LOCUS       AK304624                1713 bp    mRNA    linear   HUM 31-JUL-2008
DEFINITION  Homo sapiens cDNA FLJ51483 complete cds, highly similar to
            Multiple inositol polyphosphate phosphatase 1 precursor (EC
            3.1.3.62).
ACCESSION   AK304624
VERSION     AK304624.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1713)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
            Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
            Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
            Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
  TITLE     NEDO human cDNA sequencing project focused on splicing variants
  JOURNAL   Unpublished (2007)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..1713
                     /clone="UTERU2025083"
                     /clone_lib="UTERU2"
                     /db_xref="H-InvDB:HIT000499248"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="uterus"
     CDS             65..1105
                     /codon_start=1
                     /note="highly similar to Multiple inositol polyphosphate
                     phosphatase 1 precursor (EC 3.1.3.62)"
                     /protein_id="BAG65406.1"
                     /transl_table=1
                     /translation="MDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKH
                     RCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNA
                     TALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPW
                     CDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQP
                     ISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIF
                     VLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEEC
                     ELARANSTSDEL"
BASE COUNT          518 a          343 c          360 g          492 t
ORIGIN      
        1 atctgcagct ggctcggcgc actccactga ccgtcccgac tggcctttgt ggtacgcgga
       61 ctggatggac gggcagctag tagagaaggg acggcaggat atgcgacagc tggcgctgcg
      121 tctggcctcg ctcttcccgg cccttttcag ccgtgagaac tacggccgcc tgcggctcat
      181 caccagttcc aagcaccgct gcatggatag cagcgccgcc ttcctgcagg ggctgtggca
      241 gcactaccac cctggcttgc cgccgccgga cgtcgcagat atggagtttg gacctccaac
      301 agttaatgat aaactaatga gattttttga tcactgtgag aagtttttaa ctgaagtaga
      361 aaaaaatgct acagctcttt atcacgtgga agccttcaaa actggaccag aaatgcagaa
      421 cattttaaaa aaagttgcag ctactttgca agtgccagta aatgatttaa atgcagattt
      481 aattcaagta gcctttttca cctgttcatt tgacctggca attaaaggtg ttaaatctcc
      541 ttggtgtgat gtttttgaca tagatgatgc aaaggtatta gaatatttaa atgatctgaa
      601 acaatattgg aaaagaggat atgggtatac tattaacagt cgatccagct gcaccttgtt
      661 tcaggatatc tttcagcact tggacaaagc agttgaacag aaacaaaggt ctcagccaat
      721 ttcttctcca gtcatcctcc agtttggtca tgcagagact cttcttccac tgctttctct
      781 catgggctac ttcaaagaca aggaacccct aacagcgtac aattacaaaa aacaaatgca
      841 tcggaagttc cgaagtggtc tcattgtacc ttatgcctcg aacctgatat ttgtgcttta
      901 ccactgtgaa aatgctaaga ctcctaaaga acaattccga gtgcagatgt tattaaatga
      961 aaaggtgtta cctttggctt actcacaaga aactgtttca ttttatgaag atctgaagaa
     1021 ccactacaag gacatccttc agagttgtca aaccagtgaa gaatgtgaat tagcaagggc
     1081 taacagtaca tctgatgaac tatgagtaac tgaagaacat ttttaattct ttaggaatct
     1141 gcaatgagtg attacatgct tgtaataggt aggcaattcc ttgattacag gaagctttta
     1201 tattacttga gtatttctgt cttttcacag aaaaacattg ggtttctctc tgggtttgga
     1261 catgaaatgt aagaaaagat ttttcactgg agcagctctc ttaaggagaa acaaatctat
     1321 ttagagaaac agctggccct gcaaatgttt acagaaatga aattcttcct acttatataa
     1381 gaaatctcac actgagatag aattgtgatt tcataataac acttgaaaag tgctggagta
     1441 acaaaatatc tcagttggac catccttaac ttgattgaac tgtctaggaa ctttacagat
     1501 tgttctgcag ttctctcttc ttttcctcag gtaggacagc tctagcattt tcttaatcag
     1561 gaatattgtg gtaagctggg agtatcactc tggaagaaag taacatctcc agatgagaat
     1621 ttgaaacaag aaacagagtg ttgtaaaagg acaccttcac tgaagcaagt cggaaagtac
     1681 aatgaaaata aatatttttg gtatttattt atg
//