LOCUS       AK131447                3889 bp    mRNA    linear   HUM 09-JAN-2008
DEFINITION  Homo sapiens cDNA FLJ16587 fis, clone TESTI4000214, weakly 
            similar to Human transcription factor TFIIS.
ACCESSION   AK131447
VERSION     AK131447.1
KEYWORDS    FLI_CDNA; oligo capping; fis (full insert sequence).
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3889)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-MAR-2004) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Helix Research Institute, Genomics Laboratory; 1532-3 Yana,
            Kisarazu, Chiba 292-0812, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Oshima,A., Takahashi-Fujii,A., Tanase,T., Imose,N., Takeuchi,K.,
            Arita,M., Musashino,K., Yuuki,H., Hara,H., Sugiyama,T., Irie,R.,
            Otsuki,T., Sato,H., Wakamatsu,A., Ishii,S., Yamamoto,J., Isono,Y.,
            Kawai-Hio,Y., Saito,K., Nishikawa,T., Kimura,K., Yamashita,H.,
            Matsuo,K., Nakamura,Y., Sekine,M., Kikuchi,H., Kanda,K.,
            Wagatsuma,M., Murakawa,K., Kanehori,K., Sugiyama,A., Kawakami,B.,
            Suzuki,Y., Sugano,S., Nagahari,K., Masuho,Y., Nagai,K. and
            Isogai,T.
  TITLE     NEDO human cDNA sequencing project
  JOURNAL   Unpublished (2004)
COMMENT     NEDO human cDNA sequencing project supported by Ministry of
            Economy, Trade and Industry of Japan; cDNA full insert sequencing:
            Research Association for Biotechnology (RAB); cDNA library
            construction: Helix Research Institute (HRI) (supported by Japan
            Key Technology Center etc.); 5'- & 3'-end one pass sequencing:
            RAB, HRI, and Biotechnology Center, National Institute of
            Technology and Evaluation; clone selection for full insert
            sequencing: HRI and RAB; annotation: HRI and RAB.
FEATURES             Location/Qualifiers
     source          1..3889
                     /clone="TESTI4000214"
                     /clone_lib="TESTI4"
                     /db_xref="H-InvDB:HIT000249735"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="testis"
     CDS             60..3710
                     /codon_start=1
                     /protein_id="BAD18592.1"
                     /translation="MSQAGDVEGPSTGDPVLSPQHNCELLQNMEGASSMPGLSPDGPG
                     ASSGPGVRAGSRRKIPRKEALRGGSSRAAGAAEVRPGVLELLAVVQSRGSMLAPGLHM
                     QLPSVPTQGRALTSKRLQVSLCDILDDSCPRKLCSRSAGLPERALACRERLAGVEEVS
                     CLRPREARDGGMSSPGCDRRSPTLSKEEPPGRPLTSSPDPVPVRVRKKWRRQGAHSEC
                     EEGAGDFLWLDQSPRGDNLLSVGDPPQVADLESLGGPCRPPSPKDTGSGPGEPGGSGA
                     GCASGTEKFGYLPATGDGPQPGSPCGPVGFPVPSGGESLSSAAQAPPQSAALCLGASA
                     QASAEQQEAVCVVRTGSDEGQAPAQDQEELEAKAQPASRGRLEQGLAAPADTCASSRE
                     PLGGLSSSLDTEASRACSGPFMEQRRSKGTKNLKKGPVPCAQDRGTDRSSDNSHQDRP
                     EEPSPGGCPRLEEVKIPHGVKLVCYLGSGPVIQLLGAISHGQAGGQLPPKLEVLEDLM
                     EVSSPSPAQRLRRKKRPMVQGPAGCQVFQPSPSGGTAGDPGGLSDPFYPPRSGSLALG
                     DPSSDPACSQSGPMEAEEDSLPEQPEDSAQLQQEKPSLYIGVRGTVVRSMQEVLWTRL
                     RELPDPVLSEEVVEGIAAGIEAALWDLTQGTNGRYKTKYRSLLFNLRDPRNLDLFLKV
                     VHGDVTPYDLVRMSSMQLAPQELARWRDQEEKRGLNIIEQQQKEPCRLPASKMTHKGE
                     VEIQRDMDQTLTLEDLVGPQMFMDCSPQALPIASEDTTGQHDHHFLDPNCHICKDWEP
                     SNELLGSFEAAKSCGDNIFQKALSQTPMPAPEMPKTRELSPTEPQDRVPPSGLHVPAA
                     PTKALPCLPPWEGVLDMFSIKRFRARAQLVSGHSCRLVQALPTVIRSAGCIPSNIVWD
                     LLASICPAKAKDVCVVRLCPHGARDTQNCRLLYSYLNDRQRHGLASVEHMGMVLLPLP
                     AFQPLPTRLRPLGGPGLWALPVSPLLSPGLEVTHSSLLLAVLLPKEGLPDTAGSSPWL
                     GKVQKMVSFNSKVEKRYYQPDDRRPNVPLKGTPPPGGAWQQSQGRGSIAPRGISAWQR
                     PPRGRGRLWPEPENWQHPGRGQWPPEPGLRQSQHPYSVAPAGHGFGRGQHFHRDSCPH
                     QALLRHLESLATMSHQLQALLCPQTKSSIPRPLQRLSSALAAPEPPGPARDSSLGPTD
                     EAGSECPFPRKA"
BASE COUNT          806 a         1191 c         1193 g          699 t
ORIGIN      
        1 aaaaactcag ggaagcccag ggcccgtgtt gtgcttttgg cccaggtagg tggacagaca
       61 tgtcccaggc gggggacgta gaaggcccca gcacaggaga ccctgtgctc agtccccaac
      121 acaactgtga gcttttacag aacatggaag gagccagctc catgccaggc ctgtcaccag
      181 atgggccggg agcaagctct gggcccggag tcagggctgg cagcagaagg aagatcccca
      241 ggaaggaggc ccttcgaggt ggcagctccc gggctgcagg tgctgctgag gtccggccag
      301 gggtcttgga gctgctagct gtggtacaga gccggggctc gatgctggct cctgggctcc
      361 acatgcagct gccctcggtg cctactcagg ggagagctct gacctccaag aggctccagg
      421 tttctctgtg tgacatctta gatgacagtt gccccaggaa actttgtagc aggtctgctg
      481 gcctcccaga gagagctctg gcctgcaggg agaggcttgc aggagtggag gaggtgagct
      541 gcctcaggcc cagggaggcc agagacggtg gaatgagttc tccagggtgt gacagaagaa
      601 gccccacact cagcaaagag gagccccctg gaaggcccct gacatcctca ccagacccag
      661 tccctgtgag ggtaagaaag aaatggagga ggcaaggggc tcattcagag tgtgaggaag
      721 gggctggtga cttcctgtgg cttgatcaga gccctcgtgg ggacaacctc ctgtctgtgg
      781 gagaccctcc ccaagttgct gacctggagt ccttgggagg cccttgcaga cctccctctc
      841 caaaagacac tgggtctggg cctggagagc caggtggaag tggggcagga tgtgcctcag
      901 ggactgagaa atttggatat ttgcccgcta caggggatgg gccccagcca ggcagcccct
      961 gtggccctgt cgggttccca gtgcccagtg gaggggagtc cctcagttca gctgcacagg
     1021 ctcctccaca gagcgcagca ctgtgcctgg gggcgtcagc acaggcctct gcagagcagc
     1081 aagaagctgt gtgtgtcgtg cggactggca gcgatgaagg ccaggctcca gcacaggacc
     1141 aggaggagct ggaggccaag gctcagccag cttccagggg aaggctggag caaggactcg
     1201 ctgcccccgc tgacacctgt gccagctccc gggagccctt gggcggcctc agctcctccc
     1261 tggatactga agccagcagg gcctgctcag gcccattcat ggagcagaga agatccaagg
     1321 gcactaagaa cctgaagaaa ggtccagtgc cctgtgccca agaccggggc acagacagaa
     1381 gctcagacaa ctcccaccag gacaggccag aggaacccag cccaggaggc tgccccagac
     1441 tggaggaagt gaaaataccc catggagtga agcttgtgtg ctacctgggt tccgggccag
     1501 tgatccagct cctgggggcc atcagccacg gccaggcagg ggggcagctg ccaccaaagc
     1561 tggaggttct agaggacttg atggaggtca gctcaccctc acctgcccag aggctcagaa
     1621 ggaagaaaag gcccatggtg cagggccctg ctgggtgcca ggttttccag ccttctcctt
     1681 caggaggcac agcaggggac cctggtggcc tctctgaccc cttctaccct ccaagaagcg
     1741 gttccctggc ccttggcgac cccagctcgg accctgcatg ttcccagagt ggcccaatgg
     1801 aggctgaaga ggattctctt ccggagcagc cagaggactc agctcagctc caacaggaga
     1861 agccatccct gtatattggg gtgcggggca ctgttgtccg ttccatgcag gaggtactat
     1921 ggactcgcct tcgggagctc ccagacccag tgctgagtga ggaggtggtg gagggcattg
     1981 ctgctggcat tgaggcagcc ctctgggacc tgacacaagg caccaatggc cggtacaaga
     2041 ccaagtatcg cagcctgctg ttcaacctgc gggaccccag gaacctggac ttgtttctca
     2101 aagtggttca tggagatgtc accccctacg acctggtgcg gatgagctcg atgcagctgg
     2161 ccccccagga gctggcccgc tggcgggacc aggaggagaa aaggggcctg aatatcattg
     2221 agcagcaaca gaaggagccg tgcagacttc cagcctccaa aatgacccac aagggcgaag
     2281 tggagattca gcgggacatg gaccagacac tgaccctgga ggatctggtg ggaccgcaga
     2341 tgttcatgga ctgcagccca caggccctgc ccatcgcatc agaggacacc acggggcagc
     2401 atgaccacca cttcttagac cccaactgcc acatctgcaa ggactgggag ccctcgaatg
     2461 agctgctagg ctccttcgaa gccgccaaga gctgcgggga caatatcttc cagaaagccc
     2521 taagccaaac tcctatgcct gctccagaga tgcccaaaac cagggagttg tctcccacgg
     2581 aaccacagga cagggtccct ccatctgggc tccatgtgcc tgctgcaccc acaaaggccc
     2641 tgccctgcct gccaccctgg gaaggtgttc tggacatgtt ctccatcaag cggttccggg
     2701 ccagggccca gctggtctcg ggacacagct gtcggcttgt ccaggctctg cccaccgtga
     2761 tccgctcggc aggctgcatc ccctccaaca ttgtctggga ccttctggcc agcatctgcc
     2821 cagccaaggc caaggacgtc tgcgtggtca gactgtgccc acatggggcc cgggacaccc
     2881 agaactgccg cctgctctac tcatacctca atgataggca gcgccacggg ctggcctctg
     2941 tggagcacat ggggatggtc ctgctgcccc tgcctgcctt ccagcccctg cccaccaggc
     3001 tgcgcccttt ggggggccca ggcctttggg ctcttcctgt ctcccctctc ctttccccag
     3061 gtctggaggt cactcactca agtctgttgc tggctgtgct gctccccaag gaagggcttc
     3121 cagacacagc agggtccagc ccctggttgg ggaaggttca aaagatggtc tccttcaaca
     3181 gtaaggtgga gaagagatac tatcagccag atgacaggag gccgaatgtg cccctgaagg
     3241 gcacccctcc cccaggaggt gcctggcagc agagccaggg caggggcagt atagctccaa
     3301 ggggaatctc tgcttggcag aggcccccca gaggcagggg gaggctctgg ccagagcctg
     3361 aaaactggca gcatcctggg cgagggcagt ggcccccaga gccaggcttg cgccagtccc
     3421 agcatcccta ttcagtagca ccagctggtc atggctttgg ccgtggccag cacttccaca
     3481 gggactcctg tccccaccaa gccctgctcc ggcacctcga atccctggcg accatgagtc
     3541 accagctcca agccttactg tgcccccaga ccaagagctc catcccccgc cctctgcagc
     3601 gtttgtctag cgcccttgca gctccagagc cccctggccc agcccgtgac tcctctttgg
     3661 ggcctacaga tgaagctggc tctgagtgtc ccttccctag aaaggcctga ccctccttac
     3721 ccaccagaac aggggttttg atgccctcac tagtgttgaa gcctgttcca gagagaggtg
     3781 ggactgcaag gagaggatgg tcagccctac ccacctgccc tgtttgagct tcctgtttga
     3841 caatgtttgc tgttgatttt ttgttcaata aagaatttgg taaaattgg
//