LOCUS       AK312287                 928 bp    mRNA    linear   HTC 24-MAY-2008
DEFINITION  Homo sapiens cDNA, FLJ92589, Homo sapiens palmitoyl-protein
            thioesterase 1(ceroid-lipofuscinosis, neuronal 1, infantile)
            (PPT1), mRNA.
ACCESSION   AK312287
VERSION     AK312287.1
KEYWORDS    HTC; HTC_FLI; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 928)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K.,
            Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T.,
            Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S.,
            Goshima,N., Nomura,N. and Isogai,T.
  TITLE     NEDO functional analysis of protein and research application
            project
  JOURNAL   Unpublished (2008)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC and Biological
            Information Research Center (BIRC), AIST; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..928
                     /clone="BRACE2025458"
                     /clone_lib="BRACE2"
                     /db_xref="H-InvDB:HIT000431153"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="cerebellum"
     CDS             8..928
                     /note="Homo sapiens palmitoyl-protein thioesterase
                     1(ceroid-lipofuscinosis, neuronal 1, infantile) (PPT1),
                     mRNA"
                     /protein_id="BAG35214.1"
                     /translation="MASPGCLWLLAVALLPWTCASRALQHLDPPAPLPLVIWHGMGDS
                     CCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKD
                     PKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHIC
                     DFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKN
                     LMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDN
                     AGQLVFLATEGDHLQLSEEWFYAHIIPFLG"
BASE COUNT          236 a          217 c          250 g          225 t
ORIGIN      
        1 agcgaagatg gcgtcgcccg gctgcctgtg gctcttggct gtggctctcc tgccatggac
       61 ctgcgcttct cgggcgctgc agcatctgga cccgccggcg ccgctgccgt tggtgatctg
      121 gcatgggatg ggagacagct gttgcaatcc cttaagcatg ggtgctatta aaaaaatggt
      181 ggagaagaaa atacctggaa tttacgtctt atctttagag attgggaaga ccctgatgga
      241 ggacgtggag aacagcttct tcttgaatgt caattcccaa gtaacaacag tgtgtcaggc
      301 acttgctaag gatcctaaat tgcagcaagg ctacaatgct atgggattct cccagggagg
      361 ccaatttctg agggcagtgg ctcagagatg cccttcacct cccatgatca atctgatctc
      421 ggttggggga caacatcaag gtgtttttgg actccctcga tgcccaggag agagctctca
      481 catctgtgac ttcatccgaa aaacactgaa tgctggggcg tactccaaag ttgttcagga
      541 acgcctcgtg caagccgaat actggcatga ccccataaag gaggatgtgt atcgcaacca
      601 cagcatcttc ttggcagata taaatcagga gcggggtatc aatgagtcct acaagaaaaa
      661 cctgatggcc ctgaagaagt ttgtgatggt gaaattcctc aatgattcca ttgtggaccc
      721 tgtagattcg gagtggtttg gattttacag aagtggccaa gccaaggaaa ccattccttt
      781 acaggagacc tccctgtaca cacaggaccg cctggggcta aaggaaatgg acaatgcagg
      841 acagctagtg tttctggcta cagaagggga ccatcttcag ttgtctgaag aatggtttta
      901 tgcccacatc ataccattcc ttggatga
//