVINAGNDFSWSSTHPADVMQAMVA"
     CDS             complement(95973..96929)
                     /transl_table=11
                     /locus_tag="RL0074"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0074"
                     /db_xref="EnsemblGenomes-Tr:CAK05562"
                     /db_xref="UniProtKB/TrEMBL:Q1MN90"
                     /protein_id="CAK05562.1"
                     /translation="MSDDTEITKVGALADGFANSAINSTEIDDDSTGYVGGVANGDNR
                     DNTDNSVDVDVKAEIDVATNNGDNRDNEYDWSYKSDDDTSTKTTTITDTDTKTDYDWS
                     YDSKTYSDNDTDTKTITDTDTKTVTDTDIKTVTETETDTKTVTDSNNTSDSFNKTDTD
                     FAVIEDVKDSNLGVAGHDLTFNLGDDFSFTLDVDSILNNSLTGAGNDSGFSAVQANHL
                     ADQDSAWNTKMENEGAQNHLNANGGTANSAEGMEMDGKSWDLKAGDDANGASTADASA
                     ILANSGFHLELVQGANLLSNTVDSSVIGGNSHTSDVGEDTST"
     CDS             97773..98555
                     /transl_table=11
                     /locus_tag="RL0075"
                     /product="putative GerE family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0075"
                     /db_xref="EnsemblGenomes-Tr:CAK05563"
                     /db_xref="GOA:Q1MN89"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="UniProtKB/TrEMBL:Q1MN89"
                     /protein_id="CAK05563.1"
                     /translation="MFMTGSGMENADQGRKLGSSGDTILVVAKADLFSECMVEALAKK
                     FPNCEVASITSTKPILDKDSSDMKLVLFYHIPGPELHEALQAARENHPETSIGLVVEA
                     IDMLEPYVSRLVEARIIDGVLPLNLRLDVFMAAVDLLMKGGEHFPSALLNRLTNKNAQ
                     LEPSLYQTKSVDAARSNALKLRRDSISALTTREVQILDLICKGTQNKIIADKLHLSEN
                     TVKVHVRNIYKKMNVRNRTEAASRFFNEHPAGEEDMSGRWRN"
     CDS             complement(98571..98891)
                     /transl_table=11
                     /locus_tag="RL0076"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0076"
                     /db_xref="EnsemblGenomes-Tr:CAK05564"
                     /db_xref="UniProtKB/TrEMBL:Q1MN88"
                     /protein_id="CAK05564.1"
                     /translation="MVKKQDAAQLKGRRIRSAMFAWGTALLAIGPTACTVVDDHIAVV
                     AKKNIPVVEAPRVSKAYAYPANRVGRPAAATVRTVAYHGSAPYICSPSGFGQKSRCFA
                     RPPI"
     CDS             99276..100301
                     /transl_table=11
                     /locus_tag="RL0077"
                     /product="putative dTDP-glucose 4-6-dehydratase-like
                     protein (UDP-glucuronic acid decarboxylase)"
                     /db_xref="EnsemblGenomes-Gn:RL0077"
                     /db_xref="EnsemblGenomes-Tr:CAK05565"
                     /db_xref="GOA:Q1MN87"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MN87"
                     /protein_id="CAK05565.1"
                     /translation="MRSFVPSEGYSEVSSGIPVAQALRTVLVNGGGGFLGSHLCERLL
                     QHGHRVICLDNFSTGRRANVDHLASNTRFHIVEHDVRQPFDIEASLIFNFASPASPPD
                     YQRDPVGTLLTNVLGAVNTLDCARKTGAIVVQSSTSEVYGDPIHSPQHESYCGNVNQI
                     GPRGCYDEGKRSAETLFFDYHRTYGVDVKVGRIFNTYGPRMRLDDGRVVSNFIVQALR
                     NADLTIYGDGQQTRSFCYVDDLIEGFLRFSTAGSACNGPINLGNPTEMTVRRLAEIIR
                     DLTNSRSRIVHLPAVTDDPRQRRPDISRAMAELDWQPRIGLETGLARTVDYFDGLLAG
                     TEKAEVV"
     CDS             100303..101286
                     /transl_table=11
                     /locus_tag="RL0078"
                     /product="putative UDP-glucose 4-epimerase (UDP-galactose
                     4-epimerase)"
                     /db_xref="EnsemblGenomes-Gn:RL0078"
                     /db_xref="EnsemblGenomes-Tr:CAK05566"
                     /db_xref="GOA:Q1MN86"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR005886"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MN86"
                     /protein_id="CAK05566.1"
                     /translation="MPRYILVTGGAGFIGSHICKALSRAGMIPVTYDNLSTGHADSVR
                     WGPLIRAELADAAALRRTLAEFSPDCVIHCGANAYVGESVEMPRKYYRNNVVGSLTLL
                     EACLDQDIDRIVFSSSCATYGVPASLPIREESPQHPVNPYGRTKLIFEMALEDFAAAY
                     GIRFAALRYFNAAGADPDGELAERHQPETHLIPRALLAAAGRLERLDIFGTDYATEDG
                     TCVRDYIHVSDLAQAHLAAVNHLLADGGSLSVNLGSGRGTSVREILEAIHRASGREVP
                     VRYRSRRVGDPPILFANTARAKAELGFAPAFSDIDTIIRTAGPTFGLEMRA"
     CDS             101283..103151
                     /transl_table=11
                     /gene="acsAB"
                     /locus_tag="RL0079"
                     /product="putative transmembrane cellulose synthase"
                     /EC_number="2.4.1.12"
                     /db_xref="EnsemblGenomes-Gn:RL0079"
                     /db_xref="EnsemblGenomes-Tr:CAK05567"
                     /db_xref="GOA:Q1MN85"
                     /db_xref="InterPro:IPR025993"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q1MN85"
                     /protein_id="CAK05567.1"
                     /translation="MSSVSQIGHGVRTAKAATVETFDPVFTGWNRVAYGFGILCWLTA
                     LGYFWIWWCQSAHIISWATFVLVTLVLVWITLVPAYFILIFLDARTVSPRAGLPEGRV
                     AMVVTKAPSEPFAVVRTTLQAMLDQIGVDFDVWLADEDPSEETRRWCEEHGVLISTRK
                     GVAEYHRTTWPRRTRCKEGNLAYFYDHFGYARYDFVAQFDADHVPTPTYLREILRPFA
                     DPEIGYVSAPSICDANAGTSWAARGRLYAEASLHGSLQTGYNNGWAPLCIGSHYAVRT
                     SALRQIGGLGPELAEDHSTTLMMNSGGWRGVHAVDAIAHGDGPANFTDLVVQEFQWSR
                     SLVTILLQHSRRHIMHLPWRLRFQFVFSQLWYPLFSVFMAMMFLLPVAALLTGRVFVN
                     VTYPDFLLHFVPMSMVLTLFAFFWRTTATFRPHDAKLLGWEGLAFIFLRWPWSLAGSL
                     AAVRDYICGSFVDFRITPKGRQQQRSLPLRVIAPYIGLAGLSAAAMMFATDAAAAQGF
                     YVFAMMNLSVYLALTVLIVVRHAVENDLPLLPQSRGLWLATATGLAIFVAGGTQAGSH
                     GLRGLEALSHGQTFVSFTETQFAVAGAGLGGGKTRIVKFHLRWNGFGRTGRDEQGA"
     CDS             103148..103711
                     /transl_table=11
                     /locus_tag="RL0080"
                     /product="conserved hypothetical exported protein"
                     /db_xref="EnsemblGenomes-Gn:RL0080"
                     /db_xref="EnsemblGenomes-Tr:CAK05568"
                     /db_xref="InterPro:IPR009337"
                     /db_xref="UniProtKB/TrEMBL:Q1MN84"
                     /protein_id="CAK05568.1"
                     /translation="MSRRNRQVSSMEDVMSIGSRLWGAALALSLCLPVATHGAEVAKT
                     KAPTPLSAYELYRIYGDKTWTWNTGGGRFFYDGRRFVAWSNDKGKPSFAEGRWVVDDL
                     GQLCMRATWTNAEGAARASTCFGHRKIGNTIYQRRQPNGEWYVFRHASVRQGDEFQKL
                     VPTDTVSAKASEVKQILLSQEVARKGG"
     CDS             103715..104686
                     /transl_table=11
                     /locus_tag="RL0081"
                     /product="putative polysaccharide degradation protein"
                     /note="Codons 85 to 235 are similar to codons 65 to 215 of
                     Alcaligenes sp. XY-234 Beta-1,3-xylanase (469 aa) fasta
                     scores: E()=0.00031, 28.105% id in 153 aa, and entire
                     protein is similar to Agrobacterium tumefaciens (strain
                     C58/ATCC 33970) AGR_L_3016p (320 aa) fasta scores:
                     E()=2.7e-82, 66.901% id in 284 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0081"
                     /db_xref="EnsemblGenomes-Tr:CAK05569"
                     /db_xref="GOA:Q1MN83"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR022790"
                     /db_xref="UniProtKB/TrEMBL:Q1MN83"
                     /protein_id="CAK05569.1"
                     /translation="MKKLMKKNLSTAAIALLLLCVADLPGRSEVQYAGIAPNPAAAVR
                     TIIDKRPVLHADGIKFGAYDPHGDFGAQASVATEALFLPWEDVDLETLRVADAYAQAR
                     GRNLLITVEPWSWDVDWRLTSAELRAKVLRGDYDVNMRAIAQMISELKSPVIVRWGQE
                     MEDKSGRFSWSGWSPQDYITAYKRMMDIVRQEAPGTELMWSPKGEPGLQAYYPGDDYV
                     DLVGLSVFGLQRYDELAYNGHRTFSEALKQGYDLVAGYGKPIWVAELGYGGGDAYMKP
                     WIETVALKQSAFPNLQEVVYFNDRDVHAWPFDLGRPDWRVVESLANR"
     CDS             complement(104748..106034)
                     /transl_table=11
                     /locus_tag="RL0082"
                     /product="putative solute-binding component of ABC
                     transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0082"
                     /db_xref="EnsemblGenomes-Tr:CAK05570"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q1MN82"
                     /protein_id="CAK05570.1"
                     /translation="MQVNRRSFLMGSAGAAAGLAFGAGSAIPAFAEDAQLRAMWWGSN
                     DRAKRTLDVAKLYQSKTPGVTIVGESLSGDGYWTKLATQMAGRSIADIFQLEPGTISD
                     YSKRGACMPLDEFVPSTLQVDSFGADMLKLTTIDGKLYGVGLGLNSFSMFFDTVEFEK
                     AGIPVPTPDLTWDEYAKLAVELAKSSGKSGGPYAARYAYVFDAWLRQRGKSLFARESV
                     GLGFTADDAREWFDYWEKLRKAGGTVAADVQTLDQNTIDTNALGLGKSVIGMAYSNQM
                     IGYQLIIKNKLGITMLPREKKGGPSGHYYRPALIWSVGATTKNGEAAAKFIDFFVNDI
                     EAGKILGVERGVPMSPTVREAILPQLNPTEQETVKYVNLLKDQVGEYPPPVPMGATQF
                     DQRVLRPICDELAFERVSPADAATRLIEEGKATIKG"
     CDS             106182..107201
                     /transl_table=11
                     /locus_tag="RL0083"
                     /product="putative LacI family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0083"
                     /db_xref="EnsemblGenomes-Tr:CAK05571"
                     /db_xref="GOA:Q1MN81"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="UniProtKB/TrEMBL:Q1MN81"
                     /protein_id="CAK05571.1"
                     /translation="MNDQKIRRPRQADIATLAGVSVSTVSRVLANEPGISESVRLQIL
                     KVAAENGYPVKPASEAVAGGLALIASDGVTGTLSVFYEAIVDGLRAGAAEAGMPFEVR
                     LVREDRTTPDAVRDYMQTAGAEGLFLVGIDPNESLRDWLQASMTPTVLVNGTDPRMQF
                     DGVSPANFFGAYEATSRLTKAGHRRILHLSGSHRHTIRERVRGFEAAIAAVSGAEGRL
                     VSLALQGSASREAHERTTEALAENAGFTAAFCMNDFIAVGVLEAVTEAGLRVPEDFAI
                     VGFDDLPCAQMTNPQLSTMRVDRAALGREAVSLMLSRFRNRTASARHICQAVAPIPGG
                     TVPNA"
     CDS             107329..109185
                     /transl_table=11
                     /locus_tag="RL0084"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0084"
                     /db_xref="EnsemblGenomes-Tr:CAK05572"
                     /db_xref="InterPro:IPR016624"
                     /db_xref="UniProtKB/TrEMBL:Q1MN80"
                     /protein_id="CAK05572.1"
                     /translation="MTYDPASANPLAGNPLETRADMSRALLALFDPLLACFSKGNARV
                     TLNGGGAHFDRAAADLEGFARPLWGLAPLGAGNGDFAHWHRFAEGLANGTDPAHPEYW
                     GTVNGRDQRMVELAALGFALALVPEKIWEPLDARARGNVVAYLKHARQFDYADNNWKF
                     FRIFVDIALDRLGADFDRSLTRQYLEELEGFYIGDGWYRDGNVRRIDHYIPFAMHFYG
                     LIYSKLVDDDYAKRYRERAVLFARDFRHWFAADGATIPFGRSLTYRFACAGFWSALAF
                     ADVEALPWGEVKHLCLQHLRWWKDKPIADRDGVLSIGFGYPNLLMSESYNSAGSPYWA
                     FKAFLPLAIAEDHPFWTAKEKVPEQAPDIIPQRHPGMVIMRAGGDVVALSSGQENLQM
                     RCGTEKYAKFAYSARYGFSVEADERAFALAAFDSALAFSDDGLHYRVRETNEEAKIAG
                     EVLFAKWSPFADVDVETWLVPAAPWHIRLHRIRTSRPLRIAEGGFAIGRRDFELDTLS
                     ASGGVAYAVGEADFTGILDLGSSVKRSGLVQKAMPNTNVIVAKTLVPQLRGQIPTGET
                     ILVTAVLALDDPAALSSAWARPPKAPDIAALEALVREKGVTVSAIEAPGQMP"
     CDS             109182..110192
                     /transl_table=11
                     /locus_tag="RL0085"
                     /product="putative glycerate dehydrogenase"
                     /note="Codon 70 to the C-terminus are similar to codons 60
                     to the C-terminus of Methylobacterium extorquens. HprA
                     DHGY_METEX (EMBL:MESERCYC) ( Glycerate dehydrogenase (EC
                     1.1.1.29) (NADH-dependent hydroxypyruvate reductase) (HPR)
                     (GDH) (Hydroxypyruvate dehydrogenase) (Glyoxylate
                     reductase) (HPR-A).) fasta scores: E()=2.1e-16 ungapped id
                     39.574% 313 id, and to entire protein of Rhizobium
                     meliloti (Sinorhizobium meliloti). Putative dehydrogenase
                     protein. Q92W31 (EMBL:B95906) (336) fasta scores:
                     E()=2.7e-82 64.881% id in 336 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0085"
                     /db_xref="EnsemblGenomes-Tr:CAK05573"
                     /db_xref="GOA:Q1MN79"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MN79"
                     /protein_id="CAK05573.1"
                     /translation="MSQPAIILAMQPSRTQHVLPDEVLRRLGGIGRLLDSKPLQRFDD
                     ERARRLLAEAEILITGWGGPYVGPEIPTAAPHLKFIVHAAGTVKGVIDDAIFEAGIPV
                     SHSAEANAVPVAEFTLAAIIFAGKRVFRFRDLYVADRNRNRTHLMQREAIGNYRRTVG
                     IVGASRIGRRVIELLKPFDYRLLLSDPTLDAAEAAGLGTEKIDLDELMRQSDIVSLHA
                     PSLPSTQHMIDARRLSLMKDGATLINTARGILIDEAALLSVLKTGRIDAVLDVTDPEI
                     PEAGSAFYDLPNVFLTPHIAGAIGLERARLGEMAVDEIERFVTGQPLLYQIHQANLAN
                     IA"
     CDS             complement(110281..111609)
                     /transl_table=11
                     /locus_tag="RL0086"
                     /product="putative GFO/IDH/MocA family oxidoreductase"
                     /note="N-terminus to codon 230 is similar to the
                     N-terminus to codon 200 of Rhizobium meliloti
                     (Sinorhizobium meliloti) Inositol 2-dehydrogenase (330 aa)
                     fasta scores: E()=1.3e-08, 26.471% id in 204 aa, and
                     entire protein is similar to Rhizobium meliloti
                     (Sinorhizobium meliloti) PUTATIVE OXIDOREDUCTASE PROTEIN.
                     (433 aa) fasta scores: E()=2.6e-146, 82.89% id in 415 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0086"
                     /db_xref="EnsemblGenomes-Tr:CAK05574"
                     /db_xref="GOA:Q1MN78"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MN78"
                     /protein_id="CAK05574.1"
                     /translation="MGLISVFVSSRMQEDHSMEKRRFALIGTGNRGTTMWGKDLLAGW
                     REHVDLTAIVEKNSLRGERARNMIGSNAPLYENIDSMLAEQKPDLVIVCTPDHTHDDI
                     VVRALESGIDVITEKPMTTSVEKIRRILDAEKRTGRRVDVSFNYRYAPTAAKIKELLN
                     AGEIGRVTSVDFHWYLNTKHGADYFRRWHAYKENSGSLFVHKATHHFDLLNWYLDSDP
                     EAVTSFADLQNYGRKGPFRGPRCKLCPHTHECDYYLDLEADPFLDSLYEDPSKIDGYF
                     RDGCVFREDIDIPDTMVVSLRYRNNVHVSYSLNTFQPIEGHHLAFNGTKGRIELRQYE
                     AQPWEEPKQDTILLIRNFPDGKEAVERIVVPHFTGGHYGGDDRMRNMIFKPDTEDRLA
                     QRAGTRAGAMSVLCGIAALESSRTGKVVDIADLMPELANDGSPNSLRTSR"
     CDS             complement(111710..112534)
                     /transl_table=11
                     /locus_tag="RL0087"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0087"
                     /db_xref="EnsemblGenomes-Tr:CAK05575"
                     /db_xref="InterPro:IPR013022"
                     /db_xref="UniProtKB/TrEMBL:Q1MN77"
                     /protein_id="CAK05575.1"
                     /translation="MQVEGLSINLATIREQCGFAEAVDICLKHGITAIAPWRDQVAKV
                     GLDEAVRIVKSNGIKLTGLCRGGFFPAANDADWQKNLDDNRRAIDEAAAFSADCLVLV
                     VGGLPGSSKDIVAARRMVFDGIAAVLPHAQAAGVKLAIEPLHPMYAADRACVNTLGQA
                     LDLCEQLGEDVGVAVDVYHVWWDPDLANQIARAGRMKRIFAHHICDWLVPTKDMLLDR
                     GMMGDGVIDLKGIRRMVEAAGFFGAQEVEIFSAENWWKRPAEEVIATCVERFRSCC"
     CDS             complement(112672..113835)
                     /transl_table=11
                     /locus_tag="RL0088"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0088"
                     /db_xref="EnsemblGenomes-Tr:CAK05576"
                     /db_xref="GOA:Q1MN76"
                     /db_xref="InterPro:IPR009334"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q1MN76"
                     /protein_id="CAK05576.1"
                     /translation="MTTINLPLDGKIVPYTLTGTPIALAKRDAKAFPRIAFAAAHVVA
                     DPLADNDPWLTPAIDWERTLAFRHRLWDLGLGVAEAMDTAQRGMGLGWPEARDLIRRA
                     LSEAAGRKDALIACGAGTDHLTPGPDVTVDTILSAYEEQIETVEAAGGRIILMASRAL
                     AAAAKGPDDYIRVYDRILRQVKEPVIIHWLGEMFDPALEGYWGNGDHIQAMSTCLEVI
                     EAHADKVDGIKISLLSKEKEVAMRRRLPKGVRMYTGDDFNYAELIAGDEEGHSDALLG
                     IFDAIAPAASAALEALGRKSNHEFFDLLEPTVPLSRHIFKAPTRFYKTGVVFLAYLNG
                     LQDHFVMVGGQQSTRSLTHLAELFRLADKARVLADPELATARMKQVLAVHGVN"
     CDS             complement(113839..114987)
                     /transl_table=11
                     /locus_tag="RL0089"
                     /product="putative oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:RL0089"
                     /db_xref="EnsemblGenomes-Tr:CAK05577"
                     /db_xref="GOA:Q1MN75"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MN75"
                     /protein_id="CAK05577.1"
                     /translation="MARLGIILHGVTGRMGYNQHLVRSILAFRDQGGITLKSGEKLEI
                     DPIIVGRNGAKMEELAKKHNIKRWSTDLDAALANPDDTIFFDAGTTLMRAELLSKALD
                     AGKHVYCEKPISDDLQVALDLARKARRSGLKHGVVQDKLFLPGLRKLALLRDSGFFGK
                     ILSVRGEFGYWVFEGDWGVPAQRPSWNYRKGDGGGIILDMLCHWRYVLDNLFGEVKAV
                     SCLGATHIPRRIDEQGKPYDCDTDDAAYATFELEGGAIAQVNSSWAVRVRRDDLVTFQ
                     VDGTHGSAVAGLTKCWSQHRVNTPKPVWNPDQPQTIDFYKTWDEVPDTQAFDNGFKAQ
                     WEMFIRHVVEDAPWPYGLEAGAKGVQLAELGLKSWAERRWLDVPALEF"
     CDS             complement(115119..115796)
                     /transl_table=11
                     /locus_tag="RL0090"
                     /product="putative TetR family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0090"
                     /db_xref="EnsemblGenomes-Tr:CAK05578"
                     /db_xref="GOA:Q1MN74"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011075"
                     /db_xref="InterPro:IPR015893"
                     /db_xref="UniProtKB/TrEMBL:Q1MN74"
                     /protein_id="CAK05578.1"
                     /translation="MNDSGGNGEKKRSRRPSAERTAQRDPERTRAAILDAATREFAEN
                     GMGGARVDAIAERAGTNKRMLYHYFGDKEQLYLRVLEEAYVGIRTAERALHIGDRSPE
                     EGISELALFTWRYFLQHPEFLSLLGTENLHRARWLRQSVRLKELHSHLIGELSDVLEQ
                     GKKQGVFIETADPLHVYLTIASLGYFYLSNQYTLSTIFGRDLMEPTHLNAWERHIVHV
                     TLASIKR"
     CDS             115995..117281
                     /transl_table=11
                     /locus_tag="RL0091"
                     /product="putative ATP-binding component of ABC
                     transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0091"
                     /db_xref="EnsemblGenomes-Tr:CAK05579"
                     /db_xref="GOA:Q1MN73"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="UniProtKB/TrEMBL:Q1MN73"
                     /protein_id="CAK05579.1"
                     /translation="MTFRVSRRNFVAGGATLLSLSALGTSALAQETRLRLLWWGSQPR
                     ADRTNKVSQLYQSKKPGTSITGEFLGWGDYWPRLATQVAGRNAPDVIQMDYRYIVQYA
                     RRGALAPLESYMPAKLNLDDFDKAQIEGGSVDGHLYGVSLGANSAATVLNTTAFKEAG
                     VDLPTQATTWEEFGRIGAEITKAGKRKGMFGIADGSGGEPLFENWLRQRGKALYTADG
                     KIAFDVDDASEWYDMWAKFREAGACVPADIQALDKNDIETNTVSLGKSAAGFAHSNQF
                     VAYQAMNKDKLALTNYMRIKPESKGGHYRKPSMFFSVSAQSKAVDLAVDYVNFFVKNP
                     EAALLLDVERGIPESSAMREVVAAKLDENGKVALAYVSGLGDLAGKLPPPPPAGAGEG
                     ELMLRNIAEQVGFGQLSPSDGGKQLVAEITQILARG"
     CDS             117288..118247
                     /transl_table=11
                     /locus_tag="RL0092"
                     /product="putative transmembrane component of ABC
                     transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0092"
                     /db_xref="EnsemblGenomes-Tr:CAK05580"
                     /db_xref="GOA:Q1MN72"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="UniProtKB/TrEMBL:Q1MN72"
                     /protein_id="CAK05580.1"
                     /translation="MSNAMRTPAGAINVERYQGAVADGRFRRLWNANAPGYLFLLPWL
                     IGFFGLTLGPALISLYLSFTDFDMLQSPRWVGMANYVRIATADPKFSAAMYVTLTYVV
                     FSVPFKLTFALLVAMALNRGLRGLSVYRAIFYLPSLLGGSVAIAVLWRQLFASDGLVN
                     AALSYFGIEGPSWISHPNYSIYTLVALSVWQFGSPMIIFLAGLRQIPQDMYEAASLDG
                     ASKFRQFYKITLPLLTPVIFFNAVVQTIDAFKAFTPAFIISGGTGGPINSTLFYTLYL
                     YQEAFGNFRMGYASALAWILVVIIAIFTAFSFLTSRYWVHYDD"
     CDS             118249..119127
                     /transl_table=11
                     /locus_tag="RL0093"
                     /product="putative transmembrane component of ABC
                     transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0093"
                     /db_xref="EnsemblGenomes-Tr:CAK05581"
                     /db_xref="GOA:Q1MN71"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="UniProtKB/TrEMBL:Q1MN71"
                     /protein_id="CAK05581.1"
                     /translation="MTASVTAARPPSDITKRSLPASLIIHALLIAASLLMLYPLLWMV
                     SASVRPETEIFSSTSLIPSSIDFSSYARGWVGLDVSFGRFFWNSLVISLLVVTGNVIA
                     CSLTAFAFARLRFAGRNFWFAIMLGTLMIPYHVTLIPQYVLFLDLGWVNTILPLVVPK
                     FLASDAFFIFLMVQFFRGIPRELDEAAMMDGCSAWRIYWKIMLPLSLPVLATAAIFSF
                     IWTWDDFFGPLIYLNDMNTYTIQLGLRTFVDSTSASDWGGLFAMSTLTLVPVFFFFLF
                     FQRLLIEGIATTGMKR"
     CDS             119151..120224
                     /transl_table=11
                     /locus_tag="RL0094"
                     /product="putative GFO/IDH/MocA family oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:RL0094"
                     /db_xref="EnsemblGenomes-Tr:CAK05582"
                     /db_xref="GOA:Q1MN70"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MN70"
                     /protein_id="CAK05582.1"
                     /translation="MSIRTVAIVGCGIGRSHIVEGYLPHSDKFKVVAICDLNEQRMAA
                     VGDEFGIERRTTSFAELLADDTIDIIDICTPPGIHLEQVVAALAAGKHVVCEKPLTGS
                     LAAVDTIMAAEKTAKGVLMPIFQYRYGDGIQKAKRIIDAGIAGKPYTASVETFWLRKP
                     EYYAVPWRGKWATELGGVLVTHALHLHDMLMHLMGPAARVFGRVATRVNDIEVEDCAS
                     ASLLMESGAFVSLSCTLGSQEQISRLRLHFENVTFESSHEPYTPGKDPWKIIAANDDV
                     REQIDRVVGDWQPVAPRFTTQMGQFHAFLSGHAPLPVTTKDARRALELVTAIYQSSDS
                     GADVPLPVGPDSPKYADWRARTK"
     CDS             120256..121332
                     /transl_table=11
                     /locus_tag="RL0095"
                     /product="putative ATP-binding component of ABC
                     transporter protein"
                     /db_xref="EnsemblGenomes-Gn:RL0095"
                     /db_xref="EnsemblGenomes-Tr:CAK05583"
                     /db_xref="GOA:Q1MN69"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008995"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013611"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MN69"
                     /protein_id="CAK05583.1"
                     /translation="MATSVVLQKVEKRYGAMDVIHGIDLTIDPGEFVVFVGPSGCGKS
                     TLLRMIAGLEEITGGGLLLDNERMNEVAPAKRGIAMVFQSYALYPHMSVYKNLAFGLE
                     TAGYKKAEIEPKVKRAAEILQIEKLLERKPKALSGGQRQRVAIGRAIVREPRIFLFDE
                     PLSNLDAELRVQMRVEISRLHRSLGNTMIYVTHDQVEAMTMADKIVVLNSGRIEQVGA
                     PLDLYNNPANRFVAGFIGSPKMNFLKARIEQAGETETSIHVCGNSVRLPRRLKGGAGE
                     EVTFGIRPEHLSLAEGAITLSTINVDLVENLGGATMLYTTTPDNQLLTVALDGQQKVE
                     RGANVKASFDPARCHVFDAAGKTI"
     CDS             121601..122494
                     /transl_table=11
                     /locus_tag="RL0096"
                     /product="conserved hypothetical protein"
                     /note="Similar, but truncated at the N-terminus, to
                     Haemophilus influenzae LicA protein (339 aa) fasta scores:
                     E()=4.8e-12, 28.333% id in 300 aa, and similar, but
                     truncated at the N-terminus to Rhizobium loti
                     (Mesorhizobium loti) Mll5370 protein. (414 aa) fasta
                     scores:E()=2.8e-52, 49.123% id in 285 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0096"
                     /db_xref="EnsemblGenomes-Tr:CAK05584"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q1MN68"
                     /protein_id="CAK05584.1"
                     /translation="MLWGVSMTPEDRIHALGIWQGPIAISPIAGGITNRNYLVSDAVA
                     RCVVRLGTDIPIHHINRQNELAASRAAHAAGISPAVIHHSPGVLVLEYIEARALSPED
                     IRTPQMLARVLPLVRACHRDIARHFRGQAMIFWVFHVIRDYAANLKASESAYLPLLPG
                     LVGRAETLEEAAGPFEIAFGHNDLLAANFLDDGKRLWLIDWDYAGFNTPLFDLGGLAS
                     NNELSEATERTMLETYFDRPLTDDLNRRYTAMKCASLLRETLWSMISEIHSSIDFDYA
                     GYTAENLARFDRAYQAFEQDQ"
     CDS             122495..124945
                     /transl_table=11
                     /locus_tag="RL0097"
                     /product="putative dehydrogenase"
                     /product="Pyruvate dehydrogenase phosphatase regulatory
                     subunit."
                     /db_xref="EnsemblGenomes-Gn:RL0097"
                     /db_xref="EnsemblGenomes-Tr:CAK05585"
                     /db_xref="GOA:Q1MN67"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR029043"
                     /db_xref="InterPro:IPR032503"
                     /db_xref="UniProtKB/TrEMBL:Q1MN67"
                     /protein_id="CAK05585.1"
                     /translation="MTKELPKTAKAVVIGGGIIGCSTAYHLGKLGWTDTVLLERKKLT
                     SGTTFHAAGLVGQLRTSANITQLLGYSVDLYKRLEEETGLGTGWKMNGGLRVACNEER
                     WTEVRRQATTAQSFGLEMQLLTPQEAFDLWPLMAVDDLVGAAFLPTDGQANPSDITQA
                     LAKGARMSGVSIFEDTEVLDLEIDKGRIRAVITAQGRIECERVVVCAGQWTRAFAARF
                     GVNVPLVSVEHQYIITESFGVPSNLPTLRDPDRLTYYKEEVGGIVMGGYEPNPIPWAA
                     NGIPDGFHYTLLDSNFDHFEQIMEQALGRVPALENVGVKQLLNGPESFTPDGNFILGE
                     APELKNFFVGAGFNAFGIASAGGAGMALAEWVTKGEPPYDLWPVDIRRFGRPHFDTDW
                     VRTRTLEAYGKHYTMAWPFEEHSSGRPCRKSPLYDRLKAQGACFGEKLGWERPNWFAD
                     LFANEEPKDVYSYTRQNWFDAVGREHKAVREAAAIFDQTSFAKFVLKGRDAEAALSWI
                     ASNDVARPVGSLVYTQMLNDKGGIECDVTVARIAENEYYIVTGTGFATHDFDWIARNI
                     PAEMHAELVDVTSAYSVLSLMGPNSRAVLEKVTGSDVSNAAFPFGKVRTIGIAGCPVR
                     ALRITYVGELGYELHIPVEYATTVYDVLMAAGGELGLVNAGYRAIESCRLEKGYRAWG
                     SDIGPDHTPVEAGLGWAVKMRKSIPFRGREAIERQLSGGVKKRLACFVPEDADTVLLG
                     RETIYRDGKRVGWLSSGGFGYTLGKPIGYGYVRNPDGVTEDFVLSGTYELDVARERIP
                     CKVSLSPLYDPDMARVKA"
     CDS             complement(125075..126532)
                     /transl_table=11
                     /locus_tag="RL0098"
                     /product="putative mannitol dehydrogenase"
                     /db_xref="EnsemblGenomes-Gn:RL0098"
                     /db_xref="EnsemblGenomes-Tr:CAK05586"
                     /db_xref="GOA:Q1MN66"
                     /db_xref="InterPro:IPR000669"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013118"
                     /db_xref="InterPro:IPR013131"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023027"
                     /db_xref="UniProtKB/TrEMBL:Q1MN66"
                     /protein_id="CAK05586.1"
                     /translation="MTERLQTLSDLAPTAKLPAYDRNQLKSGILHLGPGAFFRAHFAP
                     FTDAALAAEGGDWGIEVASLRTADVADNLSAQNGLYTTLIRDSSGTTAEVIGSILKAH
                     VAPRDPAGLLARLEDPAIRIVSMTVTEKAYGFDPATGGLDLKHPDIVADLVSRHTPRG
                     VIGYLVEGLARRRQKGIAPFTPLSCDNLPSNGAVLKRLVLEFASRIDPDLHRWIEASV
                     PFPSTMVDRITPASTEATYADAERLTGRTDMAAVETEPFTQWVIEDHFANGRPAWEKV
                     RGALMVEEVSAYEKMKLRMLNGAHSLLAYLGYIGGYEFIRDVMDDAALAALAYRHMHA
                     AARTLDPVPGIDLDDYASELIARFANKAIAHRTYQIAMDGTQKLPQRLLEPASEALAH
                     GDRAETYAIAVAAWMRYAIGEHGNGERYELRDPRAGEIAALIADIPRTGLAISAALFT
                     LPGLFPAALTGHRAWTQDVADKLEILIQDDRLPLF"
     CDS             complement(126529..127944)
                     /transl_table=11
                     /locus_tag="RL0099"
                     /product="putative uronate isomerase (glucuronate
                     isomerase)"
                     /db_xref="EnsemblGenomes-Gn:RL0099"
                     /db_xref="EnsemblGenomes-Tr:CAK05587"
                     /db_xref="GOA:Q1MN65"
                     /db_xref="InterPro:IPR003766"
                     /db_xref="InterPro:IPR023177"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="UniProtKB/TrEMBL:Q1MN65"
                     /protein_id="CAK05587.1"
                     /translation="MDAGNGFLHPDRLFPADPATRTVARDLYETVRNLPIVSPHGHTE
                     PSWFADDKPFEDAASLLVIPDHYLFRMLHSVGVTLDELGVPRLDGKPVASGRAIWRTF
                     AAHYHLFRGTPSSLWVDHAMSAVLGCTEPLTPDNADALYDHINAQLALPEFRPRALHQ
                     RFGIETIATTDGALDPLAHHQKMAADGWIGKVRTTYRPDSVTDPDAVGFRDNLVKFGE
                     ITGTEVTRWDGLIEAHRRRRAYFRQFGATATDHGVPTAFTADLPLTEKQALLDKALKG
                     PLSAEDAELFRGQMMTEMAGLSAEDGMVMQIHAGSRRNTDSGLFATRGPNMGADIPTS
                     TDWVGGLNALLSKYGHAPGLRVLLFTLDETTYARELAPMVGHWPCLMIGPPWWFHDSP
                     LGIRRYLDQVVETAGFANMAGFNDDTRALLSIPARHDVWRREVCRFLAQLAGEHRLSK
                     REAEIVAGELSYGNAKKAYKL"
     CDS             128125..128334
                     /transl_table=11
                     /locus_tag="RL0100"
                     /product="putative slyX protein"
                     /db_xref="EnsemblGenomes-Gn:RL0100"
                     /db_xref="EnsemblGenomes-Tr:CAK05588"
                     /db_xref="InterPro:IPR007236"
                     /db_xref="UniProtKB/TrEMBL:Q1MN64"
                     /protein_id="CAK05588.1"
                     /translation="MSDETNHITRLEEMLAHQAKTIEELSDQLAEQWKTVEQMRTKLD
                     RLTERFLSLEEQSLDAPAITRPPHY"
     CDS             complement(128390..129871)
                     /transl_table=11
                     /gene="gabD2"
                     /locus_tag="RL0101"
                     /product="putative succinate-semialdehyde dehydrogenase
                     [NAD(P)+]"
                     /product="Succinate-semialdehyde dehydrogenase [NADP+] (EC
                     1.2.1.16) (SSDH)."
                     /EC_number="1.2.1.16"
                     /db_xref="EnsemblGenomes-Gn:RL0101"
                     /db_xref="EnsemblGenomes-Tr:CAK05589"
                     /db_xref="GOA:Q1MN63"
                     /db_xref="InterPro:IPR010102"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q1MN63"
                     /protein_id="CAK05589.1"
                     /translation="MAFTSALTKHVPFSSPLLRDAGYIDGVWTSGDATKTFDVLNPAT
                     GELLASLPDMGAAETRAAIDAAHAAQPGWAARPARERSTILRKWFDLMVANADELAAI
                     LTAEMGKPFPEARGEILYAAAYIEWYAEEAKRIYGETIPAPSDDKRMIVIRQPVGVVG
                     TITPWNFPAAMITRKIAPALAVGCTVVSKPAEQTPLTAIALAVLAEQAGIPAGVFNVI
                     VGVDGPAIGRELCGNEKVRKISFTGSTEVGRILMRQCADQIKKVSLELGGNAPFIVFD
                     DADLDAAVEGAIASKYRNAGQTCVCANRLYVQSNVYDAFAAKLAAKVAEMSVGDGFEP
                     GVVIGPLIDEQGLAKVEDHVSDALAKGAKLLTGGKRIDGAGTFFTPTVLTGVARGMKV
                     AREETFGPVAPLFRFDTVEDVINQANDTEFGLAAYFYAGDLKKVWRVAEALEYGMIGI
                     NTGLMSSETAPFGGIKQSGLGREGSRHGADDYLEMKYLCIGGV"
     CDS             complement(130039..131319)
                     /transl_table=11
                     /gene="goaG"
                     /gene_synonym="gabT"
                     /locus_tag="RL0102"
                     /product="putative 4-aminobutyrate aminotransferase"
                     /db_xref="EnsemblGenomes-Gn:RL0102"
                     /db_xref="EnsemblGenomes-Tr:CAK05590"
                     /db_xref="GOA:Q1MN62"
                     /db_xref="InterPro:IPR004632"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q1MN62"
                     /protein_id="CAK05590.1"
                     /translation="MNATSLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGRRYID
                     FAAGIAVLNTGHRHPRVIAAVKDQLDRFTHTCHQVVPYESYVHLAERLNALLPGDFEK
                     KTIFVTTGAEAVENAVKIARAATGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGA
                     MPGDVFHIPFPVELHGVTADQSLAALKKLFAADVDPQRVAAIIIEPVQGEGGFYSAPA
                     AFMKALRELCDQHGILLIADEVQTGFARTGRMFAMDHHEVAPDLTTMAKSLAGGFPLA
                     AVTGRAAIMDAPGPGGLGGTYGGNPLGIAAAHAVLDVIVDEDLCNRANLLGGRLKQRL
                     ESMRETVPEIVDIRGPGFMNAVEFNDRTTGLPSAEFANRVRLIALDKGLILLTCGVHG
                     NVIRFLAPITIQDEIFGEALDILEASMLQASAAK"
     CDS             131486..132295
                     /transl_table=11
                     /gene="gabR"
                     /locus_tag="RL0103"
                     /product="putative MerR family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0103"
                     /db_xref="EnsemblGenomes-Tr:CAK05591"
                     /db_xref="GOA:Q1MN61"
                     /db_xref="InterPro:IPR000551"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:Q1MN61"
                     /protein_id="CAK05591.1"
                     /translation="MNDNGPVRYKVAEAARLAGVSASTLRLWESQGLVVPGRSETGHR
                     QYSADDVARLKRISWYRVERGLNPAAIREALESEEPSADGAEASQDTGLGRKLRSLRH
                     ANGKTLDQVAGDIGVTSSTLSTLERTSQGVSFKTLHDLAEYYGTTVSRLSGEESGDVP
                     VLVRAGEWRKWPETTPGVTVQLLAEGRRMMDCHRFVLAPGAASEGAYRHEGEEFMHVL
                     SGRLELVLDGDQFFDLGPGDSLYFESRRDHSWRNRHDGETVLLWINTPPTF"
     CDS             132535..133161
                     /transl_table=11
                     /locus_tag="RL0104"
                     /product="putative ribonuclease"
                     /note="Similar to the N-terminus to codon 170 of
                     Escherichia coli Ribonuclease D (375 aa) fasta scores:
                     E()=3.2e-06, 31.847% id in 157 aa, and entire protein is
                     similar to Agrobacterium tumefaciens (strain C58/ATCC
                     33970) Ribonuclease D (208 aa) fasta scores: E()=4.8e-72,
                     88.942% id in 208 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0104"
                     /db_xref="EnsemblGenomes-Tr:CAK05592"
                     /db_xref="GOA:Q1MN60"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q1MN60"
                     /protein_id="CAK05592.1"
                     /translation="MAATIRYHEGDISAADVARYTGAIAIDTETLGLVPRRDRLCVVQ
                     LSPGDGTADIIRIAAGQKEAPNLVALLEDPTHQKIFHYGRFDIAVLFHTFSVTTTPVF
                     CTKIASRLIRTYTDRHGLKDNLKEMLDVDVSKAQQSSDWAAERLSPAQLEYAASDVLY
                     LHALRDKLTERLIRDGRYDHATACFEFLPTRAKLDLLGWEEADIFAHS"
     CDS             133393..134958
                     /transl_table=11
                     /locus_tag="RL0105"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0105"
                     /db_xref="EnsemblGenomes-Tr:CAK05593"
                     /db_xref="UniProtKB/TrEMBL:Q1MN59"
                     /protein_id="CAK05593.1"
                     /translation="MLTPVRAASNASFSSQGQTAAIVASGLGQSVIAPAPVNAVEAAD
                     LNSAIAGKLNILLLAARERMVEALFDVIDAAGHSLSLDRGEDESNLAFASRLADAIRR
                     LPAARIDEVERQLTAQGHGLPLRTIAEALKNPTGPEAARIVAYLEIVRYKDRDLAARA
                     VVRSYRQNDASPMRTEARPEIQLHEDNRPAAATRQLAEKVPVLVAPLTEAAALLTAEE
                     PLIAETVEAADPETPQPEEAPAQPAPVAAAEVAAEESLPQELEAQQLLSTDLDKIEDT
                     QEAVEQSAVQPRIVSDKADPVIPRNWAGIVASMTEEASEMIATLIREQEIETVLEDVP
                     VEAAVEIDTILDEAVISEATGSLTKQPMELAAPDVRQTAALRPSQPDIPPLVVETRQP
                     REVSAQAEMIPVPETIESPYVPLAARMPEGLAYTQLPYQFAKDILSNEKAGETHHQHQ
                     HHRDGAPQDQNQDEQQAQSGGEDAEPDGEETDAAPARRTPRMIDAEPVAHQPAGAAAD
                     PVYALYQRMVGWE"
     CDS             complement(135131..136834)
                     /transl_table=11
                     /gene="rpsA"
                     /locus_tag="RL0106"
                     /product="putative 30S ribosomal protein S1"
                     /db_xref="EnsemblGenomes-Gn:RL0106"
                     /db_xref="EnsemblGenomes-Tr:CAK05594"
                     /db_xref="GOA:Q1MN58"
                     /db_xref="InterPro:IPR000110"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="UniProtKB/TrEMBL:Q1MN58"
                     /protein_id="CAK05594.1"
                     /translation="MSVATPSREDFAALLEESFAKNDLAEGYVTKGIVTGIEKDVAVV
                     DVGLKVEGRIALKEFGARAKDGLLKVGDEVEVYVERIENALGEAVLSREKARREESWV
                     KLEAKFEAGERVEGVIFNQVKGGFTVDLDGAIAFLPRSQVDIRPIRDVTPLMHNPQPF
                     EILKMDKRRGNIVVSRRTVLEESRAEQRSEIVQNLEEGQVVDGVVKNITDYGAFVDLG
                     GIDGLLHVTDMAWRRVNHPSEILNIGQQVKVQIIRINQETHRISLGMKQLESDPWDGI
                     QAKYPEGKKISGTVTNITDYGAFVELEPGIEGLIHISEMSWTKKNVHPGKILSTSQEV
                     EVVVLEVDPSKRRISLGLKQTLENPWAAFARSHPAGTEVEGEVKNKTEFGLFIGLDGD
                     VDGMVHLSDLDWNRPGEQVIEEFNKGDVVKAVVLDVDVEKERISLGIKQLGKDAVGDA
                     AASGDLRKNAVVSCEVIAVNDGGVEVKLVNHEDITSFIRRADLARDRDEQRPERFSVG
                     QVFDARVTNFSKKDRKIMLSIKALEIAEEKEAVAQFGSSDSGASLGDILGAALKNRGG
                     E"
     CDS             complement(137011..137658)
                     /transl_table=11
                     /locus_tag="RL0107"
                     /product="putative cytidylate kinase"
                     /db_xref="EnsemblGenomes-Gn:RL0107"
                     /db_xref="EnsemblGenomes-Tr:CAK05595"
                     /db_xref="GOA:Q1MN57"
                     /db_xref="InterPro:IPR003136"
                     /db_xref="InterPro:IPR011994"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MN57"
                     /protein_id="CAK05595.1"
                     /translation="MTNETFTIAIDGPAAAGKGTLSRRIADQYGFHHLDTGLTYRATA
                     KALLDAGLPLDDEAVAEKIAREVELAGLDRDILSKHEIGEAASRIAVMPAVRRALVEA
                     QRRFSTKAPGTVLDGRDIGTVVCPNAAVKFYVTASPEVRARRRYDEILGKGLTADFDA
                     IFEDVKRRDERDMGRADSPLKPADDAHLLDTSEMSIEAAFQAAQSIIDAVLSRNA"
     CDS             complement(137731..139089)
                     /transl_table=11
                     /gene="aroA1"
                     /locus_tag="RL0108"
                     /product="putative 3-phosphoshikimate
                     1-carboxyvinyltransferase
                     (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
                     synthase)"
                     /EC_number="2.5.1.19"
                     /db_xref="EnsemblGenomes-Gn:RL0108"
                     /db_xref="EnsemblGenomes-Tr:CAK05596"
                     /db_xref="GOA:Q1MN56"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="InterPro:IPR006264"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="InterPro:IPR023193"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MN56"
                     /protein_id="CAK05596.1"
                     /translation="MLNGSASKPATARKSAGLTGSVRIPGDKSISHRSFMIGGLASGE
                     TRITGLLEGEDVINTGRAMQAMGARIRKEGAQWVIEGTGNGALLAPDAPLDFGNAGTG
                     VRLTMGLVGTYDFHSTFIGDASLSKRPMGRVLNPLREMGVQVSASEGDRLPVTLRGPG
                     TPSPIRYRVPMASAQVKSAVLLAGLNTPGVTTVIEPVMTRDHTEKMLQGFGAALSVET
                     DGDGVRTIRLEGRGKLAGQVIDVPGDPSSTAFPLVAALIVPGSDITIVNVLMNPTRTG
                     LILTLQEMGADIEVVNARLAGGEDVADLRVRHSELKGVTVPEDRAPSMIDEYPILAVA
                     ACFAEGATVMKGLEELRVKESDRLSAVADGLKLNGVDCDEGEDFLIVRGRPDGKGLGN
                     AADGRVSTHLDHRIAMSFLVLGLASEHAVTIDDAAMIATSFPEFMQLMTGLGAKIELV
                     AE"
     CDS             139366..139749
                     /transl_table=11
                     /locus_tag="RL0109"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0109"
                     /db_xref="EnsemblGenomes-Tr:CAK05597"
                     /db_xref="InterPro:IPR012644"
                     /db_xref="UniProtKB/TrEMBL:Q1MN55"
                     /protein_id="CAK05597.1"
                     /translation="MAKAELGTKRTDPETGKKFYDLNRDPIVSPYTGKSYPLSFFEET
                     SAIAEVAEEDEVAEVDTENTEVELVSLEDADDAASGDDIPDIGDDDVEIEGDDDDDTF
                     LTPDEDDDDDDMSDIIGVTGDEDEV"
     CDS             140098..140430
                     /transl_table=11
                     /locus_tag="RL0110"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0110"
                     /db_xref="EnsemblGenomes-Tr:CAK05598"
                     /db_xref="InterPro:IPR000305"
                     /db_xref="UniProtKB/TrEMBL:Q1MN54"
                     /protein_id="CAK05598.1"
                     /translation="MNYVYILHSTEFPDRYYVGVTSDLKSRLAKHNAGEVSHTSKYLP
                     WSLKTYLAFSDEAQAFAFEKYLKSASGRAFAKIKTLAAPFNSGRTLPQPPDQTIATRP
                     TGSRVRLT"
     CDS             140531..141253
                     /transl_table=11
                     /locus_tag="RL0111"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:RL0111"
                     /db_xref="EnsemblGenomes-Tr:CAK05599"
                     /db_xref="GOA:Q1MN53"
                     /db_xref="InterPro:IPR010699"
                     /db_xref="UniProtKB/TrEMBL:Q1MN53"
                     /protein_id="CAK05599.1"
                     /translation="MTRSRRRRIIRTRRTLTGLALVGSISFLAGMTDATGLLLTGDFV
                     SFMTGNTTRAALALSEGNLYHAAVLICAIVVFVLGNAAGIVISHISQRRIFVVLGCVG
                     LVLALASMMTVQNMLFARFYMIVFSMGMVNAAVEHIEGLPIGLTYVTGALSRFGRGIG
                     RWIIGDRRVEWTIQIVPWGGMVLGAIAGAVLTRLTGAHALWLVSLFAMVLALAAMLIP
                     RPLQRRFNQKVAPSGSAITRAK"
     CDS             141322..142110
                     /transl_table=11
                     /locus_tag="RL0112"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:RL0112"
                     /db_xref="EnsemblGenomes-Tr:CAK05600"
                     /db_xref="GOA:Q1MN52"
                     /db_xref="InterPro:IPR003848"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q1MN52"
                     /protein_id="CAK05600.1"
                     /translation="MFLISKLVWIFAQPLSLAFFLVFLALLAGLLRWRTLSILGAAGS
                     ALILFVTLYTTAGNLLMQGLEQRFAKPAADPDSLQCMIVLGGGFENEVNTARHGIEFN
                     GGADRFIEALRLAQKFPQSRILVSGGDGSISGIYEGDAAASERFFPLFGVGRDRLIEE
                     RQSRTTFENAVNTKEFLASQGLSNCLLITSGFHMPRSVGIFRKLGIDIVPWPTDYRTD
                     GQVRLGLDFTQPSLNAQNLATAIREWYGLVGYYLAGRTSELYPS"
     CDS             142264..142677
                     /transl_table=11
                     /locus_tag="RL0113"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0113"
                     /db_xref="EnsemblGenomes-Tr:CAK05601"
                     /db_xref="UniProtKB/TrEMBL:Q1MN51"
                     /protein_id="CAK05601.1"
                     /translation="MRRRDHEITAFGNLQVEIIGTAVVIALRPLLPVAGQLALVDHRV
                     DQAVIVDVLPDDETIGKFGRLALLLEMFLLVDLRVGDQRLLTEGDSRHGKQQDDIQNG
                     EHQRFHGFPLLDKGSVAQCMSPKVCSGSRTTTCIT"
     CDS             142765..143400
                     /transl_table=11
                     /locus_tag="RL0114"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:RL0114"
                     /db_xref="EnsemblGenomes-Tr:CAK05602"
                     /db_xref="GOA:Q1MN50"
                     /db_xref="InterPro:IPR005115"
                     /db_xref="UniProtKB/TrEMBL:Q1MN50"
                     /protein_id="CAK05602.1"
                     /translation="MSLLVYLDYAGIALFAATGALAASRKQLDLIGFLFFAMVTGTGG
                     GTVRDIVLGRVPVFWVLNPAYILVCCIVGVMVFFTAHLLESRYRLLIWLDAIGLAAYC
                     VIGAAKGLAATGSPTIAIVTGTLTATFGGILRDLMANEPSVLLRPEIYVTAALIGAGV
                     FTLANGLGMQLYLASACGVVAAFGVRGGALWFGWTFPTYRHKPGRHPDDVM"
     CDS             complement(143477..143899)
                     /transl_table=11
                     /gene="irrA"
                     /locus_tag="RL0115"
                     /product="iron response regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0115"
                     /db_xref="EnsemblGenomes-Tr:CAK05603"
                     /db_xref="GOA:Q1MN49"
                     /db_xref="InterPro:IPR002481"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q1MN49"
                     /protein_id="CAK05603.1"
                     /translation="MMTGAFPIAIEVRLRGAGLRPTRQRVALGDLLFAKGDRHLTVEE
                     LHEEAVAAGVPVSLATVYNTLHQFTEAGLIRVLAVESAKTYFDTNVSDHHHFFVEGDN
                     EVLDIPVSNLTIANLPEPPEGMEIAHVDVVIRLRAKQG"
     CDS             144197..144712
                     /transl_table=11
                     /gene="fabA"
                     /locus_tag="RL0116"
                     /product="putative 3-hydroxydecanoyl-[acyl-carrier-
                     protein] dehydratase (Beta-hydroxydecanoyl thioester
                     dehydrase)"
                     /EC_number="4.2.1.60"
                     /db_xref="EnsemblGenomes-Gn:RL0116"
                     /db_xref="EnsemblGenomes-Tr:CAK05604"
                     /db_xref="GOA:Q1MN48"
                     /db_xref="InterPro:IPR010083"
                     /db_xref="InterPro:IPR013114"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q1MN48"
                     /protein_id="CAK05604.1"
                     /translation="MTTRQSSFSYEELIACAHGELFGPGNAQLPLPPMLMVHRITEIS
                     ETGGTFDKGYLRAEYDVRPDDWYFPCHFEGNPIMPGCLGLDGMWQLTGFFLGWLGEEG
                     RGMALSTGEVKFKGMVRPQTKLIEYGIDFKRVMRGRLVLGTADGWLKADGETIYQAAD
                     LRVGLSKDKTA"
     CDS             144791..145990
                     /transl_table=11
                     /gene="fabB"
                     /locus_tag="RL0117"
                     /product="putative 3-oxoacyl-[acyl-carrier-protein]
                     synthase I"
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase I (EC
                     2.3.1.41) (Beta-ketoacyl-ACP synthase I) (KAS I)."
                     /EC_number="2.3.1.41"
                     /db_xref="EnsemblGenomes-Gn:RL0117"
                     /db_xref="EnsemblGenomes-Tr:CAK05605"
                     /db_xref="GOA:Q1MN47"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR018201"
                     /db_xref="InterPro:IPR020841"
                     /db_xref="UniProtKB/TrEMBL:Q1MN47"
                     /protein_id="CAK05605.1"
                     /translation="MSSIGNDAAEVTESLRQAKSGISFSSDFAEHGFKCQVWGSPKLG
                     SAELAELVDRRAMRFLSQGGAWNHVAMKQALADSGLEEKDYAQNERTGIIMGSGGPST
                     RTLIEAAEITIKNNSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAH
                     CIGNAAEMIQWGKQDVMFAGGHEDLDWTMSNLFDAMGAMSSKYNDTPDSASRAYDVNR
                     DGFVIAGGAGVLVLEELERAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMRQA
                     LATVKGDVDYVNTHGTSTPVGDSKEIGAIREVFGSKIPHIQSTKSLTGHSLGAAGVQE
                     SIYSLLMMQQGFIGESAHITELDPEFEGVPIVRKRIDDAKIDIALSNSFGFGGTNATL
                     VFQRYNG"
     CDS             145998..146804
                     /transl_table=11
                     /gene="fabI1"
                     /locus_tag="RL0118"
                     /product="putative Enoyl-[acyl-carrier-protein] reductase
                     [NADH] (NADH-dependent enoyl-ACP reductase)"
                     /EC_number="1.3.1.9"
                     /db_xref="EnsemblGenomes-Gn:RL0118"
                     /db_xref="EnsemblGenomes-Tr:CAK05606"
                     /db_xref="GOA:Q1MN46"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR014358"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MN46"
                     /protein_id="CAK05606.1"
                     /translation="MTGIMQGKRGLVMGVANNHSIAWGISKALAAQGAELAFTYQGDA
                     LGKRVKPLAAEVNSDFVLPCDVEDIASVDAVVDAISERWGKLDFIVHAIGFSDKNELK
                     GLYADTTRENFSRTMVISCFSFTEIAKRCAPLMEDGGAMLTLTYNGSTRVIPNYNVMG
                     VAKAALEASVRYLAADYGPRGIRVNAISAGPIRTLAGAGISDARAILSWNQRNAPLRK
                     TVTIDQVGSSALYLLSDLSSGVTGEVHFVDAGFNVTSMPTLETLRKADVE"
     CDS             complement(146893..147909)
                     /transl_table=11
                     /locus_tag="RL0119"
                     /product="putative ribosomal RNA small subunit
                     methyltransferase"
                     /EC_number="2.1.1.52"
                     /db_xref="EnsemblGenomes-Gn:RL0119"
                     /db_xref="EnsemblGenomes-Tr:CAK05607"
                     /db_xref="GOA:Q1MN45"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR007848"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q1MN45"
                     /protein_id="CAK05607.1"
                     /translation="MSSETLKTLFHPFASGTVAAPGEGERVLFLGAEAGFALPEGFAA
                     SLSAVQGFRPLYRQLLAQRIEAKPEIDGEDYDAALVLCTKHKGENEANLAAAIARTRL
                     GGLIVVAGAKEDGIQPLRKRMEGFNLAVDYMPKYHGVAFWFGRPADADEIISKLAKAP
                     VRVDGRFNATAGMFSHDRIDAGSELLTSRLPEDFTGDVADFGAGWGYLSVEMARKSVG
                     LTRLDLYEADHAALEAARDNLAKNCPNAPARFFWHDLAGEPVKDKYDLIIMNPPFHEG
                     HAAEPALGQAMIKTAASALRGGGRLMLVANRGLPYEPVLAANFRESGETCRNARFKVL
                     WAKK"
     CDS             complement(147985..150123)
                     /transl_table=11
                     /gene="pnp"
                     /locus_tag="RL0120"
                     /product="putative Polynribonucleotide
                     nucleotidyltransferase (Polynucleotide phosphorylase)
                     (PNPase)"
                     /EC_number="2.7.7.8"
                     /db_xref="EnsemblGenomes-Gn:RL0120"
                     /db_xref="EnsemblGenomes-Tr:CAK05608"
                     /db_xref="GOA:Q1MN44"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR012162"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR015848"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MN44"
                     /protein_id="CAK05608.1"
                     /translation="MFDTHTVEIEWAGRPLKLETGKIARQADGAVLATYGETVVLATV
                     VSAKAPKAGQDFFPLTVNYQEKTYAAGKIPGGYFKREGRPSEKETLVSRLIDRPIRPL
                     FPEGYKNDTQVVVTVIQHDLENDPDVLSMVATSAALTLSGVPFMGPVGGARVGYINGE
                     YVLNPHLDEMDESSLDLVVAGTYDAVLMVESEAKELNEDVMLGAVMFGHKGFQPVLDA
                     IIKLAEVAAKEPRDFQPADYSALESEMLGLAEGELRNAYKITQKADRYAAVDAVKAKV
                     KAHFLPEEGEAKYTAEEVGAIFKHLQAKIVRWNILDTKSRIDGRNLETVRPIVSEVGL
                     LPRTHGSALFTRGETQAIVVATLGTGEDEQYVDSLTGMYKERFLLHYNFPPYSVGETG
                     RMGSPGRREIGHGKLAWRAIRPMLPTPEQFPYTLRVVSEITESNGSSSMATVCGTSLA
                     LMDAGVPLAKPVAGIAMGLILEGDRFAVLSDILGDEDHLGDMDFKVAGTADGITSLQM
                     DIKITGITEEIMKVALGQAQGGRVHILGEMSKAITESRGQLGEFAPRIEVMNIPVDKI
                     REVIGSGGKVIREIVEKTGAKINIEDDGTVKIASSSGKEIEAARKWIHSIVAEPEIGQ
                     VYEGTVVKTADFGAFVNFFGARDGLVHISQLASERVAKTQDVVKEGDKVWVKLLGFDE
                     RGKVRLSMKVVDQATGQEIPNEKKKEEAAE"
     CDS             complement(150472..150741)
                     /transl_table=11
                     /gene="rpsO"
                     /locus_tag="RL0121"
                     /product="putative 30S ribosomal protein S15"
                     /db_xref="EnsemblGenomes-Gn:RL0121"
                     /db_xref="EnsemblGenomes-Tr:CAK05609"
                     /db_xref="GOA:Q1MN43"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR005290"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MN43"
                     /protein_id="CAK05609.1"
                     /translation="MSITAERKSALIKEYATVEGDTGSPEVQVAILTERINNLTEHFK
                     DHKKDNHSRRGLLTMVSSRRSLLDYLKKKDEGRYSKLITSLGIRR"
     CDS             complement(150895..151833)
                     /transl_table=11
                     /locus_tag="RL0122"
                     /product="putative oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:RL0122"
                     /db_xref="EnsemblGenomes-Tr:CAK05610"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q1MN42"
                     /protein_id="CAK05610.1"
                     /translation="MSGGSDAISSLSGRHSGPRGHGGPTEGKIMRGTAIGILTFFSMF
                     LAAAGARSAERWAELPAFPSMPVAKTSGMAEVNDIKMYYAEYGEGDPILFIHGGLGNA
                     DVWGHQVADFAKDHLVIVADSRGHGRSTRSQQPFGYDLMTSDYVALLDYLKIDKVTLV
                     GWSDGGIIGIDMAMKNPEKLTRVIAQAANVTTDGVKADVMNNKTFNDYINVAGEYYRK
                     LSPTPNEYEAFVTQISHMWETQPAWTAADLGKIAVPVTLAIGDHDEAVKLDHTEMMAK
                     DIPGAKLVILKDASHFAMLQDPTGYDAMIRDAMAGR"
     CDS             complement(151863..152795)
                     /transl_table=11
                     /gene="truB"
                     /locus_tag="RL0123"
                     /product="putative tRNA pseudouridine synthase B (tRNA
                     pseudouridine 55 synthase) (Psi55 synthase)
                     (Pseudouridylate synthase) (Uracil hydrolyase)"
                     /EC_number="4.2.1.70"
                     /db_xref="EnsemblGenomes-Gn:RL0123"
                     /db_xref="EnsemblGenomes-Tr:CAK05611"
                     /db_xref="GOA:Q1MN41"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR014780"
                     /db_xref="InterPro:IPR015240"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="InterPro:IPR032819"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MN41"
                     /protein_id="CAK05611.1"
                     /translation="MSKPRKPKGRPISGWLILDKPVDFGSTEAVSKIKWLYKAEKAGH
                     AGTLDPLASGMLPIALGDATKTVPYVMDGRKIYEFTVSWGEERATDDLEGDVTKSSDK
                     RPSEQQIRDILPGYIGTISQVPPQFSAIKIAGERAYDLAREGETIEIPSREVDIFRLT
                     LLACPDADSAHFEVECGKGTYVRALARDFGRELGCYGHVSGLRRTFVAPFAEGAMVPL
                     ADLVALEAIEDMDERLAALDALLIDTCEALSSLPHLVINDDQAHRLKMGNPILVRGRD
                     APVAESEAYATARGKLIAIGEIGQGEFRPKRVFA"
     CDS             complement(152809..153213)
                     /transl_table=11
                     /gene="rbfA"
                     /locus_tag="RL0124"
                     /product="putative ribosome-binding factor protein"
                     /db_xref="EnsemblGenomes-Gn:RL0124"
                     /db_xref="EnsemblGenomes-Tr:CAK05612"
                     /db_xref="GOA:Q1MN40"
                     /db_xref="InterPro:IPR000238"
                     /db_xref="InterPro:IPR015946"
                     /db_xref="InterPro:IPR020053"
                     /db_xref="InterPro:IPR023799"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MN40"
                     /protein_id="CAK05612.1"
                     /translation="MTRPTSSAPSQRMLRIGEQVRAAITQVLQRGEVRDDVIEATVIS
                     VSEVRMSPDLKIATAYVTPLGVSDHSIVIEALNRHARFIRGRLGPQLRQMKYMPEVRF
                     RDDTSFDNYKKIDELLRSPEVSRDLDGDNDEQ"
     CDS             complement(153364..156117)
                     /transl_table=11
                     /gene="infB"
                     /locus_tag="RL0125"
                     /product="putative translation initiation factor IF-2"
                     /db_xref="EnsemblGenomes-Gn:RL0125"
                     /db_xref="EnsemblGenomes-Tr:CAK05613"
                     /db_xref="GOA:Q1MN39"
                     /db_xref="InterPro:IPR000178"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006847"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR013575"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MN39"
                     /protein_id="CAK05613.1"
                     /translation="MTDSNDDKTISVAGKKTLTLKPSGMSQGTVRQDMGRGRTKAVVV
                     ETRKRRPMRPEDEKPITPVAPAAPVRAAEPAPAPVQARPQQPTPAPRVQQGNNNQTNQ
                     RPPQQSHQPPRQNDRPRPVVLNHLSPEEMDARRRALADSQARDAQDAIRRAEEEKRRA
                     AEEVIRKAAEAEEAARRAAEEAIRQAEAPAVAEPAAAEPAPAEARTDAPRPPQPASSA
                     PAARRPDAAGAPAARPAPGAAVPGAVRGRRDEKEEDDRGAARGGPVRGRVVRPEPAKP
                     VTTRPKTDEERRRGKLTITTANVDGEDNARGRSLSAMRRRQEKFRRGQMQETREKISR
                     EVVLPETITIQELSQRMSERAVDVIKYLMKEGQMMKPGDVIDADLAEIIAGEFGHTVR
                     RVSESDVELGIFNVSDEDGELVSRPPVVTIMGHVDHGKTSLLDAIRHANVVSGEAGGI
                     TQHIGAYQVEQNGQKITFIDTPGHAAFTAMRARGAQATDIAILVVAADDSVMPQTIES
                     INHAKAAGVPIIVAINKVDKHEADPQKVRNQLLQHEVFVESMGGEVLDVEVSAKTGKN
                     LDKLLEAILLQAEILDLKANANRTAEGTVIEAQLDRGRGSVATVLVQKGTLRPGQIIV
                     AGDVWGRVRALVTDKGDHVKEAGPATPVEVLGLSGTPQAGDKFAVVESESRAREISEY
                     RQRLARDKAAARQSGQRGSLEQMMMQRQSVGIKEFPLVIKGDVQGSIEAIAGALEKLG
                     TDEVRARIVHSGAGGITESDISLAEASNAAIIGFNVRANTQARQFAEREGIEIRYYNI
                     IYDLVDDVKAAMSGLLSPERRETFIGNAEILEVFNITKVGKVAGCRVVEGKVERGAGV
                     RLIRNDVVVHEGKLKTLKRFKDEVSEVPMGQECGMAFENYEDMRAGDVIECFRVEHIT
                     RTL"
     CDS             complement(156219..156911)
                     /transl_table=11
                     /locus_tag="RL0126"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0126"
                     /db_xref="EnsemblGenomes-Tr:CAK05614"
                     /db_xref="InterPro:IPR007393"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q1MN38"
                     /protein_id="CAK05614.1"
                     /translation="MMTAHEPDAPLEDDDLAGYDVNGRMCIVTRESGSPEELIRFVAA
                     PDGTVVADLKRELPGRGCWVKIDRSLVDRAVAKKLFARALKTDVKAADDLGESVDRLL
                     AAQLMQMMNMARKAGQFVSGSSKVDAAVRSGAALAVFHSTGAADDGVRKIDQARKAWH
                     LGMETEEEIPSFRLFSESEMEGLMGQNAFIHAAVLAGQAGEGVVKRAKMLEQYRIGGQ
                     SRAAGGAGRLKQ"
     CDS             complement(156908..158509)
                     /transl_table=11
                     /gene="nusA"
                     /locus_tag="RL0127"
                     /product="putative transcription elongation protein (N
                     utilization substance protein A) (L factor)"
                     /db_xref="EnsemblGenomes-Gn:RL0127"
                     /db_xref="EnsemblGenomes-Tr:CAK05615"
                     /db_xref="GOA:Q1MN37"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR009019"
                     /db_xref="InterPro:IPR010213"
                     /db_xref="InterPro:IPR010214"
                     /db_xref="InterPro:IPR010995"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013735"
                     /db_xref="InterPro:IPR015946"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR025249"
                     /db_xref="InterPro:IPR030842"
                     /db_xref="UniProtKB/TrEMBL:Q1MN37"
                     /protein_id="CAK05615.1"
                     /translation="MAVSANRLELLQIADAVAREKVIDREIVLAAMADAIQKAARSRY
                     GTESNIRADINPKTGEIRLQRLLEVVEKAEDYSTQIPLELARDRNPDAALGDFIADPL
                     PPMDFGRIAAQSAKQVIVQKVREAERDRQFDEFKDRVGEIVNGTVKRVEYGNVIVDLG
                     RGEGIIRRDEMIPRENVRYGDRVRAYVYDVRREQRGPQIFLSRTHPQFMVKLFTMEVP
                     EIYDGIIQVKSVARDPGSRAKIAVISNDSSIDPVGACVGMRGSRVQAVVGELQGEKID
                     IIPWSQDPATFVVNALQPAEVAKVVLDEDAERIEVVVPDEQLSLAIGRRGQNVRLASQ
                     LTGWDIDIMTEAEESERRQKEFNERTNLFMDSLDVDEMVGQVLASEGFAAVEELAYVD
                     LDEISSIDGFDEETAQEIQQRAREFLERLEAEMDEKRKALGVQDELREINGMTAQMMV
                     ALGEDGIKSIEDFAGCAADDLVGWSERKNGETKKFEGLFSKFDVSRVEAEQMIVQARL
                     SAGWITQEDLAKGTEEEVTEAEQEA"
     CDS             complement(158569..159174)
                     /transl_table=11
                     /locus_tag="RL0128"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0128"
                     /db_xref="EnsemblGenomes-Tr:CAK05616"
                     /db_xref="GOA:Q1MN36"
                     /db_xref="InterPro:IPR003728"
                     /db_xref="InterPro:IPR028989"
                     /db_xref="InterPro:IPR028998"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MN36"
                     /protein_id="CAK05616.1"
                     /translation="MSDLTNADNEREPRLITETGLDQRLADIIEPVLVDLGFRLIRVR
                     MMNQNGATMQVMAERNDGTMTVQDCEEVSMAISPVLDVEDPVDKEYHLEVSSPGIDRP
                     MVRKSDFVRWQGHLVKCETSILIDNRKRFRGKIVEAGTDGFTLERDQIAYGEEQKVTI
                     PFTALSDAKLILTDDLIRDALRADKLAKAQAANQNEADDEE"
     CDS             159373..161052
                     /transl_table=11
                     /locus_tag="RL0129"
                     /product="putative transmembrane transport protein"
                     /db_xref="EnsemblGenomes-Gn:RL0129"
                     /db_xref="EnsemblGenomes-Tr:CAK05617"
                     /db_xref="GOA:Q1MN35"
                     /db_xref="InterPro:IPR010290"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q1MN35"
                     /protein_id="CAK05617.1"
                     /translation="MRIYCRWRAITKAGEIVAYTSSTLAPLRHDTYRTIWFASLSSNF
                     GGLIQAVGAAWMMTTITASEDMVALVQTSTALPIMLFSLISGALADNYDRRRVMLTAQ
                     CMMLTVSALLTASALLGWITPWLLLFFTFLIGCGTALNNPSWQASVGDMVPRADLPAA
                     VTLNSMGFNITRSVGPAIGGVIVAAAGAAAAFAVNTLSYLALIYALLRWRPAAPVSTL
                     PREALGSAIFAGLRYVSMSPNLEKVLVRGLLFGIGASSILALLPVVALDLVAGGPLTY
                     GFMLGAFGIGAIGGAVLNARLRQVLSSEMIVRLSFAGFALSAVIAALSPSAVLTSAGL
                     LVSGACWVSALSLFNTIVQLSTPRWVVGRALSLYQTVTFGGIAGGSWLWGIAADRYGV
                     ADALLMSSVVMLLGIAIGLRFSMPAFASLNLDPLNRFIEPALSLDITPRSGPIVIQVD
                     YEIADEDLAEFMELMGERRRIRIRDGARNWALMRDLENPSLWTETYHTPTWVEYIRHN
                     QRRTQADAENTDRLRALHRGEGPLHVHRMIERQAIPPDNDVFHKAPIDLHH"
     CDS             161049..161531
                     /transl_table=11
                     /locus_tag="RL0130"
                     /product="putative transcriptional
                     regulator/acetyltransferase"
                     /db_xref="EnsemblGenomes-Gn:RL0130"
                     /db_xref="EnsemblGenomes-Tr:CAK05618"
                     /db_xref="GOA:Q1MN34"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q1MN34"
                     /protein_id="CAK05618.1"
                     /translation="MRPAMQRSGIYRFRLARQSDLAAIVRLLADDNLGGTREIVSDPV
                     DARYLSAFAAIEADANQLLAVANDATDRVVGCLQLSFVPGLSRTGMWRGQIESVRVAS
                     DLRGSGLGSHFIEWAIAQCAERGCGLVQLTPDKTRGDAIRFYERLGFVASHEGLKRNL
                     "
     CDS             complement(161538..162812)
                     /transl_table=11
                     /locus_tag="RL0131"
                     /product="conserved hypothetical exported protein"
                     /db_xref="EnsemblGenomes-Gn:RL0131"
                     /db_xref="EnsemblGenomes-Tr:CAK05619"
                     /db_xref="InterPro:IPR002477"
                     /db_xref="InterPro:IPR011757"
                     /db_xref="InterPro:IPR011970"
                     /db_xref="InterPro:IPR023346"
                     /db_xref="InterPro:IPR031304"
                     /db_xref="UniProtKB/TrEMBL:Q1MN33"
                     /protein_id="CAK05619.1"
                     /translation="MRGLHMLKDGPRRLRIFALALAAALLPLSCYAAPSKADVEVQFE
                     KWVQADLWPEAKANGISEKVFQAAFSGITLNWNLPDLAPPGFPPPKEQKQTQAEFSSP
                     APYFNEDQLKKLAATGRGFAAQYGSTLKRIEKTYGVPGSIVLAIWGRETGFGAAKIPN
                     SAIEVLATKAFMSTRKEMFRTELVAALHILDGGDVTPANFKGSWAGALGQPQFMPTSY
                     LKYAVDFDGDGHRNIWTSVPDTLASIANYLVKKGWQRNRDWGFEVSIPEAVSCAQEGP
                     DLAKPLSHWTSLGIDRISGKGFPSGEMKAEGMMLVPAGRDGPEFIVTPNFYIIKEYNN
                     SDLYALYIGNLADRIAYNGGAFQGKWGDVGKMLRSDVAAMQKALERQGYDVGGSDGLP
                     GYKTRRSIGQWQAKNGMKPTCFPEATMKGKLK"
     CDS             complement(162809..163414)
                     /transl_table=11
                     /gene="recR"
                     /locus_tag="RL0131A"
                     /product="putative recombination protein"
                     /db_xref="EnsemblGenomes-Gn:RL0131A"
                     /db_xref="EnsemblGenomes-Tr:CAK05620"
                     /db_xref="GOA:Q1MN32"
                     /db_xref="InterPro:IPR000093"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR015967"
                     /db_xref="InterPro:IPR023627"
                     /db_xref="InterPro:IPR023628"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MN32"
                     /protein_id="CAK05620.1"
                     /translation="MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLIKKKDQLLG
                     PLSHAMGEAYDKVKICSRCGNVDTVDPCIVCTDVQRDQSVIIVVEDVSDLWALERAGA
                     MNAAYHVLGGTLSPLDGVGPDDLNIRGLIDRVGEGGIRELIIAVNATVEGQTTAHYIT
                     DQLQGLDVKITRLAHGVPVGGELDYLDEGTLAAALRARTVI"
     CDS             163433..164101
                     /transl_table=11
                     /locus_tag="RL0132"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0132"
                     /db_xref="EnsemblGenomes-Tr:CAK05621"
                     /db_xref="GOA:Q1MN31"
                     /db_xref="InterPro:IPR005302"
                     /db_xref="InterPro:IPR011037"
                     /db_xref="InterPro:IPR015808"
                     /db_xref="UniProtKB/TrEMBL:Q1MN31"
                     /protein_id="CAK05621.1"
                     /translation="MERKRNRGRIGHPMKILALCTGNPESLPGKSYKTGIFKHAVTGA
                     VMIDAEGLVGDAICNRKHHGGVDQAVYVEGSLTLDWWSRELGRPYEPGTFGENMVISD
                     LDNRDVAVGDRFLTGDLVLEVTSCRMPCATFAARMADPKFVKRYTAAARPGIYCRVIR
                     GGVVEPGMPMEYTSFSGDKITMPELMEAFGRRLPGADRTRYLAAPIHYKLRAMLESQA
                     DEAR"
     CDS             complement(164124..164447)
                     /transl_table=11
                     /locus_tag="RL0133"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0133"
                     /db_xref="EnsemblGenomes-Tr:CAK05622"
                     /db_xref="GOA:Q1MN30"
                     /db_xref="InterPro:IPR004401"
                     /db_xref="UniProtKB/TrEMBL:Q1MN30"
                     /protein_id="CAK05622.1"
                     /translation="MRDIMGMMGKVKEMQAKMEQMQAEIAELTAEGKAGGGLVTVLIS
                     GKGDLKSLKIDPSLFKEDDVEILEDLIVAAHKDAKDKAEALAAEKTKALTAGLPIPPG
                     FKLPF"
     CDS             complement(164470..166347)
                     /transl_table=11
                     /gene="dnaX"
                     /locus_tag="RL0134"
                     /product="putative DNA polymerase III"
                     /EC_number="2.7.7.7"
                     /db_xref="EnsemblGenomes-Gn:RL0134"
                     /db_xref="EnsemblGenomes-Tr:CAK05623"
                     /db_xref="GOA:Q1MN29"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR012763"
                     /db_xref="InterPro:IPR022107"
                     /db_xref="InterPro:IPR022754"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MN29"
                     /protein_id="CAK05623.1"
                     /translation="MSDTERQSKDAASTGTGYRVLARKYRPKDFTDLMVGQEPMVRTL
                     TNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTSEIDKPTIDLRAPGEHCQAI
                     MEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLSTQAFNGLL
                     KTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFTTIAAKEGIEA
                     EPDALAMIARAAEGSARDGLSLLDQAIAHGAGVVQAEAVRGMLGLADRARIVDLFQHI
                     VKGDVAAALGEFQNQYEAGANPVVVLTDLADFTHLVTRLKYVPDAANDPSLSEVERTK
                     AAEFAKCVAVTTLSRIWQMLLKGIPETEGSSRTAGAAEMVLIRLAHAAHLPAPEDAAR
                     RLAEFSGDNTGPRPSSSPSGNGGGSGTRVPYQSSVAARAAETAPSQPPSSAPVAMLRA
                     VPSSQSETMAVGRIEPKPAEAPKPLVPVNSVNDIVNLATEKRDPKLKAMVRTFLRPVR
                     IEAGRLDVSLAPGAPTTLLNELAVKLKEWTGIHWIVSLSRDEGQPTLVEAEARTREQH
                     VIDARQDPDVAAILAHFPGAKIIDVRVRAPEPEEEGEATPPAAAESEEGDILPGDDIE
                     F"
     CDS             166459..166989
                     /transl_table=11
                     /locus_tag="RL0135"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0135"
                     /db_xref="EnsemblGenomes-Tr:CAK05624"
                     /db_xref="GOA:Q1MN28"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="UniProtKB/TrEMBL:Q1MN28"
                     /protein_id="CAK05624.1"
                     /translation="MASGSSTTNLPDAHIGNIVIKSKPTCEKTASRRKRQEECPLKGF
                     ALDPRLENDSVSIMVTGLCDLRLSKDARWPWLILVPRRADITEIFELTPLDQVLLAFE
                     TELVAKALKKITGATKINIGALGNIVRQLHVHVIARFEGDANWPGPVWGFGRAEPYED
                     GKRDEFTAKLREALSS"
     CDS             166986..167945
                     /transl_table=11
                     /locus_tag="RL0136"
                     /product="putative MutT/nudix family protein"
                     /db_xref="EnsemblGenomes-Gn:RL0136"
                     /db_xref="EnsemblGenomes-Tr:CAK05625"
                     /db_xref="GOA:Q1MN27"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015375"
                     /db_xref="InterPro:IPR015376"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:Q1MN27"
                     /protein_id="CAK05625.1"
                     /translation="MSHSLFDSDVPHPEPSNLTAFAANDLNRDSEHRDEQSVEKALAK
                     EGTHIFAFTRDKLVLKHDGQVLDPLFARYELQELQPDWDETVLLGYRKSGEPRLAVPV
                     GIDVDDLTSQYKPADGRTLFREMLIDEVLLGEFAQAASLIRWNGDNRFCGRCGSAMEI
                     HIGGYKRVCAACEHVIFPRTDPVVIMLTVDEQRDLCLLGRSPHFAPGMYSCLAGFLEP
                     GETIENAVRRETLEESGIRTGRIRYHASQPWPMPHSLMIGCYAEAKSTEISRDETELE
                     DCRWFTREETIEMLERPSATGRASPPKGAIAHRLMRDWVEWKR"
     CDS             167950..168645
                     /transl_table=11
                     /locus_tag="RL0137"
                     /product="putative transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0137"
                     /db_xref="EnsemblGenomes-Tr:CAK05626"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013196"
                     /db_xref="InterPro:IPR026881"
                     /db_xref="UniProtKB/TrEMBL:Q1MN26"
                     /protein_id="CAK05626.1"
                     /translation="MPVARSERLLTLLQTLRRYRRPVTGTVLAQETGVSLRTLYRDIA
                     SLQAQGAMIEGEAGIGYVLKPGFMLPPMMFSEEELEALVLGSRWVARAAEPRLAGAGA
                     DALAKIAAVLPADMREMIDSAALFVGPKRRDEDKADVSAIRRAIRLERILELHYGDEQ
                     GRISRRRVWPFGLGYYEHVRVLMAWCELRQDFRHFRTDRIIDMALHEVRYPRRRTVLL
                     KEWRETQDVPMEN"
     CDS             169172..169540
                     /transl_table=11
                     /locus_tag="RL0138"
                     /product="putative glyoxalase/dioxygenase"
                     /db_xref="EnsemblGenomes-Gn:RL0138"
                     /db_xref="EnsemblGenomes-Tr:CAK05627"
                     /db_xref="GOA:Q1MN25"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="InterPro:IPR026275"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="UniProtKB/TrEMBL:Q1MN25"
                     /protein_id="CAK05627.1"
                     /translation="MTSPNLIILYVKDPGESASFYRNLLNREPAVEAPNFVAFPLEGG
                     FTLGLWRRSKVEPQPSAIGNRGEVAFMVEGENAVARHYEDWRQRGLPIAQELTELDFG
                     PTFVVLDPDGHRLRVCEPDK"
     CDS             complement(169654..170508)
                     /transl_table=11
                     /locus_tag="RL0139"
                     /product="putative P-protein [includes: chorismate mutase
                     and prephenate dehydrogenase]"
                     /EC_number="4.2.1.51"
                     /db_xref="EnsemblGenomes-Gn:RL0139"
                     /db_xref="EnsemblGenomes-Tr:CAK05628"
                     /db_xref="GOA:Q1MN24"
                     /db_xref="InterPro:IPR001086"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR008242"
                     /db_xref="InterPro:IPR018528"
                     /db_xref="UniProtKB/TrEMBL:Q1MN24"
                     /protein_id="CAK05628.1"
                     /translation="MNIKTNRIAFQGEFGANSDMASRDMFPTMEPLPCQTFEDAFTAV
                     DNGDADIGMIPIENTIAGRVADIHHLLPESRLHIIGEYFMPIRFQLMVLPGVTKDEIR
                     TVHSHIHALGQCRKIVRANGWKPVIAGDTAGAAKLVQETGDRSMAALAPRLAADLYGL
                     EIIAENVEDTENNVTRFVVLSRDEEWAQRNSAEEKVVTTFVFNVRNIPAALYKALGGF
                     ATNNINMTKLESYQLGGKFVATQFYADIEGHPNDPNVRRALEELRFFSEKVRILGVYK
                     GHAMRGLL"
     CDS             complement(170519..171274)
                     /transl_table=11
                     /gene="kdsB"
                     /locus_tag="RL0140"
                     /product="putative 3-deoxy-manno-octulosonate
                     cytidylyltransferase (CMP-KDO synthetase)
                     (CMP-2-keto-3-deoxyoctulosonic acid synthetase)"
                     /product="3-deoxy-manno-octulosonate cytidylyltransferase
                     (EC 2.7.7.38) (CMP-KDO synthetase)
                     (CMP-2-keto-3-deoxyoctulosonic acid synthetase) (CKS)."
                     /EC_number="2.7.7.38"
                     /db_xref="EnsemblGenomes-Gn:RL0140"
                     /db_xref="EnsemblGenomes-Tr:CAK05629"
                     /db_xref="GOA:Q1MN23"
                     /db_xref="InterPro:IPR003329"
                     /db_xref="InterPro:IPR004528"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MN23"
                     /protein_id="CAK05629.1"
                     /translation="MSDSNLDGVLVLIPARMASTRLPGKPLADICGLPMIVQVAMRAR
                     EAAIGRVVVAVDETRVFDAVAAAGFEVVMTRVDHQSGSDRIFEALTKVDPEGKAKIIV
                     NIQGDLPTIDPETVRAALRPLENEAVDIGTLTTEIDNEEDKTAPHIVKIIGSPISGNR
                     LHALYFTRATAPYGQGPLYHHIGLYAYRRAALERFVSLGPSTLEKRESLEQLRALEAG
                     MRIDAEVVDTVPLGVDTPADLEKARRILSAKSN"
     CDS             171429..171992
                     /transl_table=11
                     /gene="cycM"
                     /locus_tag="RL0141"
                     /product="memmbrane-bound cytochrome c"
                     /db_xref="EnsemblGenomes-Gn:RL0141"
                     /db_xref="EnsemblGenomes-Tr:CAK05630"
                     /db_xref="GOA:Q1MN22"
                     /db_xref="InterPro:IPR002327"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="UniProtKB/TrEMBL:Q1MN22"
                     /protein_id="CAK05630.1"
                     /translation="MNSYVNTAVGALLGTIFVLMSVSIASEGIFHSEAPEKEGFAIVA
                     EEAPAAGGEAAPAVAVPIAQLLASADAKAGETVFKKCQACHDGTKGGPNKVGPNLFGV
                     VDRPIASHAGFAYSAPMKDFSKGGSEKWTFEYLNKFLLAPKKDIPGTAMGFAGLAKDQ
                     ERANVILYLHTLADSPGPLPDPNAATQ"
     CDS             complement(172062..173009)
                     /transl_table=11
                     /locus_tag="RL0142"
                     /product="putative transmembrane permease protein"
                     /db_xref="EnsemblGenomes-Gn:RL0142"
                     /db_xref="EnsemblGenomes-Tr:CAK05631"
                     /db_xref="GOA:Q1MN21"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:Q1MN21"
                     /protein_id="CAK05631.1"
                     /translation="MSAIIFDVLPVFILILIGWVIVRSGLMASNVGEALSEFVFKIAV
                     PLLLFRTIAEADFHGASPFRLWIVYFSGVAITWTAGHIAATRLFGRDERIGVLAGVSS
                     AFANNIFIGLPLVERTVGDEGLVALSILLAVHLPVMMVAGTVLMEHAERKIAGKSDRS
                     MVLVLRQIAVNLVRNPLVIGLAAGMAMHLSGLTMPTTLATVVGQIAGIAGPAALISLG
                     MALERYGVSGNLGIASVTSSLKLLLLPGCVWAASRLLGLSPEWTAAIVLTSSVPTGVN
                     AWLIANRFGVGHSLAASTITVTTALGAITVSLWAYFLGA"
     CDS             173497..174489
                     /transl_table=11
                     /locus_tag="RL0143"
                     /product="putative Pfk family kinase"
                     /db_xref="EnsemblGenomes-Gn:RL0143"
                     /db_xref="EnsemblGenomes-Tr:CAK05632"
                     /db_xref="GOA:Q1MN20"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q1MN20"
                     /protein_id="CAK05632.1"
                     /translation="MTRFDVLTVGNAIVDIIARCDDQFLIDNQITKAAMNLIDAERAE
                     LLYSRMGPALEASGGSAGNTAAGVASLGGKAAYFGNVAQDQLGDIFAHDIRAQGVHYQ
                     TRPKGTFPPTARSMIFVTEDGERSMNTYLGACVELGPEDVETDVVADAKVTYFEGYLW
                     DPPRAKEAILDCARIAHENGREMSMTLSDSFCVDRYRGEFLDLMRSGKVDIVFANRQE
                     ALSLYETDDFEEALNRIAADCKIAAVTMSEDGAVILKGRERFYVDAIRIREVVDTTGA
                     GDLFASGFLYGYTQGRSLEDCGKLGCLAAGIVIQQIGPRPMTSLSEAAKRAGLI"
     CDS             complement(174482..175021)
                     /transl_table=11
                     /locus_tag="RL0144"
                     /product="conserved hypothetical protein"
                     /note="Similar, but truncated at the N-terminus, to
                     Agrobacterium tumefaciens (strain C58/ATCC 33970)
                     Hypothetical protein Atu0078 (200 aa), fasta
                     scores:E()=1.4e-52, 73.889% id in 180 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0144"
                     /db_xref="EnsemblGenomes-Tr:CAK05633"
                     /db_xref="InterPro:IPR003646"
                     /db_xref="InterPro:IPR010466"
                     /db_xref="UniProtKB/TrEMBL:Q1MN19"
                     /protein_id="CAK05633.1"
                     /translation="MRSKVLKSCLALAIALAASMGSVEFAHAQAAKGPSGLPLPRFVT
                     LKSKRVNLRIGPGTDYAVSWMYLKSGLPVEIIQEYDNWRRIRDADGTEGWVNQSLLSG
                     QRAAIAAPWMKTKGKGIYVNLRREAQPSASIVAKLEPGVMLTIGECNGDWCRAESDGA
                     SGWVAQSEIWGAYPGEAFK"
     CDS             175207..176208
                     /transl_table=11
                     /gene="gyaR1"
                     /locus_tag="RL0145"
                     /product="putative glyoxylate reductase"
                     /EC_number="1.1.1.26"
                     /db_xref="EnsemblGenomes-Gn:RL0145"
                     /db_xref="EnsemblGenomes-Tr:CAK05634"
                     /db_xref="GOA:Q1MN18"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:Q1MN18"
                     /protein_id="CAK05634.1"
                     /translation="MTAKKKPKVYITRKLPDAVETRMRELFDAELNIDDAPRSVPELI
                     AAVKTADVLVPTVTDRIDAALIEQAGPQMKLIASFSNGTDHIDVEAAARKGITVTNTP
                     NVLTEDTADMTMALILAVPRRLGEGARVLTDKPGEWAGWSPTWMLGRRIHGKRIGIVG
                     MGRIGTAVARRAKAFGLSIHYHNRKRVNPAVEDELEATYWESLDQMLARVDIVSVNCP
                     STPATFHLISARRLALLQPTAYLVNTARGDVVDEAALIKCLREGRIAGAGLDVFENEP
                     AVNPRLIKLANEGKVVLLPHMSSATIEGRIDMGDKVIINIRTFIDGHRPPNRVLPGR"
     CDS             complement(176222..176710)
                     /transl_table=11
                     /locus_tag="RL0146"
                     /product="putative acetyltransferase"
                     /db_xref="EnsemblGenomes-Gn:RL0146"
                     /db_xref="EnsemblGenomes-Tr:CAK05635"
                     /db_xref="GOA:Q1MN17"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q1MN17"
                     /protein_id="CAK05635.1"
                     /translation="MRIVPLDQTFTRWDELLALILSAFASMNGRIDPPSSALKLTTAS
                     LAEKAGTEIGHVAIDGEKLIGCLFLRPEADCLYVGKLAVLPEVQGKGLGKRLLALAEE
                     TAAALDLPALRLETRIELTDNHAVFAAWGFCRTAEKAHPGFARTTFVEMRKVLAPPIC
                     VA"
     CDS             complement(176707..177531)
                     /transl_table=11
                     /locus_tag="RL0147"
                     /product="putative molydopterin synthase sulfurylase"
                     /db_xref="EnsemblGenomes-Gn:RL0147"
                     /db_xref="EnsemblGenomes-Tr:CAK05636"
                     /db_xref="GOA:Q1MN16"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MN16"
                     /protein_id="CAK05636.1"
                     /translation="MTEAAFPGVGRHDNIGAMEPLSPEEIARYHRHILLPEIGGAGQQ
                     KLKAARVLVIGAGGLGAPVLQYLAAAGVGTLGIVDDDRVSLSNLQRQVIHDSGTIGEL
                     KTESAAFAIARLNPHVRLIRFEERFSPEAARRQLSGFDLLIDGSDNFDTRYAAADAAD
                     EARIPLVTGAVGRFDGSLTVLKPYETAEDGTPNPRYRDLFPEAPPAGLIPACAEAGII
                     GALTGVIGTMMAMEAIKLVTGIGEPLVGRLLLYDALSARFDTIRYKRRRTTQRQAG"
     CDS             complement(177528..178652)
                     /transl_table=11
                     /gene="recF"
                     /locus_tag="RL0148"
                     /product="putative DNA replication and repair protein"
                     /db_xref="EnsemblGenomes-Gn:RL0148"
                     /db_xref="EnsemblGenomes-Tr:CAK05637"
                     /db_xref="GOA:Q1MN15"
                     /db_xref="InterPro:IPR001238"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR018078"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MN15"
                     /protein_id="CAK05637.1"
                     /translation="MPHKVSLSRLKLTDFRNYAAAALALDGRHAVLTGDNGAGKTNLM
                     EAVSLLSPGRGLRRAAYGDITRVGAAGGFSIFAALDGMEGDVEIGTGIETGEETTARK
                     LRINGTTAKTADELTDHLRLLWLTPAMDGLFTGASSDRRRFLDRLVLSLDPAHGRRAS
                     DFERAMRSRNKLLDEGRFDPSWLAGIEEQMASLGIAMALARQEMLGLLTRLIEETRET
                     SPFPSASLQLSGFMDGQFSRPSVDLEDDYAAMLAESRYRDAGAGRTLEGPHRADLIVH
                     HREKAMEAERCSTGEQKALLVGLVLAHARLVGNLTGHAPILLLDEIAAHLDEGRRAAL
                     FDLIDGLGGQAFMTGTDRAMFSALGDKAQFFTVADGRVFE"
     CDS             179034..179399
                     /transl_table=11
                     /locus_tag="RL0149"
                     /product="putative HTH-type transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0149"
                     /db_xref="EnsemblGenomes-Tr:CAK05638"
                     /db_xref="GOA:Q1MN14"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="UniProtKB/TrEMBL:Q1MN14"
                     /protein_id="CAK05638.1"
                     /translation="MPDPVDIIVGRNVRQFRALRRVSQLELGEALGLTFQQIQKYEKG
                     ANRVSASKLHQIAVFLDVDISALFEGAGMSPFGSRVELSPDAYALALSYDKLNSPAGK
                     EAVKTIVTLMTGESAETTA"
     CDS             complement(179558..179758)
                     /transl_table=11
                     /locus_tag="RL0150"
                     /product="conserved hypothetical protein"
                     /product="hypothetical protein smc02277"
                     /db_xref="EnsemblGenomes-Gn:RL0150"
                     /db_xref="EnsemblGenomes-Tr:CAK05639"
                     /db_xref="UniProtKB/TrEMBL:Q1MN13"
                     /protein_id="CAK05639.1"
                     /translation="MAPAFSSQSEDVDVLAGAIYTWCAERNIKLRSQQGLSIASIAID
                     LYHAGHQTQDDLLMALHECELH"
     CDS             complement(180070..181197)
                     /transl_table=11
                     /gene="dnaJ"
                     /locus_tag="RL0151"
                     /product="putative chaperone protein"
                     /db_xref="EnsemblGenomes-Gn:RL0151"
                     /db_xref="EnsemblGenomes-Tr:CAK05640"
                     /db_xref="GOA:Q1MN12"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MN12"
                     /protein_id="CAK05640.1"
                     /translation="MAKADFYETLGVAKSADEKELKSAFRKLAMKYHPDKNPDDKDAE
                     RKFKEINEAYEMLKDPQKRAAYDRYGHAAFEHGGMGGGGGGFAGGGFSDIFEDIFGEM
                     MGGGRARQRSSGGRERGADLRYNMEITLEESFSGKTAQIRVPTSITCDVCSGSGAKPG
                     TQPKNCGTCQGTGRVRAAQGFFSIERTCPTCHGRGQIIPDPCPKCHGQGRVTEERSLS
                     VNIPAGIEDGTRIRLQGEGEAGARGGPAGDLYIFLSVKPHEFYQRDGADLYCAVPISM
                     TTAALGGTFDVATLDGTKSRVTVPEGTQVGKQFRLKGKGMPVLRSVQTGDLYIQIQIE
                     TPQKLTKRQRELLQEFEQLSSKENNPESTGFFARMKEFFEG"
     CDS             complement(181283..183199)
                     /transl_table=11
                     /gene="dnaK"
                     /locus_tag="RL0152"
                     /product="putative heat shock chaperone protein"
                     /db_xref="EnsemblGenomes-Gn:RL0152"
                     /db_xref="EnsemblGenomes-Tr:CAK05641"
                     /db_xref="GOA:Q1MN11"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MN11"
                     /protein_id="CAK05641.1"
                     /translation="MAKVIGIDLGTTNSCVAVMDGKDAKVIENAEGARTTPSMVAFSD
                     DGERLVGQPAKRQAVTNPTNTLFAVKRLIGRRYEDPTVEKDKHLVPFTIVKGDNGDAW
                     VEANGKGYSPAQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDAQRQATKDAGRI
                     AGLEVLRIINEPTAAALAYGLDKKEGKTIAVYDLGGGTFDISILEIGDGVFEVKSTNG
                     DTFLGGEDFDMRLVEYLVGEFKRDNGIDLKNDKLALQRLKEAAEKAKIELSSSQQTEI
                     NLPFITADASGPKHLTLKLTRAKLESLVDDLVQRTIAPCKAALKDAGVTAAEIDEVVL
                     VGGMSRMPKVQEVVKQLFGKEPHKGVNPDEVVALGAAIQAGVLQGDVKDVLLLDVTPL
                     SLGIETLGGVFTRLIERNTTIPTKKSQTFSTAEDNQQAVTIRVSQGEREMAADNKLLG
                     QFDLVGLPPSPRGMPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLSDADIE
                     KMVKDAEAHATEDKKRREAVEARNQAESLIHSSEKSLKDYGDKVSEADRTAISDAIAA
                     LKTASEASEPDADDIKAKTQTLMEVSMKLGQAIYEAQQAEGGAAGDASAESGDNVVDA
                     DYEEIKDDDRKKSA"
     CDS             complement(183536..185872)
                     /transl_table=11
                     /locus_tag="RL0153"
                     /product="putative penicillin-binding
                     transpeptidase/transglycosylase protein"
                     /db_xref="EnsemblGenomes-Gn:RL0153"
                     /db_xref="EnsemblGenomes-Tr:CAK05642"
                     /db_xref="GOA:Q1MN10"
                     /db_xref="InterPro:IPR001264"
                     /db_xref="InterPro:IPR001460"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="InterPro:IPR023346"
                     /db_xref="UniProtKB/TrEMBL:Q1MN10"
                     /protein_id="CAK05642.1"
                     /translation="MAGRGRSGDRIEPSFSGRPARDDDEFSLDADDRIAGGRSQRRGG
                     SKPPPQRAAPRRRREPPEREGGGFFGFMRRVIYWCVVLFIWAGIGVAGLVVYYGSRMP
                     SASTWAIPERPPNVKITAVDGSVIANRGATGGEALSLENMSPYIPEAVIAIEDRRFYS
                     HFGVDPLGLGRAIVTNLTAGHMVQGGSTLTQQLAKNLFLSPERTLERKVQEVLLSLWL
                     EQKYTKDQILAMYLNRVFFGSNAYGVEAASRRYFNKSARDVNLGEAAVLAGLLKAPSR
                     LSPARDAEAANARAQLVLAAMREQGFITDSEVKTAMSQTPASAKSYWSGAGHYVADMV
                     MDELPGLIGDVKEDVIVDTTIDKSLEKKAEQSLVDILDKEGGKLDASQAALVSIDGTG
                     AIRALVGGRDYATSQFNRAVKAKRQPGSSFKPFVYAAALEKGLTPYSVFNDAPIRIGD
                     WTPENYEKKYNGEVTLATALAKSLNTVAAQLVMYDGPDQVIKLAHRLGIESELQPNAS
                     IALGTSEVSLMELTASYAAFMNGGYKATPHVIRRVTTAEGKVLYENTYDSPPRVLSEQ
                     IAAEMDAMMMGVIDNGTGKSAKIPGWQAAGKTGTTQNSRDALFVGFTSNLTTGVWFGN
                     DDGKPMKKVTGGGLPAKAWKEFMIAAHKGLSPAPLFGNGQLIADPNNGQPMAEAPGNG
                     QLGSGQPMTAEAPPSTIGGIISGVFGGNDNANRYPQAPVRQQAATSGSGPVPPADIAE
                     GGGSGYEGMVPPGDVGGAQTTSSVQPRRTTLLDLIMGQ"
     CDS             complement(186083..186304)
                     /transl_table=11
                     /locus_tag="RL0154"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:RL0154"
                     /db_xref="EnsemblGenomes-Tr:CAK05643"
                     /db_xref="UniProtKB/TrEMBL:Q1MN09"
                     /protein_id="CAK05643.1"
                     /translation="MTQDYLAFLGLFAPRAAAIDVTVWHKHNPILPVRLTDGANLNPS
                     GQIWRRFHLGEWEYKQDPETLDDYEARQF"
     CDS             complement(186908..187558)
                     /transl_table=11
                     /locus_tag="RL0155"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0155"
                     /db_xref="EnsemblGenomes-Tr:CAK05644"
                     /db_xref="InterPro:IPR003646"
                     /db_xref="UniProtKB/TrEMBL:Q1MN08"
                     /protein_id="CAK05644.1"
                     /translation="MKNLIVKVAAAAMLVLAPAIAQAAEGYSTANVNMRAGPSTRYPA
                     VAVVPAGSSVEIRGCLSNVNWCDVEFYGGRGWVSGQYVQAVYQQRRVYVGPQYYRPLG
                     IPMVSFSVGNYWDRYYRNRDFYRERDRWSRGPDYYYRDRVYRDRDRDWSDDKRRDDRR
                     DDIRRSDRRDNDNRGNTRSSDFRDLPQFNGGKADTYNRPDPRASPFVCRPGDPSCD"
     CDS             complement(187564..187821)
                     /transl_table=11
                     /locus_tag="RL0156"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:RL0156"
                     /db_xref="EnsemblGenomes-Tr:CAK05645"
                     /db_xref="UniProtKB/TrEMBL:Q1MN07"
                     /protein_id="CAK05645.1"
                     /translation="MESHGPTALKVHAFAISQGLSRTRYCVTKFPPFKLRSSPPEYKL
                     LKDNENSGALTNASDRSMFCSRWHMPRKRSQALLEKRANEE"
     CDS             complement(187987..189444)
                     /transl_table=11
                     /locus_tag="RL0157"
                     /product="putative peptidase"
                     /note="Similar to Bacillus clausii KSM-K16. Deacylase.
                     Q5WDJ9 (EMBL:AP006627) (432) fasta scores: E()=3.8e-37
                     33.183% id in 443 aa, and to Agrobacterium tumefaciens
                     (strain C58/ATCC 33970). AGR_C_165p. Q7D266
                     (EMBL:AE007952) (507) fasta scores: E()=4.1e-158 82.062%
                     id in 485 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0157"
                     /db_xref="EnsemblGenomes-Tr:CAK05646"
                     /db_xref="GOA:Q1MN06"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:Q1MN06"
                     /protein_id="CAK05646.1"
                     /translation="MFFRLACLSGLVYRPAEFQKESKMTDVNQVLARADQNLSSSLDK
                     LFELLRIQSISTDPAYKAECRKAAEWLVAYLEGLGFTASVRDTPGHPMVVAHHAGASA
                     DAPHVLFYGHYDVQPVDPIELWENDPFEPSIKDVGEGRKILTGRGTSDDKGQLMTFVE
                     ACRAYKEINGALPCRVTILFEGEEESGSPSLKPFLEANATELKADYALVCDTGMWDRD
                     TPAIAAALRGLVGEEVIVTAADRDLHSGLFGGAAANPIHILVKALAGLHDETGRITLD
                     GFYEGVEETPDNIKASWETLGKTAESFLGEVGLSIPSGEKGRSVLELTWARPTAEING
                     IWGGYTGEGFKTVIAAKASAKVSFRLVGTQDPAAIREAFRSYISSKIPADCSVEFHPH
                     GGSPAIHLSYDSPVLTKAKNALSDEWPKPAIVIGMGGSIPIVGDFQKMLGMESLLVGF
                     GLSDDRIHSPNEKYELVSYHKGIRSWVRILEALAA"
     CDS             189588..191972
                     /transl_table=11
                     /locus_tag="RL0158"
                     /product="putative GGDEF/EAL domain transcriptional
                     regulator"
                     /note="Codons 260 to the C-terminus are similar to codons
                     740 to the C-terminus of Pseudomonas putida. morA Q7WYW5
                     (EMBL:AY323811) ( MorA.) fasta scores: ungapped id 40.600%
                     length=1282 id in E(), and to Agrobacterium tumefaciens
                     (strain C58/ATCC 33970). GGDEF family protein. Q8U728
                     (EMBL:HS161255) (779) fasta scores: E()=2.7e-134 49.935%
                     id in 773 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0158"
                     /db_xref="EnsemblGenomes-Tr:CAK05647"
                     /db_xref="GOA:Q1MN05"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="InterPro:IPR005330"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q1MN05"
                     /protein_id="CAK05647.1"
                     /translation="MFSVITCIRDNHDWRLVLAAAAVCLVGTMAAMLLLSRAQECDAG
                     RRKLWIGASAFAFGTGVWATHFIAMLAYDGGMPIGYQLGLTALSFLLSVVGSWAAILV
                     ASESRGRFSRIRGGVLMALGIASMHLTGMQAIETQAAILYDPFMTLSAVLAGALLSSA
                     AFHAFFQSKGLRRLLASSITFVLAICALHFISMASITLVPDPGKEVPATVLDASLLAA
                     IVVVAATTLILIALAVVFIESHLTDLKGLANASQEGLLILREGRIIDANERFQGLSGW
                     KLAGLSGKAPSAVLTAVQGTGQNRPSETVLNTRDGREIAVEVTASRIVYRGHNCEVLA
                     VRDLTERRQAEEMIEHLAHHDVLTDLPNRSLFDTRIRQALQMAERKNSEVALFYLDLD
                     RFKAVNDIFGHAEGDRILRKVASILRRVADESDTVARLGGDEFAIIQLAGQQPAAAQK
                     LAADILGEFAAEMDTARDPTAVGVSVGIALYPTDGAAAEELCNNADTALYRVKHDGRG
                     KICFFDAEMDKAARNRRQIESELRHAIIRNQIHVSYQPILDALSGEIGGYEALMRWNR
                     PGHGLTEPDIFISIAEESGSIVQLGEWVLQQACREAVRWPLPLMIAVNLSPVQFMLPN
                     LCERIEAILAETGLAPSRLELEITEAALIRDRDRVMTTLLRLHKLGVHIVMDDFGTGF
                     SSLSNLRSFPFDKIKVDRSFTGVLEHDAGARSIVRAIIGLGHSLGMPVVTEGVETEMQ
                     RRIVVEEGCAQVQGLLLGKPDIEPSIKLAAHENVLTAQIETGVSSLRRAQGAGE"
     CDS             complement(192083..192499)
                     /transl_table=11
                     /locus_tag="RL0159"
                     /product="putative MarR family transcriptional regulator
                     protein"
                     /db_xref="EnsemblGenomes-Gn:RL0159"
                     /db_xref="EnsemblGenomes-Tr:CAK05648"
                     /db_xref="GOA:Q1MN04"
                     /db_xref="InterPro:IPR000835"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR023187"
                     /db_xref="UniProtKB/TrEMBL:Q1MN04"
                     /protein_id="CAK05648.1"
                     /translation="MDSGAYLASQLAKGFARSLHQRAVGLGFSPGQFPILLELWAEDG
                     LTQKQLLERVDIEQATMANTLSRMVRDGLIERRPHPSDKRAQLLFLTPRARAMEAEAI
                     ETAREADLALFKGFRVFERELTLEYIRRLLENAKAL"
     CDS             192994..196044
                     /transl_table=11
                     /gene="polA"
                     /locus_tag="RL0160"
                     /product="putative DNA polymerase I"
                     /EC_number="2.7.7.7"
                     /db_xref="EnsemblGenomes-Gn:RL0160"
                     /db_xref="EnsemblGenomes-Tr:CAK05649"
                     /db_xref="GOA:Q1MN03"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="InterPro:IPR002298"
                     /db_xref="InterPro:IPR002421"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="InterPro:IPR018320"
                     /db_xref="InterPro:IPR019760"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR020046"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q1MN03"
                     /protein_id="CAK05649.1"
                     /translation="MPNSIWTSSHARAIHARMKKGDHLFLVDGSGFIFRAFHALPPLT
                     RKTDGLPIGAVSGFCNMLWKLLRDARNTDVGVTPTHLAVIFDYSARTFRKDLYDAYKA
                     NRSAPPEELIPQFGLIREATRAFNLPCIETEGFEADDIIATYARQAEATGADVTIVSS
                     DKDLMQLVSPNVHMYDSMKDKQIGIPDVVEKWGVPPEKMIDLQAMTGDSVDNVPGIPG
                     IGPKTAAQLLEEYGDLDTLLERATEIKQVKRRETILANIDMARLSRDLVRLRTDVPLD
                     LDLDALVLEPQNGPKLIGFLKTMEFTTLTRRVAEACDCDASAIEPAIVRIEWGEKARG
                     PDLDAAEPEPVAGGIPDVSGESVPVPPRAKAKTAVEGAFSPADLAKARAEAFATLPFD
                     HSAYVTIRDLATLDRWIADARATGLVAFDTETTSLDAMQAELVGFSLAIADNTADPTG
                     TKIRAAYVPLVHKNGVGDLLGGGLAENQIPMGDALARLKALLEDESILKVAQNLKYDY
                     LLMKRYGIETRSFDDTMLISYVLDAGTGAHGMDPLSEKFLGHTPIPYKDVAGSGKANV
                     TFDLVDIDRATHYAAEDADVTLRLWLVLKPRLAAAGLTSVYERLERPLLPVLARMEAR
                     GITVDRQILSRLSGELAQSAARLEDEIYVLAGERFNIGSPKQLGDILFGKMGLSGGSK
                     TKTGQWSTSAQVLEDLAAAGFELPRKIVDWRQVTKLKSTYTDALPGYVHPETKRVHTS
                     YSLASTTTGRLSSSEPNLQNIPVRTAEGRKIRTAFISTPGHKLISADYSQIELRVLAH
                     VAEIPQLTKAFEDGVDIHAMTASEMFGVPVEGMPGEVRRRAKAINFGIIYGISAFGLA
                     NQLSIERSEAGDYIKKYFERFPGIRDYMESRKAMARDKGYVETIFGRRINYPEIRSSN
                     PSVRAFNERAAINAPIQGSAADVIRRAMIKIEPALVEVGLADRVRMLLQVHDELIFEV
                     EDEDVEKAMPVIVSVMENATMPALEMRVPLRVDARAATNWDEAH"
     CDS             196319..198664
                     /transl_table=11
                     /locus_tag="RL0161"
                     /product="putative cell division DNA translocase protein"
                     /note="Codons 60 to the C-terminus are similar to codons
                     650 to the C-terminus of Escherichia coli. ftsK FTSK_ECOLI
                     (EMBL:A64828) ( DNA translocase ftsK.) fasta scores:
                     ungapped id 47.076% length=1329 id in E(), and codons 180
                     to the C-terminus are similar to Rhizobium meliloti
                     (Sinorhizobium meliloti). Putative cell division protein
                     FtsK like protein. Q92TK5 (EMBL:C96030) (611) fasta
                     scores: E()=9.9e-133 79.500% id in 600 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0161"
                     /db_xref="EnsemblGenomes-Tr:CAK05650"
                     /db_xref="GOA:Q1MN02"
                     /db_xref="InterPro:IPR002543"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018541"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MN02"
                     /protein_id="CAK05650.1"
                     /translation="MRFPRTNLTDAGDFSSEIETDLPEENPGEKPAAPIWQSNFSLAP
                     NVRFTRTPETLISRRRAPNEPVRDDSQIGQQAIRIEPVAVDVPFDIYLPEPDEISAAP
                     QRIELQQSPLLDEAAAPAFRASAELSSISDFAFWEVMAFEEAEPVRAPPLISFPKTET
                     SPESITSLFRIMEWRPGRPAPAQVVSRPAPQPAAVSAKVAVRPAAAISLEKPRRIAVE
                     APVMLAPQAAPTPQLAPAPHIASAPQAAPAPQRTPPVAAVLPSPRLAARPEKIDASGY
                     EFPPRALLQEPPERLGEIMSQETLEQNAGLLESVLEDFGIKGEIIHVRPGPVVTLYEF
                     EPAPGVKSSRVIGLADDIARSMSALSARVAVVPGRNVIGIELPNVTRETVYFREMIES
                     QDFEKSGYKLALGLGKTIGGEPVIAELAKMPHLLVAGTTGSGKSVAINTMILSLLYRM
                     TPEQCRLIMVDPKMLELSVYDGIPHLLTPVVTDPKKAVMALKWAVREMEERYRKMSRL
                     GVRNIDGYNDRVAQAREKGETIHVMVQVGFDKGTGTPIEESQALDLTPMPYIVVIVDE
                     MADLMMVAGKDIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPTRISFQV
                     TSKIDSRTILGEQGAEQLLGQGDMLHMQGGGRISRVHGPFVSDVEVEKVVAHLKTQGR
                     PEYLDTVTADEEEETEEEEAGAVFDKSAMASEDGNELYEQAVKVVMRDKKCSTSYIQR
                     RLGIGYNRAASLVERMEKEGLVGPANHVGKREIVSGRGDGE"
     CDS             complement(198700..199203)
                     /transl_table=11
                     /locus_tag="RL0162"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0162"
                     /db_xref="EnsemblGenomes-Tr:CAK05651"
                     /db_xref="InterPro:IPR007344"
                     /db_xref="UniProtKB/TrEMBL:Q1MN01"
                     /protein_id="CAK05651.1"
                     /translation="MRAIKVVDYDPSWPRLFAEISAEVSALLGDRLLSIDHIGSTSVP
                     GLAAKPKIDLAAVMISDAFLPAAIEIVRAADFVFHGDTGEQRWAFTRDHDGYGFRLYL
                     CGPDNRAHRGRILFRDYLRNHPERAKAYADLKRRLAAEADDDWDFYTGGKTDFVSETV
                     RLAALKT"
     CDS             complement(199223..199819)
                     /transl_table=11
                     /gene="phnN"
                     /locus_tag="RL0163"
                     /product="putative ATP-binding phosphonate metabolism
                     protein"
                     /db_xref="EnsemblGenomes-Gn:RL0163"
                     /db_xref="EnsemblGenomes-Tr:CAK05652"
                     /db_xref="GOA:Q1MN00"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="InterPro:IPR012699"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MN00"
                     /protein_id="CAK05652.1"
                     /translation="MMSHEPHAGAGAERGTMVVVVGPSGAGKDTLMNLAARRFKGRED
                     VHFVRRVITRHRDAGGEDHLSVSLQGFAAMEQSGSFAVWWEAHGLKYGIPAEISVALS
                     KGHIVVANGSRSALHRFQAAFPRLKVINVTARPEVLAGRLETRGRETHEDIMARLARG
                     PLTVRGEYDVVELDNSGSLEEAEQKMIEILNGLLTKTP"
     CDS             complement(199816..200988)
                     /transl_table=11
                     /gene="phnM1"
                     /locus_tag="RL0164"
                     /product="putative phosphonate metabolism protein"
                     /db_xref="EnsemblGenomes-Gn:RL0164"
                     /db_xref="EnsemblGenomes-Tr:CAK05653"
                     /db_xref="GOA:Q1MMZ9"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR012696"
                     /db_xref="InterPro:IPR013108"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="UniProtKB/TrEMBL:Q1MMZ9"
                     /protein_id="CAK05653.1"
                     /translation="MPAPKAERPDAMSKETVFSNARIVLEDDILSGSILIRDGKIADI
                     SEGNSVAGEDFEGDYMIPGLVELHTDHLEGHYQPRPGIRWNKTAAVQAHDAQIVTSGI
                     TTVFDCLRMGADEDGGFEHGEMREMADAIQSAETEGRLRAEHLIHLRCEVSADNVLEH
                     FADFESDRHVRLVSLMDHAPGQRQFQTMDQYIFYYQKKRGLSDEAFARFVAKRQAESA
                     RNSTPHRNAIAKVCAERGITVASHDDATLSHVDEAIDNGVRLAEFPTSFDAARASHEH
                     GMSVLMGAPNIVRGKSHSGNIAARDLAEMGVLDVLSSDYVPLSLLHAPFILADEVESI
                     SLPKAIAMVTSTPARTVSLDDRGRIATGLRADLVRVHRSHGVPVTRSVWRQGRRVA"
     CDS             complement(200969..201664)
                     /transl_table=11
                     /locus_tag="RL0165"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0165"
                     /db_xref="EnsemblGenomes-Tr:CAK05654"
                     /db_xref="InterPro:IPR009389"
                     /db_xref="UniProtKB/TrEMBL:Q1MMZ8"
                     /protein_id="CAK05654.1"
                     /translation="MRYALYFSPPKDDPLTGAASLWLGRNAFTGETYPAPEHEQLGAA
                     EQFELTADPRRYGFHATIKAPFSLASSVTEKDLMTVAEDFARRTQAFEIPELVLGQLG
                     RFFALVPGSLHQPLQDFAAKVVRSFEPFRAALSETDMARRNPEKLSDSQRAHLKRWGY
                     PYVMEDFGFHMTLSGQVPETRAEVMKAILTERFANFTGRPLSISGLAVFIEETRGAPF
                     KVHSWLPLAGAKS"
     CDS             complement(201786..203138)
                     /transl_table=11
                     /gene="phoT"
                     /locus_tag="RL0166"
                     /product="putative permease component of phosphate uptake
                     ABC transporter protein"
                     /db_xref="EnsemblGenomes-Gn:RL0166"
                     /db_xref="EnsemblGenomes-Tr:CAK05655"
                     /db_xref="GOA:Q1MMZ7"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR005769"
                     /db_xref="UniProtKB/TrEMBL:Q1MMZ7"
                     /protein_id="CAK05655.1"
                     /translation="MSSVPTINAAERERLLSAYPDVFHRSFMQRWGLLLISAAVFVYL
                     AFCFAFFNVIPTFVNGNWDRAAIYVQDWYSWRAQPRLRFQNDQVVPQWTSRRQYPEGA
                     DINWLKPNADGSRYTVTFGSDGDRMEVTPSRVDVYIDGKLYPVTITHDRASLPSDAPA
                     RMQQDDNKVNVYYGFAGQAEIRTNQVYIQRRFLGWANFFFDTHSPFWGRSLPEVVGLM
                     FSGERLDPNQSNASLALDNFLNNASWQHGDILSKLMQTLVMAFVGTLFGTLVAFPLAF
                     IAARNIMRSRAANWGTKRLFDFLRSIDMLIWALFFTRAFGPGPLPGIAAIFFTDTGAL
                     GKVYAEALENIDDKQREGVRSVGAAPVAVQRYGVIPQVLPVFISQSLYFWESNTRSAT
                     AIGAVGAGGIGLKLLESMKTNSDWDKVAYMVLLILLVVFAFDNLSNALRSRVMGKKGH
                     "
     CDS             complement(203138..204118)
                     /transl_table=11
                     /gene="phoE"
                     /locus_tag="RL0167"
                     /product="putative permease component of phosphate uptake
                     ABC transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0167"
                     /db_xref="EnsemblGenomes-Tr:CAK05656"
                     /db_xref="GOA:Q1MMZ6"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR005769"
                     /db_xref="UniProtKB/TrEMBL:Q1MMZ6"
                     /protein_id="CAK05656.1"
                     /translation="MAHSAGADSLSGLQEGSRTILDHYQSQVRTRRIYTVVSIVVFLI
                     ILGASLDFANSANSGKFFERLPYFFDFMKSFVPDSPLEIFRAMFDLPSPFSDGSIKYD
                     YTSDRVWITDSFYIPNFFYQLAITLNIAIVSTILGASGAFLLCFFASTNLVGAGVTRW
                     VVRRIMEIMRAFPEIVVAGLLAAILSIGPISAIIAVWVHTVGALGKLFFEVVENADMK
                     PDEGLRAAGAGWLERVRFAILPQVLPNFVSYTLLRTEINVRASTIIGAVGGGGIGEVF
                     SLSIGRDHAAKTYAIIILLLITVICVDQFSAWLRRRLIGKQSFEFGQGAA"
     CDS             complement(204187..205110)
                     /transl_table=11
                     /gene="phoD"
                     /locus_tag="RL0168"
                     /product="putative solute-binding component of phosphate
                     uptake ABC transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0168"
                     /db_xref="EnsemblGenomes-Tr:CAK05657"
                     /db_xref="GOA:Q1MMZ5"
                     /db_xref="InterPro:IPR005770"
                     /db_xref="InterPro:IPR017797"
                     /db_xref="UniProtKB/TrEMBL:Q1MMZ5"
                     /protein_id="CAK05657.1"
                     /translation="METSMSAFRKILMATIAVAALAGNAAAQDVKVLRIGLDGGENEA
                     DQVRRTECVKPGLIAATGVSEVQLFPSPNYNGVIQGLLGGTIDLAVMGAASYAAIYIK
                     DPNAVTPVLTTKQADGSTGYYSIMVARKDSGIKTLADAKGKKLGFADPDSTSGYLVPN
                     VALPKDTGAPVKQYFSETGFGGGHENLVLGVLDKKFDVGTTFGSGQGDWAQGYSSGNL
                     HQMVTKGLLDMDDIVEVWKSPLIPNGPLMVSQKLPADLQKKVTTYFAELPKTDKSCFE
                     SFTGGGYVDWVPVDQSFYQTIIDARKAVIGG"
     CDS             complement(205369..206436)
                     /transl_table=11
                     /locus_tag="RL0169"
                     /product="putative transposase for insertion element
                     family protein"
                     /product="transposase for insertion sequence element
                     is1111a"
                     /db_xref="EnsemblGenomes-Gn:RL0169"
                     /db_xref="EnsemblGenomes-Tr:CAK05658"
                     /db_xref="GOA:Q1M490"
                     /db_xref="InterPro:IPR002525"
                     /db_xref="InterPro:IPR003346"
                     /db_xref="UniProtKB/TrEMBL:Q1M490"
                     /protein_id="CAK05658.1"
                     /translation="MTASYEYHIGVDYHKSYSHLVVQDSSGKTLRSGRVKNDRQSLGG
                     FLERYRENSHAVVEATRNWMVMYDWLDDICDDVVLAHPLKVKAIADAKIKTDKIDATV
                     LAHLLRADLVPEAWAPSERSRDLRVALRERMFYVRLRTMTKNRIVTVFDRYPEQTAQL
                     KKLGDLFGKAGRVQLAQVNVSEIDRIQIDRGLAFIGDIDMRIKQSEATIRAMTKANAN
                     VKLLKTIPGIGEFFARLIDAEIDDISRFRHSKKLAAYAGLVPSTHSSGGKTFHGKIIK
                     QGNKWLRWAFVEAVAPAIASDPQLRAQYEHLKIKGINKARVAIARKLLTITFQILRDQ
                     RAYEPRGESTMEGASTISRLS"
     CDS             complement(206639..207484)
                     /transl_table=11
                     /gene="phoC"
                     /locus_tag="RL0170"
                     /product="putative ATP-binding component of phosphate
                     uptake ABC transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0170"
                     /db_xref="EnsemblGenomes-Tr:CAK05659"
                     /db_xref="GOA:Q1MMZ3"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR012693"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMZ3"
                     /protein_id="CAK05659.1"
                     /translation="MMFELKNVTRRFGKKLAVDSVTLAIAQGQMVGIIGRSGAGKSTL
                     LRMINRLQEPSSGSVHFAGVEVSGLRGQALRNWQRDCAMIFQQFNLVPRLDVLTNVML
                     GRLNHRSTLMSLLNIFTREERVHAIAALERLGIEQTALQAAGTLSGGQQQRVAIARAL
                     MQNPKMVLADEPIASLDPLNAKIVMDALRDINEREGITVITNLHTLDTARNYCERIVG
                     MAGGRVVFDGKPSELTAEAVKEIYGTDKDGAGIDETMTSTSLESKRRAEDVSSGRVAK
                     AAAVH"
     CDS             complement(207600..208217)
                     /transl_table=11
                     /locus_tag="RL0171"
                     /product="putative acetyltransferase"
                     /db_xref="EnsemblGenomes-Gn:RL0171"
                     /db_xref="EnsemblGenomes-Tr:CAK05660"
                     /db_xref="GOA:Q1MMZ2"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR017694"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="UniProtKB/TrEMBL:Q1MMZ2"
                     /protein_id="CAK05660.1"
                     /translation="MSRKLGIEPYFHETASVSDSTFGRYTEVSERCRISEASFGDYSY
                     IMQDGSVWCATIGKFVNIAAAVRINATNHPTWRATLHHFTYRAADYWPDGDMETDFFA
                     WRRANRVTIGNDVWIGHGATILPGVSVGNGAVIGAGAVVSKDVAPYTIVGGVPAKLIR
                     ERFPREVGERMDRLSWWDWEHDRLRQALEDFRNLDAEDFLSRYGG"
     CDS             complement(208214..208921)
                     /transl_table=11
                     /locus_tag="RL0172"
                     /product="putative ATP-binding component of phosphate
                     uptake ABC transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0172"
                     /db_xref="EnsemblGenomes-Tr:CAK05661"
                     /db_xref="GOA:Q1MMZ1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR012701"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MMZ1"
                     /protein_id="CAK05661.1"
                     /translation="MATPLVVSEVSKSFTMHLRDGIKLPVVSDVAFSVASGECVVLGG
                     PSGIGKSSLLKMIYGNYAVDTGQILIRHDGRIVDLASIDPRTVLNVRRNTLGYVSQFL
                     RTVPRVAAIDVVAEPLVARGEDAVTAREKAGALLARLNLPETLWQLPPATFSGGEQQR
                     VNIARGFITEHTILLLDEPTASLDARNRAVVVGMIAEKKKAGVALLGIFHDEEVREAV
                     ADRILDVQQFSPRKIAA"
     CDS             complement(208948..209724)
                     /transl_table=11
                     /gene="phnK"
                     /locus_tag="RL0173"
                     /product="putative ATP-binding component of phosphate
                     uptake ABC transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0173"
                     /db_xref="EnsemblGenomes-Tr:CAK05662"
                     /db_xref="GOA:Q1MMZ0"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR012700"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MMZ0"
                     /protein_id="CAK05662.1"
                     /translation="MSDTPLLKVHDVSKFYGNRIGCRDVSFELWPGEVLAIVGESGSG
                     KTTLLNCLSTRLLPSTGSVEYHMRDGSYRDLYRMNEAERRFLMRTDWGFVHQNPADGL
                     RMTVSAGANVGERLMATGDRHYGKIRASAIDWLERVEIDADRIDDQPRAFSGGMRQRL
                     QIARNLVTGPRLVFMDEPTGGLDVSVQARLLDLVRGLVNDLGLSAIIVTHDLAVARLL
                     SHRMMVMKDGYVIEHGLTDRVLDDPREPYTQLLVSSILQV"
     CDS             complement(209721..210596)
                     /transl_table=11
                     /gene="phnJ"
                     /locus_tag="RL0174"
                     /product="putative phosphonate metabolism protein"
                     /db_xref="EnsemblGenomes-Gn:RL0174"
                     /db_xref="EnsemblGenomes-Tr:CAK05663"
                     /db_xref="GOA:Q1MMY9"
                     /db_xref="InterPro:IPR010306"
                     /db_xref="UniProtKB/TrEMBL:Q1MMY9"
                     /protein_id="CAK05663.1"
                     /translation="MTDLASYNFAYLDEQTKRMIRRAILKAIAIPGYQVPFASREMPM
                     PYGWGTGGVQVTASIIGPDDVLKVIDQGADDTTNAVSIRAFFQKVANVAVTTHTKDAT
                     IIQTRHRIPEEKLGVGQVLVYQVPIPEPLRFLEPRETETRKMHALEEYGLMHVKLYED
                     IAHNGRISRTYAYPVKVHGRYVMDPSPTPKFDNPKMHMSDALQLFGAGREKRIYAVPP
                     YTDVVSLDFEDYPFDIQRFDKPCALCGAEDVYLDEVVLDDKGGRMFVCSDTDHCEDRR
                     AHGHAGEMLAREAAE"
     CDS             complement(210593..211699)
                     /transl_table=11
                     /gene="phnI"
                     /locus_tag="RL0175"
                     /product="putative phosphonate metabolism protein"
                     /db_xref="EnsemblGenomes-Gn:RL0175"
                     /db_xref="EnsemblGenomes-Tr:CAK05664"
                     /db_xref="GOA:Q1MMY8"
                     /db_xref="InterPro:IPR008773"
                     /db_xref="UniProtKB/TrEMBL:Q1MMY8"
                     /protein_id="CAK05664.1"
                     /translation="MYVAVKGGETAIANAHRLLADRRRGDRSLPAIGIDQIVAQLALA
                     VDRVMAEASLFDRTLAALAIRQSRGDMIEAIFLLRAYRTTLPRFGYSRPLDTADMTIE
                     RRISATYKDLPGGQLLGPTFDYTHRLLDPSLLSDEAVETPAQRAAETGRVMRVSEILG
                     EEGLIEADGDMPEDHEIGDLTREPMEFPMTRDLRLQALARGDEGFLLALGYSTQRGYG
                     RNHPFTGEIRIGDVEVEFDVPELGFAVSLGTIQITECQMVNQFKGSAKAPPQFTRGYG
                     LVFGQSERKAMAMSLVDRALRAEELGEDITAPAQDEEFVISHSDNVQATGFVEHLKLP
                     HYVDFQAELDLVRRMRREFEAARNGGEDMKEAAE"
     CDS             complement(211704..212312)
                     /transl_table=11
                     /gene="phnH"
                     /locus_tag="RL0176"
                     /product="putative phosphonate utilisation protein"
                     /db_xref="EnsemblGenomes-Gn:RL0176"
                     /db_xref="EnsemblGenomes-Tr:CAK05665"
                     /db_xref="GOA:Q1MMY7"
                     /db_xref="InterPro:IPR008772"
                     /db_xref="UniProtKB/TrEMBL:Q1MMY7"
                     /protein_id="CAK05665.1"
                     /translation="MGLKTEALTGGFVEPVFHAQSVFKMLMDGMARPGTIQTVQPDVA
                     PPAPLGIAAGTIALTLCDHDTPVWLSQGLARSAVPEWLGFHTGAPLTTEKAEARFAFT
                     EAGTALSSFGLFASGTQEYPDRSTTLIIELAELEGGRRLALMGPGIQSVAEIAPIGLP
                     ETFLRLWTENRALFPRGVDIVLTAGKRFLCLPRTTKITATEI"
     CDS             complement(212312..212788)
                     /transl_table=11
                     /gene="phnG"
                     /locus_tag="RL0177"
                     /product="putative phosphonate utilisation protein"
                     /db_xref="EnsemblGenomes-Gn:RL0177"
                     /db_xref="EnsemblGenomes-Tr:CAK05666"
                     /db_xref="GOA:Q1MMY6"
                     /db_xref="InterPro:IPR009609"
                     /db_xref="UniProtKB/TrEMBL:Q1MMY6"
                     /protein_id="CAK05666.1"
                     /translation="MISADRTDAASQTASGRKRAADLLARAERSELLAAFDALPEKPV
                     AHQVRGPETGLVMVRGRIGGGGAPFNLGEVTVTRATVRLDSGSVGHAQALGTDREKAR
                     LAAIFDALWQEEATKDFVEQALLLPVTERIADAERRKADETAATRVDFFTMVRGDN"
     CDS             212906..213643
                     /transl_table=11
                     /locus_tag="RL0178"
                     /product="putative GntR family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0178"
                     /db_xref="EnsemblGenomes-Tr:CAK05667"
                     /db_xref="GOA:Q1MMY5"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011663"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012702"
                     /db_xref="InterPro:IPR028978"
                     /db_xref="UniProtKB/TrEMBL:Q1MMY5"
                     /protein_id="CAK05667.1"
                     /translation="MSGLKQVQRQTGVALWRQIADRIREAISNGAYDETGMVPPETML
                     ALQFGVNRHTVRSALAALAQEGIVRAVQGRGTLIERKERLNFPITRRTRFTAGIGDQA
                     REMRGLLLEEAKEEASAEIARWLGLKPGEEVIRLETLRQADKRPVSRATSWFPAKRFA
                     GIGEAYRTEESITKAFAELGLPDYVRATTEVTAAHASAADMADLELTPGAILLIAKAM
                     NTDLEGVPVQYSISRFAADRVQFTIEN"
     CDS             complement(213683..214318)
                     /transl_table=11
                     /gene="gpmA"
                     /locus_tag="RL0179"
                     /product="putative 2,3-bisphosphoglycerate-dependent
                     phosphoglycerate mutase (Phosphoglyceromutase) (PGAM)
                     (BPG-dependent PGAM) (dPGM)"
                     /product="2,3-bisphosphoglycerate-dependent
                     phosphoglycerate mutase (ec 5.4.2.1)
                     (phosphoglyceromutase) (pgam) (bpg-dependent pgam) (dpgm)"
                     /EC_number="5.4.2.1"
                     /db_xref="EnsemblGenomes-Gn:RL0179"
                     /db_xref="EnsemblGenomes-Tr:CAK05668"
                     /db_xref="GOA:Q1MMY4"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR005952"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMY4"
                     /protein_id="CAK05668.1"
                     /translation="MSGTLVLVRHGQSDWNLKNLFTGWKDPDLTELGIQEANTGGAAL
                     AEYGIKFDVAYTSVLVRAQHTLKLILDKVGQPDLLTIRDQALNERDYGDLSGLNKDDA
                     RAKWGEEQVHIWRRSYDVPPPGGESLRDTGARVWPYYLTEILPRVLRGEKVLVAAHGN
                     SLRSLVMVLDKLSREGVLALNLATGVPMVYKLKADSTVASKEVLGDMSGAH"
     CDS             complement(214340..215164)
                     /transl_table=11
                     /gene="dapB1"
                     /locus_tag="RL0180"
                     /product="putative dihydrodipicolinate reductase"
                     /EC_number="1.3.1.26"
                     /db_xref="EnsemblGenomes-Gn:RL0180"
                     /db_xref="EnsemblGenomes-Tr:CAK05669"
                     /db_xref="GOA:Q1MMY3"
                     /db_xref="InterPro:IPR000846"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022663"
                     /db_xref="InterPro:IPR022664"
                     /db_xref="InterPro:IPR023940"
                     /db_xref="UniProtKB/TrEMBL:Q1MMY3"
                     /protein_id="CAK05669.1"
                     /translation="MSDAAMKLVVVGAAGRMGQTLIRLIHSIEGVRLHAAVERAGSPF
                     VGKDAGEIAGLGPTGVIIGDDPLNAFLDAEGVLDFTSPAATVEFSGLAAQARIVHVVG
                     TTGCSADDNTKIAAAARHARIVKSGNMSLGVNLLSVLAEQAARALDPDDWDIEILEMH
                     HKHKVDAPSGTALLIGEAAAKGRGIDLASQSVRVRDGHTGAREAGTIGFATLRGGSVI
                     GEHSVLFAGEGEIVTLSHSAADRSIFARGAIKAALWARDKKPGLYSMLDVLGLSSS"
     CDS             complement(215180..216967)
                     /transl_table=11
                     /locus_tag="RL0181"
                     /product="putative transmembrane component of ABC
                     transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0181"
                     /db_xref="EnsemblGenomes-Tr:CAK05670"
                     /db_xref="GOA:Q1MMY2"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MMY2"
                     /protein_id="CAK05670.1"
                     /translation="MEAAESRTQSVSSDTVTGILKRIIAENGRDHLWGYVFAIACLIV
                     VALSTAFTAWIMRAIIDEAFANRRADVVWIICLSIFIAFVLRGFASYGQAVALSRVGN
                     DIVARYQRRLYAHLMTLSVGFFSEARSAHIAAQVSQNVSGIRDVLNLTITSTVRDLLT
                     FVSLLAVMIIQDPLLSLAVFIMAPPLLYALRYVSKRLRSATREAVHLNSHVLGAMQET
                     IQGIAIVKAFTMEEELERKVNKLIKGAESRANRIARLSERTSPLTESFAGFAVASVLA
                     YAAYRSIYFNVPPGAFFSFVTALLLAYDPARRLARLQVQMERAVVNARMIYELLDMEP
                     RQRDLPDARPLTVTQARIEFRNVSFAYGKESVLSGVSFIAEGGGTTALVGPSGAGKST
                     VISLIPRFYDPREGEILIDGQDIAHITKKSLRQQLAYVSQQPYLFEGTIRDNIRYGRP
                     EATDAEVEEAARLAYAHDFISAQPQGYETPVGENGVTLSGGQRQRLSIARALVRNAPI
                     LLLDEATSALDTESEAAVQKALDEAMSGRTVVVIAHRLSTVVRADKIVVMQQGRVVEE
                     GNHETLAKVSDGLYARLNNLQRPSASDSN"
     CDS             complement(217115..218140)
                     /transl_table=11
                     /gene="glk"
                     /locus_tag="RL0182"
                     /product="putative glucokinase"
                     /EC_number="2.7.1.2"
                     /db_xref="EnsemblGenomes-Gn:RL0182"
                     /db_xref="EnsemblGenomes-Tr:CAK05671"
                     /db_xref="GOA:Q1MMY1"
                     /db_xref="InterPro:IPR003836"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMY1"
                     /protein_id="CAK05671.1"
                     /translation="MSKPNNSTAPLPFPILIGDIGGTNARFSILTDAYAEPKQFPNVR
                     TADFATIDEAIQQGVLDKTAVQPRSAILAVAGPINDDEIPLTNCDWVVRPKTMIEGLG
                     MEDVLVVNDFEAQALAIAALSDENRERIGDATRDMIASRVVLGPGTGLGVGGLVHAQH
                     SWIPVPGEGGHVDLGPRSKRDYDIFPHIETIEGRVSAEQILCGRGLVNLYHAICVVDG
                     IEPTMKDPADITSHALAGSDKAAVETVSLFATYLGRVAGDLAMVFMARGGVYLSGGIS
                     QKIIPALKKPEFRIAFEDKAPHTALLRTIPTYVVTHPLAALAGLSSYARMPANFGVST
                     EGRRWRR"
     CDS             complement(218158..218538)
                     /transl_table=11
                     /locus_tag="RL0183"
                     /product="putative methylglyoxal synthase"
                     /product="methylglyoxal synthase (ec 4.2.3.3) (mgs)"
                     /EC_number="4.2.3.3"
                     /db_xref="EnsemblGenomes-Gn:RL0183"
                     /db_xref="EnsemblGenomes-Tr:CAK05672"
                     /db_xref="GOA:Q1MMY0"
                     /db_xref="InterPro:IPR004363"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR018148"
                     /db_xref="UniProtKB/TrEMBL:Q1MMY0"
                     /protein_id="CAK05672.1"
                     /translation="MAGGKCLALIAHDQKKDDMAAFARANRDILSRWKIVATGTTGGR
                     VLDAAPDLDVVRLKSGPLGGDQQIGALISTGEVDALIFFVDPLTPMPHDVDVKALMRL
                     AIVYDIPMALNHATAIKLLPTLEA"
     CDS             complement(218624..219700)
                     /transl_table=11
                     /locus_tag="RL0184"
                     /product="putative murein endopeptidase
                     (d-alanyl-d-alanine-endopeptidase)"
                     /note="Similar, but extended at the N and C-termini, to
                     Shigella flexneri. mepA MEPA_ECOLI (EMBL:AE015256)
                     (Penicillin-insensitive murein endopeptidase precursor (EC
                     3.4.99.-) (D-alanyl-D-alanine-endopeptidase)
                     (DD-endopeptidase).) fasta scores: ungapped id 41.250%
                     length=274 id in E(), and to entire protein of Rhizobium
                     meliloti (Sinorhizobium meliloti). PUTATIVE MUREIN
                     ENDOPEPTIDASE TRANSMEMBRANE PROTEIN (EC 3.4.99.- ). Q92T29
                     (EMBL:SME591782) (355) fasta scores: E()=2.6e-69 61.708%
                     id in 363 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0184"
                     /db_xref="EnsemblGenomes-Tr:CAK05673"
                     /db_xref="GOA:Q1MMX9"
                     /db_xref="InterPro:IPR005073"
                     /db_xref="InterPro:IPR009045"
                     /db_xref="UniProtKB/TrEMBL:Q1MMX9"
                     /protein_id="CAK05673.1"
                     /translation="MAFGFAQAFRTLGTLALAGAIGAGLAVGDVGAEQKTPSPGSAKA
                     LFGGAGLPTQGPAQPIGFYAKGCMAGAVALPTDGPTWQAMRLSRNRRWGNPAMIALLE
                     RFSQDAVRYAGWPGILVGDIAQPRGGPMLNGHSSHQIGLDADIWFSPMPARRMTAQER
                     EDLPFTSMLQKDKFLTVNPKVWTESRARLLMLAASYPEVERIFVNPAIKKKMCDTWGG
                     DRTNLGKLRPIYGHDSHFHIRIKCPPGAAGCTPQAPVPAGDGCDKSLAYWFTPAPWAP
                     PKPPKPGAKPPKPPREMMVTDLPNACAAVLDAASVASMQAATYGGPSAASALAATPAA
                     ASADDTDGALPDVGPVPNDKPAIQ"
     CDS             219976..221808
                     /transl_table=11
                     /locus_tag="RL0185"
                     /product="putative solute-binding component of ABC
                     transporter"
                     /note="Similar, but truncated at the C-terminus, to
                     Rhizobium sp. (strain NGR234). Hypothetical protein Y4WM
                     precursor. Y4WM_RHISN (EMBL:RSAE104) (663) fasta scores:
                     E()=2.2e-171 67.833% id in 600 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0185"
                     /db_xref="EnsemblGenomes-Tr:CAK05674"
                     /db_xref="GOA:Q1MMX8"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="InterPro:IPR030678"
                     /db_xref="UniProtKB/TrEMBL:Q1MMX8"
                     /protein_id="CAK05674.1"
                     /translation="MAALWSKIGLFLSLAGALAPMTATAQDQPFLIGSSVISEMKYKP
                     GFAHFDYVNPDAPKGGDLRLSASGAFDTFNPLLAKGQAAVGLTLVYDTLMKPADDELL
                     VSYGLLAEGLSFPTDVSSATFRLRKEAKWSDGQPVTPEDVIFSLDKTKELNPLTANYY
                     RHVAKAEKTGDRDVTFTFDEKNNRELPNILGQLVVVPKHWWEGQGPDGKPRDISKTTL
                     EPVMGSGPYKIASFSPGATIRYELRDDYWGKDLNVNVGQNNFRNVIYTYFGDRDVEFE
                     AFRAGNSDYWQETTAARWATGYDFPAVKEGRVKKEEVANPLRATGIMQALVPNMRRDL
                     FKDIRVREALNYGLDFEELNRTVAFNSYKRIDSYFWNTELASSGLPQGRELEILQGMK
                     DKVPAEIFTTPYTNPVAGDPQKSRDNLRKAIALLKEAGWEIKGNRMVNSKTGQPMSFE
                     ILLSSPMLERWAVPYASNLRKIGIDARVRTVDASQAVNRERSFDYDMIWNVWAETMNP
                     GNEQADYWGSGSVNQQGSRNYAGIANPAVDELIRMVIFAPNRDEQIAAIKAMDRVLLA
                     NHYVIPLFYRDTYNIAYWNTVTHPAEFPAYSLGFPDAWWSTSAK"
     CDS             221959..223047
                     /transl_table=11
                     /locus_tag="RL0186"
                     /product="putative transmembrane component of ABC
                     transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0186"
                     /db_xref="EnsemblGenomes-Tr:CAK05675"
                     /db_xref="GOA:Q1MMX7"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="UniProtKB/TrEMBL:Q1MMX7"
                     /protein_id="CAK05675.1"
                     /translation="MGAYILRRLLLMIPTIVGIMAISFVVIQFAPGGPVEQVIAQLTG
                     QADSADQRLSGGGDLLGGGGSDEGSKYRGAQGLDPELIAKLEKQFGFDKPPLTRFGEM
                     MWNYIRFDFGESFFRNTSVLELIKEKLPVSISLGIWILIFSYAISIPLGIRKAVKDGS
                     TFDVWTSGVIVVGYAVPSFLFGILLIVLFAGGSFYDWFPLRGLVSDNFDQLAWWQKPL
                     DYFWHLTLPLISLSLSAFATTTLLTKNSFIEEIKKQYVVTARAKGLNERQVLYGHIFR
                     NAMLIIIAGFPGAFISAFFTGSLLIENIFSLDGLGRLGYLSVINRDYPIVFATLYIFS
                     LLGLVVSLVSDLIYTWIDPRIDFERRDV"
     CDS             223047..224195
                     /transl_table=11
                     /locus_tag="RL0187"
                     /product="putative transmembrane component of ABC
                     transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0187"
                     /db_xref="EnsemblGenomes-Tr:CAK05676"
                     /db_xref="GOA:Q1MMX6"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="UniProtKB/TrEMBL:Q1MMX6"
                     /protein_id="CAK05676.1"
                     /translation="MDAAANPVITTPVKPPRKGLLSPTNIRRWHNFKANGRGYWSLWL
                     FLVLFVLSLFAEFLANDRPIIASYKGEVLFPVLIDYPEEKFGGFLAETDYRSSVIADE
                     INANGWMIWPPIRYSYRSVNSNIPHSAPTAPFWLMTNEERCAGYPQGVNDPDCTLGNL
                     NWLGTDDQARDVLARVIYGFRISVLFGLVLTICSAVIGVTAGAVQGYFGGWTDLLLQR
                     FIEIWSSMPVLYILLIIAALLPPGFFVLLGIMLLFSWVGFVGIVRAEFLRARNFEYVR
                     AARALGVNNRTIMWRHLLPNAMVATLTFLPFILSGSITTLTSLDFLGFGMPPGSPSLG
                     EMIAQGKTNLQAPWLGLTAFFAMSIMLSLLIFIGEAVRDAFDPRKTFQ"
     CDS             224192..225829
                     /transl_table=11
                     /locus_tag="RL0188"
                     /product="putative ATP-binding component of ABC
                     transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0188"
                     /db_xref="EnsemblGenomes-Tr:CAK05677"
                     /db_xref="GOA:Q1MMX5"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MMX5"
                     /protein_id="CAK05677.1"
                     /translation="MSDMTEPLLSVRDLSVAFHQGGETSLAVDHISFDIAKGEVVALV
                     GESGSGKSVSANSILRLLPYPSASHPSGEILFKGKDLLKASERALREVRGNDITMIFQ
                     EPMTSLNPLHTIEKQIAEILALHQGLTGQSARQRVLELLNQVGIREPEKRLKAYPHEL
                     SGGQRQRVMIAMALANRPELLIADEPTTALDVTVQAQILELLRQLKAVHGMSMLFITH
                     DLGIVRKFADRVCVMTKGKIVETGTVEEVFANPKHDYTRHLLASEPRGEPPLADPSKP
                     LVMEGSDIRVWFPIKSGLMRRVVDHVKAVDGIDLSLRAGQTLGVVGESGSGKTTLGLA
                     LTRLISSEGRIAFVGKDIAGYSFNEMRPLRNQLQVVFQDPYGSLSPRMSVGDIVAEGL
                     KVHERSLTSEERDQRVCWALEEVGLDPLTRWRYPHEFSGGQRQRIAIARAMVLKPRFV
                     MLDEPTSALDMSVQAQVVDLLRDLQKKHDLAYLFISHDLKVVKALANDVIVMRFGKVV
                     EQGPSADIFRAPKDDYTRALMAAAFNIEAVPTPAVQQ"
     CDS             225838..226797
                     /transl_table=11
                     /locus_tag="RL0189"
                     /product="putative 2-hydroxyacid dehydrogenase"
                     /db_xref="EnsemblGenomes-Gn:RL0189"
                     /db_xref="EnsemblGenomes-Tr:CAK05678"
                     /db_xref="GOA:Q1MMX4"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MMX4"
                     /protein_id="CAK05678.1"
                     /translation="MPATPPVLVDIKFNAEGVARVLKTAFADRGSINLADPRNRARDL
                     RAVEYALLWKPDADLFARAPNLKVIFSGGAGVDHIIGMDGLPEIPIVRFVDRSLTTRM
                     SEWVVMQCLMHLRGQYTHDSHQRQREWAKLIAPEAAEVTVGVMGLGILGQDAVAKLRV
                     MGFNVIGWSRSRKQIDGVETFDASELDSFLARTDILVGLLPLTPETSGFYDAGLFAKL
                     RRNGALGQPVFINAGRGKSQVEADIVSAIRDGTLGGASLDVFEAEPLASDHPLWELRN
                     VFITPHDAAVSEENALFCHVETQIARFERGEPLQFVVDRAAGY"
     CDS             226886..227233
                     /transl_table=11
                     /locus_tag="RL0190"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:RL0190"
                     /db_xref="EnsemblGenomes-Tr:CAK05679"
                     /db_xref="GOA:Q1MMX3"
                     /db_xref="UniProtKB/TrEMBL:Q1MMX3"
                     /protein_id="CAK05679.1"
                     /translation="MMAHQTDTRWEKSNGKLHKEEQIPPVKARQGRMGYRILTVLIVA
                     LVLAFVVWIPVEIWGNREANEVAPQQPGQQLQSQQPAPAPAPALQNGTAVPTETPNTT
                     PAAPNVAPATPAQ"
     CDS             227421..228725
                     /transl_table=11
                     /locus_tag="RL0191"
                     /product="putative nicotinate phosphoribosyltransferase"
                     /product="nicotinate phosphoribosyltransferase (ec
                     2.4.2.11) (naprtase)"
                     /EC_number="2.4.2.11"
                     /db_xref="EnsemblGenomes-Gn:RL0191"
                     /db_xref="EnsemblGenomes-Tr:CAK05680"
                     /db_xref="GOA:Q1MMX2"
                     /db_xref="InterPro:IPR002638"
                     /db_xref="InterPro:IPR006406"
                     /db_xref="InterPro:IPR007229"
                     /db_xref="UniProtKB/TrEMBL:Q1MMX2"
                     /protein_id="CAK05680.1"
                     /translation="MARTDIARRVYNHAWKLDPIIRSLIDTDFYKLLMLQMIWKLYPD
                     VNASFTLINRTKRVRLAEELDEGELREQLDHARTLRLSKKEMIWLAGNSFYGRAQIFE
                     PEFLAWLSNFQLPEYELSKKDGQYVLDFHGSWKETTMWEIPALAIVNELRSRSAMKAL
                     GPFTLDVLYARAKAKMWSKVERLKELPGLRISDFGTRRRHSFLWQRWCVEALKEGIGP
                     AFAGTSNVLLAMDSDLEAVGTNAHELPMVAAALAETDEQLRNAPYKILRDWNKLYGGN
                     LLIVLPDAFGTAAFLRDAPEWVADWTGFRPDSAPPIEGGEKIIDWWKKMGRDPRQKLL
                     IFSDGLDVDAIIDTYRHFEGRVRMSFGWGTNLTNDFSGCAPIEISGLNPISVVCKVSD
                     ANGRPAVKLSDNPQKATGEPAEVERYLKFFGAEDRIDQTVLV"
     CDS             complement(229362..229760)
                     /transl_table=11
                     /locus_tag="RL0192"
                     /product="conserved hypothetical protein"
                     /note="C-terminus from codon 60 is similar to Xanthomonas
                     campestris (pv. campestris). Hypothetical protein XCC0125.
                     Q8PE56 (EMBL:AE012107) (85) fasta scores: E()=0.093
                     32.836% id in 67 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0192"
                     /db_xref="EnsemblGenomes-Tr:CAK05681"
                     /db_xref="InterPro:IPR025309"
                     /db_xref="UniProtKB/TrEMBL:Q1MMX1"
                     /protein_id="CAK05681.1"
                     /translation="MCWIRARPNNEMARLPAYPRGRRSDGAARFRRSKIPDFLPCSFT
                     ASLHVWVYRLPKSKTEVKQVEELSVKSKIIKTVYFSQEDGRLRICFKNGEERLFEGVP
                     SSEAHAMTVAPSPGHYYLDRIRTRFRRLAA"
     CDS             complement(229806..230375)
                     /transl_table=11
                     /locus_tag="RL0193"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0193"
                     /db_xref="EnsemblGenomes-Tr:CAK05682"
                     /db_xref="GOA:Q1MMX0"
                     /db_xref="InterPro:IPR010662"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q1MMX0"
                     /protein_id="CAK05682.1"
                     /translation="MIRGKDMKDIIILPGIGGSGEAHWQTRWERSNPYMRRFQPTNWE
                     KPDLADWISALERAVGASTTPPLLVAHSLACLLVAHWQQVSSLAVAGAFLVAVPDPQS
                     ASFPKEAAGFADPPSQRMRFPTLIIASGDDPFGTLDHAHARADLWGSGLVAIGPFGHI
                     NGQSGLEDWGQGKALLTAFSAGLARSDRA"
     CDS             230468..230944
                     /transl_table=11
                     /locus_tag="RL0194"
                     /product="putative AsnC transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0194"
                     /db_xref="EnsemblGenomes-Tr:CAK05683"
                     /db_xref="GOA:Q1MMW9"
                     /db_xref="InterPro:IPR000485"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR019885"
                     /db_xref="InterPro:IPR019887"
                     /db_xref="InterPro:IPR019888"
                     /db_xref="UniProtKB/TrEMBL:Q1MMW9"
                     /protein_id="CAK05683.1"
                     /translation="MAFQENNRVQLDPTDIAIIEAMQENGRIAVSELGRRVGLSQPAA
                     SERVKRLEDRGIIVGYAARIDPTALGIGMTAVLRLRTTHEHIKPCLKQFAEMPQVMEV
                     LRLTGEDCFLLKVLVPAPGELETIVDTIARFGAVTTSLVLRSENPKPIGRALLQRP"
     CDS             231363..231680
                     /transl_table=11
                     /locus_tag="RL0195"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:RL0195"
                     /db_xref="EnsemblGenomes-Tr:CAK05684"
                     /db_xref="GOA:Q1MMW8"
                     /db_xref="UniProtKB/TrEMBL:Q1MMW8"
                     /protein_id="CAK05684.1"
                     /translation="MRFLLRLASLVALAAAVIAGTIDSIQSVAASSVVMTPISDAWQD
                     VSPTTLTSLQSSLSYYIHPRFYALIFQWLMLQPAFAVFLVIALLLWMIGYKKPSVAGR
                     FTA"
     CDS             231998..232990
                     /transl_table=11
                     /locus_tag="RL0196"
                     /product="putative outer membrane basic lipo-protein"
                     /db_xref="EnsemblGenomes-Gn:RL0196"
                     /db_xref="EnsemblGenomes-Tr:CAK05685"
                     /db_xref="GOA:Q1MMW7"
                     /db_xref="InterPro:IPR003760"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="UniProtKB/TrEMBL:Q1MMW7"
                     /protein_id="CAK05685.1"
                     /translation="MKKSLLTLFAVAAMSTTALAADVKPALVYGTGGKFDKSFNEAAY
                     NGAEKFKAETGIAYRDFEPTGDTQGEQAIRNFASRGFNPVVAVSFAWTSAIEKVAAEF
                     PDTKFIIVDSVVDKPNVRSVVYKEEEGSYLVGVLAGMASKTGKVGFVGGMDIPLIRKF
                     ECGYEQGARSVKADIEVFQNMTGTTGAAWNDPVRGGELTKNQIDQGADVVYAAAGATG
                     LGVLQTAADNKKLSIGVDSNQNHLHPGSVLTSMVKRVDLAVYNAYNDTKNDKFTAGVQ
                     ALGVKEDGVGAAIDDNNKSLITPEMQAAVDKAKADIIAGTIKVHDYTSDNACPK"
     CDS             233067..234590
                     /transl_table=11
                     /locus_tag="RL0197"
                     /product="putative ATP-binding component of ABC
                     transporter"
                     /note="Similar to Agrobacterium tumefaciens (strain
                     C58/ATCC 33970). ABC transporter, nucleotide
                     binding/ATPase protein. Q8UJ14 (EMBL:C97374) (501) fasta
                     scores: E()=2.7e-149 87.976% id in 499 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0197"
                     /db_xref="EnsemblGenomes-Tr:CAK05686"
                     /db_xref="GOA:Q1MMW6"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MMW6"
                     /protein_id="CAK05686.1"
                     /translation="MEPAVTDKPAIELVGIDKKFGAVHANKDINLTVAKGTIHGIIGE
                     NGAGKSTLMSIIYGFYHADSGEIRVNGNPVTIRDSQAAIATGIGMVHQHFMLVDNFTV
                     LENIMLGAEGGMLLARGVASARAELKRLETEYGLEVDPDALIEELPVGLQQRVEILKA
                     MYRGAEILILDEPTGVLTPAEADHLFRILKVLRDQGKTIILITHKLREIMAITDTVSV
                     MRRGEMVATRKTAETTVEELAELMVGRRVLLRVQKGEANPGSAVLSVRNLTVKDNRGV
                     TMVDNVSFDVRAGEIVGIAGVAGNGQSELLEAIAGIRKPTSGEILLDGQTIDKADPAR
                     LRDLGLAHIPEDRHHMGLVLKFEEYENSVLGYHRRPAYSKGPLLDLEAIRKDAMEKIE
                     KYDIRPPNPRLKTANFSGGNQQKIVVAREIERDLKMLIIGQPTRGVDIGAIEFIHRRI
                     IEMRDAGKAILLVSVELDEIRSLSDRILVMFAGHVVGEKTPDAGEQTLGLMMAGIAA"
     CDS             234598..235701
                     /transl_table=11
                     /locus_tag="RL0198"
                     /product="putative transmembrane permease component of ABC
                     transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0198"
                     /db_xref="EnsemblGenomes-Tr:CAK05687"
                     /db_xref="GOA:Q1MMW5"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="UniProtKB/TrEMBL:Q1MMW5"
                     /protein_id="CAK05687.1"
                     /translation="MSTASVPLPNWINYGLIPILNLIVAFLISGFVVWLIGESPLDAL
                     SLLIEGALGNGEFIGFTLFYATSFIFTGLSVAVAIHAGLFNIGSEGQAYMGGLGCALV
                     ALSLDNYVPWYVTMPVAVVGAALFGAVAAFIPAWLQAKRGSHIVITTIMFNYIIASLM
                     NYLLVHVLIVPGKMAPETRTFLEGGQLPKLTWLMEIFGTKLGAAPLNVSFIIALVMCY
                     VVWLLIWRTKLGFEMRTLGVSPTAASYAGIPYVRIVMIAMMLSGALAGMMALNPVMGA
                     SARLQVGFVGGAGFVGIAVSLMGRNHPLGIILAAFLFGILYQGGDWISFEMPNITREM
                     ILVIQGLVILFAGALEYMFRPAMVRLYQQFKRG"
     CDS             235712..236683
                     /transl_table=11
                     /locus_tag="RL0199"
                     /product="putative transmembrane permease component of ABC
                     transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0199"
                     /db_xref="EnsemblGenomes-Tr:CAK05688"
                     /db_xref="GOA:Q1MMW4"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="UniProtKB/TrEMBL:Q1MMW4"
                     /protein_id="CAK05688.1"
                     /translation="MDYYDIFISVLASTIRLSIPLIFTALAGLFSERAGIFDIGLEGK
                     MLGSAFAAACVAYLTDSAWLGLGAGILCSVALSLVHGFASITNRGNQIVSGVAINFFI
                     AGITIVLGQAWFGQGGRTPQLAPDSRFAPIILPGADVARDIPIIGPLYANVISGNNIL
                     TYLAFLAVPFSWWVLYRTRFGLRLRAVGENPGAVDTAGISVAWLRYRAVMCAGILCGF
                     AGTYLAIAQSAAFIKDMSAGKGYIALAALVFAKWKPVPVMFACLLFGFLDALANFMQG
                     KQVPLIGEVPVQVFQALPYVLTCVLLAGFIGVATPPKAGGVPYTKER"
     CDS             236685..237074
                     /transl_table=11
                     /gene="cdd"
                     /locus_tag="RL0200"
                     /product="putative cytidine deaminase (cytidine
                     aminohydrolase)"
                     /EC_number="3.5.4.5"
                     /db_xref="EnsemblGenomes-Gn:RL0200"
                     /db_xref="EnsemblGenomes-Tr:CAK05689"
                     /db_xref="GOA:Q1MMW3"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR006262"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:Q1MMW3"
                     /protein_id="CAK05689.1"
                     /translation="MSHDLFEAARGAMAFAHAPYSKFPVGAAIRAEDGKVYTGANIEN
                     LSFPQGWCAEPTAIGAMIMGGAKKIVEMAVIAEKLPLCPPCGGCRQKISEFASKETKI
                     YLCDEAGVKKTMTMEELLPFSFETELG"
     CDS             237071..237871
                     /transl_table=11
                     /gene="punA"
                     /locus_tag="RL0201"
                     /product="putative purine nucleoside phosphorylase"
                     /product="purine nucleoside phosphorylase i (ec 2.4.2.1)
                     (pnp i) (pu-npase i) (inosine phosphorylase)"
                     /EC_number="2.4.2.1"
                     /db_xref="EnsemblGenomes-Gn:RL0201"
                     /db_xref="EnsemblGenomes-Tr:CAK05690"
                     /db_xref="GOA:Q1MMW2"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR011268"
                     /db_xref="InterPro:IPR011269"
                     /db_xref="UniProtKB/TrEMBL:Q1MMW2"
                     /protein_id="CAK05690.1"
                     /translation="MKATVSLLAALLGGIKPRHGIVLGSGLGSLVGELDGAVRVPYRD
                     LPGFPVSAVSGHAGEVVAGRLGGVPVVMLSGRVHYYEKGDANAMRLPIEVLKALGVEA
                     LILTNSAGSLRDDMPPGSVMQITDHINYSGMNPLIGEESDHRFVGMTNAYDAGLAAAM
                     QRAAAKLEIELAQGVYMWFSGPSFETPAEIRMARILGADAVGMSTVPEVIISRMLGLR
                     VAAASVITNYGAGMTGNELSHEETKDMAPIGGARLAAILKDMIAAGRG"
     CDS             237987..238763
                     /transl_table=11
                     /gene="deoC1"
                     /locus_tag="RL0202"
                     /product="putative deoxyribose-phosphate aldolase"
                     /EC_number="4.1.2.4"
                     /db_xref="EnsemblGenomes-Gn:RL0202"
                     /db_xref="EnsemblGenomes-Tr:CAK05691"
                     /db_xref="GOA:Q1MMW1"
                     /db_xref="InterPro:IPR002915"
                     /db_xref="InterPro:IPR011343"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q1MMW1"
                     /protein_id="CAK05691.1"
                     /translation="MNSHSNRETAAVALSLLDLTNLRDDCTEAQIDALCARAQTPYGT
                     SAAICIWPRFVAQARNILGTGHAVRIATVVNLPSGDMEVADVAAEAREAIADGADEID
                     LVIPYRKLLAGNEKAVTDMVKAVRAECAGPVLLKVIIETGELKDAALIRHASELAIEA
                     GADFIKTSTGKVAVNATLEAADIMIRAIRESGRKVGFKPAGGIGSVADAALYLSLAET
                     IMTPDWAMPSTFRFGASDLLDDILSVLSGTQSASAAASGY"
     CDS             238765..240072
                     /transl_table=11
                     /gene="deoA"
                     /locus_tag="RL0203"
                     /product="putative thymidine phosphorylase"
                     /EC_number="2.4.2.4"
                     /db_xref="EnsemblGenomes-Gn:RL0203"
                     /db_xref="EnsemblGenomes-Tr:CAK05692"
                     /db_xref="GOA:Q1MMW0"
                     /db_xref="InterPro:IPR000053"
                     /db_xref="InterPro:IPR000312"
                     /db_xref="InterPro:IPR013102"
                     /db_xref="InterPro:IPR013465"
                     /db_xref="InterPro:IPR017459"
                     /db_xref="InterPro:IPR017872"
                     /db_xref="InterPro:IPR018090"
                     /db_xref="UniProtKB/TrEMBL:Q1MMW0"
                     /protein_id="CAK05692.1"
                     /translation="MIPQEIIRRKRDGDELDAAEISSFIAALAAGQLSEGQIGAFAMA
                     VWFKGMSRTETVALTLAMADSGDRLQWADVDRPIADKHSTGGVGDNVSLMLAPIAAAC
                     GLAVPMISGRGLGHTGGTLDKLESIPGYMITPDADLFHKVVKEAGCAIIGQTGTLAPA
                     DGRLYAVRDVTATVDSIPLITASILSKKLAAGLETLVLDVKVGNGAFMVDRGQAETLA
                     QSLVEVANGAGVKTSALITDMNQPLADSAGNAVEMRNCLDFLAGRKADTRLETVVLAF
                     AAEMLVKSGIAASSDEAEGMARRALSSGKAAEVFARMVSMLGGPADLIENPDRYLARA
                     PVAKPVPAARSGWLAACDARGIGVSVIDLGGGRRHPADRIDHRVGFSELLPLGTRVNA
                     GEPIALVHAADDAAAERAVAALAAHYRITEEKPELTPVIAGLI"
     CDS             complement(240079..240612)
                     /transl_table=11
                     /locus_tag="RL0204"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0204"
                     /db_xref="EnsemblGenomes-Tr:CAK05693"
                     /db_xref="GOA:Q1MMV9"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR011969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:Q1MMV9"
                     /protein_id="CAK05693.1"
                     /translation="MLVRTVLFASIAAVLATQVPSFFGGTSQQPAETLSANYVSAQTE
                     QPVAPEPVYGSNAIRLQADAQGHYTGSFKINGKPVQGLIDTGATYVALNETLARRLGF
                     TANQLDFRYGVNTANGQTKAAHVTLDRVEIGGIRVREVEAFVLKDDALTTTLVGMSFL
                     QKLASYSVADGSLSLKQ"
     CDS             complement(240774..241403)
                     /transl_table=11
                     /gene="upp"
                     /locus_tag="RL0205"
                     /product="putative uracil phosphoribosyltransferase (UMP
                     pyrophosphorylase)"
                     /EC_number="2.4.2.9"
                     /db_xref="EnsemblGenomes-Gn:RL0205"
                     /db_xref="EnsemblGenomes-Tr:CAK05694"
                     /db_xref="GOA:Q1MMV8"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005765"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMV8"
                     /protein_id="CAK05694.1"
                     /translation="MDGVTVIDHPLVQHKLTIMRRKETSTGSFRRLLREISTLLCYEV
                     TRDLELTMETIETPLQTMESPILEGKKLVFASILRAGNGLLEGMLDLVPSARVSHIGV
                     YRDHETLQPVEYYFKAPEDVAERLIIVVDPMLATGNSSIAAIDKLKERGAHNIRFLCL
                     LAAPEGIRNFRAAHPDVPVFTASIDSHLNEKGYIMPGLGDAGDRMYGTK"
     CDS             complement(241550..242518)
                     /transl_table=11
                     /locus_tag="RL0206"
                     /product="putative adenosine deaminase"
                     /EC_number="3.5.4.4"
                     /db_xref="EnsemblGenomes-Gn:RL0206"
                     /db_xref="EnsemblGenomes-Tr:CAK05695"
                     /db_xref="GOA:Q1MMV7"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006330"
                     /db_xref="InterPro:IPR028892"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMV7"
                     /protein_id="CAK05695.1"
                     /translation="MTSHLKKVELHCHLEGAAPPALTAAQARKYGVDISAELRDGAYV
                     WHDFASFLVCYDKVSEVYRTEEDYALLTETYLDELAGIDTIYSELIVSPDHGKRIGLG
                     ADAYISGICEGIRRAREKSGIEARLIVTGERHFGPESVIGAAEYAARAANPLITGFNL
                     AGEERMGRVADYARAFDIARDAGLGLTIHAGEVCGAFSVADALDAVRPSRIGHGVRAI
                     EDLDLVTRLADLGTVLEICPGSNIALGVFPDFASHPLRRLKDAGVRVTISSDDPPFFH
                     TSLKREYELAAGTFGFGDAEIDAMTRTAIEAAFVDDETRKALLARI"
     CDS             complement(242515..243735)
                     /transl_table=11
                     /gene="deoB"
                     /locus_tag="RL0207"
                     /product="putative phosphopentomutase
                     (phosphodeoxyribomutase)"
                     /EC_number="5.4.2.7"
                     /db_xref="EnsemblGenomes-Gn:RL0207"
                     /db_xref="EnsemblGenomes-Tr:CAK05696"
                     /db_xref="GOA:Q1MMV6"
                     /db_xref="InterPro:IPR006124"
                     /db_xref="InterPro:IPR010045"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR024052"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMV6"
                     /protein_id="CAK05696.1"
                     /translation="MARAFLFVLDSFGVGGAPDAAAYGDEGADTLGHIAEFCAAGAAD
                     RAGLREGPLSLPNMSELGLMQIARSASGRFPAGMPVPEKVYGIYGAATEISRGKDTPS
                     GHWEIAGTPVSFDWGYFPIEGDAFPQEFIEALCREADVPGILGNCHASGTEIIARLGE
                     EHIRTGKPICYTSSDSVFQVAAHEVHFGLDRLLAFCGLARGLLDSYNIGRVIARPFIG
                     QSASTFQRTGNRRDFSVLPPEPTLLDRLIEQGRHVHAVGKIGDIFAHQGISRVIKANG
                     NEALMDASLSAIDAAEDGDLVFTNFVDFDMIYGHRRDVPGYAAALEAFDARLPDVHKK
                     LKPGDLVVLTADHGCDPTWRGTDHTRERVPVIAYGPGIRSRSIGVRRGYADIGESIAR
                     HLGIPAGPHGRSFL"
     CDS             complement(243895..244476)
                     /transl_table=11
                     /locus_tag="RL0208"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:RL0208"
                     /db_xref="EnsemblGenomes-Tr:CAK05697"
                     /db_xref="GOA:Q1MMV5"
                     /db_xref="InterPro:IPR012495"
                     /db_xref="UniProtKB/TrEMBL:Q1MMV5"
                     /protein_id="CAK05697.1"
                     /translation="MALRNPFTRLVLTMRRLARDRKGAGAIEFAILFPVLVMLYIGAF
                     EITVGLSVSKRVTRAAGTVADLVTQQQSVTKSALAQMPSVATAIFVPYNSTSLTLKIT
                     GITIDAGANAKVLWSWAKDGTVPYAKNTAVTNVPADMKTANSFLVRTELSIPYTMFLF
                     APNFMPDGMRTITISRSYFYRQRQGDSIPCGDC"
     CDS             complement(244476..245111)
                     /transl_table=11
                     /locus_tag="RL0209"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:RL0209"
                     /db_xref="EnsemblGenomes-Tr:CAK05698"
                     /db_xref="GOA:Q1MMV4"
                     /db_xref="InterPro:IPR012495"
                     /db_xref="UniProtKB/TrEMBL:Q1MMV4"
                     /protein_id="CAK05698.1"
                     /translation="MTVIDQKTDKGRAFAPFRFLRFRTLARSREGAAAIEFALLAIPY
                     FLVIFAILETFVAFAAEELVSNAVDTMSRRMRTGQITYNLGRTTDMNQAQFRQAFCDE
                     ISILIRCSASEVATPSKLYLDVQTFSTFSAIPTTIPKVSTDKYADINTAAFKFAPGGA
                     GTINMVRAYYRWEIITDLVRPYITTIRPSDGSMPSQYLIVATAAFQNEQYP"
     CDS             complement(245227..245637)
                     /transl_table=11
                     /gene="pilQ"
                     /locus_tag="RL0210"
                     /product="putative pilus subunit transmembrane protein"
                     /note="putative alternative start site at codon 13"
                     /db_xref="EnsemblGenomes-Gn:RL0210"
                     /db_xref="EnsemblGenomes-Tr:CAK05699"
                     /db_xref="GOA:Q1MMV3"
                     /db_xref="InterPro:IPR032789"
                     /db_xref="UniProtKB/TrEMBL:Q1MMV3"
                     /protein_id="CAK05699.1"
                     /translation="MSSSGKTIFFAGMIAVFGISGVSAAADDDMLRVYMDHARVLKLD
                     RPVSKVIVGNAAVADATVADAKTIVLTGRSFGTTNLVLLDADGNAILDERILVSIDEG
                     NTVRVYRQTQRSVLSCTPNCEQHAQQAATATSSP"
     CDS             246017..246202
                     /transl_table=11
                     /gene="pilA"
                     /locus_tag="RL0211"
                     /product="putative pilus subunit protein"
                     /db_xref="EnsemblGenomes-Gn:RL0211"
                     /db_xref="EnsemblGenomes-Tr:CAK05700"
                     /db_xref="GOA:Q1MMV2"
                     /db_xref="InterPro:IPR007047"
                     /db_xref="UniProtKB/TrEMBL:Q1MMV2"
                     /protein_id="CAK05700.1"
                     /translation="MTKLFSRFLKDESGATAIEYGLIAALISVALITGATTLGDRIGT
                     TFNNLGTKMNTGVTASN"
     CDS             246327..246839
                     /transl_table=11
                     /gene="cpaA"
                     /locus_tag="RL0212"
                     /product="putative pilus assembly protein"
                     /db_xref="EnsemblGenomes-Gn:RL0212"
                     /db_xref="EnsemblGenomes-Tr:CAK05701"
                     /db_xref="GOA:Q1MMV1"
                     /db_xref="InterPro:IPR000045"
                     /db_xref="UniProtKB/TrEMBL:Q1MMV1"
                     /protein_id="CAK05701.1"
                     /translation="MIAAAVFVILPLCLAMAAFSDLFTMTIPNRISVILTASFFVLAP
                     LSGLGLAEIGMHLAGAAIVFSACFALFAFNVMGGGDAKLMSAAALWFGLNESLLFLMT
                     DVAMIGGLITLLILLVRGQSDTILAIGLPVPNSVLLAKKIPYGIAIAIGGFMAFPSSP
                     LFLAALESLK"
     CDS             246950..247765
                     /transl_table=11
                     /gene="cpaB"
                     /locus_tag="RL0213"
                     /product="putative pilus assembly protein"
                     /db_xref="EnsemblGenomes-Gn:RL0213"
                     /db_xref="EnsemblGenomes-Tr:CAK05702"
                     /db_xref="InterPro:IPR013974"
                     /db_xref="InterPro:IPR017592"
                     /db_xref="InterPro:IPR031571"
                     /db_xref="UniProtKB/TrEMBL:Q1MMV0"
                     /protein_id="CAK05702.1"
                     /translation="MKPARLIILAVAVVAAGLAGLLAMQMAGSGGVVTQVRSVVEKEP
                     TVNILVSSANLSVGARLDDQSVHWMAWPQGGVVPGLITEADKPDAVKDLQGAVVRLPI
                     FEGEPIRPEKIADSSSRILSSLLPAGKRAVATEISVATGAGGFILPNDRVDVIMVRKG
                     AEADKLITETVLSNVRVLAIDQQIQEKDDGSKSVVGTTATLELTPDQTKVLAVAQQMA
                     DRLSLALRSVADAQEQDTSAADYLLSGDNGSAIIQVIKSGAIVTDASAAPKAE"
     CDS             247771..249276
                     /transl_table=11
                     /gene="rcpA"
                     /locus_tag="RL0214"
                     /product="putative pilus assembly protein"
                     /db_xref="EnsemblGenomes-Gn:RL0214"
                     /db_xref="EnsemblGenomes-Tr:CAK05703"
                     /db_xref="GOA:Q1MMU9"
                     /db_xref="InterPro:IPR001775"
                     /db_xref="InterPro:IPR004846"
                     /db_xref="InterPro:IPR007055"
                     /db_xref="InterPro:IPR032789"
                     /db_xref="UniProtKB/TrEMBL:Q1MMU9"
                     /protein_id="CAK05703.1"
                     /translation="MQMGNSMRRAGPLVTGCLSLAIGVSGMVPASFATLFAAGEARAD
                     SDSLVRISQTGSNAHRRLKLGLNKAVVVDLPEDAHDILVSDPTMADAVTRTSRRIYLF
                     GKKVGQTNIFVFGAGGQEIVNLDIEIERDVSGLEVNLRRFIRDSNINVEIVSDNIVLT
                     GTVRTPQDATQAADLAQVFLKGGEATTRTETASGTGGDSSVALFAEGRQSSQVVNLLQ
                     IEGEDQVTLKVTIAEVRREVLKQLGFDNLVSNSSGMTVAQLGSPSADSATATVGGGLA
                     ALFKSSIGKYDISTYLNALEQAKVVKTLAEPTLTAISGQAATFNSGGQQLYSTTDSDG
                     NVTVVPFNYGINLAFKPVVLSSGRISLQIKTNVSEPVAGSGNATYQRRSAETSVELPS
                     GGSIALAGLIRDNVSQTMGGTPGVSKIPLLGTLFRQKGFERQETELVIIATPYLVRPV
                     ARNQLNRPDDNFSPENDGATFFLNRVNKVYGRREAPVADAQFHGSIGFIYK"
     CDS             249273..250025
                     /transl_table=11
                     /gene="cpaD"
                     /locus_tag="RL0215"
                     /product="putative pilus assembly protein"
                     /db_xref="EnsemblGenomes-Gn:RL0215"
                     /db_xref="EnsemblGenomes-Tr:CAK05704"
                     /db_xref="InterPro:IPR013361"
                     /db_xref="InterPro:IPR019027"
                     /db_xref="UniProtKB/TrEMBL:Q1MMU8"
                     /protein_id="CAK05704.1"
                     /translation="MSGARAAAMAENRDQAMAHMNATTPRLGISKALFATVAMSVAIL
                     SGCAGPHDQLTTGGIPDDYRARHPIIVTEAEQTVDIPVASTDRRLTIAQRDLIRGFAA
                     NYISRASGPVYVLSPQGSPNSAAAYQLRNQVRAELTSRGIASSKIVNTSYAAVGPGDA
                     APIRLSFTGTTAVTTQCGQWPKDISNDLTNQNYYNFGCASQNNLAAQIANPEDLVAPR
                     GMTPIDAQRRNNAIQEYRTTTTTIEDAGDSGF"
     CDS             250040..251317
                     /transl_table=11
                     /gene="cpaE"
                     /locus_tag="RL0216"
                     /product="putative pilus assembly protein"
                     /db_xref="EnsemblGenomes-Gn:RL0216"
                     /db_xref="EnsemblGenomes-Tr:CAK05705"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MMU7"
                     /protein_id="CAK05705.1"
                     /translation="MSAIEYEIRNPSELRNAEEAVRMADLENMRPLPRISVHAFCESE
                     ALQHVMERCANDRRVAKVSMRITSGGVAAAANMFSGAPTPNLIILETKANAANLLGEL
                     APLAAVCDPTTKVVIIGYYNDIGLYRELIRNGISEYMVQPVAMPDILTAMASIFVDPD
                     AEPLGRSIAFIGSKGGTGASTIAHNCAFGISNLFSTETILADLDLPYGTANIDFDQDP
                     AQGIAEAVFAPDRLDEVFLDRLLTKCSEHLSLLAAPSLLDRAYDFDGQAFQPVLDVLQ
                     RSAPVTVLDVPHAWSEWTRSVLSSVDEVVIAAVPDLANLRNAKNMLDALRKMRPNDRP
                     PHLILNQVGMPKRPEISPSDFCEPLEIDPIAIIPFDINLFGNAANSGRMISEVDPKSP
                     TAETFSQISHIVTGRVAIKKAKKGGLLGLLKRK"
     CDS             251351..252826
                     /transl_table=11
                     /gene="cpaF"
                     /locus_tag="RL0217"
                     /product="putative component of pilus"
                     /db_xref="EnsemblGenomes-Gn:RL0217"
                     /db_xref="EnsemblGenomes-Tr:CAK05706"
                     /db_xref="GOA:Q1MMU6"
                     /db_xref="InterPro:IPR001482"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MMU6"
                     /protein_id="CAK05706.1"
                     /translation="MFGKRGNEGSGKVGGAIAPPPPAPAAAPAASSPSILVEPSRESA
                     RQQVTPPQMQTPQRKRPARTDEYYDTKAQVFSALIDTIDLSQLSKLDGESAREEIRDI
                     VNDIITIKNFAMSISEQEELLEDICNDVLGYGPLEPLLARDDIADIMVNGAGQTFIEV
                     GGKTIESEIRFRDNAQLLSICQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSI
                     DGPALTIRKFKKDKLTLDQLVRFGAITPEGATVLQIIGRVRCNVVISGGTGSGKTTLL
                     NCLTNYIDRDERVITCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMR
                     PERIIVGEVRGPEVFDLLQAMNTGHDGSMGTIHANTPRECLSRIESMIAMGGFTLPAK
                     TVREIISSSVDVVIQAARLRDGSRRITQITEVIGMEGDVIITQDLMRYEIEGEDANGR
                     LVGRHMSTGVGKPHFWDRARYFNEEKRLAAALDAMEAKTKE"
     CDS             252832..253839
                     /transl_table=11
                     /locus_tag="RL0218"
                     /product="putative pilus assembly protein"
                     /db_xref="EnsemblGenomes-Gn:RL0218"
                     /db_xref="EnsemblGenomes-Tr:CAK05707"
                     /db_xref="GOA:Q1MMU5"
                     /db_xref="InterPro:IPR018076"
                     /db_xref="UniProtKB/TrEMBL:Q1MMU5"
                     /protein_id="CAK05707.1"
                     /translation="MFGFDPIVLAIVVLAAVSAAAVAYALLFSKIEADKKSASRINRV
                     KSAESDRVKVKAARDRVQELSKRRKSVQDNLKDLEKRQHEKTKKTVSMKSRLVQAGLT
                     ITAAKFYLISAVFASVLLLIALVVGASLMVMIGIAVVAGLGLPRWVVGFLIKRRQTKF
                     LNEFPNALDVITRSIKSGLPLNDAIRLIATEGTEPVKSEFLRVIEAQQVGLSIPDACA
                     RMTIHMPLQEVNFFAIVIAIQSQAGGNLSEAIGNLSKVLRERRKMKAKVSALSMEAKA
                     SAVIIGALPFIVATLVYMTSPNYMMILFTDPRGHFIMGVSAIWMSIGIFVMRNMVNFD
                     I"
     CDS             253855..254841
                     /transl_table=11
                     /gene="tadC"
                     /locus_tag="RL0219"
                     /product="putative component of pilus protein"
                     /db_xref="EnsemblGenomes-Gn:RL0219"
                     /db_xref="EnsemblGenomes-Tr:CAK05708"
                     /db_xref="GOA:Q1MMU4"
                     /db_xref="InterPro:IPR018076"
                     /db_xref="UniProtKB/TrEMBL:Q1MMU4"
                     /protein_id="CAK05708.1"
                     /translation="MSQDLAATLTNPSMLIALLVAIAVFATFYTIAVPFFERGDLNKR
                     MKAVSTEREQIRARERARMNTETGAGKASLRSQNNRSVRQIVERFNLRKALVDENTIN
                     KLRAAGFRSENALNTFLVARFLLPFLFLALAAFWVFGLGNLAEKGTPIRLFAVIGVGY
                     LGFYAPNIYISNRMGKRQHSIKRAWPDALDLMLICVESGISIEAAMRRVSEELGEQSP
                     ALAEEMVLTTAELSFLPDRRVALENLATRTQIELVRSVTQALIQADRYGTPVAQALRV
                     LAQEGRDERMNEAEKKAAALPPKLTVPMILFFLPVLIAVILGPAGIQVADKF"
     CDS             255044..255676
                     /transl_table=11
                     /locus_tag="RL0220"
                     /product="putative transmembrane efflux protein"
                     /db_xref="EnsemblGenomes-Gn:RL0220"
                     /db_xref="EnsemblGenomes-Tr:CAK05709"
                     /db_xref="GOA:Q1MMU3"
                     /db_xref="InterPro:IPR001123"
                     /db_xref="UniProtKB/TrEMBL:Q1MMU3"
                     /protein_id="CAK05709.1"
                     /translation="MSSAGIFISIMAALAVGAMSPGPSFVVVSRIAISRSRLDGLAAA
                     LGMGAGGVVFAVLALAGLTALLSQFEWLYVLLKVAGGAYLVYIAVNIWRSAGQPLEVS
                     DAVNGNRALRLSFMTALLTQLSNPKTIIVYASLFAALLPRTVPLDLIVALPLGVFAVE
                     AGWYSIVAFALSARHPRRLYLAAKGWIDRAAGAVMGGLGLRLILSGLSAR"
     CDS             complement(255786..256619)
                     /transl_table=11
                     /locus_tag="RL0221"
                     /product="conserved hypothetical protein"
                     /product="hypothetical protein atu0215 (agr_c_369p)"
                     /db_xref="EnsemblGenomes-Gn:RL0221"
                     /db_xref="EnsemblGenomes-Tr:CAK05710"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR014596"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q1MMU2"
                     /protein_id="CAK05710.1"
                     /translation="MPASLTTTITNRILQGAAASLLVLALAGCSTTKDRMTTGSVPKL
                     TKPVEEMDATELRSATDRLGQAYEKNPRDPVTGVNYANLLRMNGRDTQALAVMQQVAI
                     ANPGDRNVLAAYGKAQAAAGQFQQALDTIGRAQTPDRPDWKLISAQGAILDQMGRASD
                     ARQRYRDALDIQPNEPSILSNLGMSYVLTGDLRTAETYLRSAASQPTADSRVRQNLAL
                     VVGLQGRFPEAEQIARRELSPQQADANVAYLRGMLSQQNSWQKLAAKDKTPQAGDSNT
                     N"
     CDS             256764..258155
                     /transl_table=11
                     /locus_tag="RL0222"
                     /product="putative peptidase"
                     /note="Codons 120 to the C-terminus are similar to codons
                     80 to the C-terminus of Salmonella typhimurium. PepB
                     PEPB_SALTY (EMBL:AE008815) ( Peptidase B (EC 3.4.11.23)
                     (Aminopeptidase B).) fasta scores: ungapped id 42.208%
                     3.4.11.23 id in E(), and to Rhizobium meliloti
                     (Sinorhizobium meliloti). PUTATIVE AMINOPEPTIDASE PROTEIN
                     (EC 3.4.-.-). Q92T36 (EMBL:SME591782) (EC ( 463) fasta
                     scores: E()=2.1e-157 83.624% id in 458 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0222"
                     /db_xref="EnsemblGenomes-Tr:CAK05711"
                     /db_xref="GOA:Q1MMU1"
                     /db_xref="InterPro:IPR000819"
                     /db_xref="InterPro:IPR011356"
                     /db_xref="UniProtKB/TrEMBL:Q1MMU1"
                     /protein_id="CAK05711.1"
                     /translation="MAPYQFIERPTPFNTKGGSTLPIFAVTPAHIETGTIDPIALDWA
                     RRAGYKAESGSLLLIPTAEGHLGGALYGLGTNPSEQPYITGRLARALPAGDWHIETAP
                     LTANRLALGFGLGSYRFDRYKSEKSPAATLMIPRDADAADIKRQLAGVFLARDLINTP
                     TNDMGPNQLEAVFRGLAAHYKAEMSVISGDDLLTQNFPLVHTVGRASADAPRLLELRW
                     GKKGHRKVTLVGKGVCFDTGGLDIKPAASMLLMKKDMGGAANVMGLALMIMDAKLKVD
                     LRVIVPVVENAISSNAFRPGDIYRSRKGLTVQIDNTDAEGRLILADALAYADEEEPEL
                     LIDMATLTGAARVALGPDLPPFFTDDANLAHDLTEASLETDDPIWRLPLYSGYEKDIR
                     TKFADLTNAPAGGMAGAITAALFLKRFVSKAKSWAHFDIYGWAQSERPHSPGGGEAQA
                     IRALFHHIRESLR"
     CDS             258334..258684
                     /transl_table=11
                     /locus_tag="RL0223"
                     /product="putative MarR family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0223"
                     /db_xref="EnsemblGenomes-Tr:CAK05712"
                     /db_xref="GOA:Q1MMU0"
                     /db_xref="InterPro:IPR000835"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q1MMU0"
                     /protein_id="CAK05712.1"
                     /translation="MPIELTASQALGLWHGVALDQVRHDDRDLTLRQMAILLHIYLVP
                     PPHTVRGLAATLEVTKPVITRALDTMGEMGLVDRVRDDADRRNVIIKRTVGGALYLEN
                     LGDLIRDQARRLPI"
     CDS             258696..259553
                     /transl_table=11
                     /locus_tag="RL0224"
                     /product="putative dipeptidyl-peptidase"
                     /note="Similar, but extended at the N-terminus to Bacillus
                     sphaericus. Dipeptidyl-peptidase VI (EC 3.4.22.-) (DPP VI)
                     (Gamma-D-glutamyl-L- diamino acid endopeptidase II)
                     (Gamma-D-glutamyl-MESO-diaminopimelate peptidase II)
                     (Endopeptidase II). DPP6_BACSH (EMBL:BSEPEPII) (EC 3.4 (
                     271) fasta scores: E()=3.1e-06 26.667% id in 270 aa, and
                     similar to entire protein of Rhizobium meliloti
                     (Sinorhizobium meliloti). Hypothetical protein SMc02827.
                     Q92KU2 (EMBL:SME591782) (284) fasta scores: E()=1.2e-68
                     64.539% id in 282 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0224"
                     /db_xref="EnsemblGenomes-Tr:CAK05713"
                     /db_xref="InterPro:IPR000064"
                     /db_xref="UniProtKB/TrEMBL:Q1MMT9"
                     /protein_id="CAK05713.1"
                     /translation="MTMLDCRLHAYRSDLAEAGLEGKVEAPRFTEGTPARVAVPVVAL
                     RPEPDLARGIDTELLLGEDVTVFDRADGWCWVKAASDGYVGYVKADALLEGRPAATHI
                     VTVQRTFLYPEPELRKPHQAILSMGSRIHVAGETEARGNRYVVLEDGTAIFAKHVQPI
                     GALDGADYVEIVARFLETPYLWGGRSGLGIDCSGLVQLAMLMTGRAAPRDTDMQAAGL
                     GQPIDRSELRRGDLVFWKGHVAVFEDPETILHANGHSMTVARENFAAAVERIGWLYEQ
                     PTGYRRPIS"
     CDS             complement(259554..260945)
                     /transl_table=11
                     /locus_tag="RL0225"
                     /product="putative amidase"
                     /db_xref="EnsemblGenomes-Gn:RL0225"
                     /db_xref="EnsemblGenomes-Tr:CAK05714"
                     /db_xref="GOA:Q1MMT8"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:Q1MMT8"
                     /protein_id="CAK05714.1"
                     /translation="MTETDLTIHELRQRFADKSLSPLEYWLALEDHIAAWEPSISALY
                     LYDPESARAQAKASTERWAKAETLGPLDGIPVTLKELIATKGQPVPSGTRAVELKPAD
                     ADAPAAARLREDGAVIFAKTTCPDYGMLSSGLSSFHPLSRNPWDITQNPGGSSAGASA
                     AAAAGYGPLHIGTDIGGSVRLPAGWTGIFGFKPSHGRIPADPYYVGRCVGPMARTVED
                     AAFSMATLSRPDWRDGTSLPPNDFNWMDLDIDLSGMKIGLMLDAGCGLAVDDEIRTAV
                     ETAAKQFEAAGATILSVQPVLTRAMLDGLDNFWRSRLWGDIADLDEERRDSILPYIRD
                     WAMGGADISGVDAVRGFNQTIEMRKSCGRLFTEVDALLSPTNPIISYPAEWASPTNDP
                     ALPFEHIGFTVPWNMSEQPAASINCGFSRSGMPIGLQIVGPRFDDMRVLRLSKAFEDW
                     MGGVRSWPQPPIG"
     CDS             complement(260982..261845)
                     /transl_table=11
                     /locus_tag="RL0226"
                     /product="putative transmembrane permease component of ABC
                     transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0226"
                     /db_xref="EnsemblGenomes-Tr:CAK05715"
                     /db_xref="GOA:Q1MMT7"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="UniProtKB/TrEMBL:Q1MMT7"
                     /protein_id="CAK05715.1"
                     /translation="MVPIASTAIAGRRRVFRLSRRMNLIAGAVIIGLLVAVALLSLVW
                     TPLPPAKMQIIHKLQPPLAFGLLGTDQFGHDVLSMLMAGCWNSLSIAITAVTIGGTLG
                     SIAGISAAAIRGPFEALLMRICDVIFALPPILSAMVLGAFLGPGRFTAITAIAVFMIP
                     VFARVTLATSLQAWSRDYVTAARAIGNTRLTISLRHVLPNIISQIIVHGAIQLGLAIL
                     TEAGLSFLGLGMAPPAPTWGRMLADAQTYLALAPWLAILPGLAIALTVFGFNMLGDGL
                     RDLLDPREASR"
     CDS             complement(261849..262796)
                     /transl_table=11
                     /locus_tag="RL0227"
                     /product="putative transmembrane component of ABC
                     transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0227"
                     /db_xref="EnsemblGenomes-Tr:CAK05716"
                     /db_xref="GOA:Q1MMT6"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="UniProtKB/TrEMBL:Q1MMT6"
                     /protein_id="CAK05716.1"
                     /translation="MIPLLARRFVGLIVTLVVVSLLIFAVMDLLPGDPASIMLGTSAT
                     PETLAALRHSLGLDQPLLLRYGQWLAGVLSGDLGNSLTYGVPVAGLIVERLAVTLPLA
                     LMAIVLSVAIALPLGVLAASRRGGIFDVIATLFSQISIAVPAFWVALLLIILFSTMLG
                     LMPAGGFPGWSAGLTPALQALVMPAVALAMPQAGVLTRVARSAVLDTMHEDFARTAVA
                     KGLSRSAVLWRHIVPNALIPILTMIGLQFTFLVAGAVLVENVFNLPGLGRLALQALSQ
                     RDIIVMQDVVLFFAGLVIVMNFIVDLSYMAIDPRMRKAA"
     CDS             complement(262908..264437)
                     /transl_table=11
                     /locus_tag="RL0228"
                     /product="putative solute-binding component of ABC
                     transporter"
                     /note="Similar, but truncated at the N-terminus, to
                     Agrobacterium tumefaciens (strain C58/ATCC 33970). ABC
                     transporter, substrate binding protein (AGR_L_861p).
                     Q8U7L1 (EMBL:HS184254) (540) fasta scores: E()=4.5e-149
                     74.168% id in 511 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0228"
                     /db_xref="EnsemblGenomes-Tr:CAK05717"
                     /db_xref="GOA:Q1MMT5"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="InterPro:IPR030678"
                     /db_xref="UniProtKB/TrEMBL:Q1MMT5"
                     /protein_id="CAK05717.1"
                     /translation="MIKLSFAPSARLARRLSLSAALSAGLVMTAMTPAEAAKTTLNLG
                     MSVEPTGLDPTIAAPVAIGQVIWQNVFEGLVTIDQAGKIQPQLAKSWEISPDGLTYTF
                     KLQTGVKFHDGEAFDAASAKFSLDRARGADSVNPQKRFFASIASIDTPDAETLVLHLS
                     APTGSLIYWLGWPASVMVAPKTAADDKTTPVGTGPFKFASWAKGDKVELARNADYWNK
                     DAAAKLDKVTFRFIADPQAQAAALKSGDLDAFPEFAAPELMSSFDGDARLVTRIGNTE
                     LKVVAGMNTAKKPFDDKRVRQALMMAIDRKTVIDGAWSGLGTPIGSHYTPNDPGYQDM
                     TGVLPYDVEKAKALLAEAGYPNGFTFTIKSPQMAYAPRSAQVMQAMFAEIGVTMNIEP
                     TEFPAKWVQDIMKDRNFDMTIVAHAEPLDIDIYARDPYYFNYKNPAFNALMKKVQETA
                     DPAAQSAIYGEAQKILAEDVPALYLFVMPKLGVWDKKLKGLWENEPIPSNVLSGVSWD
                     E"
     CDS             complement(264588..265508)
                     /transl_table=11
                     /locus_tag="RL0229"
                     /product="putative LysR family transcriptional regulator"
                     /note="Similar to Agrobacterium tumefaciens (strain
                     C58/ATCC 33970). Transcriptional regulator, LysR family.
                     Q8U7L2 (EMBL:AE009372) (332) fasta scores: E()=8.1e-79
                     75.168% id in 298 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0229"
                     /db_xref="EnsemblGenomes-Tr:CAK05718"
                     /db_xref="GOA:Q1MMT4"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q1MMT4"
                     /protein_id="CAK05718.1"
                     /translation="MQIRALMYFDELVRTNSMRQAAENLNVAPTAISRQIENLEYHFG
                     APLVERSARGVKLTAAGELLAARAGRTLRELDHVQQLIEDLKGLQRGRVSIYANGATV
                     ANLLAPALAEFSLKYPKLRFTVTITSARQAIDAVNSAEADIAVTLFAPPMSGTKVRLR
                     SEIGYDLIATPQHPAAAHAEIPLRMLADYALALPDQSFGFRQAFDALFEKEGLSLDPV
                     FVTSSLEMLKELVLSGAAVTLLPALTVRREIEAGQLLAIPLAGKTGIRTHVDLCVAPD
                     RQLSFAATKLLDFIERFMRERTNRRAETKD"
     CDS             complement(265565..266560)
                     /transl_table=11
                     /locus_tag="RL0230"
                     /product="putative peptidase"
                     /product="endo-type 6-aminohexanoate oligomer hydrolase"
                     /db_xref="EnsemblGenomes-Gn:RL0230"
                     /db_xref="EnsemblGenomes-Tr:CAK05719"
                     /db_xref="InterPro:IPR005321"
                     /db_xref="InterPro:IPR016117"
                     /db_xref="UniProtKB/TrEMBL:Q1MMT3"
                     /protein_id="CAK05719.1"
                     /translation="MPDLLNLITDIEGVSVGHATDLVLGSGVTVIVFDEPVVASGTVL
                     GGAPGGRDTGLLDPSMTVNAVDAFVLSGGSAFGLDAAGGVQAGLRELGRGFAVGPVRI
                     PIVPQAILMDLLNGGDKDWGLHSPYRDMGYTALQAAAKGTFALGTTGAGTGATTATVK
                     GGLGSASAVSSAGHRVAAIVAVNALGSATIGDGPHFWAAPFEKDAEFGGLGMPDVADH
                     RMRLKGMNTPATTIGAVVTDAQLTKAEAHRLSLAGHDGFARALLPAHLPLDGDTVFAA
                     STARHQRDDMASLMELCHLATIVMARAIARGVYAATALPVEGAQKAWRDRYASSS"
     CDS             complement(266793..267068)
                     /transl_table=11
                     /locus_tag="RL0231"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0231"
                     /db_xref="EnsemblGenomes-Tr:CAK05720"
                     /db_xref="UniProtKB/TrEMBL:Q1MMT2"
                     /protein_id="CAK05720.1"
                     /translation="MTFVLLSTVPDKSIRHGCAYRAAGVLSMKKQVIEYAGVPVGIVI
                     PDEDRLKFIAVKFHVHDLDEQRFGSPDEVRLAIHDLMTRRHPKPLHA"
     CDS             complement(267509..270430)
                     /transl_table=11
                     /gene="optF"
                     /locus_tag="RL0232"
                     /product="putative aminotransferase"
                     /note="C-terminus from codon 545 is similar to
                     Burkholderia cepacia (Pseudomonas cepacia). dgdA
                     DGDA_BURCE (EMBL:PCDGD) ( 2,2-dialkylglycine decarboxylase
                     (EC 4.1.1.64) (DGD).) fasta scores: ungapped id 35.663%
                     length=432 id in E(), and entire protein is similar to
                     Rhizobium meliloti (Sinorhizobium meliloti). PUTATIVE
                     AMINOTRANSFERASE PROTEIN (EC 2.6.1.-). Q92MC9
                     (EMBL:SME591791) (( 975) fasta scores: E()=0 64.928% id in
                     978 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0232"
                     /db_xref="EnsemblGenomes-Tr:CAK05721"
                     /db_xref="GOA:Q1MMT1"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q1MMT1"
                     /protein_id="CAK05721.1"
                     /translation="MTDEALVDRMALPRPDVTATDVEEILLAHYSLSGRLAELGSQQD
                     RNYRVDSDRGRYVLKICHAAYEIRELEAQNAAIRHLKSRQGAPRVPKVIATNDGREIV
                     VLTVRGQGYQVRLLEYLEGQGLTELTYLAPASVAALGALCARLAQALADFNHPGLDRS
                     LQWDLRRAGPVAVQLLSAITDSAARDRIAKTMVMAVRRIQPLAPALRLQAVHHDVTGD
                     NVVGHRDAHGHIIPDGVIDFGDIIRGWLVGDLAVTCASLLHQADGDPFYILPAVTAYQ
                     AIYPLSEEELKALWPLIVARAVILVASGEQQISVDPDNDYVRGNLDRERAIFDTAMSV
                     PFDLMEAAILKAAGADVAAPETSGWLPLLPDIDPAGIAYVDLGVRSPHFSAGNWLNTD
                     MDWRLLARMATENGTAATRYGEYRLSRAGTARGQATCALHVDICLAAGSAIAAPFAGR
                     IGWKDQHLTLAGDNMTLHLDGLDLSVDDGAEIAAGDSLGTVFGEASSLGGLRVQLCSV
                     AGLEPPLFASPRAAAAWSVLCPSPSLLLSPQADAPQPETAALFARRRAHLARPQKNYY
                     AAPPQIERGWKEHLFDVEGRAYLDMVNNVTILGHGHPRFAAAIGAQWLRLNTNSRFHY
                     AAITEFSERLAALSPDGLDAVFLVNSGSEANDLALRLAQAHSGARNMLCLLEAYHGWS
                     AASDAVSTSIADNPQAPTTRPDWVHTIVSPNTYRGDFRGPDTAADYLGMATPVLEAID
                     AAGEGLAGFIAESVYGNAGGIPLPEGYLKELYAQVRARGGLCIADEVQVGYARLGHYF
                     WGFQQQGVVPDIITVAKGMGNGHPLGAVITTREIAQSLEKEGTFFSSTGGSPVSCVAG
                     MTVLDIMAEEKLQENARTVGDHLKARLAALIDRHPIAGAVHGMGLYLGLEFVRDRTTL
                     EPATEETAAICDRLLELGVIMQPTGDHQNVLKIKPPLCLSIDSADFFADMLEKVLEEG
                     W"
     CDS             complement(270544..271428)
                     /transl_table=11
                     /gene="purU"
                     /locus_tag="RL0233"
                     /product="putative formyltetrahydrofolate deformylase"
                     /EC_number="3.5.1.10"
                     /db_xref="EnsemblGenomes-Gn:RL0233"
                     /db_xref="EnsemblGenomes-Tr:CAK05722"
                     /db_xref="GOA:Q1MMT0"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR004810"
                     /db_xref="UniProtKB/TrEMBL:Q1MMT0"
                     /protein_id="CAK05722.1"
                     /translation="MTSYVLTVSCKSTRGIVAAISSYLADKGCNIVDSSQFDDLDTGK
                     FFTRVSFISEEGVPLAELKEGFEPICKRFAMDAEIHDGNARMKVLLMVSRFGHCLNDL
                     LYRWKIGALPIDIVGVVSNHFDYQKVVVNHDIPFHHIKVTKENKLQAEGQIMDIVEQT
                     GTELIVLARYMQVLSDAMCQKMSGKIINIHHSFLPSFKGANPYKQAYGRGVKLIGATA
                     HYVTADLDEGPIIEQDTARITHAQSPDDYVSIGRDVESQVLARAIHAHIHHRTFLNGN
                     RTVVFPASPGGYASERMG"
     CDS             complement(271645..272664)
                     /transl_table=11
                     /gene="exoZ"
                     /locus_tag="RL0234"
                     /product="putative expolysaccharide biosynthesis protein"
                     /product="exopolysaccharide production protein exoz"
                     /note="Similar, but extended at the N-terminus, to
                     Rhizobium meliloti (Sinorhizobium meliloti). exoZ
                     EXOZ_RHIME (EMBL:B95975) ( Exopolysaccharide production
                     protein exoZ.) fasta scores: ungapped id 38.028%
                     length=317 id in E(), and to length=335 AAQ87046 ( id
                     36.812%) fasta scores: 345 aa overlap id 40.063% id in
                     que"
                     /db_xref="EnsemblGenomes-Gn:RL0234"
                     /db_xref="EnsemblGenomes-Tr:CAK05723"
                     /db_xref="GOA:Q1MMS9"
                     /db_xref="InterPro:IPR002656"
                     /db_xref="UniProtKB/TrEMBL:Q1MMS9"
                     /protein_id="CAK05723.1"
                     /translation="MLVQLQYLRAIAALMVVYFHAVLQLAKVNPAVDATAFVYGETGV
                     DIFFVLSGFVMWLTTSGRGMSPIDFARRRIKRIVPLYWLATLFSATVALVAPSLLKST
                     VFDLPHLAASLFFLPWANPADPSTITPVVVPGWTLNYEMFFYFIFALLLPLQEARRIP
                     AMFAVFAVILIACRLLPETTVTRFYGEPIMLEFLAGVVLGWLYGQKVLLPNRWAWAAL
                     AMGFAFLFINEALMPPESRFYAWGIPAIFIVYGAISIDFSKLPVIGWLNYLGDCSYSI
                     YITHAFTLAFLRVAADRLPIGILQQPVLFVILSLVLSSIGGAIIHEITSPRRRKVAVA
                     SRPPA"
     CDS             complement(272824..274014)
                     /transl_table=11
                     /locus_tag="RL0235"
                     /product="putative transmembrane exopolysaccharide
                     biosynthesis protein"
                     /db_xref="EnsemblGenomes-Gn:RL0235"
                     /db_xref="EnsemblGenomes-Tr:CAK05724"
                     /db_xref="GOA:Q1MMS8"
                     /db_xref="UniProtKB/TrEMBL:Q1MMS8"
                     /protein_id="CAK05724.1"
                     /translation="MLWLGLLSVLYNGILAFINHNIVPLSLTHVAASEGLIMASAIIY
                     ILHKGIYETDLPAFLFLLFTLIVTIYVSVLNRMLFIDHFRNVLIIFCFTGLGGWSNEK
                     TMKLAFRWASLAVMIFLIFEIISVPFYVSIVHPSDYFANTRGLLPLSYNTTGLFQNAL
                     GFPERFSFGIIDHRSSSIFLEQVSLANFCGVIAVYLISMWEKLSRWDRLLMIGTAVLI
                     LVTNDTRTMLIFCFACIVGYFVFPKIPKNFNLALMPLIVAAGFLVYVLKPNATGDNFT
                     GRINLTMKKIMELDPLAVLGLSVDRVAEFADSGYVYLIYAATIFGVIALWLFVCLFPA
                     GRTAAQRRCAHSLSLFIFLNMMIGGTAVFSMKIAGLLWFVVGYMRFHDSPRIRQDRPA
                     DVLS"
     CDS             complement(274119..275201)
                     /transl_table=11
                     /locus_tag="RL0236"
                     /product="putative carboxymethyl cellulase"
                     /db_xref="EnsemblGenomes-Gn:RL0236"
                     /db_xref="EnsemblGenomes-Tr:CAK05725"
                     /db_xref="GOA:Q1MMS7"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:Q1MMS7"
                     /protein_id="CAK05725.1"
                     /translation="MLRFAAIARMPMKTTRHLTALLLAAALIPSPALAAEAPCYRGVN
                     LSGGEYGERGGIYGTNYTYPSEDTIGYFAEKGMTIIRLPFRWERLQPALGGRLDEDEL
                     KRIKDTIGLIRKHGMAVLLDPHNFGYYDKTQVGTAPATDAAFGDFWARLAVEFANQDG
                     VLFGLMNEPHDIKATDWLDAANAAIRSIRAVGARNLILVPGTAWSGAGSWEKDVIGGA
                     NGTVMLGVRDPLDFYAYEVHQYLDADSSGTHPTCEGAGAAVAAINGVTAWLKQNHKRG
                     FLGEFGASADKDCMSGLTEIYATMSDNSDVWLGWSYWAAGDWWPANEPFNVQPRKGPE
                     RPQMRLLAEVAKAGAGTCSAVKPAGK"
     CDS             275304..276911
                     /transl_table=11
                     /locus_tag="RL0237"
                     /product="putative exopolysaccharide related transporter"
                     /db_xref="EnsemblGenomes-Gn:RL0237"
                     /db_xref="EnsemblGenomes-Tr:CAK05726"
                     /db_xref="GOA:Q1MMS6"
                     /db_xref="InterPro:IPR003856"
                     /db_xref="InterPro:IPR032807"
                     /db_xref="UniProtKB/TrEMBL:Q1MMS6"
                     /protein_id="CAK05726.1"
                     /translation="MNQYDRNRVSRLPDWRSFEPSQTAPEGVRVRSPVIRPDDFVRPS
                     PEPAPPPFVPPASIAETRQYEPPAPPPPKPPVVDAPPNAEPAAAAPLLDLRSSIAAIW
                     SRRLIVFGLALLGALAGGAVAPLIAQKFTAVSSLYFDPRQIGLADAGAQSSGPSPEMI
                     SALIDSQVQILTSGNVLRRVAEAMKLDQDPEFTGGRTDGAALIGTLQKALVITREAST
                     YVVSLAATTNDPEKSARLANQVVTSFTEEENSASNGIYENTSSTLDGRLDDLRQKVLE
                     AEQAVETFRADNDMAATEGNLISDQRLLSLNTLLVTAQEKTIQAKARADAVANLRVED
                     IVAGNQAEGGVTSPLVSLRQQYATQAAAVGSLESQMGTRHPRLQAARSSLQSISVEIR
                     GELQRLATSARGEYEQAKAAEDSIAKELAVQKALHASSSDKQVELNELQRKATAARDI
                     YETVLKRSSQTSEEQNLNQSNIRVISPAEPPVKADGPGKKILLVAGIIGGFLAGFVVG
                     AGFAILAGLFGHPVIRSYFRKSSAAAA"
     CDS             277070..277402
                     /transl_table=11
                     /locus_tag="RL0238"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0238"
                     /db_xref="EnsemblGenomes-Tr:CAK05727"
                     /db_xref="UniProtKB/TrEMBL:Q1MMS5"
                     /protein_id="CAK05727.1"
                     /translation="MRLLMMLLISLAAVPGLAPASAFAVDWTKSVDSGVQPLYPYKGL
                     PGVKAQPDKKEEESYNCRTETVQIRRRYDEIFRSGGMPTLMYVCERDGFVTTGGKVPL
                     RGHYQPVR"
     CDS             complement(277814..278572)
                     /transl_table=11
                     /locus_tag="RL0239"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0239"
                     /db_xref="EnsemblGenomes-Tr:CAK05728"
                     /db_xref="GOA:Q1MMS4"
                     /db_xref="InterPro:IPR007072"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q1MMS4"
                     /protein_id="CAK05728.1"
                     /translation="MTTKDDRLEFEAHKREMSLALGKDEASFQQSLNTLIGLDKFDYS
                     YLWSWMGVPIIQLPVDILATQEVIWETKPDVIIETGIARGGSLIFMASILAAMGNDAA
                     KVVGVDIDIRAHNRESIETHPMSSRIKMIQGGSVDDDVIVAVKAEIPPSARVMVVLDS
                     DHSYEHVLAECRAYGPLVTEGCYLVVADTFIGHLTEEQAFTKRSKVWLRGNEPLKAVT
                     DYLAETDRFEVDPVLNGKLVLSSSPGGYCVCRKA"
     CDS             complement(278605..279753)
                     /transl_table=11
                     /locus_tag="RL0240"
                     /product="putative perosamine synthetase"
                     /db_xref="EnsemblGenomes-Gn:RL0240"
                     /db_xref="EnsemblGenomes-Tr:CAK05729"
                     /db_xref="GOA:Q1MMS3"
                     /db_xref="InterPro:IPR000653"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q1MMS3"
                     /protein_id="CAK05729.1"
                     /translation="MTNRIFYTKPSITQLETDYATDAAATGWGAHCYDYINRFERDFK
                     TYLGSGFAIATSSCTGAMHMGLAALGVGEGDEVILADTNWVATVSPIVHLGAKPVFVD
                     VLPDSWCIDPSEVERHITPKTKAIIATHLYGNLCDMDALLEIGQRTGIPVIEDAAEAV
                     GSVWNGRRAGSMGTFGTFSFHGTKTLTTGEGGMFVTNDAALSERVLTLSNHGRARGQT
                     KQFWPDEIGFKYKMSNIQAAIGCAQLERIEELVARKREILAAYMVRLSALPGISMNPE
                     YSGTINGAWMPTAVFHPSTGTTREIMQQAFEAANIDARVFFYPLSSLSMFEDRPENVN
                     AWSIPGRAINLPSYHDMSEADIDRVAATLLDVAGGRIYHNRTALRQSV"
     CDS             280053..280805
                     /transl_table=11
                     /locus_tag="RL0241"
                     /product="onserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0241"
                     /db_xref="EnsemblGenomes-Tr:CAK05730"
                     /db_xref="GOA:Q1MMS2"
                     /db_xref="InterPro:IPR007072"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q1MMS2"
                     /protein_id="CAK05730.1"
                     /translation="MTTKDDRQEFEANKREMSLALGRDTDVFRQTLDTLVSLDKYDYS
                     YLWSWMGMPIIQMPADVMATQEVIWATKPDVIVETGVARGGSMIFQAAMLQLIGKGKV
                     VGVDIDIRAHNRQAIESHPMAHRVELIEGPSTSAEIMAKVKASIPEGASVMVILDSDH
                     SKAHVLDELRNYAPLVTDGQYLVVADTILGRYEPSQVPTKRSKVLLPGDEPLVALNDY
                     LQETDRFELDTIINGKLVLSSSPGGYLRCVRS"
     CDS             complement(281701..282939)
                     /transl_table=11
                     /locus_tag="RL0242"
                     /product="putative O antigen biosynthesis protein"
                     /db_xref="EnsemblGenomes-Gn:RL0242"
                     /db_xref="EnsemblGenomes-Tr:CAK05732"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q1MMS0"
                     /protein_id="CAK05732.1"
                     /translation="MSGIKLSICIPTYNREAYLRNALTYCENDYTFTFPFEIVICDNA
                     STDGTQQVVEEFIARGQPIRYYKRETNAGAAANVTSALRLGKGEYLIYLADDDMLIAD
                     AVADTIRYLDNNQEVTCAHAPWFFYDEVAKTDIEKFYNVEEDRKFPHGSFGDVFQYIC
                     EGHIFPEIAIYRSSALRSAWIPREFCFYPFPFLAHFLDQGAVSFLQRPFYRSIVNSAI
                     ARDRPQEGTNDVMTSWDRYRGGLEYFLYMGVKRGAMTLTPETHLKYEEMCKVFTLNRM
                     AVAFRFWAERKNFIKAYELYTRIMWGGMLNHPEIRNFRERLPLMVAIQTLVSEVNSAI
                     GIDTLLLGGFSEITALEGLMRELGLNEKVKMTVKLSDSPLESTAVFVSVNSDREYFVA
                     LGYLPNLVFHEHDLSRHIIM"
     CDS             complement(282936..283439)
                     /transl_table=11
                     /locus_tag="RL0243"
                     /product="putative dTDP-4-dehydrorhamnose 3,5-epimerase
                     protein"
                     /db_xref="EnsemblGenomes-Gn:RL0243"
                     /db_xref="EnsemblGenomes-Tr:CAK05733"
                     /db_xref="GOA:Q1MMR9"
                     /db_xref="InterPro:IPR000888"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:Q1MMR9"
                     /protein_id="CAK05733.1"
                     /translation="MEVDARSDDRGMFARTFDAQTFAAQGLVPVYPQCNVSQNHKRGT
                     LRGMHYQAEPRPEIKLVRATRGRVFDVALDLRPDSPSYLKWASVELDAIRHNAFYIPA
                     GCAHGFLTLEDDCELYYQMSETYVPELARGVRWDDPAFSIAWPFTPSIINERDAALDS
                     YGQETSL"
     CDS             complement(283475..284710)
                     /transl_table=11
                     /locus_tag="RL0244"
                     /product="putative methyltransferase"
                     /db_xref="EnsemblGenomes-Gn:RL0244"
                     /db_xref="EnsemblGenomes-Tr:CAK05734"
                     /db_xref="GOA:Q1MMR8"
                     /db_xref="InterPro:IPR013630"
                     /db_xref="InterPro:IPR013691"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q1MMR8"
                     /protein_id="CAK05734.1"
                     /translation="MTAHNCRFCNAPLKHRFVDLGSTPLANAYLTEEQLKLPEPSYPL
                     RAFVCTECWLVQADAFVPPEDIFSHYAYFSSYSDGWVEHARQFTIMARERFGLDATSQ
                     VIEVASNDGYLLKHFVEAGVPVLGIEPAENVAEVARQIGVPTEARFFGKETAADLVSR
                     GLAADIVIGNNVLAHVPDINDFVGGLSAVLKPDGVVSVEFPHLLRLMENIQFDTVYHE
                     HFYYLSLLAVEKVFAAHGLKVFDVEELPTHGGSLRVLACRATSMVHAIGHGLAKVRAD
                     EAAAGFDKVETYEAFQSRVAPIKDGLLAFLTEAKRSGKKVAAYGAAAKGNTLLNFCGV
                     GTDLIEYVVDRNPHKQGHFLPGSKLPIYAPEKMDETQPDYVLILPWNIKNEVVAANSR
                     VGAWGGRFAVAVPELTVLG"
     CDS             complement(284707..285780)
                     /transl_table=11
                     /locus_tag="RL0245"
                     /product="putative CDP-glucose 4,6-dehydratase"
                     /EC_number="4.2.1.45"
                     /db_xref="EnsemblGenomes-Gn:RL0245"
                     /db_xref="EnsemblGenomes-Tr:CAK05735"
                     /db_xref="GOA:Q1MMR7"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR013445"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MMR7"
                     /protein_id="CAK05735.1"
                     /translation="MEAMGLTDFWNGRRVFLTGHTGFKGSWLSLWLEKLGAEVTAVSL
                     EPETNPSLYGRLAPWNGQGHHIADIREAATFKQHFIDFEPEIVIHMAAQALVRRSYEN
                     PTETFATNVMGTANVLDAVRETPSVKTALVVTSDKVYANNGSGVPFVETDMLGGKDPY
                     SNSKACTELVVRSYRDSFFKGRDIKLATVRAGNVIGGGDWSKDRLIPDFIRAFESSQP
                     ILLRYPEAIRPWQHVLEPLGGYLAFAEALTLAGEQELPEALNFGPDPQSFATVSELAE
                     ALGLAHGVNDVWKPALGKHLPEAPALTLSSALALSAIGWRPRLGLKQTIDWTAAWYKA
                     NREGADMRAFSLGQIAAYEETIS"
     CDS             complement(285762..286535)
                     /transl_table=11
                     /gene="ddhA"
                     /locus_tag="RL0246"
                     /product="putative glucose-1-phosphate
                     cytidylyltransferase"
                     /EC_number="2.7.7.33"
                     /db_xref="EnsemblGenomes-Gn:RL0246"
                     /db_xref="EnsemblGenomes-Tr:CAK05736"
                     /db_xref="GOA:Q1MMR6"
                     /db_xref="InterPro:IPR013446"
                     /db_xref="InterPro:IPR025877"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q1MMR6"
                     /protein_id="CAK05736.1"
                     /translation="MKVVILAGGLGSRLAEETSIRPKPLVEIGGMPILWHIMSIYAHH
                     GLNDFIICAGYKGYLIKEYFVNLVLHHNDITVDLASNSINYHGGTRPNWRVTVVDTGM
                     YSMTGGRLGRIRDHLTPGEPFCMTYGDGVGDIDIAAEVAFHRSHGLKATMCAVTPPGR
                     YGATNIEGQFITSFVEKPRGDGQRINGGFFVLDPSVVDLIPSDDTIWEAGPLEWLAAN
                     NQLAAFKHDGFWQPMDTLRERNQLEELWSSGKAPWKLWA"
     CDS             complement(286621..287004)
                     /transl_table=11
                     /locus_tag="RL0247"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:RL0247"
                     /db_xref="EnsemblGenomes-Tr:CAK05737"
                     /db_xref="UniProtKB/TrEMBL:Q1MMR5"
                     /protein_id="CAK05737.1"
                     /translation="MVAGLKSLDVFSRRQPTKGGEFRDPEAGEFRDSEVGFFLRPTRR
                     AFARRQSAGYLTLFYQDRPRLVGSIAPAWRPLVKLEGRAFGQTGCLERQAVPLLNARP
                     AKRAAVGSHTPASLAQERNRIPGQG"
     CDS             complement(287084..287374)
                     /transl_table=11
                     /locus_tag="RL0248"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:RL0248"
                     /db_xref="EnsemblGenomes-Tr:CAK05738"
                     /db_xref="UniProtKB/TrEMBL:Q1MMR4"
                     /protein_id="CAK05738.1"
                     /translation="MIRYATSAASNPPPPKAREVSAAEPPVEMSRTKPVIEVASAGAA
                     LAAYPLLPSGESDELGSDTLPKTTKPPRRAATKRKPKVAEADDAPLQLSLEA"
     CDS             287869..288288
                     /transl_table=11
                     /locus_tag="RL0249"
                     /product="conserved hypothetical exported protein"
                     /db_xref="EnsemblGenomes-Gn:RL0249"
                     /db_xref="EnsemblGenomes-Tr:CAK05739"
                     /db_xref="GOA:Q1MMR3"
                     /db_xref="InterPro:IPR012413"
                     /db_xref="UniProtKB/TrEMBL:Q1MMR3"
                     /protein_id="CAK05739.1"
                     /translation="MLAPRTLLLAGLLAILTPAIAGADSLKLGKPGVGPLNTGSTLCD
                     FRGCFGFGPQQWHRPAYVQPNYRPRGAGPTYYRPGAAGPPQLTYDPPPAQRVQPKARD
                     MNRHAAWCSNEYRSYNPRTDRFLTYEGIYKTCRSPYR"
     CDS             complement(288300..288662)
                     /transl_table=11
                     /locus_tag="RL0250"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0250"
                     /db_xref="EnsemblGenomes-Tr:CAK05740"
                     /db_xref="InterPro:IPR011893"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q1MMR2"
                     /protein_id="CAK05740.1"
                     /translation="MLCEGDCAHAPQALNLSKRKDIAMTEKARVTILYCTQCNWLLRA
                     SWMAQELLHTFSDSLGEVALIPATGGNFEIRVNGDLIWERKRDGGFPGPRELKQRVRD
                     IVEPGRDLGHVDRASLES"
     CDS             288797..289573
                     /transl_table=11
                     /locus_tag="RL0251"
                     /product="putative glutamine amidotransferase"
                     /db_xref="EnsemblGenomes-Gn:RL0251"
                     /db_xref="EnsemblGenomes-Tr:CAK05741"
                     /db_xref="GOA:Q1MMR1"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q1MMR1"
                     /protein_id="CAK05741.1"
                     /translation="MVSSRDRPYQEEPMRVAVIENMRNTGLGALAAALDEAGAEIEWF
                     RVWRDGILPKDISGHDALVVLGGEQSALDDETHPYLPELVRLARRFGDAGKAVLGICL
                     GSQILARAYGADNHLGIAREFGWHGIGVTAEGRADPLLSPLGGEFTIFEWHADTFSLP
                     EGAVRLASSPVAENQAFRIGRAVYGTQFHFEANSAVVAQWKAEFPDTIARIAPGWLEN
                     HAELAARHAGAADAAGLAIARAWVSLIEQEEVEMLSQASA"
     CDS             289585..290133
                     /transl_table=11
                     /locus_tag="RL0252"
                     /product="putative acyl transferase"
                     /EC_number="2.3.1.-"
                     /db_xref="EnsemblGenomes-Gn:RL0252"
                     /db_xref="EnsemblGenomes-Tr:CAK05742"
                     /db_xref="GOA:Q1MMR0"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="InterPro:IPR024688"
                     /db_xref="UniProtKB/TrEMBL:Q1MMR0"
                     /protein_id="CAK05742.1"
                     /translation="MLASERDKMAAGEWYCCLDDELDLLRRQARLAVHAHNTLPADER
                     GAVAPALRALFAQAAPDIFIEAPFHCSYGINITLGERVYFNAGCTVLDSGRVTIGDRS
                     MFGPGVQIYCAEHHKEPALRSTGIEIARPVTIGSDVWIGGSAIILGGITIGDGAIVGA
                     GAVVTRDVPAGATVVGNPARIR"
     CDS             290133..290669
                     /transl_table=11
                     /gene="gfa"
                     /locus_tag="RL0253"
                     /product="putative glutathione-dependent
                     formaldehyde-activating enzyme"
                     /note="Similar to Paracoccus denitrificans. Gfa GFA_PARDE
                     (EMBL:PD34346) (Glutathione-dependent
                     formaldehyde-activating enzyme (EC 4.4.-.-).) fasta
                     scores:E()=0.093 ungapped id 28.800% length=193 id in 143
                     aa, and similar, but extended at the N-terminus, to
                     Rhizobium meliloti (Sinorhizobium meliloti). Hypothetical
                     protein SMc04177. Q92K68 (EMBL:SME591789) (153) fasta
                     scores: E()=6.6e-47 76.712% id in 146 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0253"
                     /db_xref="EnsemblGenomes-Tr:CAK05743"
                     /db_xref="GOA:Q1MMQ9"
                     /db_xref="InterPro:IPR006913"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="UniProtKB/TrEMBL:Q1MMQ9"
                     /protein_id="CAK05743.1"
                     /translation="MPANGRDDLAISTASKAPLDQKANREDIMSERTLPMEGGCRCGR
                     VRLKISAPPLLTMACHCTGCQKMTSSGYSLSAAIPSEGFEVTQGEPVIGGLHGVTKHY
                     FCPHCMSWMFTRPEGMDWCVNLRVTMLDDPSWFTPFIETWTSEKLSFAETGAVHSYEA
                     LPEMEAYEGLVKEYMGRG"
     CDS             complement(290983..292815)
                     /transl_table=11
                     /gene="lepA"
                     /locus_tag="RL0254"
                     /product="putative GTP-binding protein"
                     /db_xref="EnsemblGenomes-Gn:RL0254"
                     /db_xref="EnsemblGenomes-Tr:CAK05744"
                     /db_xref="GOA:Q1MMQ8"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006297"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR013842"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR031157"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMQ8"
                     /protein_id="CAK05744.1"
                     /translation="MARMSTNSTTPLSHIRNFSIVAHIDHGKSTLADRLIQTTGGLAE
                     REMSEQVLDNMDIERERGITIKAQTVRLHYQANNGEKYILNLIDTPGHVDFAYEVSRS
                     LSACEGSLLVVDASQGVEAQTLANVYQAIDNNHEIVTVLNKIDLPAAEPDRIKEQIEE
                     VIGIDASEAVLISAKTGLGIPDVLEAIVHKLPAPKSPGGDKAPLKALLVDSWYDAYLG
                     VMVLVRVIDGVLTKGQTVRMMGTDAKYQVERVGVLTPKMVNIDRLGPGEIGFITASIK
                     EVADTRVGDTITEDKRPTAQALPGFKPAQPVVFCGLFPVDAADFEDLRAAMGKLRLND
                     ASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLEREFDLDLIATAPSVVYKMFMTDG
                     TERELHNPADMPDVVKISEIHEPWIRATILTPDDYLGGILKLCQDRRGIQIELTYVGT
                     RAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYTLTDHREGNLVKMSILVNGEPVDAL
                     SMMVHRTAAEKRGRDMCEKLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKC
                     YGGDATRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIAALKMGDE"
     CDS             complement(292892..293593)
                     /transl_table=11
                     /locus_tag="RL0255"
                     /product="putative transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0255"
                     /db_xref="EnsemblGenomes-Tr:CAK05745"
                     /db_xref="GOA:Q1MMQ7"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR027574"
                     /db_xref="UniProtKB/TrEMBL:Q1MMQ7"
                     /protein_id="CAK05745.1"
                     /translation="MMDASTQSTDTTGSFTAAAWDRIAPIMAEIEALPLLQRLSDGTL
                     PPEVFRHYILQDALYLKHYARCLAIVAAKAPDNAQVLRFLGSAQKAITVEQGLHAGFL
                     TQFGITSANVTSAEPSPAGFAYTNFLLATAYHSSYAVALSSILPCFWIYWHVGEAIKN
                     RPVIEGNAFQAWINTYGDPQFAAGAREVIALTDMAARAASPVERAQMTDVFIRASQYE
                     WMFWDSAWRQETWPV"
     CDS             293730..294308
                     /transl_table=11
                     /locus_tag="RL0256"
                     /product="putative transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0256"
                     /db_xref="EnsemblGenomes-Tr:CAK05746"
                     /db_xref="GOA:Q1MMQ6"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:Q1MMQ6"
                     /protein_id="CAK05746.1"
                     /translation="MDWKMEPELEQAIGIRIRTLRQEKALTLDDLAAASGVSRAMISR
                     IERAEASPTASLLARICAALGLSLSAFFAEEGQASPLARRQEQQVWRDPETGYIRRSV
                     SPPGTPSDVDIVEVEFPPGARVSFPPHASAHGMTQHIWLFDGELEMTAGEAVYRLRPG
                     DCLFMPVGEGHVFHNPGNAPARYCVVLNRGGR"
     CDS             294333..294851
                     /transl_table=11
                     /locus_tag="RL0257"
                     /product="putative acetyltransferase"
                     /db_xref="EnsemblGenomes-Gn:RL0257"
                     /db_xref="EnsemblGenomes-Tr:CAK05747"
                     /db_xref="GOA:Q1MMQ5"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q1MMQ5"
                     /protein_id="CAK05747.1"
                     /translation="MPGIRILSAEEARAAVPALSEVLVDCVAGGASVGFMQPYGPDDA
                     EPYWRDVADAVATGANLLLVAELDGRIVGTVQVGAAQMPNQPHRGDLKKLLVHRSARG
                     KGLARLLMDAAEREAAGRGKTLLVLDTATGSDAEAIYPRLGWQRVGVIPDYALWPEGG
                     FCATTLFYKRLA"
     CDS             complement(294867..295478)
                     /transl_table=11
                     /locus_tag="RL0258"
                     /product="putative haloacid dehydrogenase hydrolase"
                     /db_xref="EnsemblGenomes-Gn:RL0258"
                     /db_xref="EnsemblGenomes-Tr:CAK05748"
                     /db_xref="GOA:Q1MMQ4"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q1MMQ4"
                     /protein_id="CAK05748.1"
                     /translation="MKVLMVDVDGVLIHGRPTDGLPHFTYLERDLGLRFDLLQQEFFQ
                     THWGDIIIGRAALEPRLAGVLAKIAPHLSAETLIDYWFENDSRLDRNLLEELAGLRQS
                     GITLLLATNQEHRRARYLMEQIGLSAHFDDIIYSAALGHSKPSPDFFRLATERAGVLP
                     GEIAFIDDMAVNIEAARQFGWNAAQWTAGATLGGALPVFARPT"
     CDS             295612..296637
                     /transl_table=11
                     /locus_tag="RL0259"
                     /product="putative acetylpolyamine aminohydrolase"
                     /db_xref="EnsemblGenomes-Gn:RL0259"
                     /db_xref="EnsemblGenomes-Tr:CAK05749"
                     /db_xref="GOA:Q1MMQ3"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q1MMQ3"
                     /protein_id="CAK05749.1"
                     /translation="MRVIYSEDHKLRDARTELHAGQLVTPFEAPFRAEWILAAVKQAG
                     FTDVVAPDAHGLETARKVHDPAYLDFLATVWDRWVAAGFTGEAIANSFAVRRTSQRVP
                     DNIVGAIGHYANAADTSITKGSYEAAIASMRCAITGADWLNAGNRFAFALCRPPGHHA
                     GIDLFGGYCFINNSGVAAQRLLDHGARKVAVLDVDFHHGNGTQDLFYHRGDVFTASLH
                     GDPMQAFPYFLGHADEEGEGEGTGANRNYPMPPGTPWDVWSSALADALTRIKAFGAEA
                     IVVALGVDTFERDPISFFSLTSDDFTRMGAMIASAGLPVLACMEGGYGVPEIGLNVAN
                     VLKGLEA"
     CDS             296647..297222
                     /transl_table=11
                     /locus_tag="RL0260"
                     /product="Putative transcriptional regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:RL0260"
                     /db_xref="EnsemblGenomes-Tr:CAK05750"
                     /db_xref="GOA:Q1MMQ2"
                     /db_xref="InterPro:IPR003783"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q1MMQ2"
                     /protein_id="CAK05750.1"
                     /translation="MTDETVPSDIPTSRMLSWARNSTVYRLERRMMTEKQLFDAIARK
                     AKEKFAGISAAQLKAVADFAVKFAYDNKVLDDHAYAEVSTRSAVRGGKSKRAIAQKLA
                     AKGVSSDKVEAALEEADDLYAAAIFARKRAFGPFRRVELDEKRKAKELSAFARNGFSF
                     DIGRKVFDMSFEDAEEIIVAGRSAAPQHQRS"
     CDS             297295..298206
                     /transl_table=11
                     /locus_tag="RL0261"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:RL0261"
                     /db_xref="EnsemblGenomes-Tr:CAK05751"
                     /db_xref="GOA:Q1MMQ1"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="UniProtKB/TrEMBL:Q1MMQ1"
                     /protein_id="CAK05751.1"
                     /translation="MDIKNIETGTDGAALIAQPGISPTSGGLAAGVAMCLMSMSSIQF
                     GAALSSSAIATYGVAGATWLRLAFAAIILAAVVRPSVLRYSGAQWQATLLLGTTTAAM
                     TLCFFAAIQRLPLGLAIAIDFLGPLSVAVFGYGLTWRLTWPLIAAAGILFLAHDGEGW
                     VGNSSGVLFALGSAVGWAVYILLTKKVGAAFKGLEGLSMSLIVAGLVATPFGLAETGG
                     AFTAQGLVEVLGLAILVPLLPYALEMVALRRMPSASFGILMSLEPALGALAGFLILAQ
                     PMTALQMLGTALVVAASAGATASAAKT"
     CDS             complement(298251..298718)
                     /transl_table=11
                     /locus_tag="RL0262"
                     /product="putative truncated haemoglobin"
                     /db_xref="EnsemblGenomes-Gn:RL0262"
                     /db_xref="EnsemblGenomes-Tr:CAK05752"
                     /db_xref="GOA:Q1MMQ0"
                     /db_xref="InterPro:IPR009050"
                     /db_xref="InterPro:IPR012292"
                     /db_xref="UniProtKB/TrEMBL:Q1MMQ0"
                     /protein_id="CAK05752.1"
                     /translation="MDNDIQGRPAHVAAIRERAEAEMREMGVDAAFIDRLVETFYGRV
                     LAHPDLGPVFDARLSGRWPEHMAKMKSFWSAVAFRSGAYGGKPVQAHTGVQNLTPDLF
                     PKWLSLFAATLDDIAPTPEAKAWFMATAERIAKSLILSLFYNPALDDPARKPA"
     CDS             298892..299875
                     /transl_table=11
                     /gene="mbfA"
                     /locus_tag="RL0263"
                     /product="member of rubrerythrin family of electron
                     transporters"
                     /db_xref="EnsemblGenomes-Gn:RL0263"
                     /db_xref="EnsemblGenomes-Tr:CAK05753"
                     /db_xref="GOA:Q1MMP9"
                     /db_xref="InterPro:IPR003251"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012347"
                     /db_xref="InterPro:IPR017040"
                     /db_xref="UniProtKB/TrEMBL:Q1MMP9"
                     /protein_id="CAK05753.1"
                     /translation="MLARFFRSSKRSFDSLSEQEILALGIASEEDDARIYLAYADRLR
                     REFPASAKVFEDMAEVEDTHRKSLIEIHRQRFGERIPLIRREHVEGFYERKPDWLRAN
                     LSLDAMRRETEAMEEQAYRFYVEAAKRTSDASTRQLLGDLALAEQGHEDIARMLGDKH
                     TPEDVKHDEDATVHRQFVLTYVQPGLAGLMDGSVSTLAPIFAAAFATQDTWQTFLVGL
                     SASVGAGISMGFTEAAHDDGKISGRGSPIKRGLACGIMTALGGLGHALPYLIPHFWTA
                     TITAAVVVFFELWAIAFIQNRYMETPFLRAAFQVVLGGGLVLGAGILIGNG"
     CDS             complement(300040..300639)
                     /transl_table=11
                     /locus_tag="RL0264"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0264"
                     /db_xref="EnsemblGenomes-Tr:CAK05754"
                     /db_xref="InterPro:IPR010319"
                     /db_xref="UniProtKB/TrEMBL:Q1MMP8"
                     /protein_id="CAK05754.1"
                     /translation="MRIKGIFVAMMAMFAMATAAIPAPSRNASMVTGNATSQPIGHYD
                     FCQIHRSECGADRNAGPVAMNPGKWSLVRSVNATANRTITPMTDKEIYGKDEVWAYPT
                     TAGDCEDFALLKRRMLIQRGFPAADLLMTVVRKPDGEGHAVLTLRTAEGDFVLDNLAA
                     DVKPWFGTPYSFVKRQSSYNAGRWVTIENGRDVLVGALR"
     CDS             complement(300805..301629)
                     /transl_table=11
                     /locus_tag="RL0265"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0265"
                     /db_xref="EnsemblGenomes-Tr:CAK05755"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q1MMP7"
                     /protein_id="CAK05755.1"
                     /translation="MSDQLSNAQPQFLTVGEGEAAREIATLVRPAQTGNGAPALVWLS
                     GYRSDMSGTKAVELDGLAAELGLACIRLDYSGHGLSGGSFRDGTISRWLEEALAVIRH
                     VAPDRVILVGSSMGGWIALRLAQELARQGGPKLAGMVLIAPAPDFTSELIEPNLKAKE
                     RKSLAERGYFEERSQYSPEPNIYTRALIEDGRKNRVLDGIIETGCPVHILQGMKDADV
                     PHAHAMKLVEHLPADDVVLTFVRDGDHRLSRPGDIALLLSAVKGIIRSSTNRQMPT"
     CDS             301757..302344
                     /transl_table=11
                     /gene="infC"
                     /locus_tag="RL0266"
                     /product="putative translation initiation factor"
                     /db_xref="EnsemblGenomes-Gn:RL0266"
                     /db_xref="EnsemblGenomes-Tr:CAK05756"
                     /db_xref="GOA:Q1MMP6"
                     /db_xref="InterPro:IPR001288"
                     /db_xref="InterPro:IPR019814"
                     /db_xref="InterPro:IPR019815"
                     /db_xref="UniProtKB/TrEMBL:Q1MMP6"
                     /protein_id="CAK05756.1"
                     /translation="MGARCCNVPKQREENTTIRRPFKTDAPVKDGPRSNREIRIPKVQ
                     LIGADGENMGVVPTDQALRMAEEAGLDLVEISPNVEPPVCKILDLGKLKYANQKKAAE
                     ARKKQKIVEVKEIKMRPNIDTHDYEVKMKAMGRFFDEGDKVKVTLKFRGREMAHQELG
                     MKLLQQVKADTIEFAKVEAEPKLEGRQMMMVLAPK"
     CDS             302656..302859
                     /transl_table=11
                     /gene="rpmI"
                     /locus_tag="RL0267"
                     /product="putative 50S ribosomal protein L35"
                     /db_xref="EnsemblGenomes-Gn:RL0267"
                     /db_xref="EnsemblGenomes-Tr:CAK05757"
                     /db_xref="GOA:Q1MMP5"
                     /db_xref="InterPro:IPR001706"
                     /db_xref="InterPro:IPR018265"
                     /db_xref="InterPro:IPR021137"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMP5"
                     /protein_id="CAK05757.1"
                     /translation="MPKMKTKSSAKKRFKITATGKVKAAAAGKRHGMIKRSNKFIRDA
                     RGTMVLAEPDGRKVIKNYLPNGL"
     CDS             302898..303302
                     /transl_table=11
                     /gene="rplT"
                     /locus_tag="RL0268"
                     /product="putative 50S ribosomal protein L20"
                     /db_xref="EnsemblGenomes-Gn:RL0268"
                     /db_xref="EnsemblGenomes-Tr:CAK05758"
                     /db_xref="GOA:Q1MMP4"
                     /db_xref="InterPro:IPR005813"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMP4"
                     /protein_id="CAK05758.1"
                     /translation="MARVKRGVTSHAKHKKVLKAAKGFYGRRKNTIRTAKAAVDRSKQ
                     YAYRDRKVNKRNFRALWIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHE
                     PEAFGALVSAAKKALEYLKEAGTANEFEGAVK"
     CDS             303453..304535
                     /transl_table=11
                     /gene="pheS"
                     /locus_tag="RL0269"
                     /product="putative phenylalanyl-tRNA synthetase alpha
                     chain"
                     /EC_number="6.1.1.20"
                     /db_xref="EnsemblGenomes-Gn:RL0269"
                     /db_xref="EnsemblGenomes-Tr:CAK05759"
                     /db_xref="GOA:Q1MMP3"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004188"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="InterPro:IPR022911"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMP3"
                     /protein_id="CAK05759.1"
                     /translation="MSDIDQLNTSLLAEIAAADDETALEAVRVSALGKKGSVSELLKT
                     LGAMTPEERQSKGAAINVLKNAVTEALTARKTTLRQAAIDARLQAETVDVSLPVRSSP
                     AERGRIHPISQIVDEITAIFADMGFSIAEGPDIETDYYNFTALNFPEGHPAREMHDTF
                     FFNPDENGERKVLRTHTSPVQVRTMEAQTPPIRIIIPGKTYRQDSDATHSPMFHQVEG
                     LVVDKKANVANLRWVLEEFCKTFFEVDSVTMRFRPSFFPFTEPSFEVDIQCDRSGPIV
                     KFGEGTDWMEILGCGMVHPNVLRYGGLDPDEYQGFAWGMGLDRIAMLKYGMPDLRDFF
                     NADVRWMTHYGFRPLDMPTLFGGLSA"
     CDS             304552..306975
                     /transl_table=11
                     /gene="pheT"
                     /locus_tag="RL0270"
                     /product="putative phenylalanyl-tRNA synthetase beta
                     chain"
                     /EC_number="6.1.1.20"
                     /db_xref="EnsemblGenomes-Gn:RL0270"
                     /db_xref="EnsemblGenomes-Tr:CAK05760"
                     /db_xref="GOA:Q1MMP2"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR004532"
                     /db_xref="InterPro:IPR005121"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR020825"
                     /db_xref="InterPro:IPR033714"
                     /db_xref="UniProtKB/TrEMBL:Q1MMP2"
                     /protein_id="CAK05760.1"
                     /translation="MKFTLSWLKEHLETDAGLDEICTRLTEIGLEVEDVDDKAAFKPF
                     VIARVVSAEKHPQADRLKVLMVDTGSGAPVQVVCGAPNARAGLVGAFAAPGTYVPGID
                     VTLAVGNIRGVESHGMMCSEKELQISDSHDGIIDLPEDAPVGQSYAAYAHLDDPLIEI
                     NLTPNRPDCTSIHGIARDLAASGLGTLKMRPAPSFAVEGETPVKLTLDLDDPKLCPGF
                     ALRLVRGVRNGPSPRWMQQRLIAIGLRPINALVDVTNYMTFDQGRPIHVFDAAKINGN
                     LAVRRAAEGETVLALDQREYKLSPNNVVISDENGIESIGGIMGGEHSGCDENTVDVLI
                     ESALWDPMNIAKSGRSLGIITDARYRFERGVDPEYMVPGLERTTELVLELCGGKAAKA
                     EIVGYQGYEPKIVDFPYSEVKRLTGLDVSNEESNTILTRLGFTVSGSGERVSVAVPSW
                     RPDVDGKADLVEEVMRIHGVDNIKPAPLESHAAVNGKILTTLQIRTRLAKRALAARGM
                     LEAVTWSFIPEDQAKLFGGGSPALKLANPIAAEMSDMRPSLLPGLLSAAQRNADKGYG
                     DVALFEVSGTYENDRPEGQRRVAGGIRRGTASLAGAGRAWSNAAKGGGKPVDVFDAKA
                     DALAVIEACGLPMGNIQIEQGGPAWYHPGRSGTIKMGPKVVLGYFGEFHPLTLESLDV
                     SGALCGFEVYVDAMPEAKRKATRTKPALELSPFQLVRRDFAFVVDKTVEAGAIVKAAT
                     GADRKLVTAVNVFDIFEGASVGDGKKSVAIEVQIQPVERTLTDEDFEALTQKIVASVA
                     KFTGGVLRS"
     CDS             complement(307030..307389)
                     /transl_table=11
                     /locus_tag="RL0271"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0271"
                     /db_xref="EnsemblGenomes-Tr:CAK05761"
                     /db_xref="InterPro:IPR032710"
                     /db_xref="UniProtKB/TrEMBL:Q1MMP1"
                     /protein_id="CAK05761.1"
                     /translation="MSDRQAVEQTVHLYVEGMAFANEAALKKAFHPKSSIIGHYENAV
                     EWLTRDEFIAAILQEEPAPPGTQPYMDIQSVDVEGDAASVKVTDDFAGMRFTDYLSLL
                     KIDGRWTIVSKLFHLHR"
     CDS             complement(307497..308492)
                     /transl_table=11
                     /locus_tag="RL0272"
                     /product="putative aldo-keto reductase/oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:RL0272"
                     /db_xref="EnsemblGenomes-Tr:CAK05762"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q1MMP0"
                     /protein_id="CAK05762.1"
                     /translation="MKTRKLGNDLTVSAVGLGCMGMSFAYGASDDAESIKTLHRAIDL
                     GVTFFDTAEVYGPFTNEVLLGKALKPFRDRVVIATKFGFKIDASKPGIAAITGVDSRP
                     EHVRTVAEASLKRLGIETIDLFYQHRVDPDVPIEETVGVMAELVKEGKVRALGLSEAG
                     SATIRRAHAVHPIAALQSEYSLWTRDPEEEVLATCRELGIGFVPYSPLGRGFLTGAIR
                     KAEDLDADDFRRQVPRFQAENFDANAALVATLERLAAEKGVTAAQLALAWVLNQGDDI
                     VPIPGARKLHHLEQNAAAADIVLSPAELARLEEIIPAGQVAGKRYSDASLAMTNI"
     CDS             308617..309525
                     /transl_table=11
                     /locus_tag="RL0273"
                     /product="putative LysR family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0273"
                     /db_xref="EnsemblGenomes-Tr:CAK05763"
                     /db_xref="GOA:Q1MMN9"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q1MMN9"
                     /protein_id="CAK05763.1"
                     /translation="MNRTQLSQLAVLAAVSEHRSFRAAAKELLVAPSAISHAISSLEE
                     SLGVRLLARTTRSVAPTEEGRLLLERLRPALEEIDIALEAVRDTRAKPAGNLRITAPR
                     FASDLLLAPRLGDFLNLYPDITLEIANEDGFTDIVKEGFDAGIRLEESLEADMIAVRV
                     SPDLTTVIAASPEYFEHHPKPEHPRDLVHHRCIKRRFTNGSIYRWEFEKDGQELVVSV
                     DGPLIVSEDRLALLAALNGAGLAYLFDMRVYDELAGGTLVRVLEDWCAPYSGPFLYYP
                     TRRQMRPALRAFIDFFRYSEQDTGGR"
     CDS             complement(309571..310068)
                     /transl_table=11
                     /locus_tag="RL0274"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0274"
                     /db_xref="EnsemblGenomes-Tr:CAK05764"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR010287"
                     /db_xref="InterPro:IPR012347"
                     /db_xref="UniProtKB/TrEMBL:Q1MMN8"
                     /protein_id="CAK05764.1"
                     /translation="MAKEKTLEDLFYDTLKDIYFAERQILRALPKMARAAQSPELKKG
                     FEKHREETEGQVERLQQVFELIGKRAQGKTCEAIQGIIAEGEEIMEEFKGTVALDAGL
                     ISAAQAVEHYEIARYGTLKTWAATLGLKEVVGLLDQTLQQETATDKTLSQLATTAANQ
                     KAKAA"
     CDS             310215..310832
                     /transl_table=11
                     /locus_tag="RL0275"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0275"
                     /db_xref="EnsemblGenomes-Tr:CAK05765"
                     /db_xref="InterPro:IPR009045"
                     /db_xref="UniProtKB/TrEMBL:Q1MMN7"
                     /protein_id="CAK05765.1"
                     /translation="MRKPGSMKGLEDLGRVRLSQNFFLRDFLHSEIADFYRIPNIPED
                     PDLAIETGKRLCEELLEPLEATFGRLHIRSGYRSPAVNRFGNENKLNCSTNASTAAHH
                     IWDMRDFDGCMGAAVCIAVPWMVDHYRVESDWQRLAWWIHDHLPYASLCFFPKLWAFN
                     IQWHERPKRVIQSYVSPRGILTKPGMANWESDHSEWYTGFPLLKS"
     CDS             complement(310822..311265)
                     /transl_table=11
                     /locus_tag="RL0276"
                     /product="putative acetyltransferase"
                     /db_xref="EnsemblGenomes-Gn:RL0276"
                     /db_xref="EnsemblGenomes-Tr:CAK05766"
                     /db_xref="GOA:Q1MMN6"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR032962"
                     /db_xref="UniProtKB/TrEMBL:Q1MMN6"
                     /protein_id="CAK05766.1"
                     /translation="MTVTIREARPEDEARWRELWAAYLVFYDVTVDADITDSTWRRVF
                     DPASAIAMRVAEVDGRMMGFALYLTHEGTWIRGRDCYLEDLFVDADARGQGVGRALMD
                     DLVSTCKAKGWSRLYWHTSEQNRTARALYDSYVESDGHIRYRISF"
     CDS             complement(311280..312290)
                     /transl_table=11
                     /locus_tag="RL0277"
                     /product="putative oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:RL0277"
                     /db_xref="EnsemblGenomes-Tr:CAK05767"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q1MMN5"
                     /protein_id="CAK05767.1"
                     /translation="MVRAAFCRIRDFNSFTLLESVMEMRRLGKTGLSVAPIVIGGNVF
                     GWTADEKTSFAILDAFFDAGLNTIDTADVYSSWVPGNKGGDSEEIIGRWLSQAKVSRD
                     KALIVTKVGSDMGQGKTLKETYILKAVEDSLRRLQTDYIDVYLSHWPDEDTPHEETLG
                     AYAKLKQQGKIRAIGCSNYDAKLLQASFDAAEKAGLPRYDVLQPEYNLYERSSFEGPL
                     ADLCVKEDIGVITYFSLAAGFLTGKYRSKSDTQGRAREGRVSKYLDDKGLRILAALDK
                     VSAETGAKPAEISLAWLLRKKGVTAPIASATSLSQLESLAKSATLALSDDAMALLDQA
                     GA"
     CDS             312406..313392
                     /transl_table=11
                     /locus_tag="RL0278"
                     /product="putative oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:RL0278"
                     /db_xref="EnsemblGenomes-Tr:CAK05768"
                     /db_xref="GOA:Q1MMN4"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MMN4"
                     /protein_id="CAK05768.1"
                     /translation="MLRFGIISTAKIGRDNVVPAIQDAENCVVTAIASRDLARAREMA
                     DRFSVPHAFGSYEEMLASDLIDAVYIPLPTSQHIEWSIKAADAGKHVLCEKPLALKAD
                     DIDDVIAARDRNRVVVTEAYMITYSPVWQKVRSLIDEGAIGSLRHVQGAFTYFNRDPA
                     NMRNVPELGGGGLPDIGVYPVMGTRFSTGKEPLWIQAITERDADFGTDIYSSVKADFG
                     DFELSFYISTQMANRQVMVFHGTEGYIEVKSPFNANRWGPEEIELADRSHSESRIFRF
                     QDSRQYKRQVEAFARAVKNGKEEIVTLENSKLNQKVIDAIYRASEKDGWEAV"
     CDS             complement(313495..313872)
                     /transl_table=11
                     /locus_tag="RL0279"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:RL0279"
                     /db_xref="EnsemblGenomes-Tr:CAK05769"
                     /db_xref="GOA:Q1MMN3"
                     /db_xref="InterPro:IPR007267"
                     /db_xref="UniProtKB/TrEMBL:Q1MMN3"
                     /protein_id="CAK05769.1"
                     /translation="MRKLIHFAIAGGIGFLVDAGILSALLALTPLGPFLARLVAIAFA
                     MAATWAFNRSFTFDRSGRSLAAEGFRYGSVGVTAALVNYGLYSALLLSLPALQPLAAM
                     VIASIASMIFSFFGYSRFVFRAE"
     CDS             complement(313869..314876)
                     /transl_table=11
                     /locus_tag="RL0280"
                     /product="putative glycosyltransferase"
                     /note="N-terminus to codon 240 is similar to
                     Actinobacillus actinomycetemcomitans. DNA for
                     glycosyltransferase, lytic transglycosylase,
                     dTDP-4-rhamnose reductase, complete cds. O05377
                     (EMBL:AAAB2668) (234) fasta scores: E()=0.00011 25.688% id
                     in 218 aa, and enitre protein is similar to Anabaena sp.
                     (strain PCC 7120). All0042 protein. Q8Z0P8 (EMBL:AP003581)
                     (315) fasta scores: E()=1.6e-55 54.054% id in 296 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0280"
                     /db_xref="EnsemblGenomes-Tr:CAK05770"
                     /db_xref="GOA:Q1MMN2"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q1MMN2"
                     /protein_id="CAK05770.1"
                     /translation="MARSRTDNLNIAVLLPCYNEAATISAVVQGFRATLPDAAIHVYD
                     NNSTDGTALQAMLAGAHVVRERRQGKGHVVRRMFADIDADIYIIADGDGTYAPGDAEE
                     LVRTLLTERADMVVGTRRGVHSDAGRQGHALGNRLFNLLYRMIFGPDFTDIFSGYRAF
                     SRRFVKSFPAVSGGFEIETEMSVHASRLKLPVSELELDYGRRPEGSHSKLSTFRDGAK
                     ILWMFAMLMKETRPFAFFSAISATFMLASLGFMAPVLAEYFETGLVSRMPTWVLSTAL
                     LMISFMLFTAGVILDSVARARAEQLRIHYMGLERPSALKAPLSDAGPVSRARPGKADA
                     A"
     CDS             315036..316904
                     /transl_table=11
                     /locus_tag="RL0281"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:RL0281"
                     /db_xref="EnsemblGenomes-Tr:CAK05771"
                     /db_xref="GOA:Q1MMN1"
                     /db_xref="UniProtKB/TrEMBL:Q1MMN1"
                     /protein_id="CAK05771.1"
                     /translation="MNAVQPIPHASSAIDAPRGGLPAPRDGLRDLLTRLWPTVIAYSV
                     ILAAAILITKLSGATDYVGPDNDDGMRLVEVRDFLAGQGWFDLMQYRLGLDGGTLMHW
                     SRLIDLPIASLIWFFGLFAPRETAEALALAVWPVSLILPAMLAMAVAGRRIGGVAAMH
                     ISLGLTSLAIYTGNRFAPGAIDHHNVQLALVATMIAMLLDPERRAWSYAVAGIAAAVA
                     IAIGAETTPFVAAVCLTIALLWAWEGENFAAAAKAFGLALAIAISILFFATVPPRLYS
                     TVTCDNLSLGYYSLAAIGGGLLLFSAVFASRLRRPLRFAALAVVGAGVLGSAIVIAPQ
                     CLSDPLAGLDPMLVELWLRNVSEAQSIFALGRTDLFSIGGFYAAGLFGIAVCIFRVVQ
                     RDRVQIHLVLLFLLMTSWAIALVQVRGSTFSNLISILPLALLIIDVRRISNGDSENVA
                     AAFVYIVTVLASAPAAWAVGGGFVSLQMQNAAQKKAAEPAKKISCTSQAALAPLAGLP
                     AGLVSAPSEMGVPILRFTANRVLSAPYHRNQGGMLTELHIGMAEPQEAEAFLKGTGVT
                     VLAFCPSDLQTREITKLKPDGLYAELGKSNIPPYLEPLPKAADVGVQFFRYRPATN"
     CDS             317593..319173
                     /transl_table=11
                     /gene="xseA"
                     /locus_tag="RL0282"
                     /product="putative exodeoxyribonuclease VII large subunit"
                     /EC_number="3.1.11.6"
                     /db_xref="EnsemblGenomes-Gn:RL0282"
                     /db_xref="EnsemblGenomes-Tr:CAK05772"
                     /db_xref="GOA:Q1MMN0"
                     /db_xref="InterPro:IPR003753"
                     /db_xref="InterPro:IPR020579"
                     /db_xref="InterPro:IPR025824"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMN0"
                     /protein_id="CAK05772.1"
                     /translation="MSNVFDGDSPTNLAEYSVSELSGSIKRTVETAFDQVRVRGEISG
                     YRGPHSSGHAYFALKDDRARIDAVIWKGTFSRLKFRPEEGMEVIATGKVTTFPGSSKY
                     QIVIETLEPAGAGALMALIEERKRKLGAEGLFDAARKKRLPFMPGVIGVVTSPTGAVI
                     RDILHRISDRFPVHVLVWPVKVQGEGSGEEVANAIRGFNALEPSGTIPRPDVLIVARG
                     GGSLEDLWSFNDEIVVRAAAESAIPLISAVGHETDWTLIDYAADVRAPTPTGAAEMAV
                     PVKAELEAQAAGLAARLQGCMNRQMDQRRQSVRALMRALPSLDQLLALPRRRFDEAAT
                     GLGRGLELNTINKRRGFERVAAHLRPDLLAGRIAERRQTLNERMARAERMVERLIDRS
                     KSRVDRAEAILASLPARLKTQTDRGRERLGNLSRHADTAVRHQLTRARSELSAQDRVL
                     QSLSYKNVLKRGYAVIRDEDNRPVSQAAHLSAGMGIAIEFADGRVGAMTTEGGTPPAG
                     AKKRSTKPAEPPKQGSLF"
     CDS             319176..319769
                     /transl_table=11
                     /locus_tag="RL0283"
                     /product="putative NAD(P)H oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:RL0283"
                     /db_xref="EnsemblGenomes-Tr:CAK05773"
                     /db_xref="InterPro:IPR003680"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:Q1MMM9"
                     /protein_id="CAK05773.1"
                     /translation="MRILLVLAHPLEDSFAAAVARTAREALEASGHVVDLFDLYAENF
                     DPRLSKAERGGYFDQPYDTSAVADIVARLKAADGLILVFPQWWFNFPAILKGFFDRVF
                     APGVAFSHDAAGGRIVPQLTHIRLLYALTTTGSPWWLVRLYMGDPVRRLLKRGIAAFC
                     SKGLNFRMLSLHDMDRASDVKRRAHLDRVRKLLSAIR"
     CDS             complement(319773..320273)
                     /transl_table=11
                     /locus_tag="RL0284"
                     /product="putative MarR family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0284"
                     /db_xref="EnsemblGenomes-Tr:CAK05774"
                     /db_xref="GOA:Q1MMM8"
                     /db_xref="InterPro:IPR000835"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR023187"
                     /db_xref="UniProtKB/TrEMBL:Q1MMM8"
                     /protein_id="CAK05774.1"
                     /translation="MSEDGKMDHVDKILAQWRRERPDLDVEPMGILGRLKRLSTHLGR
                     EVEAVLMKQGLSSSAFDVLATLRRAGAPHRLSPGELLEMTMVSSGTMTNRIDQLEKAG
                     YVERILNPEDRRSVLIALTEKGLATVETAVDAHVVNQHRLSKNLSAADKAELDRLLRK
                     FLADFE"
     CDS             320355..321266
                     /transl_table=11
                     /locus_tag="RL0285"
                     /product="putative transmembrane transporter protein"
                     /db_xref="EnsemblGenomes-Gn:RL0285"
                     /db_xref="EnsemblGenomes-Tr:CAK05775"
                     /db_xref="GOA:Q1MMM7"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="UniProtKB/TrEMBL:Q1MMM7"
                     /protein_id="CAK05775.1"
                     /translation="MKTNSRYVADLAATALAPAIWGSTYIVTTTFLPAGYPLTVAMLR
                     ALPAGLLLLFLVRKLPFGIWWGRAFVLGALNFSFFWAMLFVSAYRLPGGVAATVGAVQ
                     PLIVIALSQLFLGKPVRPLAVLAGLAGMAGVGLLVLTPKAGLDPIGVAAGLAGAVSMA
                     FGTVLTRRWAPPVSNLTFTAWQLTAGGMLLVPFAFFLEPALPMPTAANIAGIAYLGLI
                     GAAFTYLLWFRGLSRIEPSAVASLGFLSPLVATLLGWLALGQSLTPVQIGGLAMVLAS
                     VWLSQRTMMPLRPIRPAASPEPVNHPA"
     CDS             complement(321214..322467)
                     /transl_table=11
                     /locus_tag="RL0286"
                     /product="putative aminopeptidase"
                     /db_xref="EnsemblGenomes-Gn:RL0286"
                     /db_xref="EnsemblGenomes-Tr:CAK05776"
                     /db_xref="GOA:Q1MMM6"
                     /db_xref="InterPro:IPR000787"
                     /db_xref="UniProtKB/TrEMBL:Q1MMM6"
                     /protein_id="CAK05776.1"
                     /translation="MTFMPQSQNTVDPVKLEKLAEVAVKVGLQLQKGQDLVITAPVVA
                     LPLVRLITKHAYKAGAGLVSAFYSDEETTLARYQYGSDESFDRASGWLYEGMAKAYAN
                     GAARLAVAGDNPMLLSEQDAGKVGRANRANSTAYKPALEKISNFDINWNIVSYPNPSW
                     AKVVFPDDPEPIAIAKLAKAIFAASRVDVSDPVAAWAEHNANLGKRSAWLNGERFASL
                     HFRGPGTDLTIGLADGHEWHGGASTAKNGITCNPNIPTEEVFTTPHALRVEGHVSSTK
                     PLSHQGTLIDNIQVRFEGGRIVEAKASRGEEVLNKVLDTDEGARRLGEVALVPHSSPI
                     SASGILFYNTLFDENASCHIALGQCYSKCFLDGATLSQEQIKAQGGNSSLIHIDWMIG
                     SDKVDIDGLKPDGSRVPVMRQGEWA"
     CDS             complement(322594..323340)
                     /transl_table=11
                     /locus_tag="RL0287"
                     /product="putative glutathione S transferase"
                     /db_xref="EnsemblGenomes-Gn:RL0287"
                     /db_xref="EnsemblGenomes-Tr:CAK05777"
                     /db_xref="GOA:Q1MMM5"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q1MMM5"
                     /protein_id="CAK05777.1"
                     /translation="MNFAASTIRCIYIYHRRVETAMSKLTLVSHHLCPYVQRATIALL
                     EKGVPFGRINIDLADKPDWFLQISPLGKVPLLRIEEEDGSQAVLFESSVICEYLEETQ
                     PGVALHPRDALTRARHRGWMEFGSSLLSDLWGYETAEDAAQLEAKRTALISKFATVEK
                     VLTDGPYFAGNDFSLVDAVFAPVFRYFDLFETLGDSDIFEGLERVKRWRKTLSERSSV
                     KAAVGEDYPQRLMEFLEKHNSILLRLPAAA"
     CDS             323360..323803
                     /transl_table=11
                     /locus_tag="RL0288"
                     /product="putative MarR family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0288"
                     /db_xref="EnsemblGenomes-Tr:CAK05778"
                     /db_xref="GOA:Q1MMM4"
                     /db_xref="InterPro:IPR000835"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR023187"
                     /db_xref="UniProtKB/TrEMBL:Q1MMM4"
                     /protein_id="CAK05778.1"
                     /translation="MSEKPSNPSEAVTSAWTSIMRARERLLGAIEADLKAAGMPPLAW
                     YDVLWELARSQDGKLRPYEIEERTLLAQYNLSRLLDRLEREGLVRREVFAEDGRGRWV
                     VLSDAGRKLRERMWIVYAKSIDTHIGCKLAENEAKAIAGLLDRFL"
     CDS             complement(323880..324353)
                     /transl_table=11
                     /locus_tag="RL0289"
                     /product="conserved hypothetical exported protein"
                     /db_xref="EnsemblGenomes-Gn:RL0289"
                     /db_xref="EnsemblGenomes-Tr:CAK05779"
                     /db_xref="GOA:Q1MMM3"
                     /db_xref="InterPro:IPR004369"
                     /db_xref="InterPro:IPR007214"
                     /db_xref="UniProtKB/TrEMBL:Q1MMM3"
                     /protein_id="CAK05779.1"
                     /translation="MSKTTRATQLLSQAGVAFTVHAYDYDPNAERVGLQAAEALGEAP
                     HRVLKTLMAEVDGKPVCVVVPSDREVSMKKLASAFHGKSAHMMKPADAERLTGYHVGG
                     ISPFGQKKTVPTAIEEAALAEPLVYINGGQRGLQVRLDPKAALKALKAVAAPLIA"
     CDS             complement(324386..324736)
                     /transl_table=11
                     /locus_tag="RL0290"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0290"
                     /db_xref="EnsemblGenomes-Tr:CAK05780"
                     /db_xref="InterPro:IPR006504"
                     /db_xref="InterPro:IPR006660"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q1MMM2"
                     /protein_id="CAK05780.1"
                     /translation="MAVTIYGIKNCDTMKKARNWLEEHSVAYEFHDYKALGIDRTHLE
                     AWIDEAGLDTVLNRAGTTFRKLPDAERENLTREKAIQLMLDQPSMIKRPVLEAEGKLL
                     VGFKPEIYAGTFGS"
     CDS             complement(324858..325919)
                     /transl_table=11
                     /locus_tag="RL0291"
                     /product="putative arginine catabolism protein"
                     /db_xref="EnsemblGenomes-Gn:RL0291"
                     /db_xref="EnsemblGenomes-Tr:CAK05781"
                     /db_xref="GOA:Q1MMM1"
                     /db_xref="InterPro:IPR007036"
                     /db_xref="UniProtKB/TrEMBL:Q1MMM1"
                     /protein_id="CAK05781.1"
                     /translation="MDVSEIIIPGDTPGTEWRLPVLRFKGHDPKAPKIYIQAALHAGE
                     LPGTVLLHFLCERLRQAEDQGGIAGDITIVPQANPIGAAQSHFGELQGRFDLGSRTNF
                     NRDFPLISIVDRATLTEDLDDYPATDRLKRQLLHMALGADLVLDLHCDDESLQYAYID
                     EAFWPEAADLAAALEMEAVLLSDGESSAFEEAVGFAWKYEVPGERRPRLPGKLSVTVE
                     LRGKRDVDPVLAKKDADGLWHFLSARGIVGDGKPAATVFSGPAVPLDNVEIIRTPEGG
                     AVLFHRDIGERVAEGDLLATIVTRPGQPGGSIELTAPQDGLILTRTSDRLVRRRGDLM
                     KIVCDEPSKASRKAGTLEN"
     CDS             complement(326021..326629)
                     /transl_table=11
                     /locus_tag="RL0292"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0292"
                     /db_xref="EnsemblGenomes-Tr:CAK05782"
                     /db_xref="InterPro:IPR009097"
                     /db_xref="UniProtKB/TrEMBL:Q1MMM0"
                     /protein_id="CAK05782.1"
                     /translation="MNQISFDFEDRRSRRRRPGENHSGGHRLFFALCPPAAVERQAAS
                     IADDYGKAFSLSAKPRLTTLHVTIIGIDDYEELPEDAVFAARQAGATVESAPIAITFD
                     RIMSFRREGKARPLVLYGEGGLRLLTRLHVQLGVGMHNAGLRHNISRDFTPHMTLLYD
                     RKTVPTASLDTPVSWTASEFLLIHSVLGKTEHRIIDRWPLLG"
     CDS             326890..327453
                     /transl_table=11
                     /locus_tag="RL0293"
                     /product="putative methylated-DNA--protein-cysteine
                     methyltransferase"
                     /EC_number="2.1.1.63"
                     /note="Codons 50 to the C-terminus are similar to codons
                     35 to the C-terminus of Mycobacterium bovis. Ogt
                     UniProt:OGT_MYCTU (EMBL:HS768224) (165 aa) fasta scores:
                     E()=8.5e-11, 41.129% id in 124 aa, and entire protein is
                     similar to Rhizobium meliloti (Sinorhizobium meliloti).
                     putative methylated-DNA--protein-cysteine
                     methyltransferase (ec 2.1.1.63). UniProt:Q92TT2
                     (EMBL:RME591985) (183 aa) fasta scores: E()=2.1e-53,
                     79.670% id in 182 aa, and to Mycobacterium bovis. ogt
                     UniProt:OGT_MYCTU (EMBL:HS768224) (165 aa) fasta scores:
                     E()=8.5e-11, 41.129% id in 124 aa, and to Rhizobium
                     meliloti (Sinorhizobium meliloti). putative
                     methylated-DNA--protein-cysteine methyltransferase (ec
                     2.1.1.63). UniProt:Q92TT2 (EMBL:RME591985) (183 aa) fasta
                     scores: E()=2.1e-53, 79.670% id in 182 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0293"
                     /db_xref="EnsemblGenomes-Tr:CAK05783"
                     /db_xref="GOA:Q1MML9"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR008332"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014048"
                     /db_xref="UniProtKB/TrEMBL:Q1MML9"
                     /protein_id="CAK05783.1"
                     /translation="MAETTHHYLIFETAGGFCGIAWSDAGITRFQLPTKSAEATERLL
                     LRRLPDAEAGAPTPAVLETVAAVKRYFQGEETDFSGVDLDLAGQDAFFRDIYAAARRV
                     GWGRTTTYGALAKELGVGPEAARDVGQAMAKNPVALIIPCHRVLAAGGKIGGFSAPGG
                     SSSKARMLELEGVNLGPPPPAQQSLGF"
     CDS             complement(327565..328299)
                     /transl_table=11
                     /locus_tag="RL0294"
                     /product="putative short-chain
                     dehydrogenase/oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:RL0294"
                     /db_xref="EnsemblGenomes-Tr:CAK05784"
                     /db_xref="GOA:Q1MML8"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q1MML8"
                     /protein_id="CAK05784.1"
                     /translation="MSDIKGKVIAITGASSGIGEAAAKVLAAAGAHIVIGARRTERLE
                     ELAGEIAATGGTVRLRQLDVTDRSQVEAFAGFARSEFGRLDVIVNNAGVMPLSPLEAL
                     KVDEWDRMVDVNIKGVLYGIAAALPIMKAQGSGQIINLSSIGGHSVSPTAAVYCATKF
                     AVRAISDGLRQETDRIRVTVISPGTTTSELADTITDPTARDAMKAFRAITISPEAVAN
                     SILYAVSQPDDVDVSEIIIRPTASPH"
     CDS             complement(328444..328818)
                     /transl_table=11
                     /locus_tag="RL0295"
                     /product="conserved hypothetical exported protein"
                     /note="Codons 50 to the C-terminus are similar to
                     Rhizobium meliloti (Sinorhizobium meliloti). hypothetical
                     protein. UniProt:Q930M5 (EMBL:B95283) (83 aa) fasta
                     scores: E()=1.2e-24, 85.526% id in 76 aa, and entire
                     protein is similar to Agrobacterium tumefaciens (strain
                     C58/ATCC 33970). hypothetical protein atu0859
                     (agr_c_1570p). UniProt:Q8UH26 (EMBL:A97464) (116 aa) fasta
                     scores: E()=5.8e-24, 59.459% id in 111 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0295"
                     /db_xref="EnsemblGenomes-Tr:CAK05785"
                     /db_xref="InterPro:IPR020955"
                     /db_xref="UniProtKB/TrEMBL:Q1MML7"
                     /protein_id="CAK05785.1"
                     /translation="MRRIFKSPVLRFFTAVTLAGAATSSFGADTVNDRETQQQQTSEN
                     RMQQHPYVGMWVTDDGRVRHELLPNGRYDEARGSRESAYRGRYEVTGSHIEYWDDTGF
                     TADGDFVDGNTLHHGGMVLRRK"
     CDS             328924..329817
                     /transl_table=11
                     /locus_tag="RL0296"
                     /product="putative LysR family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0296"
                     /db_xref="EnsemblGenomes-Tr:CAK05786"
                     /db_xref="GOA:Q1MML6"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q1MML6"
                     /protein_id="CAK05786.1"
                     /translation="MVDDLEGISVFLAVAEARNFRLAGERLGVTRSAVSQALQRLEDR
                     VGVALVQRTTRSVSLTEAGEVFFDAVRPSVRQVKDAMQTVREMQARPSGLLRITVSSI
                     AENFLSGTLLAGFMEACPDIKLDITITDDEFDIVEAGFDAGVRLGEVIEQDMIAISVS
                     EEQRQCAAASRSYLERRGHPRHPGELQKHACIGWRPRPDTAPYRWEFTENDRDFDVSV
                     DPTVTTNDMGMMIRMACAGAGITFGMVETFQPYIERGELVPLLEDFCPPFAGFYLYYP
                     RRQRQPLKLRALVDYVRKSKG"
     CDS             complement(329814..330104)
                     /transl_table=11
                     /locus_tag="RL0297"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0297"
                     /db_xref="EnsemblGenomes-Tr:CAK05787"
                     /db_xref="GOA:Q1MML5"
                     /db_xref="InterPro:IPR007159"
                     /db_xref="UniProtKB/TrEMBL:Q1MML5"
                     /protein_id="CAK05787.1"
                     /translation="MAHSENLIATVSTNGQIILPKTIRQRREWEAGTRLIVEEAAEGV
                     LLRQAPAFSQTKPDDVFGMLPFSGEPKTLEDMEADVLAEARRRDGLEFADGI"
     CDS             complement(330292..330726)
                     /transl_table=11
                     /locus_tag="RL0298"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:RL0298"
                     /db_xref="EnsemblGenomes-Tr:CAK05788"
                     /db_xref="GOA:Q1MML4"
                     /db_xref="UniProtKB/TrEMBL:Q1MML4"
                     /protein_id="CAK05788.1"
                     /translation="MSTESIFQTHLVLGYVAWLICFGAYILPWLTSMDRVRAHRAIAT
                     LHSFRFFGLVFILPGVVGPNLPASFAAFAAYGDLAAGLLAMLALITIRIRPIFWLFVV
                     AFNLVGMGDLALDYYHAIQAGLPAQAGSWAPHMRYRSFTCPC"
     CDS             330805..331776
                     /transl_table=11
                     /locus_tag="RL0299"
                     /product="putative LysR family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0299"
                     /db_xref="EnsemblGenomes-Tr:CAK05789"
                     /db_xref="GOA:Q1MML3"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q1MML3"
                     /protein_id="CAK05789.1"
                     /translation="MKQNFTVRQGALDGVEAFLSVAQHRSFRKAAGELGVTPSAISQA
                     VRALEERVGAVLFIRTTRSVGLTEAGERFLTRAKPAFEELVAASALARELGQRPAGLL
                     RLTVPPAVVPILLEPLIASFCQAFPEIEVEIAANEELVDIAADGFDAGIRLGQFIAAD
                     MVAVRLTPSFPLVVVGSPEYLRRRGWPERIDDLRQHACIRMRRSNGSIAPWSFVIGKK
                     PIEAVVSGPLIAHDFPTMLGATIGDMGLAQVPEPIAAGPVKAGKLVRVLEVFEPVAPG
                     VFLYYPSRHQVMPKLRAFIDHVKSRADAADKTRIHIDDRQTPATKMR"
     CDS             complement(331965..332456)
                     /transl_table=11
                     /locus_tag="RL0300"
                     /product="putative acetyltransferase"
                     /db_xref="EnsemblGenomes-Gn:RL0300"
                     /db_xref="EnsemblGenomes-Tr:CAK05790"
                     /db_xref="GOA:Q1MML2"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q1MML2"
                     /protein_id="CAK05790.1"
                     /translation="MSNVEKTMIIELTSHDFEAVLKGMAPHHLRLVQDSAIAPPDVLA
                     MLSRLAAEIGADFSPSAWMIVDDGEIVGLCSIVRVPQDGNIHIGYGIAPSRQGRGCTT
                     RAIGQLLEWARDDPRVALISAETGFENIASQRVLERNGFIRVGERIDAEDGPLICWEA
                     MTV"
     CDS             332744..333625
                     /transl_table=11
                     /locus_tag="RL0301"
                     /product="putative AraC family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0301"
                     /db_xref="EnsemblGenomes-Tr:CAK05791"
                     /db_xref="GOA:Q1MML1"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR010499"
                     /db_xref="InterPro:IPR011256"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR018062"
                     /db_xref="InterPro:IPR020449"
                     /db_xref="InterPro:IPR029442"
                     /db_xref="UniProtKB/TrEMBL:Q1MML1"
                     /protein_id="CAK05791.1"
                     /translation="MTAALRNYHERMLRVLDYVDQHLDDDLDLDLLSGVAAFSKFHFH
                     RQFTATFGLSVHRYIQLARMKRASYRLVYRDEERVTDIAMDAGYDAPDAFARAFRQRF
                     GQSPSSFRKSPDWEPWLAAFGPLDNARSKLMQKTFTTDDVIIRNVPTTPVAIMEHRGD
                     PATLGATIQRFIAWRKAAGLHPRTSPTFNVWRSERRPQSPTDYSVDLCVGTDQAIEAN
                     GEEIKAGEIPGGRCAVLRVVGNTDNLEPAALYLYRDWLPASGEEVRDFPIYCQRLSFF
                     PEVPEHEAVAELFLPLK"
     CDS             complement(333866..334813)
                     /transl_table=11
                     /locus_tag="RL0302"
                     /product="putative AraC family transcriptional regulator"
                     /product="putative arac-like transcription regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0302"
                     /db_xref="EnsemblGenomes-Tr:CAK05792"
                     /db_xref="GOA:Q1MML0"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR020449"
                     /db_xref="InterPro:IPR032783"
                     /db_xref="UniProtKB/TrEMBL:Q1MML0"
                     /protein_id="CAK05792.1"
                     /translation="MTTDPFSDILKLARAETLVTGGFTAGGPWAIRFPVPKTIKFFAV
                     VKGGCWVTLDGEAPIRFATGDVGLLSAPRAFVLASDPDVSPVDAMTLFSGVGRTTAQL
                     GDGDDFAHVGGHVLLDPVSGRLLADVLPPWIHVQANLPAATTFRWLLDRLVEERTSDL
                     PGAELASAQLAQLLFIQILRAHLAGAHCAGSGWLRALSDPRIAPALRLMHEDPARAWH
                     LEDLAAACAMSRTTFADRFRTVAGVAPLTYLTQWRMRLAEQALRDEAGKSVALIARSV
                     GYTSESAFSNAFKRVAGKSPKSYRDNNMHKRSLTQVKDI"
     CDS             334915..335910
                     /transl_table=11
                     /locus_tag="RL0303"
                     /product="putative aldo/keto reductase"
                     /db_xref="EnsemblGenomes-Gn:RL0303"
                     /db_xref="EnsemblGenomes-Tr:CAK05793"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q1MMK9"
                     /protein_id="CAK05793.1"
                     /translation="MILSKRQLGHQGLKVGAIGLGCMGMSQSYGPANEAESIATLHRA
                     IELGCDFFDTAEGYGPHTNEELLGRAFGDRREKVVLATKFGFRFENGRQLGTETDSSP
                     AAIRQTVEGSLRRLQTDHIDLLYQHRIDRKVPIEDVAGTVGELVKEGKVRFFGLSEVG
                     AATLRRAHATHPVSALQSEYSLWERNLEADVIPVLRDLGIGLVPFCPLGRGFLAGGVK
                     RAEDYPEGDTRRIDERYQGENYGANLRAARAVLDIAEAKGVKPAQIALAWLLHKGDFI
                     VPIPGTKRRAYLEQNVAADAVRLTPAEMQTLDDALATGTVSGNRYPDWIMAGIDR"
     CDS             335939..336973
                     /transl_table=11
                     /locus_tag="RL0304"
                     /product="putative CoA reductase"
                     /note="N-terminus to codon 270 is similar to the
                     N-terminus to codon 280 is similar to Zea mays (Maize).
                     Ccr2 UniProt:Q84J56 (EMBL:AY227029) (341 aa) fasta scores:
                     E()=1.5e-21, 37.407% id in 270 aa, and to entire protein
                     of Rhizobium loti (Mesorhizobium loti). probable
                     cinnamoyl-CoA reductase. UniProt:Q98JE8 (EMBL:BA000012)
                     (355 aa) fasta scores: E()=1.5e-96, 70.381% id in 341 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0304"
                     /db_xref="EnsemblGenomes-Tr:CAK05794"
                     /db_xref="GOA:Q1MMK8"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MMK8"
                     /protein_id="CAK05794.1"
                     /translation="MSGELVLVTGGSGFIAQHCILALLRAGYRVRTTLRSLSREAEVL
                     SNLRTGGAEPGDRLSFIAADLTADDGWAEAAAGCTYVIHGASPTPSGDQVCEEDWVRP
                     AVDGNMRVLRAARDAGVKRVVLTSAFGAIGVGHKPRSRPFVETDWSDLNGHVAPYQRS
                     KTLAERASWDFIAREGGGLELASVNPTTVLGPALGPDYSHSIRLIKNLLDGQQGCPKI
                     NTCVVDVRDVADLHLRAMTDPAARGERFLAASGESLWMVEIARLLKQRLGKGASKVST
                     RVLPNWFVRVVALFNPAMKGIVPHLGVNMNASSEKAQRLLGWEPRSREEAIGATADSL
                     IRLGRVNMKD"
     CDS             337174..337704
                     /transl_table=11
                     /locus_tag="RL0305"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0305"
                     /db_xref="EnsemblGenomes-Tr:CAK05795"
                     /db_xref="GOA:Q1MMK7"
                     /db_xref="InterPro:IPR002734"
                     /db_xref="InterPro:IPR024072"
                     /db_xref="UniProtKB/TrEMBL:Q1MMK7"
                     /protein_id="CAK05795.1"
                     /translation="MAKLVFGMNQSLDGYVDHTAFGPSPTLFRHFIEEAQRQAGSVYG
                     RQMYEVMRYWDDEHPEWDAERHAFAAAWRNQPKWVVSRSSKSVGPNARLVEEDLAAAI
                     RELKAERDGEIEVAGPNLAQSLTELGLIDEYRIYLHPVVLGHGKPYFAGPRPPLRLMA
                     HDRIGEDVIRLTYVPA"
     CDS             complement(338008..338655)
                     /transl_table=11
                     /locus_tag="RL0306"
                     /product="putative isochorismatase family protein"
                     /db_xref="EnsemblGenomes-Gn:RL0306"
                     /db_xref="EnsemblGenomes-Tr:CAK05796"
                     /db_xref="GOA:Q1MMK6"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:Q1MMK6"
                     /protein_id="CAK05796.1"
                     /translation="MTFRNGLASLLRPEDSVLVLIDHQPYQLANLNSHDPHAVVNNST
                     ALAKAARAFGVPTILTSVIADRGGLIFPQITDVFPGQEVIDRTFINTWEDRKVVDAVK
                     ATGRKQLIIAGLWTEICVAMPVIQALGEGWDVTVITDASGGTSVEAHEVAIQRMIAAG
                     ANMMTWLALASEWQRDWARTEHAAELTEVLKQHAAGSGIAYLWEQQLLNTPVPRA"
     CDS             338809..339708
                     /transl_table=11
                     /locus_tag="RL0307"
                     /product="putative LysR family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0307"
                     /db_xref="EnsemblGenomes-Tr:CAK05797"
                     /db_xref="GOA:Q1MMK5"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q1MMK5"
                     /protein_id="CAK05797.1"
                     /translation="MDIEELQTFVEVADAGGVSPAALRLGVSKSIVSRRLFRLEAELG
                     VQLLARTTRGAALTEAGVTFRDYAARVCAEIDVARETILPAGDLRGRLRVAVPLSFGQ
                     THFAPILAEMARRHPQLHIHTCYSDRFVDLITEGYDCAIRVGYLQDSNLIARRVGPIY
                     GKFVASPDYIKAHGSPETPEELIAHEALMQGTEAWQLMDGDKIITVRPQGRFKADNGT
                     ALVAAAVAGLGIAYLPDCLTHEFIASGALVPVMTHYPPPPAGAYVIRPPGQHPARKIR
                     VLTELLIEYCEPAPSFHDLGWAD"
     CDS             complement(339705..342569)
                     /transl_table=11
                     /locus_tag="RL0308"
                     /product="putative transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0308"
                     /db_xref="EnsemblGenomes-Tr:CAK05798"
                     /db_xref="GOA:Q1MMK4"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MMK4"
                     /protein_id="CAK05798.1"
                     /translation="MEELEEANVTTYCFGDCRFIPARQLLLHREVPIRVGSRAIDLLH
                     ALVRRPGIVVSKDELFRAAWPNVFVDESNLKVNIAVLRRALAQVEPDLTCIATVPGRG
                     YRFVAPLRVLGVADEAALSDAVRGISGELPAPPALIGRDEAMADLAGALAETRLLTIV
                     GPPGVGKTSVAVATARQVGESLKDGVCFVDLAAIDSPQLVAPAIAFACGLNSNLVNIL
                     AGLVEMLRDRELLLVLDNCEHVLNAAATVADHLNHALPRLLVVTTSREPLRCRRESVY
                     RLAPLRFPPAGSELDAAAALDFSAVELLVQRAVTQGYRLDDADASSLAAISRRLDGIA
                     LAIELAAPRLSTDGPAKLADLLENAFDAFVLQGNAAAPRHMTLMAMLDWSYRLLPERE
                     ACLLRHLSLFSGTFTLNDVVGVCGHLGSAEDVGAWLESLAARSLSSVSYHSGHRYYRL
                     LDSTRSFASERLRASGEEQAAMASYTHYLLALFEQGEVEWNWRAREDWTARYGRWGND
                     LHRAIDWAWRDGHNRELGIRLTAAAIPLWNELSSLSETRTRVAEVVEGLNGLAMDDVV
                     LRLKLVSAHALNLNFGDDRGPEIEAAWREARTLADETGNVEYRLRTTMGWAGAKTFAG
                     NHRQVLSALSELRGLLNQEGGHSAVPDVTRLELVNRFYCGDIETSVAGLKALARSHST
                     VAYRSQTSRFQLDRFVGIRSYLAPMLWVVGEHREAFDVAQECILAATTIGHPVSLMHA
                     LAVGGLSVSLWSGLLDVAQDQLKRLEAQYQICQLDIWPPLIRFYRAAIDTAGRDAQAV
                     DRMRDAIGGLRSRNLRIHFAMNLAMLADAALSHNRLDVARAVAAEASDYLERDEAWCR
                     SELFRVIGLTRWREGDVLSAAENLAMAVRAAQRSGALTLELRAATQQAKLALQTGHGD
                     IALSHLACVYQRFESGLHTADVVAARDQLEVGQMISRGGS"
     CDS             342817..343248
                     /transl_table=11
                     /locus_tag="RL0309"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0309"
                     /db_xref="EnsemblGenomes-Tr:CAK05799"
                     /db_xref="InterPro:IPR005624"
                     /db_xref="UniProtKB/TrEMBL:Q1MMK3"
                     /protein_id="CAK05799.1"
                     /translation="MPRTLNTLTLSDAKQMLQAGEAKAANLGIPYNIAVVDAGGALIA
                     FTRQDGALAGSIDLAIGKAKTARLFDKTTEYLAELAQPGAPLFGIEQSNGGNVVIFGG
                     GLPVKYDNQIIGAVGTSAGSVEQDIAVAVAAAEAISPNAKP"
     CDS             343260..344315
                     /transl_table=11
                     /locus_tag="RL0310"
                     /product="putative alcohol dehydrogenase"
                     /EC_number="1.1.1.1"
                     /db_xref="EnsemblGenomes-Gn:RL0310"
                     /db_xref="EnsemblGenomes-Tr:CAK05800"
                     /db_xref="GOA:Q1MMK2"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020843"
                     /db_xref="UniProtKB/TrEMBL:Q1MMK2"
                     /protein_id="CAK05800.1"
                     /translation="MKAARILEYKKALVLEDIPVPDIQPDEVLVKVAACGMCRSDVLL
                     IDGFFQGYGDIPPPVIPGHEITGTIEKIGSVVPKVAGIEEGDHVVVAPGWGDGVCRHC
                     MVGDTHICPNVRWPGFGPDGGFAEYIPVPARYVIKVPKHLKFEQLAPLTDAGLTPYRG
                     LKKIRNAGGLGPDRVIGVFGIGGLGAYAVQYAKLLGAGGPVVAVARNEEKLQVAKKYG
                     ADHIIAIEGKSSEDVGKELRKATGQDKFDAIIDCAGATEMMQLAFSRLAISGHYADVG
                     FIGDRIDIPLFPRVSGEQTFHGSFWGNNADLTEVMALAAEGKIQHTIKTISFDDINEY
                     IDLMRDNKIVGRAVVTF"
     CDS             344437..345120
                     /transl_table=11
                     /locus_tag="RL0311"
                     /product="putative DJ-1/PfPI family protein"
                     /db_xref="EnsemblGenomes-Gn:RL0311"
                     /db_xref="EnsemblGenomes-Tr:CAK05801"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q1MMK1"
                     /protein_id="CAK05801.1"
                     /translation="MTQHVLFIVTNAAVIGPHSRKTGFFFAEVAHPFDVLDKAGIAVE
                     FASPAGGWTPYDAYDEKDPAQKEFLESKAFRRLNHSRKLSEVDAADYDAILVPGGLGP
                     MVDIQRNADVQKAIVRAWTTGKLVTAVCHGPCALLSVDLGDGTPFVRGKKLTSFSKKE
                     EYDYARDDVPYELEDALRAEGAEYSSASNWEPHVVVDGRLITGQNPASAGPLGKELVA
                     ALKRAAVPA"
     CDS             345230..345529
                     /transl_table=11
                     /locus_tag="RL0312"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0312"
                     /db_xref="EnsemblGenomes-Tr:CAK05802"
                     /db_xref="InterPro:IPR007138"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="UniProtKB/TrEMBL:Q1MMK0"
                     /protein_id="CAK05802.1"
                     /translation="MTQSPAKITAVLTAHPGKAADLRSLLVGMAPLCRAEPGNLRWDV
                     WRDQAVPERYVLDELYRDGEAVEAHRRTPHYQDYLTRIPSLAERSALVLEAVAVS"
     CDS             345555..346931
                     /transl_table=11
                     /locus_tag="RL0313"
                     /product="putative aldehyde dehydrogenase"
                     /db_xref="EnsemblGenomes-Gn:RL0313"
                     /db_xref="EnsemblGenomes-Tr:CAK05803"
                     /db_xref="GOA:Q1MMJ9"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="UniProtKB/TrEMBL:Q1MMJ9"
                     /protein_id="CAK05803.1"
                     /translation="MLEVVQAFDRKHIADLPTDDAAALESKLETARARFLNRNDWLAP
                     HERMAVLRRLADLVGLQREVFAKRIACEGGKPYTDALVETDRAIDGIRNAADVLRTRG
                     GVEIPMGLTQASDNRRAWTIQEPIGVVAAISAFNHPLNLIVHQMAPAIATGCPVIIKP
                     AAATPLCCLELVKLVHEAGMPEGWVQAFLPESRVLSSAFASDARIAFLSFIGSAEVGW
                     RLRANLAPGTRCALEHGGVAPVIVDRSADLDAIIEPLAKGGYYHAGQVCVSVQRIYVH
                     AELKEAFIERFAARVEQLRVGDPTHAETEVGPLITPAEATRVETWIDEAATAGARRIG
                     GGRLSDTTLKPAILVDPPRDTKVSTHEIFGPVTCIYGYDEVEDAIAAANSLPVAFQAS
                     IFTRDLDVAFNAAEKLDASAVMVNDHSAFRTDWMPFAGRRESGYGVGGIPFTAREMTA
                     EKMIVFKR"
     CDS             346987..348213
                     /transl_table=11
                     /locus_tag="RL0314"
                     /product="putative transmembrane transporter protein"
                     /note="Similar, but truncated at the N-terminus, to
                     Agrobacterium tumefaciens (strain C58/ATCC 33970). MFS
                     permease. MFS permease. UniProt:Q8UGN6 (EMBL:HS481254)
                     (428 aa) fasta scores: E()=1.7e-50, 42.175% id in 377 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0314"
                     /db_xref="EnsemblGenomes-Tr:CAK05804"
                     /db_xref="GOA:Q1MMJ8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q1MMJ8"
                     /protein_id="CAK05804.1"
                     /translation="MFGKAYEAQCQATKFAPSSAHHESQALALFSLALGSFCIGTSEF
                     ASMGIIQLYAEDFGIDIPTATNAITGYAFGVVLGAPLATLVAARLNRRTLLLCLMALW
                     VVGNVLSSMASNIGLFAAARFISGVPQGAYFGAGAVIAAYFFGADRAGKAFALVMTGL
                     TIATIFGSPLATFLGQTLGWRNTYLAMAALGAVAFLALFLFVPRTEALNGGSVLHELS
                     GLRRWNVWAMIVVAALGISSIFAVYAFIGPLVTDVVQLDQSTIPLALGVFGVGMTVGN
                     AVGGQLADIFAFRGLILGYGITLILLVILSCFGTKVWVFMPCLFGLGAAMMAAIPTIQ
                     VRMTHFAPEAPTLMGAMNLAALNVANALGAWGGGLVIAAGYSVLFSPLAGFVLTAAGL
                     LVYFIALPRSASVVQA"
     CDS             complement(348345..349907)
                     /transl_table=11
                     /gene="guaA"
                     /locus_tag="RL0315"
                     /product="putative GMP synthase [glutamine hydrolysing]"
                     /EC_number="6.3.5.2"
                     /db_xref="EnsemblGenomes-Gn:RL0315"
                     /db_xref="EnsemblGenomes-Tr:CAK05805"
                     /db_xref="GOA:Q1MMJ7"
                     /db_xref="InterPro:IPR001674"
                     /db_xref="InterPro:IPR004739"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR022955"
                     /db_xref="InterPro:IPR025777"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMJ7"
                     /protein_id="CAK05805.1"
                     /translation="MTQTAHPDSVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEE
                     GFHRLQPKAVILSGSPASTVDEGSPRAPDIIFDSGLPVFGICYGQQTMCMQLGGKVES
                     GHHREFGRAFLEVDRDCQLFEGLWSSGSRHQVWMSHGDRVTALPDGFEVVATSSNAPY
                     AFIADEKRKYYGVQFHPEVVHTPDGAKLIGNFIHNIAGIKGDWSMSAYRQKAVEQIRA
                     QVGDKRVICALSGGVDSSVAALLIHEAVGDQLTCILVDHGLMRKDEAAGVVAMFREHY
                     NLHLLHVDAADRFIGELEGVSDPETKRKIIGRLFIETFEEEARKLGGADFLGQGTLYP
                     DVIESVSFTGGPSVTIKSHHNVGGLPERMKMQLVEPLRELFKDEVRALGRELGLPDSF
                     IGRHPFPGPGLAIRCPGGITREKLEILREADAIYLDEIRKAGLYDAIWQAFAVLLPVQ
                     TVGVMGDGRTYEFVCALRAVTSVDGMTADFYHYDMEFLGRAATRIINEVRGINRVVYD
                     VTSKPPGTIEWE"
     CDS             complement(350000..350638)
                     /transl_table=11
                     /locus_tag="RL0316"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0316"
                     /db_xref="EnsemblGenomes-Tr:CAK05806"
                     /db_xref="GOA:Q1MMJ6"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR010050"
                     /db_xref="UniProtKB/TrEMBL:Q1MMJ6"
                     /protein_id="CAK05806.1"
                     /translation="MKFELKSVAGKSILFVMAAEAEYGPFLRSRIEPLMTGVGPVEAA
                     IALSKTLARLDAVDDLPDLVVSLGSAGSAKLEQTEIYQVTSVSYRDMDASPLGFEKGK
                     TPFLDLPATLELPLRIPGIAEASLSTGGNIISGVAYTNIDADMVDMETYAVLRACQGY
                     KLPLIGLRGISDGAVELQHISGWTEYLHIVDRKLSYGVDSLFTALEDGVFWF"
     CDS             complement(350635..351144)
                     /transl_table=11
                     /locus_tag="RL0317"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0317"
                     /db_xref="EnsemblGenomes-Tr:CAK05807"
                     /db_xref="InterPro:IPR003736"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q1MMJ5"
                     /protein_id="CAK05807.1"
                     /translation="MSSLSNAARHANFAAARGADMSETDRGDFRARIRRNFARQAAME
                     TIGAELTRVEHGVVEIELPFDVKLTQQHGILHAGIISAALDSACGFAAYSVIDPEASI
                     LTIEFKVNLMSPGRGDRFLFRGEITKPGSTIIVADGRGYAISDGPAKLIASMTGTMMV
                     IRGREGITG"
     CDS             351355..352431
                     /transl_table=11
                     /locus_tag="RL0318"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0318"
                     /db_xref="EnsemblGenomes-Tr:CAK05808"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR018721"
                     /db_xref="UniProtKB/TrEMBL:Q1MMJ4"
                     /protein_id="CAK05808.1"
                     /translation="MTTISQSVRNFEAWLAGELGDDLVKDDLREKHEKMRSDDFVFLR
                     ATYWRWCEIILDICPELTGAPQVLAIGDTHLENFGTWRDVEGRLVWGVNDFDDAAVMP
                     YALDLVRLAASAVLARSGDGPSVRMIGELILSGYRRGLENPLPVILERDHKWLRKALL
                     LPNSERREFWEKYEMLQPGKKPAPPAYVKALADALPLGSGPFLAKPRSGGTGSLGRPR
                     FVAYAEWQGGPVLREAKALVPSAWSLRHNPQDVAIHASEIANGRARSADPHYRASGRI
                     LVRRLSPNSCKVEIDRHPEILLSPTMLELMGFEIANCHSGDAAAAAAILKDLAARGNE
                     WLHEAARAAASSISTEQKAYSRAG"
     CDS             complement(352488..353567)
                     /transl_table=11
                     /locus_tag="RL0319"
                     /product="conserved hypothetical exported protein"
                     /db_xref="EnsemblGenomes-Gn:RL0319"
                     /db_xref="EnsemblGenomes-Tr:CAK05809"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR008311"
                     /db_xref="InterPro:IPR011048"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q1MMJ3"
                     /protein_id="CAK05809.1"
                     /translation="MMQSAAINRRSFVKAAGLGFLATLTPRSLMALERADAVYASGIR
                     AADGSFAIATVTERGEIVDQVALPARAHGIAFSASTGKTVAFARRPGTYAMIFDPWNK
                     SEPIVISSREDRHFYGHGAFSPDGRLLYASENDFDGNRGMIGLYDATDRFTRIGEFET
                     YGIGPHDMTVSDDGRLLIVANGGIETHPDFGRTKLNLGEMQPSLALIDAATGALVEKH
                     VLPAEWAELSTRHVDLDGAGRIWFACQYEGHRKDLPPLVGHFAKGEDLSFIDLPEETT
                     RRLANYVGAIAVNRSEGLVGITSPKGGASVTIDARTGKMLAETSVPDAAGIAPARNGF
                     AVSSYDGDFLSTRSDVAWDQHIVRI"
     CDS             complement(353572..354675)
                     /transl_table=11
                     /locus_tag="RL0320"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0320"
                     /db_xref="EnsemblGenomes-Tr:CAK05810"
                     /db_xref="UniProtKB/TrEMBL:Q1MMJ2"
                     /protein_id="CAK05810.1"
                     /translation="MMRLWHPLLCLTLIGLATSAAAQTATPPAGLNEDAVPAVMQRAV
                     DEVIRPGYRNMQQSAARLTTAMKDLCSDGTQQTLDKAKSTFDDTIRYWSIIEIVQTGP
                     VIQDNLFEHILFYPDRKGVGLKQVQALIAKADPNDATVDAIAGKSVALQGLTALEYVL
                     YGNGSDDLVGQKGSFRCLYGEAVAGNIQREAGEVVAAWEKPDGVQASWKHPGPQSNDF
                     MDNKEAVTALLGILVHGAENVRDQRLEQFYKGKDTAPRPRMAIYWRSKNTWKSMAANL
                     EGLRTLWQKAGMAELLPPDKQSIAASIDEDFKSLLDSVPKLNPDIDVAISDAEKAKLD
                     TLLAESRDLITRISDEYGAAIGLSAGFSFSDGD"
     CDS             complement(354672..356210)
                     /transl_table=11
                     /locus_tag="RL0321"
                     /product="conserved hypothetical exported protein"
                     /db_xref="EnsemblGenomes-Gn:RL0321"
                     /db_xref="EnsemblGenomes-Tr:CAK05811"
                     /db_xref="GOA:Q1MMJ1"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="InterPro:IPR010538"
                     /db_xref="UniProtKB/TrEMBL:Q1MMJ1"
                     /protein_id="CAK05811.1"
                     /translation="MSHAPARRLIASAALCATLAGFSVSIAAGFDLPRKRTDLSEADL
                     KRVADVTRPTADFSKAEQYEAMQAGATTSIDPVTEDSFSHISANIPFEEEQNFKLGNA
                     LFRKLWVSSPSSTQASDGLGPLFNARSCMSCHVNDGRGRPPEGAASATSMFLRLSRAA
                     TTPEEEKAVARADVVNFPDPVYGHQLQDLAVPGLAAEGKMAISYREERVTLGDGETVS
                     LRRPSYAVTNLGYGPLDPATTISPRVASAMIGLGLIEAIREADILAHADPDDADGDGI
                     SGKAAIVRDHRSGKIALGRFGWKAQNATVRDQSADAFANDIGISTPDQPNAQGDCTKA
                     EEKCLDMPTGVQKRLGAEEAPGPILDLVTFYSENLAVPARRKASFAETLRGKRIFYES
                     GCISCHVPKFVTRRDTPEKAQSFQLIWPYSDFLLHDMGDGLADGQQVGLASGREWRTP
                     PLWGIGLTRTVSGHSFFLHDGRARSLTEAILWHGGEAERARNAFSSLPKDDRAALITF
                     LESL"
     CDS             complement(356258..357532)
                     /transl_table=11
                     /locus_tag="RL0322"
                     /product="putative iron-regulated protein"
                     /note="N-terminus to codon 130 is similar to N-terminus to
                     codon 150 of Synechococcus sp. (strain PCC 7942)
                     (Anacystis nidulans R2). IrpA UniProt:IRPA_SYNP7
                     (EMBL:SSIRPA) (356 aa) fasta scores: E()=0.0048, 32.558%
                     id in 129 aa, and entire protein is similar to
                     Agrobacterium tumefaciens (strain C58/ATCC 33970).
                     hypothetical protein atu0288. UniProt:Q8UIK5
                     (EMBL:AE009000) (447 aa) fasta scores: E()=1.2e-127,
                     81.446% id in 415 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0322"
                     /db_xref="EnsemblGenomes-Tr:CAK05812"
                     /db_xref="UniProtKB/TrEMBL:Q1MMJ0"
                     /protein_id="CAK05812.1"
                     /translation="MKLNTFRAAVLAIAPAALLALPAHAETDAAAVVKHYADVAHAKY
                     EDSLTTAKALDAAIDAFLKAPTDATLKAAREAWIKARVPYQQTEVYRFGNPIVDDWEG
                     KVNAWPLDEGLIDYVDASYGTESDENSLYVANVIANKTIKIDGKDVDASKLTPEFISG
                     TLAEAGGIEANVATGYHAIEFLLWGQDLNGTGPGAGDRPATDYDLKNCTHGNCDRRAE
                     YLKSASTLLVSDLQEMTDNWKPDGAATKNVEADPKAGLVAILTGMGSLSYGELAGERM
                     KLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIAAAYTGNYTRVDGTKLSGPSLHDLVAA
                     KDKALDAEVEGKLNKTLDAMNAMAKRGETVEKYDQMIGEGNKEGNAVVQAAIDGLIDQ
                     TKSVQRVIAALDLGTVQLEGSDSLDNPNAVFQ"
     CDS             complement(357822..359111)
                     /transl_table=11
                     /locus_tag="RL0323"
                     /product="putative methyltransferase"
                     /note="Codons 125 to the C-terminus is similar to codons
                     145 to the C-terminus of Escherichia coli. RsmB
                     UniProt:RSMB_ECOLI (EMBL:CEK131EZR) (429 aa) fasta scores:
                     E()=1.2e-21, 30.392% id in 306 aa, and to Agrobacterium
                     tumefaciens (strain C58/ATCC 33970). Sun UniProt:Q8UIK4
                     (EMBL:AE007967) (AGR_C_495p aa) fasta scores:
                     E()=4.5e-121, 74.533% id in 428 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0323"
                     /db_xref="EnsemblGenomes-Tr:CAK05813"
                     /db_xref="GOA:Q1MMI9"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q1MMI9"
                     /protein_id="CAK05813.1"
                     /translation="MRLGGRLEGAISVLADIDARKRPVADALKDWGLAHRFAGSGDRA
                     AIGNIVYDALRMRLSHAWLMDDDSPAAIAHGVMFRQWGFSPDSLATELADDKFAPAPL
                     SADAVSAFQSRSLDDAPPHIRGDIPEWVQPSFEQAFGAGWLAEAQALAARPTLDLRAN
                     LLKASRDKVVKALERANAHAAKIARYGIRIAAGEGASRLPNVTAELSFQKGWFEVQDE
                     GSQIVADLVLAHDGEQVLDYCAGGGGKTLAMAAAMQNKGQVHAYDADRKRLAPIIERL
                     KRAGTRNVQVHDDARALSALAGRCDKVLVDAPCTGTGTWRRRPDTKWRLTAKNLDERT
                     AQQQDALAQASSFVKSGGELIYVTCSVLPQENEEQARRFTADNPDFQIVSALPAWDQL
                     FGKDAPRPHSSDGLSVTLTPASTDTDGFFFCRMQRKG"
     CDS             complement(359256..359618)
                     /transl_table=11
                     /locus_tag="RL0324"
                     /product="conserved hypothetical protein"
                     /note="Similar to C-terminus from codon 280 of Anabaena
                     sp. (strain PCC 7120). RlpA-like protein.
                     UniProt:RLPA_ANASP (EMBL:AP003591) (371 aa) fasta scores:
                     E()=1.8e-15, 61.702% id in 94 aa, and to entire protein of
                     Agrobacterium tumefaciens (strain C58/ATCC 33970). rare
                     lipoprotein a (agr_c_498p). UniProt:Q8UIK3 (EMBL:HS393249)
                     (122 aa) fasta scores: E()=1.3e-31, 75.630% id in 119 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0324"
                     /db_xref="EnsemblGenomes-Tr:CAK05814"
                     /db_xref="InterPro:IPR009009"
                     /db_xref="InterPro:IPR012997"
                     /db_xref="UniProtKB/TrEMBL:Q1MMI8"
                     /protein_id="CAK05814.1"
                     /translation="MKNIRRSIIAAVTIAACSSMLPAEGFAGNGCGGASWYALRSKTA
                     SGERMNPAILTAAHRSLAFGTKVKVTNRNNGRTVVVRINDRGPFIRGRVIDLSRAAAQ
                     NIGMVSSGTAKVCYQVVS"
     CDS             complement(360028..360897)
                     /transl_table=11
                     /locus_tag="RL0325"
                     /product="conserved hypothetical exported protein"
                     /db_xref="EnsemblGenomes-Gn:RL0325"
                     /db_xref="EnsemblGenomes-Tr:CAK05815"
                     /db_xref="GOA:Q1MMI7"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MMI7"
                     /protein_id="CAK05815.1"
                     /translation="MHVMIFGCGYSGTAIAKAFAGDGVRVSGTTRSPDKMDMLRQKGI
                     EAFLFDGESMEEGLRQALDSVTHLVQSIAPGKADPLLRLLGKDGARLLPKLEWIGYLS
                     TVGVYGDHQGAWVTEETPCLPVSGRSTERLEAEEGWLAMGRERGVPAAVLRLSGIYGP
                     GRNAFSNLDKGTARRLIKKDQVFNRIRVEDIGAAARFLSERGLGGIYNVTDDRPGPPQ
                     DVIVEAARLMGVEPPPEQAFETAELTPMARTFYGENKRVSNAKLKAAGFAFSFPNYPM
                     SLAQLWRDGRWRG"
     CDS             complement(360897..362054)
                     /transl_table=11
                     /locus_tag="RL0326"
                     /product="putative 4Fe-4S ferredoxin protein"
                     /db_xref="EnsemblGenomes-Gn:RL0326"
                     /db_xref="EnsemblGenomes-Tr:CAK05816"
                     /db_xref="GOA:Q1MMI6"
                     /db_xref="InterPro:IPR004453"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR013542"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="UniProtKB/TrEMBL:Q1MMI6"
                     /protein_id="CAK05816.1"
                     /translation="MPEPDNDDKERRRRDNLTEFVRAESAAKGFDLCRITRPDAIPQA
                     KERLGQFIDAGRHGTMDWMAETRDRRGDPRTLWSEVRSVVVFGLNYAPEEDPRAILDK
                     PDKAAISVYARNRDYHDVIKGRLKEIATRFAARAGADVKVFVDTAPVMEKPLAAAAGI
                     GWQGKHTNLVSRVHGSWLFLGTMFTTADLVVDAPEADHCGSCRACLDICPTAAFPAPY
                     QIDARRCISYLTIEHKGPIDADLRVLIGNRIYGCDDCLAACPWNKFASSASEMKLQAR
                     EDLKEPSIAFLLTLGDAAFRAFFSGSPVKRIGRDRFVRNVLIAAGNSGDKVLIGPCRL
                     LSDDPSPVVRGMAVWALSRLMEAGEFAAFAAQRADERDDDVLNEWRLAGVG"
     CDS             complement(362067..362759)
                     /transl_table=11
                     /locus_tag="RL0327"
                     /product="putative glutathione S-transferase"
                     /db_xref="EnsemblGenomes-Gn:RL0327"
                     /db_xref="EnsemblGenomes-Tr:CAK05817"
                     /db_xref="GOA:Q1MMI5"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q1MMI5"
                     /protein_id="CAK05817.1"
                     /translation="MPTLYHHPMSSASRFVRLILAEYGYQADLIEEQTWEKRRDFLAL
                     NPAGTLPVYVDDSMRALCGASVISEYLDETHGVLKRDRRLLAEDPFQRAEIRRLTEWF
                     MQKMENDVTKPLARERVYKLQMTADQGGGAPDSKILRTARANIRQHMRYLTWLAGSRQ
                     WLAGERMSYADLAAAASISILDYLGEIEWADSPVVKDWYQRLKSRPSFRPMLTERVRG
                     LTPVSHYADLDF"
     CDS             362992..363789
                     /transl_table=11
                     /locus_tag="RL0328"
                     /product="putative undecaprenyl-diphosphatase"
                     /product="undecaprenyl-diphosphatase (ec 3.6.1.27)
                     (undecaprenyl pyrophosphate phosphatase) (bacitracin
                     resistance protein)"
                     /EC_number="3.6.1.27"
                     /db_xref="EnsemblGenomes-Gn:RL0328"
                     /db_xref="EnsemblGenomes-Tr:CAK05818"
                     /db_xref="GOA:Q1MMI4"
                     /db_xref="InterPro:IPR003824"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMI4"
                     /protein_id="CAK05818.1"
                     /translation="MDYINAAILGVIEGITEFLPISSTGHLIIAEQWLGHRSDMFNIV
                     IQAGAILAVTIIYWRRLVDLVLGWRDPVNRDYAAKLIVAFLITAILGLVVKKLGFELP
                     ETATPIAWALIIGGIWMIFAEWAAARRPPHKEITWLVAILVGIAQIVAGVFPGTSRSG
                     ATIFVAMLAGTGNRASATEFAFLVGIPTMYAASAYELLKTFRDGGAAGEDWTALGIAF
                     VVSTVVAFIAVKWLLAYIRSNRFTLFAIYRIILGVLLLGMAATGLIA"
     CDS             complement(364471..365451)
                     /transl_table=11
                     /locus_tag="RL0329"
                     /product="putative NADH-ubiquinone oxidoreductase subunit"
                     /note="Similar, but truncated at the N-terminus, to
                     Neurospora crassa. nuo-40 UniProt:NUEM_NEUCR
                     (EMBL:NCNUO40) (375 aa) fasta scores: E()=2.1e-19, 29.032%
                     id in 310 aa, and to Rhizobium meliloti (Sinorhizobium
                     meliloti). putative oxidoreductase protein (ec 1.-.-.-).
                     UniProt:Q92SP0 (EMBL:SME591783) (EC ( 326 aa) fasta
                     scores: E()=3.5e-96, 77.301% id in 326 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0329"
                     /db_xref="EnsemblGenomes-Tr:CAK05819"
                     /db_xref="GOA:Q1MMI3"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MMI3"
                     /protein_id="CAK05819.1"
                     /translation="MTLANLPPLVTVFGGSGFVGRHVVRALAKRGYNIRVAVRRPDLA
                     GFLQPLGNVGQISFVQANLRYRSSIDRAVDGASHVVNCVGILHETGRNTFDAVQEFGA
                     RAIAEAARGAGATLTHISAIGADVKSDSDYGRTKGRAETAILSVKPDAVIFRPSIVFG
                     PEDSFFNKFAEMARMSPILPLIGGGKTKFQPVYVEDIAEAVARAVDGKVAGGKVYELG
                     GPEVLSFRECLETMLKVTCRKNPLVSLPFGVASMIGSIASLIPFITPPITPDQVRMLK
                     RDNVVSPEAEAEGRTLKGLGIAPTMVASVLGSYLVHYRPHGQYTGTGKAA"
     CDS             complement(365564..365851)
                     /transl_table=11
                     /locus_tag="RL0330"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0330"
                     /db_xref="EnsemblGenomes-Tr:CAK05820"
                     /db_xref="InterPro:IPR010753"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="UniProtKB/TrEMBL:Q1MMI2"
                     /protein_id="CAK05820.1"
                     /translation="MAKGYWIARVDVRDAERYKDYVAAAKPAFEKYGANFLARGGAFT
                     ELEGKARVRNVVIEFPSMQHAVDCYNSPEYQIAAKIRQEVADAEMVVVEGV"
     CDS             complement(365881..366588)
                     /transl_table=11
                     /gene="pyrF"
                     /locus_tag="RL0331"
                     /product="putative orotidine 5'-phosphate decarboxylase"
                     /EC_number="4.1.1.23"
                     /db_xref="EnsemblGenomes-Gn:RL0331"
                     /db_xref="EnsemblGenomes-Tr:CAK05821"
                     /db_xref="GOA:Q1MMI1"
                     /db_xref="InterPro:IPR001754"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014732"
                     /db_xref="InterPro:IPR018089"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMI1"
                     /protein_id="CAK05821.1"
                     /translation="MGARERLIVGLDVPTIGEAERLVSTLGDDILFYKIGYQLVFAGG
                     LEFARDLAASGKKIFLDMKLLDIDNTVASGVENIAKMGMSMLTLHAYPKAMKAAVEAA
                     AGSGLCLLGVTVLTSMDADDLAEAGYSQDPHSLVLRRAGQARAAGMGGIVCSAEEAAA
                     VREIVGPDMAIVTPGIRPDGSDKGDQKRVMTPFDALKAGATHLVVGRPIVKAPDPRDA
                     ARAILSEMVSALWPANR"
     CDS             complement(366595..367176)
                     /transl_table=11
                     /locus_tag="RL0332"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0332"
                     /db_xref="EnsemblGenomes-Tr:CAK05822"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q1MMI0"
                     /protein_id="CAK05822.1"
                     /translation="MFGIYITHPQVRIDANVPVPKWGLSDVGAARARKAAESGWARQL
                     RRIVSSDETKAIETAEILAKASGVTVEIVHAMHENDRTATGFLPPPQFEEAANWFFAH
                     PEQSFKGWERAVDAQDRIVEAVNAVLATHDATAPIAFVGHGGVGTLLKCHLAGRPISR
                     DRDQPGGGGNLYAFGLADRRLTCDWTPIEDWQG"
     CDS             complement(367178..367777)
                     /transl_table=11
                     /gene="pmtA"
                     /locus_tag="RL0333"
                     /product="putative phospholipid N-methyltransferase"
                     /EC_number="2.1.1.17"
                     /db_xref="EnsemblGenomes-Gn:RL0333"
                     /db_xref="EnsemblGenomes-Tr:CAK05823"
                     /db_xref="GOA:Q1MMH9"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q1MMH9"
                     /protein_id="CAK05823.1"
                     /translation="MSLRVKVKERLGKRFDDEIRFFRGMMQGPKTVGSIVPTSSITAK
                     RMASVVDIHSGLPVLELGPGTGAITKAILGRGVRPENLVAIEYSTDFHKHLQRTYPGV
                     HFINGDAFDLQATLGNFSGLTFDSVVSGIPLLNFPMAKRISLLESLLDRLPAGRPMVQ
                     ISYGAISPIAANPDRYHIQHFDFVMRNIPPAQLWIYKRG"
     CDS             complement(367988..369106)
                     /transl_table=11
                     /gene="dnaN"
                     /locus_tag="RL0334"
                     /product="putative DNA polymerase III, beta chain"
                     /EC_number="2.7.7.7"
                     /db_xref="EnsemblGenomes-Gn:RL0334"
                     /db_xref="EnsemblGenomes-Tr:CAK05824"
                     /db_xref="GOA:Q1MMH8"
                     /db_xref="InterPro:IPR001001"
                     /db_xref="InterPro:IPR022634"
                     /db_xref="InterPro:IPR022635"
                     /db_xref="InterPro:IPR022637"
                     /db_xref="UniProtKB/TrEMBL:Q1MMH8"
                     /protein_id="CAK05824.1"
                     /translation="MRITIERSNLLKSLNHVHRVVERRNTIPILSNVLLKADGQKLDM
                     KATDLDLEITEATPASVEQPGATTVPAHLLYDIVRKLSDGSEVLLATSSDGGSMTVQS
                     GRSKFSLQCLPESDFPDLTAGTFTHSFKLKATDLKMLIDRTQFAISTEETRYYLNGIF
                     FHTIESNGQLKLRAVATDGHRLARADVDAPSGSEGMPGIIIPRKTVGELQKLVDNPEV
                     MVTVEVSDAKIRLTIGSIVMTSKLIDGTFPDYQRVIPTGNDKEMRVDCTSFAQAVDRV
                     STISSERGRAVKLALSEGQLMLTVNNPDSGSATEEVAVGYDTDAMEIGFNAKYLLDIT
                     AQLSGEEAIFLLADAGSPTLIRDTAGDDALYVLMPMRV"
     CDS             369366..370283
                     /transl_table=11
                     /locus_tag="RL0335"
                     /product="putative tetrapyrrole-methylase protein"
                     /db_xref="EnsemblGenomes-Gn:RL0335"
                     /db_xref="EnsemblGenomes-Tr:CAK05825"
                     /db_xref="GOA:Q1MMH7"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR008189"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="InterPro:IPR018063"
                     /db_xref="UniProtKB/TrEMBL:Q1MMH7"
                     /protein_id="CAK05825.1"
                     /translation="MNEETTADAASRRSFRLHNMAVPARPLEPALYLVATPIGNLGDI
                     TLRALETLAGADVLACEDTRVTRVLLDRYGIQNRPFAYHEHNADEAGPRLLQALEAGR
                     SVALVSDAGTPLVSDPGYRLAQQAIAAGYRVIPIPGASAPLAALVGSGLPNDAFLFAG
                     FLPAKDKARRDRLGELAAAPATLIFFESPHRIGATLLAAADVLGPTRPASVCRELTKT
                     YEEFRRGTLAELAAHYQQVENVKGEIVLVIGPPEPVETDEADVEAMLADLSKTMPTAG
                     AATEAARLTGLPRKVLYQRLLEIKNADGR"
     CDS             370273..370641
                     /transl_table=11
                     /locus_tag="RL0336"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0336"
                     /db_xref="EnsemblGenomes-Tr:CAK05826"
                     /db_xref="GOA:Q1MMH6"
                     /db_xref="InterPro:IPR003509"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR011856"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMH6"
                     /protein_id="CAK05826.1"
                     /translation="MGDSDLTAIRRKALRRGRISEYVAAVFLMLKGYRILALRHRTRL
                     GEIDIIARKGDLAVFVEVKARHGEAAAVDAVSVAAQKRIRAASDLWLARQADQARLSQ
                     RYDIVAIMPGRLPRHFLDAF"
     CDS             370769..371257
                     /transl_table=11
                     /locus_tag="RL0337"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0337"
                     /db_xref="EnsemblGenomes-Tr:CAK05827"
                     /db_xref="InterPro:IPR008579"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:Q1MMH5"
                     /protein_id="CAK05827.1"
                     /translation="MLASAVAMAARSVPYAVAKPAGKSFVAHASDLLPLKSTPINPDW
                     IVSGNPQARTAEHSRGHDEASLTAIWDCTAGEFRWYFGWDETVMILEGEVHITAEDGT
                     ERTLSAGDVAFFAGGTWASWRVDNYVRKVAFLRKPFPKPLAIAYRLRNMLRNSGNQGI
                     AA"
     CDS             371352..372299
                     /transl_table=11
                     /locus_tag="RL0338"
                     /product="putative glutathione synthetase"
                     /db_xref="EnsemblGenomes-Gn:RL0338"
                     /db_xref="EnsemblGenomes-Tr:CAK05828"
                     /db_xref="GOA:Q1MMH4"
                     /db_xref="InterPro:IPR004215"
                     /db_xref="InterPro:IPR004218"
                     /db_xref="InterPro:IPR006284"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:Q1MMH4"
                     /protein_id="CAK05828.1"
                     /translation="MAKITNVAVQMDHVEGINIAGDSTFAMSLEAQVRGYNLFHYTPD
                     RLSFRDGKLYASVEPMVLRDLKGDHYELGVPERVDLATMDVVLLRQDPPFDMAYITST
                     HLLERIHPKTLVVNDPAWVRNSPEKIFVTEFSDLMPKTLITKDAAEIRRFRDEMGDII
                     LKPLYGNGGAGVFHSTRDDRNLSSLLEMFGQLFREPFIAQQYLPDVRKGDKRIILVDG
                     EFAGAINRVPAEHDSRSNMHVGGRAEATELTPREQEICTRIGPALRERGFLLVGIDVI
                     GDYMTEINVTSPTGIREVKKFGGADIASLLWDAIERKRG"
     CDS             372474..374006
                     /transl_table=11
                     /locus_tag="RL0339"
                     /product="putative Mg2+ chelatase family protein"
                     /db_xref="EnsemblGenomes-Gn:RL0339"
                     /db_xref="EnsemblGenomes-Tr:CAK05829"
                     /db_xref="InterPro:IPR000523"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004482"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR025158"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q1MMH3"
                     /protein_id="CAK05829.1"
                     /translation="MVARVSTVAFQGIEGVPVEVQVMVAPGKVGMQIVGLPDKAVAES
                     RERVQAALHASGLALPAKRVTVNLAPADLPKEGSHFDLPIALALMAALGAIPADALSD
                     FVVVGELNLDGTIAAISGALPAAIGANALGKGLICPAESGAEAAWAGAEVDILAPRSL
                     IALANHFRGTQVLSRPEASIRANAANLPDLAEIKGQESAKRALEVAAAGGHNLLMVGP
                     PGSGKSMLAARLPSILPPLSAAELLEVSMVHSIAGQLSGGKLSDRRPFRTPHHSATMA
                     ALVGGGLRARPGEASLAHHGVLFLDEFPEFTPQALDALRQPLEGGECVIARANHRVSY
                     PAKFQLIAAMNPCRCGMAGEPGHTCARGSRCMSDYQARISGPLMDRIDIRIDVPAVSA
                     ADLIRPMAAESSADVARRVARAREIQQERFESTGAKGIGTNARCSTAMIEKLAEPDAS
                     GLQLLRDAAEKMKFSARGYHRVLKVARTLADLDGKPTVGRIHLAEAISYRIAGERLTA
                     AA"
     CDS             complement(374234..375196)
                     /transl_table=11
                     /gene="cysK"
                     /locus_tag="RL0340"
                     /product="putative cysteine synthase"
                     /db_xref="EnsemblGenomes-Gn:RL0340"
                     /db_xref="EnsemblGenomes-Tr:CAK05830"
                     /db_xref="GOA:Q1MMH2"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005856"
                     /db_xref="InterPro:IPR005859"
                     /db_xref="UniProtKB/TrEMBL:Q1MMH2"
                     /protein_id="CAK05830.1"
                     /translation="MSHKPGRGRIYSSITETIGDTPLVRFDKLAREKGVVANLIGKLE
                     FFNPIASVKDRIGVAMIEGLEAQGKITPGKTVLIEPTSGNTGIALAFAAAAKGYRLIL
                     TMPETMSVERRKMLALLGAELVLTEGPKGMKGAIAKAEELASSLDDAVIPQQFENPDN
                     PEIHRKTTAEEIWNDTDGTVDIVVSGIGTGGTITGVGQVLKSRKPEIKIIAVEPADSP
                     ILSGGNPGPHKIQGIGAGFAPKILDTGIYDEVVTVTNDEAFEQARLVARLEGVPVGIS
                     SGAALTAAIKVGIRPENAGKNIVIIIPSFAERYLSTALFEGLGS"
     CDS             complement(375342..375959)
                     /transl_table=11
                     /locus_tag="RL0341"
                     /product="putative LysE family transport protein"
                     /db_xref="EnsemblGenomes-Gn:RL0341"
                     /db_xref="EnsemblGenomes-Tr:CAK05831"
                     /db_xref="GOA:Q1MMH1"
                     /db_xref="InterPro:IPR001123"
                     /db_xref="UniProtKB/TrEMBL:Q1MMH1"
                     /protein_id="CAK05831.1"
                     /translation="MSLTVLITYAGALFIAAAIPGPGITAIVARALGSNFRETFFMGL
                     GLVLGDMIYLTAVILGLAFVAQTFTEVFITIKIAGVLYLGYIAWKLWTAGLLPQDIAA
                     RKSTNIGLSFLSGLLVTLGNPKTMLFYVALVPTLIDIGNIGLRDYALLLTATFVVLIV
                     VLVPYMLLASRARTMLKQPRALQALNRVASGILAGTAAFIATRAG"
     CDS             376192..376710
                     /transl_table=11
                     /locus_tag="RL0342"
                     /product="putative ferritin-family protein"
                     /note="Similar to Bacillus brevis (Brevibacillus brevis).
                     Dps protein. UniProt:P83695 (149 aa) fasta scores:
                     E()=5.8e-07, 28.767% id in 146 aa, and to Agrobacterium
                     tumefaciens (strain C58/ATCC 33970). hypothetical protein
                     atu4777. UniProt:Q8U6N0 (EMBL:AE009406) (212 aa) fasta
                     scores: E()=2.5e-46, 76.331% id in 169 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0342"
                     /db_xref="EnsemblGenomes-Tr:CAK05832"
                     /db_xref="GOA:Q1MMH0"
                     /db_xref="InterPro:IPR002177"
                     /db_xref="InterPro:IPR008331"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012347"
                     /db_xref="UniProtKB/TrEMBL:Q1MMH0"
                     /protein_id="CAK05832.1"
                     /translation="MSHTPAETRRLSPLKTPSSLSTNATTDISAALTALLADVFTLYV
                     KTKNFHWHMSGPHFRDYHLLLDEQAEQIFAMTDDIAERARKIGGTTLRSIGQIARQQR
                     LLDNDADFVTPEDMLSELREDNVQLVSLLREVHGLCDEHNDVATASLIENWIDEGERR
                     TWFLFETTRPQR"
     CDS             complement(376758..377672)
                     /transl_table=11
                     /locus_tag="RL0343"
                     /product="putative transmembrane protein"
                     /db_xref="EnsemblGenomes-Gn:RL0343"
                     /db_xref="EnsemblGenomes-Tr:CAK05833"
                     /db_xref="GOA:Q1MMG9"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="UniProtKB/TrEMBL:Q1MMG9"
                     /protein_id="CAK05833.1"
                     /translation="MEAIMGSDIRRGTAEMTAAMLISGTIGWFVVMSGQPVSGVVFWR
                     CLFGALTLLVICGALGLLRPGIITLRAFGIAIFGGIAIVLNWLLLFASYSHATISIAT
                     TVYNTQPFMLLVLGALFLGEKITATKLFWLTLAFAGMIAIVEAKPETGGSTSDGYGLG
                     ILMALGAAFFYALAALAAKWLKGTPPHLIALIQVATGMLMLAPMTDFSHPPGDVRSWA
                     ILVTVGVVHTGLMYVLLYGAIQRLPTHLTGALSFIYPIAAILVDRLAFGHALQPMQIL
                     GAAIILLAAAGMNLGWTPRWLRPRALES"
     CDS             377772..378236
                     /transl_table=11
                     /locus_tag="RL0344"
                     /product="putative AsnC family transcriptional regulatory
                     protein"
                     /db_xref="EnsemblGenomes-Gn:RL0344"
                     /db_xref="EnsemblGenomes-Tr:CAK05834"
                     /db_xref="GOA:Q1MMG8"
                     /db_xref="InterPro:IPR000485"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR019885"
                     /db_xref="InterPro:IPR019887"
                     /db_xref="InterPro:IPR019888"
                     /db_xref="UniProtKB/TrEMBL:Q1MMG8"
                     /protein_id="CAK05834.1"
                     /translation="MANDVQSLDEIDQAILEALAGNARISLKELAQQVGLSSPSAAER
                     LRRLEERGVIKAFTIDLDLATIGYPLQAIVRVRPLPGQLHIVERIIQDIPEIIECDKV
                     TGDDCFIARLVIRSMADLDGILDRVAERAETNTAMIKASPVKRRLPPLSRRK"
     CDS             complement(378243..379142)
                     /transl_table=11
                     /locus_tag="RL0345"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0345"
                     /db_xref="EnsemblGenomes-Tr:CAK05835"
                     /db_xref="GOA:Q1MMG7"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q1MMG7"
                     /protein_id="CAK05835.1"
                     /translation="MAQRLDSAGLTFRQDYFGDPAGWAALVCLLRDIFGIDIGPLQQL
                     GGPDPTSMPFGWFDADGGLAANISAFALPFVLNDRIVHAAGLQSGAVRPPWRGRGLYR
                     DVTVKALDWCEKQGFEAVILYTDKPSLYEAYGFRAIPLHRYEGAAPAPSTPAAPARPL
                     LPTNADDLALLHSLLKGRSPVSTSLAVTGNAAMFLINTRLDPDVRISFLEDKQAVIAW
                     KIDETGRFSLLDVVAADMPPLAAILAGLEIAPASVEVLFRPDKLGWEGVPQSLESGTR
                     LMLRGLGDATPDFPAMLSPMAEF"
     CDS             complement(379142..379612)
                     /transl_table=11
                     /gene="dut"
                     /locus_tag="RL0346"
                     /product="putative deoxyuridine 5'triphosphate
                     nucleotidohydrolase"
                     /EC_number="3.6.1.23"
                     /db_xref="EnsemblGenomes-Gn:RL0346"
                     /db_xref="EnsemblGenomes-Tr:CAK05836"
                     /db_xref="GOA:Q1MMG6"
                     /db_xref="InterPro:IPR008180"
                     /db_xref="InterPro:IPR008181"
                     /db_xref="InterPro:IPR029054"
                     /db_xref="InterPro:IPR033704"
                     /db_xref="UniProtKB/Swiss-Prot:Q1MMG6"
                     /protein_id="CAK05836.1"
                     /translation="MTIHHDLSPTLNLIRLANGEGLDLPAYESKGAAGMDLRAAVDEA
                     APLTLLPGKRALVPTGFIFEIPEGFEGQVRPRSGLAFKNGITCLNSPGTVDSDYRGEV
                     KVLLANLGEEAFVISRGMRIAQMVIAPVTQMRVAEITEASETMRGAGGFGSTGV"
     CDS             379704..381287
                     /transl_table=11
                     /gene="prfC"
                     /locus_tag="RL0347"
                     /product="putative peptide chain release factor (RF-3)"
                     /db_xref="EnsemblGenomes-Gn:RL0347"
                     /db_xref="EnsemblGenomes-Tr:CAK05837"
                     /db_xref="GOA:Q1MMG5"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004548"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR031157"
                     /db_xref="InterPro:IPR032090"
                     /db_xref="UniProtKB/TrEMBL:Q1MMG5"
                     /protein_id="CAK05837.1"
                     /translation="MAESLAEAVSRRRTFAIIAHPDAGKTTLTEKLLLFGGAIQLAGE
                     VKAKKDRMQTRSDWMKIERERGISVVTSVMTFEYNDNVFNILDTPGHEDFADDTYRTL
                     TAVDAAVMVIDAAKGIEPRTLKLFEVCRMRDIPIITFINKMDRESRDPFEILDEVEEK
                     LALDTAPITWPIGRSKTFCGSYNIAANTVRGSDTEIEGTPVNGPQSVAGRLPENERQV
                     FVEETELAIEACRPFDRQAFLEGHMTPVFFGSALRNYGVRDLINALGDFAPPPRDQVA
                     DTRTVHATDDKMTAFVFKIQANMDPNHRDRIAFARICSGKLERGMKARLARTGKQLGL
                     TAPQFFFASQRQLADTAYAGDVVGIPNHGTLRIGDTLTEGESLVFQGVPNFSPEILRR
                     VRLEDAMKAKKLKEALQQMAEEGVVQLFSPEDGSPAIVGVVGALQLDVLKERLMAEYG
                     LPVSFEMSRFSVCRWISAEQPADLEKFLTVKRGDIARDLDGDPVFLAQDGFSLRYESE
                     RHPAIKMVAIKEYHAAKAA"
     CDS             complement(381291..382181)
                     /transl_table=11
                     /locus_tag="RL0348"
                     /product="putative LysR family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0348"
                     /db_xref="EnsemblGenomes-Tr:CAK05838"
                     /db_xref="GOA:Q1MMG4"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q1MMG4"
                     /protein_id="CAK05838.1"
                     /translation="MALFNLNDLHLFVQAVDSGSFTAAARHLGIPKSTVSKRVAELEA
                     RLGVRLIQRTSRSFALTELGREFFQHAQASIIEAEMAEGIVRRHLAEPAGSVRLTASV
                     PTAQFTLTEHLPALAVRYPKLRLSVHVTDRFVDIVQEGFDIALRSHRTPLPDSALVQR
                     KLASHPFFILASPDYVSVHGQPRRPEELAQHATIMTSLTEDLWRLYSGGDEVLVALQS
                     VMAADEPYVLMEMAMSGLGITCLPTSVCRKALADGRLVRVLPEWTAGSIETTILMPHR
                     RGQLPAVRAVVDFLAERLAG"
     CDS             382296..383003
                     /transl_table=11
                     /locus_tag="RL0349"
                     /product="putative glutathione-S-transferase"
                     /db_xref="EnsemblGenomes-Gn:RL0349"
                     /db_xref="EnsemblGenomes-Tr:CAK05839"
                     /db_xref="GOA:Q1MMG3"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q1MMG3"
                     /protein_id="CAK05839.1"
                     /translation="MSPILFYGVPEGCSFGSIVALEWSGLPYRLCRVEMPEIVSSEEY
                     KRINMVGETPSLLLEDGRTISESMAILHHIGACTIGSGLGFAQGSADFDRLNQMLAFL
                     NTTFFQAFGPLWYAIEHPLEPEEKQALTAYGIAAVEKAHHRLERLLDGREWLLGNGPS
                     LADAYFVGIARWNDFHKVVDRRQFPGLHRLYERMQQEPAVRFAHAIEHRQEAKSSGGF
                     RGEVDLAEGLGLLKQAA"
     CDS             complement(383049..383435)
                     /transl_table=11
                     /locus_tag="RL0350"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0350"
                     /db_xref="EnsemblGenomes-Tr:CAK05840"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="UniProtKB/TrEMBL:Q1MMG2"
                     /protein_id="CAK05840.1"
                     /translation="MEMIAHNPANGIYAASPDYIHALEVRQSSRLLFVSGTMGLDQQG
                     MAAADLEGQLELIWFNLRAILTSADMTVDNIVRLTSYLSDGVFMEANQNARVRALGGR
                     AVPTTAIIVETLRDDWLVEIEIIAAG"
     CDS             383463..384044
                     /transl_table=11
                     /locus_tag="RL0350A"
                     /product="putative AsnC family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0350A"
                     /db_xref="EnsemblGenomes-Tr:CAK05841"
                     /db_xref="GOA:Q1MMG1"
                     /db_xref="InterPro:IPR000485"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR019887"
                     /db_xref="InterPro:IPR019888"
                     /db_xref="UniProtKB/TrEMBL:Q1MMG1"
                     /protein_id="CAK05841.1"
                     /translation="MKNVSIGDYSSAERGVCGMAKNTDDLRLGRRQQPVIDAFDRRIL
                     AALAADSSQSYARLGEAVGLSAPAVHERVRRLRQSGAIKGVHAALDGAALGKPLLAFV
                     HVEAAGWGKSERLMQVLQFPEVEEMHSVAGDTSVLFKVRTASPQALEAFLAQIHAVPG
                     VTGTRSYIALSTYLERPVQAGVTDSWPDMPLPE"
     CDS             complement(384071..384472)
                     /transl_table=11
                     /locus_tag="RL0351"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:RL0351"
                     /db_xref="EnsemblGenomes-Tr:CAK05842"
                     /db_xref="GOA:Q1MMG0"
                     /db_xref="InterPro:IPR006913"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="UniProtKB/TrEMBL:Q1MMG0"
                     /protein_id="CAK05842.1"
                     /translation="MHITGGCHCGAIRYQAEIDPQRVSICHCTDCQRLTGSAYRITAP
                     ARPESFTLTSGEPRGYAKYGDSGGLSRQFFCPNCGSPLYRTDGEGGAIGIRVGSIDQR
                     QELVPRKQIWCRSALPGVENIETLPRFEGED"
     CDS             complement(384539..386068)
                     /transl_table=11
                     /locus_tag="RL0352"
                     /product="putative exported peptidase"
                     /note="Codons 75 to 240 are similar to codons 75 to 305 of
                     Lycopersicon esculentum (Tomato). wound-inducible
                     carboxypeptidase. UniProt:Q9M513 (EMBL:AF242849) (498 aa)
                     fasta scores: E()=0.00038, 25.568% id in 176 aa, and
                     entire protein is similar to Xanthomonas campestris (pv.
                     campestris). carboxypeptidase-related protein.
                     UniProt:Q8PA00 (EMBL:AE012270) (501 aa) fasta scores:
                     E()=2.1e-56, 35.573% id in 506 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0352"
                     /db_xref="EnsemblGenomes-Tr:CAK05843"
                     /db_xref="GOA:Q1MMF9"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q1MMF9"
                     /protein_id="CAK05843.1"
                     /translation="MRIRTLFLLATFMASLAPALSHAQESNQPRANVQSGARDGVLKL
                     LPPDSVTEHALTIGDRKFAYTATAGTLDLFGQDGAQTGAIFYTAYVARDSGANRPLTF
                     AFNGGPGAASAYLHLGLVGPKVLDFGPDGRDGANAKLVDNPQSWLDFTDLVLIDPIGT
                     GWSRTTKADDANYYNVDADAQSIAKAIALYVAHNNRSTSPKYLLGESYGGFRAAKVAS
                     VLQQSQGIIVAGAVMLSPLIEGQLMFNADQFALGAALELPSLAAAELDRHKAFDEEKQ
                     KEAETFALGDYLTTLAGPPPTGADAAAFYGRIARLTGIPEDIVSRNRGFLGSSFVKHS
                     DAGSGEVMSSYDASFAAPDPYPESDYDRGDDAILDGFTRAYGGAFADYARNELGFRTE
                     MTYSLLDGDISRRWEWGGGRGGGSRFQASATDDIRQLLAANPAFHLLIAHGYSDVVTP
                     YGVSRYVVDHLPPSLAGGRVGLKLYRGGHMFYTRAEQRAAFTADAKAFYATHLAAQPA
                     D"
     CDS             complement(386169..387359)
                     /transl_table=11
                     /locus_tag="RL0353"
                     /product="putative transmembrane transport protein"
                     /db_xref="EnsemblGenomes-Gn:RL0353"
                     /db_xref="EnsemblGenomes-Tr:CAK05844"
                     /db_xref="GOA:Q1MMF8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q1MMF8"
                     /protein_id="CAK05844.1"
                     /translation="MRGAAGRFLLGASLVLIAFNLRPVFSSASALLPEIRSELGLSAL
                     GASLLTTLPVVCLGAFSPLAPRLAQRFGTERTLLGVLLLLALGTGLRGLSSVPLLFIG
                     TALAGACIAVGNVLLPGLVKRDFAGRAALMTGFYTMALCAGAASAAGLTLPIEHALGG
                     SLEGALAVWALPALIVSLLWLPEVLRSGRQARRNGFHVKGLWRDRLAWQVTLFMGLQS
                     ALAYCVFGWLVPILRERGLDGVTAGAIVSLSVMVQAASCLIVPHIAVRGRDQRLINAS
                     LCGVAVTALLGLLFAPLSTVWLWAVLQGIGQGGLIAAAMTTIVLRSRDPDVAAHLSGM
                     AQCVGYLLAAIGPLIVGLIRGWTGSFSWCAALFVALGLGAAINGWKAGRAVEINVHAA
                     EKDG"
     CDS             complement(387458..388135)
                     /transl_table=11
                     /locus_tag="RL0354"
                     /product="putative GntR family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0354"
                     /db_xref="EnsemblGenomes-Tr:CAK05845"
                     /db_xref="GOA:Q1MMF7"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR008920"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q1MMF7"
                     /protein_id="CAK05845.1"
                     /translation="MRALSKTNLADEAIEAIRGDILGKRWAVGEKLPNEASLSAMLSV
                     SRGTVREAVRVLVSQGYLETRQGSGTYVRATSDAGRPLTMARRASLRDQFEARLALDV
                     EAARLTAIRKTPEIVAGLRRLLAERGNYDGGNQAAFIERDLAFHKAVIAASGNRAMIE
                     IYDFFSASIADTIAATLGKDIPEPDMQAHAEIVDAIETGDPDKADAAVRRFMAPVLAA
                     LERMILS"
     CDS             complement(388468..389379)
                     /transl_table=11
                     /locus_tag="RL0355"
                     /product="putative pirin-like protein"
                     /db_xref="EnsemblGenomes-Gn:RL0355"
                     /db_xref="EnsemblGenomes-Tr:CAK05846"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012093"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:Q1MMF6"
                     /protein_id="CAK05846.1"
                     /translation="MSIRPVKHESTATPTMEGAGVKLHRVFGFGDPAMTDPFLMMDDF
                     RNDNPAEYIRGFPWHPHRGIETITYVLAGTVEHGDSLGNSGLLGAGDIQWMTAGSGIM
                     HQEMPKGDFAGRMHGFQLWANLPSSLKMTPPRYQDVKSIDIPIVVDDDGTAVRVICGD
                     FWGKAGPVDGVAAEPIYLDVSVPPGRKKRLPVDTYRNAFAYIFAGSGTFRDASKPFGV
                     RVEKEVDGEELNIRDMSGNRTLVVFDSGDEVTVQAGDQGIRFLLVSGKPIEEPVAWHG
                     PIVMNSREEIMQAMRELQNGTFIKAAH"
     CDS             389586..390449
                     /transl_table=11
                     /locus_tag="RL0356"
                     /product="conserved hypothetical protein"
                     /note="Similar, but truncated at the N-terminus, to
                     Rhizobium meliloti (Sinorhizobium meliloti). hypothetical
                     protein smc01162. UniProt:Q92SL4 (EMBL:SME591783) (271 aa)
                     fasta scores: E()=2.1e-84, 78.039% id in 255 aa"
                     /db_xref="EnsemblGenomes-Gn:RL0356"
                     /db_xref="EnsemblGenomes-Tr:CAK05847"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR026869"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q1MMF5"
                     /protein_id="CAK05847.1"
                     /translation="MSFQHFPPMRRVPEQRAMCRWAAYRGDPLYLEELVSSPAHSLIE
                     QSHCATRAKTATNGDGFGIAWYGDRPEPGRYRDILPAWSDCNLKSLARQIRSPLFLAH
                     VRAATGGGTRRDNCHPFTQGTWSFMHNGQISGFERLRRPMEAMLDDELFNARGGTTDS
                     ELMFLLALQFGLREAPVAAMAEMIGVIEDLAESVIGSILLRFTAAFSDGKALYAIRYA
                     TDRKAPTLYASPVGAGYCLVSEPLNDDVDAWAEIPDGSAVTVGKDGIDVADFRPEKRS
                     AAKPLRVAIPA"
     CDS             complement(390460..391665)
                     /transl_table=11
                     /gene="coaBC"
                     /locus_tag="RL0357"
                     /product="putative coenyzme A biosynthesis bifunctional
                     protein"
                     /EC_number="6.3.2.5"
                     /db_xref="EnsemblGenomes-Gn:RL0357"
                     /db_xref="EnsemblGenomes-Tr:CAK05848"
                     /db_xref="GOA:Q1MMF4"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="InterPro:IPR005252"
                     /db_xref="InterPro:IPR007085"
                     /db_xref="UniProtKB/TrEMBL:Q1MMF4"
                     /protein_id="CAK05848.1"
                     /translation="MALSGKRILLIISGGIAAYKSLDLIRRLRERGASVRPVMTKGAQ
                     EFVTPLAVGALAADHVFLDLFSRQDEQDIGHIRLARECDLVLIAPATADLMAKMANGL
                     ADDLASTVLLATNRPVLAAPAMNPAMWAHPATRRNAAMLRADGIRFVGPMAGEMAESR
                     EAGLGRMAEPLEIVAAAETMLDDGDKPLKGRKAIVTSGPTHEPIDPVRYIANRSSGRQ
                     GHAIAAALAKLGAEVTLVSGPVTIADPVGVNVVHVERAEEMRDAVLAALPADIAVMVA
                     AVADWRVASAADQKLKKHPGESIPTLALTENPDILKTVGHHTMRPKLVIGFAAETQDV
                     EINAKAKLERKGADMIVANDVSPATGIMGGSRNRVKLVRRDGVEQWPDLAKEEVAERL
                     AALIAKQFS"
     CDS             complement(391841..392590)
                     /transl_table=11
                     /locus_tag="RL0358"
                     /product="putative 3-oxoacyl-[acyl-carrier-protein]
                     reductase"
                     /EC_number="1.1.1.100"
                     /db_xref="EnsemblGenomes-Gn:RL0358"
                     /db_xref="EnsemblGenomes-Tr:CAK05849"
                     /db_xref="GOA:Q1MMF3"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MMF3"
                     /protein_id="CAK05849.1"
                     /translation="MSRLQNKTALITGGTSGIGLETARQFIAEGARVVVTGSSTASVE
                     AARAELGGKATVIQADAGNAVGQKAVADSVREAFGTLDILFVNAGVAEFGPLEQWSEA
                     AFDKSVDINVKGPFFLIQSLLPIFSKQAAIVLNTSINAHIGMPNSSVYSLTKGALLTL
                     AKTLSGELIGRGIRVNAVSPGPIATPLYSKLGASEAQSKAMAEQIQAQIPVGRFGNPS
                     EVAKTIVFLASDEAAYIVGSELIIDGGMSNL"
     CDS             complement(392726..393490)
                     /transl_table=11
                     /locus_tag="RL0359"
                     /product="putative short-chain dehydrogenase/reductase"
                     /db_xref="EnsemblGenomes-Gn:RL0359"
                     /db_xref="EnsemblGenomes-Tr:CAK05850"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q1MMF2"
                     /protein_id="CAK05850.1"
                     /translation="MNRLNNKVAIVTGASSGIGRATAKLFAAEGAKVVVGARRQGELD
                     SLVAEIKAEGGDAIAIAGDVRSEDYHKALVAAAVTKYGKLDIAFNNAGTLGEAGASTG
                     VSEAGFSEALAINLTASFLAAKHQIGAMVENGGGSVIFTSTFVGYSFAFPGVAAYAAS
                     KSGLIGLTQALAAEFGQQGVRVNAILPGAVDTDMYRDMNDTPEKQAFVTNLHALKRVA
                     TPEELARSVLYLASDDASFVTGTASLVDGGASITRS"
     CDS             393617..394522
                     /transl_table=11
                     /locus_tag="RL0360"
                     /product="putative LysR family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0360"
                     /db_xref="EnsemblGenomes-Tr:CAK05851"
                     /db_xref="GOA:Q1MMF1"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q1MMF1"
                     /protein_id="CAK05851.1"
                     /translation="MIRIEGIAAFVAVVEAGSVSEAARRLRLSKSVVSERLAELEKSL
                     GGMLLHRTTRKLTLTEDGTVFLGRAARIVREIEEAAADMAERRGTLSGPIRIAAPVTF
                     GRMHLGPALYPFLAEHPEIELTLDIDDRRVDAASDGYDAIIRNGPIADSRLVAWKLAH
                     SRRLLCASPDYLARQGIPSSLADLNSHRGIFYTNRGVADWRFQTFDGAIVVRAKLALG
                     INNGDMLRDAAIAGLGIALLPAFIAGPAIREGRLAEIDVGHKPEAEFIYMAHPEGRNP
                     SAKLRAIADHLKKSFGDPPYWDPVG"
     CDS             complement(394524..395408)
                     /transl_table=11
                     /locus_tag="RL0361"
                     /product="putative LysR family transcriptional regulator"
                     /db_xref="EnsemblGenomes-Gn:RL0361"
                     /db_xref="EnsemblGenomes-Tr:CAK05852"
                     /db_xref="GOA:Q1MMF0"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q1MMF0"
                     /protein_id="CAK05852.1"
                     /translation="MAMELRHLRYFLAVAEEGNFTRAAGKLGIGQPPLSQQIRDLERE
                     VGAALFHRVPHGAELTAAGTAFLGEAKASLAAAEKAKLAAQSANRGETGRLSLGFTAS
                     SAFNPVVSTTIRRFRACWPEVQLSLTEMNTLALMQKLERGELDATFMRPSLDDPAGIR
                     LRRLPDEPMVIALPAGHPLARRSKLPLAALADEPFILFPRLVGLSLYDDVVLACRKAG
                     FELTVAQEAPQISSVVNLVAADLGVSIVPASISQIKLEGVAYRPIEGPPAVARLALAI
                     LKTHRSPVTENLISLLST"
     CDS             395494..396744
                     /transl_table=11
                     /locus_tag="RL0362"
                     /product="putative MFS family transmembrane transport
                     protein"
                     /db_xref="EnsemblGenomes-Gn:RL0362"
                     /db_xref="EnsemblGenomes-Tr:CAK05853"
                     /db_xref="GOA:Q1MME9"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q1MME9"
                     /protein_id="CAK05853.1"
                     /translation="MPTSVHAVKTAETAAIPGQKQYLTRGTGAYHRASLALFLSGFST
                     FSLLYCVQPLLPIFSQQFSVSPAESSLSLSLSTGSLAVAIVCAAAVSEGLGRRSLMSI
                     SLVGAALLTIATAFAPNWHLLLVIRALQGLVLGGVPAVAMAYLAEEIDPRGLGATMGL
                     YVGGTAFGGMSGRVLTGIFAEYLTWRPALFIIGAIGLAAAIGFIALLPPSRNFVRRPG