LOCUS       AK304759                 847 bp    mRNA    linear   HUM 31-JUL-2008
DEFINITION  Homo sapiens cDNA FLJ57457 complete cds, highly similar to tRNA
            isopentenyltransferase, mitochondrial precursor (EC 2.5.1.8).
ACCESSION   AK304759
VERSION     AK304759.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 847)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
            Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
            Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
            Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
  TITLE     NEDO human cDNA sequencing project focused on splicing variants
  JOURNAL   Unpublished (2007)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..847
                     /clone="UTERU3009201"
                     /clone_lib="UTERU3"
                     /db_xref="H-InvDB:HIT000499383"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="uterus"
     CDS             14..448
                     /codon_start=1
                     /note="highly similar to tRNA isopentenyltransferase,
                     mitochondrial precursor (EC 2.5.1.8)"
                     /protein_id="BAG65514.1"
                     /transl_table=1
                     /translation="MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLG
                     QRLGGEIVSADSMQVYEGLDIITNKVSAQEQRICRHHMISFVDPLVTNYTVVDFRNRA
                     TALIEDIFARDKIPIVVGGTNYYIESLLWKVLVNTKVSLVHS"
BASE COUNT          213 a          202 c          201 g          231 t
ORIGIN      
        1 agactgccat aagatggcgt ccgtggcggc tgcacgagca gttcccgtgg gcagtgggct
       61 caggggcctg caacggaccc tacctcttgt agtgattctc ggggccacgg gcaccggcaa
      121 atccacgctg gcgttgcagc taggccagcg gctcggcggt gagatcgtca gcgctgactc
      181 catgcaggtc tatgaaggcc tagacatcat caccaacaag gtttctgccc aagagcagag
      241 aatctgccgg caccacatga tcagctttgt ggatcctctt gtgaccaatt acacagtggt
      301 ggacttcaga aatagagcaa ctgctctgat tgaagatata tttgcccgag acaaaattcc
      361 tattgttgtg ggaggaacca attattacat tgaatctctg ctctggaaag ttcttgtcaa
      421 taccaaggta agtttagttc actcgtaact cactgaggaa atggattgct ctttcttgct
      481 gtctaatttc agtgggagaa aggttgactc ttgcctattt cttataccca gcaactataa
      541 ttttcctact taatattctc aagcaaatgc cacctccatg tgtgaagtgt gttcctccag
      601 gctggttcca aactcctagg ctcaagcgat cctcctgcct cagcctaccg aagtgctggg
      661 attatagtca tgagccacag tactcagcca agaaaaggat ttcttcaggt agggttgtcc
      721 tttgcacggc aggggggtgg ggcacaaatt gtaatatcta agttttttca cccccttaaa
      781 ggcaatgtat aacctcatta agaatgcatg ttttagatta atgaagttta tacttttcag
      841 tatccaa
//