LOCUS       AK123051                2384 bp    mRNA    linear   HUM 03-JUL-2008
DEFINITION  Homo sapiens cDNA FLJ41056 fis, clone TESTI2003347, highly similar
            to Gap junction alpha-10 protein.
ACCESSION   AK123051
VERSION     AK123051.1
KEYWORDS    FLI_CDNA; oligo capping; fis (full insert sequence).
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2384)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUL-2003) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Helix Research Institute, Genomics Laboratory; 1532-3 Yana,
            Kisarazu, Chiba 292-0812, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Suzuki,O., Sasaki,N., Aotsuka,S., Shoji,T., Ichihara,T.,
            Shiohata,N., Matsumoto,K., Hirano,M., Sano,S., Nomura,R.,
            Yoshikawa,Y., Matsumura,Y., Moriya,S., Chiba,E., Momiyama,H.,
            Onogawa,S., Kaeriyama,S., Satoh,N., Matsunawa,H., Takahashi,E.,
            Kataoka,R., Kuga,N., Kuroda,A., Satoh,I., Kamata,K., Takami,S.,
            Terashima,Y., Watanabe,M., Sugiyama,T., Irie,R., Otsuki,T.,
            Sato,H., Wakamatsu,A., Ishii,S., Yamamoto,J., Isono,Y.,
            Kawai-Hio,Y., Saito,K., Nishikawa,T., Kimura,K., Yamashita,H.,
            Matsuo,K., Nakamura,Y., Sekine,M., Kikuchi,H., Kanda,K.,
            Wagatsuma,M., Murakawa,K., Kanehori,K., Takahashi-Fujii,A.,
            Oshima,A., Sugiyama,A., Kawakami,B., Suzuki,Y., Sugano,S.,
            Nagahari,K., Masuho,Y., Nagai,K. and Isogai,T.
  TITLE     NEDO human cDNA sequencing project
  JOURNAL   Unpublished (2003)
COMMENT     NEDO human cDNA sequencing project supported by Ministry of
            Economy, Trade and Industry of Japan; cDNA full insert sequencing:
            Research Association for Biotechnology (RAB); cDNA library
            construction: Helix Research Institute (HRI) (supported by Japan
            Key Technology Center etc.); 5'- & 3'-end one pass sequencing:
            RAB, HRI, and Biotechnology Center, National Institute of
            Technology and Evaluation; clone selection for full insert
            sequencing: HRI and RAB; annotation: Reverse Proteomics Research
            Institute, HRI and RAB.
FEATURES             Location/Qualifiers
     source          1..2384
                     /clone="TESTI2003347"
                     /clone_lib="TESTI2"
                     /db_xref="H-InvDB:HIT000042924"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="testis"
     CDS             285..1829
                     /codon_start=1
                     /note="highly similar to Gap junction alpha-10 protein"
                     /protein_id="BAG53864.1"
                     /translation="MGDWNLLGDTLEEVHIHSTMIGKIWLTILFIFRMLVLGVAAEDV
                     WNDEQSGFICNTEQPGCRNVCYDQAFPISLIRYWVLQVIFVSSPSLVYMGHALYRLRV
                     LEEERQRMKAQLRVELEEVEFEMPRDRRRLEQELCQLEKRKLNKAPLRGTLLCTYVIH
                     IFTRSVVEVGFMIGQYLLYGFHLEPLFKCHGHPCPNIIDCFVSRPTEKTIFLLFMQSI
                     ATISLFLNILEIFHLGFKKIKRGLWGKYKLKKEHNEFHANKAKQNVAKYQSTSANSLK
                     RLPSAPDYNLLVEKQTHTAVYPSLNSSSVFQPNPDNHSVNDEKCILDEQETVLSNEIS
                     TLSTSCSHFQHISSNNNKDTHKIFGKELNGNQLMEKRETEGKDSKRNYYSRGHRSIPG
                     VAIDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKVPGSKATASS
                     LLLILQRPTSSQPRLKETPKIKAEAKIYDSKHPPQLLQSTVSTFSGREPRSPAPMGHH
                     SFRGPR"
BASE COUNT          763 a          498 c          507 g          616 t
ORIGIN      
        1 gttttttaaa agcaaggata agcagaaagg gacatggatt ttagttgatg gatgactcac
       61 tcactacatt caactgaact gaatctgctc tataccagca aagggacaaa ttcagaaaat
      121 aaattgaaga tggccatgct gtaacttcta aacatggttt gcttctcaga tttacctaaa
      181 ctaagaaagg tttgctttaa gaaatagtgc tcccttcaga atggaagaat ttatctgcct
      241 cttatttgat gtggatcaga gctaagatgg ctgactaaat aaacatgggg gactggaatc
      301 tccttggaga tactctggag gaagttcaca tccactccac catgattgga aagatctggc
      361 tcaccatcct gttcatattt cgaatgcttg ttctgggtgt agcagctgaa gatgtctgga
      421 atgatgagca gtccggcttc atctgcaata cagaacaacc aggctgcaga aatgtatgct
      481 acgaccaggc ctttcctatc tccctcatta gatactgggt tctgcaggtg atatttgtgt
      541 cttcaccatc cctggtctac atgggccatg cattgtaccg actgagagtt cttgaggaag
      601 agaggcaaag gatgaaagct cagttaagag tagaactgga ggaggtagag tttgaaatgc
      661 ctagggatcg gaggagattg gagcaagagc tttgtcagct ggagaaaagg aaactaaata
      721 aagctccact cagaggaacc ttgctttgca cttatgtgat acacattttc actcgctctg
      781 tggttgaagt tggattcatg attggacagt accttttata tggatttcac ttagagccgc
      841 tatttaagtg ccatggccac ccgtgtccaa atataatcga ctgttttgtc tcaagaccaa
      901 cagaaaagac aatattccta ttatttatgc aatctatagc cactatttca cttttcttaa
      961 acattcttga aattttccac ctaggtttta aaaagattaa aagagggctt tggggaaaat
     1021 acaagttgaa gaaggaacat aatgaattcc atgcaaacaa ggcaaaacaa aatgtagcca
     1081 aataccagag cacatctgca aattcactga agcgactccc ttctgcccct gattataatc
     1141 tgttagtgga aaagcaaaca cacactgcag tgtaccctag tttaaattca tcttctgtat
     1201 tccagccaaa tcctgacaat catagtgtaa atgatgagaa atgcattttg gatgaacagg
     1261 aaactgtact ttctaatgag atttccacac ttagtactag ttgtagtcat tttcaacaca
     1321 tcagttcaaa caataacaaa gacactcata aaatatttgg aaaagaactt aatggtaacc
     1381 agttaatgga aaaaagagaa actgaaggca aagacagcaa aaggaactac tactctagag
     1441 gtcaccgttc tattccaggt gttgctatag atggagagaa caacatgagg cagtcacccc
     1501 aaacagtttt ctccttgcca gctaactgcg attggaaacc gcggtggctt agagctacat
     1561 ggggttcctc tacagaacat gaaaaccggg ggtcacctcc taaagtgcct ggctcaaaag
     1621 ctactgcaag ctcgttactg ctcatcctcc agaggcccac atcaagtcag ccacgactca
     1681 aggagactcc aaagataaaa gctgaagcca aaatatatga ttctaaacac cctcctcagc
     1741 tactgcaaag cactgtgagc actttctcag gacgagagcc aagaagccca gcacctatgg
     1801 gtcaccacag tttccgaggt cccagatgaa aaagatgcgc tcgctaccac cgtgcggcgg
     1861 tcctttctct cgcaatagtc tcaatgctcc cgggccctgc ctccggacgc caggacagag
     1921 gccgccgact cgaagcgtga gcagttccgg aggtacttgg agaagtcggg ggtgctggac
     1981 acgctgacca aggtgttggt agccttatat gaagaaccag agaaacctaa cagtgctttg
     2041 gattttttaa agcatcactt aggagctgct actccagaaa atccagaaat agagctgctt
     2101 cgcctagaac tggccgaaat gaaagagaag tatgaagcta ttgtagaaga aaataaaaaa
     2161 ctgaaagcaa agcttgctca gtatgaacca cctcaggagg agaagcgtgc tgaataggat
     2221 tcttctcagt ttgaaagaca atgaaaaatg gttttgtatg acttgaatag tttgtatagt
     2281 atataatctt ttctgaacag atgctataga actcttttaa tatgtttaat tcacctatca
     2341 cactctgtta aaaacacata gaatcatcaa taaaaactca atat
//