LOCUS       AK098687                 821 bp    mRNA    linear   HUM 14-SEP-2006
DEFINITION  Homo sapiens cDNA FLJ25821 fis, clone TST07875.
ACCESSION   AK098687
VERSION     AK098687.1
KEYWORDS    FLI_CDNA; oligo capping; fis (full insert sequence).
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 821)
  AUTHORS   Sugano,S. and Suzuki,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUL-2002) to the DDBJ/EMBL/GenBank databases.
            Contact:Sumio Sugano
            Institute of Medical Science, University of Tokyo, Laboratory of
            Genome Structure, Human Genome Center; Shirokane-dai, 4-6-1,
            Minato-ku, Tokyo 108-8639, Japan
REFERENCE   2
  AUTHORS   Oshima,A., Takahashi-Fujii,A., Tanase,T., Imose,N., Takeuchi,K.,
            Arita,M., Musashino,K., Yuuki,H., Hara,H., Suzuki,Y., Hata,H.,
            Nakagawa,K., Mizuno,S., Morinaga,M., Kawamura,M., Sugiyama,T.,
            Irie,R., Otsuki,T., Sato,H., Nishikawa,T., Sugiyama,A.,
            Kawakami,B., Nagai,K., Isogai,T. and Sugano,S.
  TITLE     NEDO human cDNA sequencing project
  JOURNAL   Unpublished (2002)
COMMENT     NEDO human cDNA sequencing project supported by Ministry of
            Economy, Trade and Industry of Japan; cDNA full insert sequencing:
            Research Association for Biotechnology (RAB); cDNA library
            construction and 5'-end one pass sequencing: Institute of Medical
            Science, University of Tokyo, Laboratory of Genome Structure,
            Human Genome Center; 3'-end one pass sequencing: RAB; clone
            selection for full insert sequencing: RAB and Helix Research
            Institute.
FEATURES             Location/Qualifiers
     source          1..821
                     /clone="TST07875"
                     /clone_lib="TST"
                     /db_xref="H-InvDB:HIT000023517"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="testis"
     CDS             42..641
                     /codon_start=1
                     /protein_id="BAC05378.1"
                     /translation="METFPLLLLSLGLVLAEASESTMKIIKEEFTDEEMQYDMAKSGQ
                     EKQTIEILMNPILLVKNTSLSMSKDDMSSTLLTFRSLHYNDPKGNSSGNDKECCNDMT
                     VWRKVSEANGSCKWSNNFIRSSTEVMRRVHRAPSCKFVQNPGISCCESLELENTVCQF
                     TTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWLVCGSKL"
BASE COUNT          270 a          166 c          177 g          208 t
ORIGIN      
        1 agaaactgaa caggaacaga agagattaca ctacatctga gatggagacc tttcctctgc
       61 tgctgctcag cctgggcctg gttcttgcag aagcatcaga aagcacaatg aagataatta
      121 aagaagaatt tacagacgaa gagatgcaat atgacatggc aaaaagtggc caagaaaaac
      181 agaccattga gatattaatg aacccgatcc tgttagttaa aaataccagc ctcagcatgt
      241 ccaaggatga tatgtcttcc acattactga cattcagaag tttacattat aatgacccca
      301 agggaaacag ttcgggtaat gacaaagagt gttgcaatga catgacagtc tggagaaaag
      361 tttcagaagc aaacggatcg tgcaagtgga gcaataactt catccgcagc tccacagaag
      421 tgatgcgcag ggtccacagg gcccccagct gcaagtttgt acagaatcct ggcataagct
      481 gctgtgagag cctagaactg gaaaatacag tgtgccagtt cactacaggc aaacaattcc
      541 ccaggtgcca ataccatagt gttacctcat tagagaagat attgacagtg ctgacaggtc
      601 attctctgat gagctggtta gtttgtggct ctaagttgta aatcccacag agctttagga
      661 ctagggtctt actaaagaag gacctcttct tgctcattct tgtttaaacc tttccttaat
      721 atctactctt tagcactata gtgaactcct gattatttat tctaactgga ggagtgaaaa
      781 atccaaaatt gtggataatt caattaaaag ttatgactga c
//