LOCUS       AL136712                7645 bp    mRNA    linear   HTC 15-OCT-2008
DEFINITION  Homo sapiens mRNA; cDNA DKFZp566K013 (from clone DKFZp566K013).
ACCESSION   AL136712
VERSION     AL136712.1
KEYWORDS    HTC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 7645)
  AUTHORS   Koehrer K., Beyer A., Mewes H.W., Weil B., Amid C., Osanger A.,
            Fobo G., Han M., Wiemann S.
  CONSRTM   The German cDNA Consortium
  JOURNAL   Submitted (22-SEP-2004) to the INSDC. MIPS, Ingolstaedter
            Landstr.1, D-85764 Neuherberg, GERMANY
COMMENT     Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
            Research
            Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
            sequenced by BMFZ (Biomedical Research Center at the
            Heinrich-Heine-University, Duesseldorf/Germany) within the cDNA
            sequencing consortium of the German Genome Project.
            This clone (DKFZp566K013) is available at the RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
            Please contact RZPD for ordering:
            http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp566K013
            Further information about the clone and the sequencing project is
            available at http://mips.gsf.de/projects/cdna/
FEATURES             Location/Qualifiers
     source          1..7645
                     /db_xref="H-InvDB:HIT000025308"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /dev_stage="fetal"
                     /clone_lib="566 (synonym: hfkd2). Vector pAMP1; host
                     Xl-2blue; sites NotI + SalI"
                     /clone="DKFZp566K013"
                     /tissue_type="kidney"
                     /note="testicular dynamin 3"
                     /db_xref="taxon:9606"
     CDS             158..2749
                     /codon_start=1
                     /gene="DKFZp566K013"
                     /product="hypothetical protein"
                     /db_xref="GOA:Q9UQ16"
                     /db_xref="H-InvDB:HIT000025308.18"
                     /db_xref="HGNC:HGNC:29125"
                     /db_xref="InterPro:IPR000375"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR003130"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027743"
                     /db_xref="InterPro:IPR030381"
                     /db_xref="PDB:3L43"
                     /db_xref="PDB:5A3F"
                     /db_xref="UniProtKB/Swiss-Prot:Q9UQ16"
                     /protein_id="CAB66647.1"
                     /translation="MGNREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGK
                     SSVLENFVGRDFLPRGSGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRLEIE
                     AETDRVTGMNKGISSIPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMI
                     MQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARD
                     VLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPH
                     LQKVLNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAYKNFKPEDPSRKTKALLQMVQ
                     QFAVDFEKRIEGSGDQVDTLELSGGAKINRIFHERFPFEIVKMEFNEKELRREISYAI
                     KNIHGIRTGLFTPDMAFEATVKKQIVKLKGPSLKSVDLVIQELINTVKKCTKKLANFP
                     RLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDFIGFANAQQRSSQVHK
                     KTTVGNQVIRKGWLTISNIGIMKGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNL
                     KVRDVEKSFMSSKHIFALFNTEQRNVYKDYRFLELACDSQEDVDSWKASLLRAGVYPD
                     KSVGNNKAENDENGQAENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHL
                     MINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALGIIGDIS
                     TATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRPTLSAPLARPTSGRGPAPAIPSPGP
                     HSGAPPVPFRPGPLPPFPSSSDSFGAPPQVPSRPTRAPPRVPSRRPPPSPTRPTIIRP
                     LESSLLD"
BASE COUNT         2329 a         1474 c         1532 g         2310 t
ORIGIN      
        1 agccaagcgg cgggctggcg gcgggctccg acgtctgcgc caggacctgg ctggctgagc
       61 ccggcgcagc agcagcagcc agggcagcgc ggcccctact ccctgtcagg tcgtagaggc
      121 gagcagggac cagctggtcg ccggcccctc gggcaagatg gggaaccggg agatggagga
      181 gctgatcccg ctggtgaacc gtctgcagga cgcgttttcg gcgctgggac agagctgcct
      241 gctggagctg ccgcagatcg ccgtggtggg cggccagagc gccggcaaga gctcggtgct
      301 cgagaacttc gtgggcaggg actttctccc tcgagggtcg ggcattgtaa caagacgacc
      361 tcttgtgctg cagcttgtta cttctaaagc agaatatgcc gagtttctac attgcaaagg
      421 aaagaaattt acagattttg atgaagttcg ccttgagatt gaagcagaaa cagatcgcgt
      481 gactggaatg aataaaggca tttcctccat acccattaat ttacgagtct attccccaca
      541 cgtgttaaat ctaaccctta ttgatctacc tggaataact aaagtgcctg tgggagatca
      601 gccaccagat atcgagtatc agatcagaga aatgattatg cagttcatca cgagggagaa
      661 ctgtctgatt ttagctgtta ctccagccaa cactgatctt gcaaactcag atgcgctgaa
      721 gctagctaaa gaagttgatc ctcaaggtct gagaaccatt ggagttatca ccaaactgga
      781 ccttatggat gaaggaacgg atgccaggga tgttctagag aacaaactgt tgcctcttcg
      841 caggggttac gtgggggtgg taaacagaag ccagaaggac atagatggga agaaggacat
      901 aaaggcagcc atgctggcag agaggaagtt tttcctttcc cacccggctt acagacatat
      961 cgctgaccga atgggaaccc cacacctgca gaaggtcctt aatcagcaac ttaccaacca
     1021 cattcgggat accctaccaa acttcaggaa caaactacag ggacagttgc tctccataga
     1081 acatgaagta gaagcctaca aaaatttcaa accagaagac ccatcaagga agaccaaagc
     1141 attgctgcag atggttcagc aatttgctgt ggactttgag aagagaattg aagggtcagg
     1201 ggatcaagta gataccctgg aactctcagg tggtgctaaa atcaatcgta tttttcatga
     1261 acgctttcct tttgagatag taaagatgga gttcaatgag aaagaattgc gaagagaaat
     1321 aagctatgca atcaaaaaca tacatggtat caggacaggg ttgtttactc cagacatggc
     1381 atttgaagcg acagtcaaga aacagattgt aaagttgaaa gggccttcct tgaagagtgt
     1441 ggatctggta atacaagaat taatcaacac tgtgaagaag tgtaccaaaa aactggcaaa
     1501 cttccccaga ctctgcgagg aaacggaaag gattgttgct aaccacattc gtgagcgaga
     1561 agggaagaca aaggaccagg tattgctatt gattgacatt caagtctctt acatcaacac
     1621 caaccatgaa gacttcattg gcttcgcaaa tgctcagcag aggagcagtc aggttcacaa
     1681 gaaaaccaca gttggaaatc aggtgattcg caaggggtgg ctcaccatca gcaacattgg
     1741 catcatgaaa ggcggctcga agggatactg gttcgtcctt actgcggaaa gcttgtcctg
     1801 gtataaagat gatgaggaaa aagaaaagaa gtacatgctt cccttggaca acctgaaagt
     1861 tcgggatgtg gaaaagagct ttatgtctag caagcacatc tttgcactct ttaatacaga
     1921 gcaaaggaat gtatacaaag actatcgctt ccttgagctg gcatgtgatt cccaggagga
     1981 tgtcgacagc tggaaggcat ctctactaag agctggggtc tatcctgaca aatctgtagg
     2041 gaacaacaaa gctgaaaatg atgagaatgg acaagcagaa aacttttcca tggacccaca
     2101 attggagagg caagtggaga ccattcgcaa cctcgtagac tcctacatgt ccattatcaa
     2161 caaatgtatc cgagatctaa ttccaaaaac aataatgcac cttatgatca ataacgttaa
     2221 agatttcata aattccgagc tcctagcaca gttgtattct tcagaggacc aaaataccct
     2281 gatggaggaa tctgctgagc aggctcagcg ccgggatgag atgcttcgaa tgtatcaagc
     2341 actgaaagaa gcccttggga taattgggga catcagcacg gccaccgtgt ccactccggc
     2401 accccctcca gtggatgact cctggataca gcactctcgc aggtcacctc ctccaagccc
     2461 cacaacccaa aggaggccaa cactaagtgc tcccctcgca aggcccacat ccggccgagg
     2521 accagctcct gccattccct ctcctggccc ccactctggg gctcctccag tcccattccg
     2581 tccaggccca ttacctcctt tccccagcag cagtgactcc ttcggagccc ctccacaagt
     2641 tccatctagg cctacgaggg ccccgcccag ggtcccaagc cggagaccac ccccatcacc
     2701 aactcgtccc actataatcc gcccactaga atcctccctg ttagactaaa cgaagtgtct
     2761 ggcatggcaa ttaatcacta atgaattatg cgaaagcaac atatttgata accgttgcag
     2821 taaatcatga gtagtcgcat gtgtggacat cagtaggcaa gtaaccagtt ttactaatgc
     2881 attcatcgct catcttcatt gctcatggta tgtcaaacct ttggggtttg actcagaaac
     2941 tgctaacctt ttagaggctt tatatgttgt actgaccaag gtaggtttgt atagcagccc
     3001 tatactttgg ggatcatttg cctaccatga catatatttg aaattgcttt ggacaagttt
     3061 tctaggctat ctaccaggta gctcattaaa cgtaattctt cagatatgag atagtgggct
     3121 tagacctaag ccatacatat ttcttttccc acattctgtt taggatgaca gtaattctgt
     3181 tgtctaccat taatgctact acctactcca taattgccta tttagctcct cttttcttcc
     3241 tttttatttc ataagactgc taggaagtga ttttttaaaa ttaggactcc ttaagaataa
     3301 acttttccag aagcacgagg tagtttgcaa aggaaaagtc tgcactgttt gctctaaaga
     3361 gcttctcctc attccaatgt gttttgcttc atgctagaag catatgcaac agtgaataaa
     3421 agcttctttt tttgttaatc agtcaataaa tttggctaat tagtttcaga gttcaaggaa
     3481 gaagcaaaat atcacatctc tagaagtgtt ggaaaaaata taatttcttt ctttacttat
     3541 attcacctca tggtaggtta tattgaaggc tgacatggag aatgtttact tttctatttg
     3601 gcatagctaa ctacactttg atactaactc cagtcttact attattattt tggttggaaa
     3661 aaaaattcac tctttacgtg ctaatttgta atcttgtttt gtaagaattt atcctaccct
     3721 tgaaacaggc tcagtgtaac tgtatatcca ttctaggctt tcttaataaa tcttgaggct
     3781 atgggataat cacatttaaa gaatggttcc tgaaatgaag tcagtagaaa tggcatggga
     3841 taagagcaga gctcacactt ttacagttgc agtatttcaa agtccctatc caggtcactc
     3901 cagaaaaggg tattgaaacg ttgaaatcta aagcaaattt gcaatttctt aagatttcta
     3961 aaatttacca gaacagttta gcctgggggt taatagttaa gtcttgaggc taagttttgg
     4021 actaccaagg accagatgat tcacatgtag gaaacagcca gaagccaact ggaattttgt
     4081 gtgctaactg ttcccagaca gcagagcaag tattcactga gtaggggtgt cccatgacac
     4141 tatttcatat tctacagaag taaatcaggt ttcaccaact gaaatgtctc cctttgaaag
     4201 tagcaaacat gatttgtatg ttaacttaac tttaatttcc tgtgtagttt acacccagag
     4261 cagatactca taaagtataa agtaaaaact tttaaccatt attaaacaga gaacttgcca
     4321 tgttgagtgc cattgtattg aacttattct aaaggcttat gctaacccat ttataattgg
     4381 taaaaatcag aaaatacaag atttacataa aggtcatttc aacttttaag gttaccagtg
     4441 attgtataaa aacatcacaa tcctaaatcc tctcgtatct caccccaaac cccaaactgg
     4501 gggaaaaaaa gttaactctt tgtgaatgga accaatgtgc aagatacata ctgcattttt
     4561 aaaatagtgt ctcagctaaa tggaaaactg ttaagcaaac atccatagta aaacaaataa
     4621 tcttcagtga gatcttttta taaaacttct tgtttttagg attccctttg cttcttcctt
     4681 tgaattctct aaaataggca gctaacggat tatatacttc agggtttggc tttgtgctaa
     4741 atgtggtttt gtgttttgct gtatttcaaa attttccttc tgttaaagga aaatattgtg
     4801 aataaccact ggggtgttct tagatcagca caaaccatgt caaaaaaaat tggagatttt
     4861 tttccaattt tccttccact gatcttaggc agtaataaac aatggcattt gtcatctttg
     4921 gcacttgctt ttagattata gtcccacagt tgcactgccc caattgtcta cctttgtggg
     4981 tacatttttg ttctttactc ctaagttatt tctcatagaa cccagcctac tctagaattt
     5041 cagcagtgac attggagaat atttttaatt tgctgcagta ctatgtcata ttattagtat
     5101 gaatctcatt tcccaaaggg tttgtattct gctaaaagga gatgccaatg ttgaatgaag
     5161 tctgaaactc tagtatgtgc atagtttgac gtgcagcatg cacaccaggc cttaagatgg
     5221 gaatgtagct taatgatttt ctgtttccca taccatttct aatcttttgt gtaattttct
     5281 cttaactgat tgctctgata ttgtaaacac aatagatgta gctctatcat gtctagcata
     5341 atttaaaaaa tcagtgtttt taggatttgg gaaaataaac tgtaaatgtt tatttgatag
     5401 gtaaatatag ttttattgtc acatgctaaa tattgcatgc atattgacta attggaataa
     5461 ccatttactc aattatggac agcttattga aatagtattg atttagaaaa agtatattgc
     5521 atttctaaaa aacatctacc aaggttactc gtctgaatat tgcttttagc cgtgttttat
     5581 aacatagacg agcagtaggg tctgtttatt agcaaatttc ctatttgttc caatacaaac
     5641 tcactttatt ctaaagtata ttaatgaaac cagttcctgt gatgtaactg taagccttct
     5701 cgacttagac ttaaaaagtg gtcacataga ttaattttgt gactttttag tatagactgt
     5761 agccataatt ctcaaatatg aaatgggacc taataccagt atgtgataaa tgttgatgtt
     5821 ttctgtgtac aaacacattt tctatgcatg tgtctctgtg tatatggcat atacctagta
     5881 agtatgtttc tgtaagtatg tgtattttat gtccatttga gtaggtaggt aggttttaaa
     5941 aatactagtt aaaatgccac aagcatgagt gtgattgtat gtgcactgtg tgtatatata
     6001 taaatatatg tatatgtatg gttgtaaata tctatatata catgtactta gtatgtgtgg
     6061 tatcaggata ttttttaaac tgtgataata caacagatag ctttgaatga tctgccataa
     6121 catgtggtaa caatagttca tttctcataa catatatgag gtatacaaaa ttttctaact
     6181 ccagattgta gtcattttga gaggtacaaa gctcataatt accatgacaa catggtaatg
     6241 tccatagaca tttgtatctg aatccacaag aagatctgaa tctaagaagg aattaccttt
     6301 gacaatattt ttcggtaaga agtaaaacct ctggagacct atctttaaga tctctaattg
     6361 gaattataaa ttatttttgg attgctgagc tgaatcttaa aaagccaagt tgatatacat
     6421 agtcattttt cctctatggt agaagtaaaa aaaaaaaaaa aggacatagc aacattaaag
     6481 tagtggattt ttctgagtaa atttgctgaa aatataagag agaagctatc taataccttg
     6541 gaggtaggtc atccactttt tcaggtaaac atttttcatt tggcaaatgg cataattatt
     6601 tgaaagtgac aggaatctcc tcagaatgaa gaataaagcc taataggtct ctaactgttg
     6661 aactcatgaa agaagatagt gtatgagact taaaccatga gttttgtatc atttcaatta
     6721 gaagactact agctgtgagc tcagagttta atgtaaatga atctagatga ttttgaagaa
     6781 atgattattc gttcaccaga tcactcattg tacattctaa aaagctcaaa tgagtcttct
     6841 agatactctt actcatcctg tctggttgct atgtttaaaa ttatgtggtg ctgtgtaggt
     6901 gaaactttaa gaatattttt gaagcatatg taatatatgc actgctattt gtgtgtgtgt
     6961 gtgtgtgtct ttgtatatat gtaagaatgt gtgtatgtgt gagagcaaga gagaggaaac
     7021 tcaaagagga gtgtttgtct taagacctgt tcacactggt atattggtga gacttctcac
     7081 ttctggttgg aggtttcaca tatggctcaa ctcaagtcat taatctcttt ttaattttta
     7141 ctcttgaatt ccttaaactt cgctcattat gaaatgtttt aaaattatga caaaaattac
     7201 tctgtctaac cacttgcctt gtctgctacc agtttgttaa aaattattcc ccccaaccag
     7261 taattccacc agtactactt gatttgtgtt atatttccta tgtacatgta cagcctttgt
     7321 tttgcttgct tgtctatttt tactttccct tttttgggtc aaatttttct tttgctttgt
     7381 ttgaagaagg aatatacaga agtaaaatct tgtcttctct gctgattctt taattaatat
     7441 gagccggata ctttccactg tcttcttggc actttcagga tttcttaatg ctgatatatg
     7501 gactcttaga atggaatttt tgaagaaaaa tctcaaagcc tgtatcgttc ttgaaggtca
     7561 catgtaccta ttgtgaaaat gtgaagctgt atttctgaag ctgaaataaa ttataacatt
     7621 tgaagaaaaa aaaaaaaaaa aaaaa
//