LOCUS       AL136863                3166 bp    mRNA    linear   HTC 15-OCT-2008
DEFINITION  Homo sapiens mRNA; cDNA DKFZp434F054 (from clone DKFZp434F054).
ACCESSION   AL136863
VERSION     AL136863.1
KEYWORDS    HTC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3166)
  AUTHORS   Wambutt R., Heubner D., Mewes H.W., Weil B., Amid C., Osanger A.,
            Fobo G., Han M., Wiemann S.
  CONSRTM   The German cDNA Consortium
  JOURNAL   Submitted (22-SEP-2004) to the INSDC. MIPS, Ingolstaedter
            Landstr.1, D-85764 Neuherberg, GERMANY
COMMENT     Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
            Research
            Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
            sequenced by Agowa (Berlin/Germany) within the cDNA sequencing
            consortium
            of the German Genome Project.
            This clone (DKFZp434F054) is available at the RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
            Please contact RZPD for ordering:
            http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp434F054
            Further information about the clone and the sequencing project is
            available at http://mips.gsf.de/projects/cdna/
FEATURES             Location/Qualifiers
     source          1..3166
                     /db_xref="H-InvDB:HIT000025459"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /dev_stage="adult"
                     /clone_lib="434 (synonym: htes3). Vector pSport1; host
                     DH10B; sites NotI + SalI"
                     /clone="DKFZp434F054"
                     /tissue_type="testis"
                     /note="hypothetical protein"
                     /db_xref="taxon:9606"
     CDS             762..3134
                     /codon_start=1
                     /gene="DKFZp434F054"
                     /product="hypothetical protein"
                     /db_xref="GOA:Q96S15"
                     /db_xref="H-InvDB:HIT000025459.17"
                     /db_xref="HGNC:HGNC:20852"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="InterPro:IPR037590"
                     /db_xref="UniProtKB/Swiss-Prot:Q96S15"
                     /protein_id="CAB66797.1"
                     /translation="MEKMSRVTTALGGSVLTGRTMHCHLDAPANAISVCRDAAQVVVA
                     GRSIFKIYAIEEEQFVEKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTW
                     NLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVSTFS
                     GQSESVRDVQFSIRDYFTFASTFENGNVQLWDIRRPDRCERMFTAHNGPVFCCDWHPE
                     DRGWLATGGRDKMVKVWDMTTHRAKEMHCVQTIASVARVKWRPECRHHLATCSMMVDH
                     NIYVWDVRRPFVPAAMFEEHRDVTTGIAWRHPHDPSFLLSGSKDSSLCQHLFRDASQP
                     VERANPEGLCYGLFGDLAFAAKESLVAAESGRKPYTGDRRHPIFFKRKLDPAEPFAGL
                     ASSALSVFETEPGGGGMRWFVDTAERYALAGRPLAELCDHNAKVARELGRNQVAQTWT
                     MLRIIYCSPGLVPTANLNHSVGKGGSCGLPLMNSFNLKDMAPGLGSETRLDRSKGDAR
                     SDTVLLDSSATLITNEDNEETEGSDVPADYLLGDVEGEEDELYLLDPEHAHPEDPECV
                     LPQEAFPLRHEIVDTPPGPEHLQDKADSPHVSGSEADVASLAPVDSSFSLLSVSHALY
                     DSRLPPDFFGVLVRDMLHFYAEQGDVQMAVSVLIVLGERVRKDIDEQTQEHWYTSYID
                     LLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCSHCKRPMSSRGWVCDRCHRCA
                     SMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCPAGCGHLCEYS"
BASE COUNT          566 a         1061 c          967 g          572 t
ORIGIN      
        1 ggcggcttcc ggcgcggcgg ttccggacaa ccgtgcgctt ttagtaaaag attggggttc
       61 gcgcggggga gaagggctgc cccgggccct ctggttctcg tcccgcagcg tccgctcccc
      121 cgcgccactg cgccgctccc aggaaccctg tactccgggg tcgccggctt ctctcctgcc
      181 tccggtcccg ccagacacct cgagctcctt aagtagctcg gtccttgacg tccctctggg
      241 cccttcccgc gtctatcgcc tgagtccccg ggcccctcta gccctctgtt ccctcccctc
      301 ttttgttcct ccctagagcc ccgccgccct cagggctgac agtgtggacg gcgggagtct
      361 cctcgctccc ctgctgggat tgactgaccg agcgtttagt gactgcccag atctggctga
      421 tgggggtacc gagaggtggc ctgggccggg aatgtccagc tagagtcttc cgtggaagtc
      481 agacatgaaa ctgacaggcc taagggaagc taggaagtcc cctcaccgct cagccagggt
      541 gatgggctgg actgacagac tccagtgaat ttgagcttgc ctgtcaggct gattggctga
      601 tagacagccc tggattggct cactaagact gaccagcccg ggaccaagca gttctggggt
      661 cccaacctgg gtggaaggtc tgaactgatg acccacccag gctgaccagg ccagcccacc
      721 tcactgacct cctgacccct gacctcatca cctgtgcagc catggagaag atgtcccgtg
      781 tgaccacagc cctgggtggc agcgtgctga caggccgcac catgcactgc cacctggatg
      841 ctcccgccaa tgccatcagt gtgtgccgcg acgcagccca ggtggtcgtg gcaggccgta
      901 gcatcttcaa gatctatgcc atcgaggagg aacagttcgt ggaaaagctg aacctgcgtg
      961 tggggcgcaa gccttcgctt aacctgagct gtgctgacgt ggtctggcac cagatggatg
     1021 agaacctgct ggccacagca gccaccaatg gcgtggtggt cacgtggaac ctgggccggc
     1081 catcccgcaa caagcaggac cagctgttca cagaacacaa gcgcacggta aacaaagtct
     1141 gcttccaccc caccgaagcc cacgtgctgc tcagtggctc ccaggatggc ttcatgaagt
     1201 gctttgacct ccgcagaaag gactctgtca gcaccttctc gggccagtcg gagagcgtgc
     1261 gggacgtgca gttcagtatc cgggactact tcaccttcgc ctccaccttt gagaacggca
     1321 atgtgcagct ctgggacatc cggcgtcccg accggtgcga gaggatgttc acagcccaca
     1381 acggacccgt cttctgctgc gactggcacc ccgaggacag gggctggttg gccactggag
     1441 ggcgcgacaa gatggtgaag gtctgggaca tgaccacgca ccgtgccaag gagatgcact
     1501 gtgtgcagac catcgcctcg gtggcccgtg tgaagtggcg gccagagtgc cgccaccacc
     1561 tggccacgtg ctccatgatg gtggaccaca acatctatgt ttgggacgtg cgccggccct
     1621 tcgtgccagc tgccatgttt gaggaacacc gagacgtcac cacgggaatt gcctggcgcc
     1681 acccccacga cccctccttc ctgctgtctg gctccaagga cagctcgctg tgccagcacc
     1741 tgttccgcga cgccagccag cccgtcgagc gcgccaaccc tgagggcctc tgctacggcc
     1801 tcttcgggga cctggccttc gccgccaagg agagcctcgt ggctgccgag tcggggcgca
     1861 agccctacac tggcgaccgg cgccacccca tcttctttaa gcgcaagctg gaccctgccg
     1921 agcccttcgc aggcctcgcc tccagtgccc tcagtgtctt tgagacggag ccaggtggcg
     1981 gcggcatgcg ctggtttgtg gacacagctg agcgttatgc gctggctggc cggccactgg
     2041 ccgagctctg tgaccacaac gcaaaggtgg ctcgagagct tggccgcaac caggtggcgc
     2101 aaacgtggac catgctgcgg atcatctact gcagccctgg cctagtgccc actgcaaacc
     2161 tcaaccacag tgtgggcaag ggtggctcct gtggcctccc gctcatgaac agtttcaacc
     2221 tgaaggatat ggccccaggg ttgggcagtg agacgcggct ggaccgcagc aaaggagatg
     2281 cacggagcga cacagttctg ctcgactcct cggccacact catcaccaat gaggataacg
     2341 aggaaaccga gggcagcgac gtacctgccg actacctgct gggtgacgtg gaaggtgagg
     2401 aggacgagct gtacctgctg gatccggaac acgcgcaccc cgaggaccct gagtgcgtgc
     2461 tgccgcagga ggcctttccg ctgcgccacg agatcgtgga cacgcctccc ggacccgagc
     2521 acctgcagga caaggccgac tccccgcacg tgagcggcag cgaggcggat gtggcctccc
     2581 tggcccccgt ggactcctcc ttctcgctcc tgtctgtctc acacgcgctc tacgacagcc
     2641 gcctgccgcc cgacttcttc ggcgtgctgg tgcgcgacat gctgcacttc tacgctgagc
     2701 agggcgacgt gcagatggct gtgtctgtgc tcatcgtcct gggtgaacgg gtgcgcaagg
     2761 acatcgacga gcagacccag gagcactggt acacttccta catcgacctg ctgcagcgct
     2821 tccgcctctg gaacgtgtcc aacgaggtgg tcaagctgag caccagccgc gccgtcagct
     2881 gcctcaacca ggcctccacc accctgcacg tcaactgcag ccactgcaag cggcccatga
     2941 gcagccgggg ctgggtctgc gacaggtgcc accgctgcgc cagcatgtgt gccgtctgcc
     3001 accacgtagt caagggtctc ttcgtgtggt gccagggctg cagccacggc ggccacctgc
     3061 agcacatcat gaagtggctg gaaggcagct cccactgtcc cgcaggctgc ggccacctct
     3121 gcgagtactc ctgacggggc atctgctggg cttgcccggg cggccg
//