LOCUS       AL136750                1503 bp    mRNA    linear   HTC 15-OCT-2008
DEFINITION  Homo sapiens mRNA; cDNA DKFZp434G0514 (from clone DKFZp434G0514).
ACCESSION   AL136750
VERSION     AL136750.1
KEYWORDS    HTC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1503)
  AUTHORS   Koehrer K., Beyer A., Mewes H.W., Weil B., Amid C., Osanger A.,
            Fobo G., Han M., Wiemann S.
  CONSRTM   The German cDNA Consortium
  JOURNAL   Submitted (22-SEP-2004) to the INSDC. MIPS, Ingolstaedter
            Landstr.1, D-85764 Neuherberg, GERMANY
COMMENT     Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
            Research
            Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
            sequenced by BMFZ (Biomedical Research Center at the
            Heinrich-Heine-University, Duesseldorf/Germany) within the cDNA
            sequencing consortium of the German Genome Project.
            This clone (DKFZp434G0514) is available at the RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
            Please contact RZPD for ordering:
            http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp434G0514
            Further information about the clone and the sequencing project is
            available at http://mips.gsf.de/projects/cdna/
FEATURES             Location/Qualifiers
     source          1..1503
                     /db_xref="H-InvDB:HIT000025346"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /dev_stage="adult"
                     /clone_lib="434 (synonym: htes3). Vector pSport1; host
                     DH10B; sites NotI + SalI"
                     /clone="DKFZp434G0514"
                     /tissue_type="testis"
                     /note="hypothetical protein"
                     /db_xref="taxon:9606"
     CDS             144..1283
                     /codon_start=1
                     /gene="DKFZp434G0514"
                     /product="hypothetical protein"
                     /db_xref="GOA:Q9NX58"
                     /db_xref="H-InvDB:HIT000025346.19"
                     /db_xref="HGNC:HGNC:26021"
                     /db_xref="InterPro:IPR014898"
                     /db_xref="UniProtKB/Swiss-Prot:Q9NX58"
                     /protein_id="CAB66684.1"
                     /translation="MVFFTCNACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDD
                     YKNHVKCISEDQKYGGKGYEGKTHKGDIKQQAWIQKISELIKRPNVSPKVRELLEQIS
                     AFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEASNSEPVNKEQDQRPLHPVAN
                     PHAEISTKVPASKVKDAVEQQGEVKKNKRERKEERQKKRKREKKELKLENHQENSRNQ
                     KPKKRKKGQEADLEAGGEEVPEANGSAGKRSKKKKQRKDSASEEEARVGAGKRKRRHS
                     EVETDSKKKKMKLPEHPEGGEPEDDEAPAKGKFNWKGTIKAILKQAPDNEITIKKLRK
                     KVLAQYYTVTDEHHRSEEELLVIFNKKISKNPTFKLLKDKVKLVK"
BASE COUNT          572 a          259 c          353 g          319 t
ORIGIN      
        1 cccagaggtc cgacctggga ggctggggct cagagagcaa tgtttgctgt cttccattgg
       61 agtgactgaa tttctacatg acggcttttt gacaagactt aaaacctgtc ttggatagag
      121 aatatttagc catttaccta aaaatggtat tttttacatg caatgcatgt ggtgaatcag
      181 tgaagaaaat acaagtggaa aagcatgtgt ctgtttgcag aaactgtgaa tgcctttctt
      241 gcattgactg cggtaaagat ttctggggcg atgactataa aaaccacgtg aaatgcataa
      301 gtgaagatca gaagtatggt ggcaaaggct atgaaggtaa aacccacaaa ggcgacatca
      361 aacagcaggc gtggattcag aaaattagtg aattaataaa gagacccaat gtcagcccca
      421 aagtgagaga acttttagag caaattagtg cttttgacaa cgttcccagg aaaaaggcaa
      481 aatttcagaa ttggatgaag aacagtttaa aagttcataa tgaatccatt ctggaccagg
      541 tgtggaatat cttttctgaa gcttccaaca gcgaaccagt caataaggaa caggatcaac
      601 ggccactcca cccagtggca aatccacatg cagaaatctc caccaaggtt ccagcctcca
      661 aagtgaaaga cgccgtggaa cagcaagggg aggtgaagaa gaataaaaga gaaagaaagg
      721 aagaacggca gaagaaaagg aaaagagaaa agaaagaact aaagttagaa aaccaccagg
      781 aaaactcaag gaatcagaag cctaagaagc gcaaaaaggg acaggaggct gaccttgagg
      841 ctggtgggga ggaagtccct gaggccaatg gctctgcagg gaagaggagc aagaagaaga
      901 agcagcgcaa ggacagcgcc agtgaggaag aggcacgcgt gggcgcaggg aagaggaagc
      961 ggaggcactc ggaagttgaa acagattcta agaagaaaaa gatgaagctc ccagagcatc
     1021 ctgagggcgg agaaccagaa gacgatgagg ctcctgcaaa aggtaaattc aactggaagg
     1081 gaactattaa agcaattctg aaacaggccc cagacaatga aataaccatc aaaaagctaa
     1141 ggaaaaaggt tttagctcag tactacacag tgacagatga gcatcacaga tccgaagagg
     1201 aactcctggt catctttaac aagaaaatca gcaagaaccc tacctttaag ttattaaagg
     1261 acaaagtcaa gcttgtgaaa tgaacatttg tgtatttaaa aattgaatcc attctgctga
     1321 cttcttcctt tcactgctgt ttataaaatg tgtaatgaat tctaacaact caaattttgc
     1381 tttttgaagc tgtattttta agttaagaaa atatattttt ggtataactt ttatgagaaa
     1441 aataaaatat attctggtcc aaacttcaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     1501 aaa
//