LOCUS       AK090851                2440 bp    mRNA    linear   HUM 09-JAN-2008
DEFINITION  Homo sapiens cDNA FLJ33532 fis, clone BRAMY2007287, weakly similar
            to ACETYL-COENZYME A SYNTHETASE (EC 6.2.1.1).
ACCESSION   AK090851
VERSION     AK090851.1
KEYWORDS    FLI_CDNA; oligo capping; fis (full insert sequence).
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2440)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUL-2002) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Helix Research Institute, Genomics Laboratory; 1532-3 Yana,
            Kisarazu, Chiba 292-0812, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Ota,T., Suzuki,Y., Nishikawa,T., Otsuki,T., Sugiyama,T., Irie,R.,
            Wakamatsu,A., Hayashi,K., Sato,H., Nagai,K., Kimura,K., Makita,H.,
            Sekine,M., Obayashi,M., Nishi,T., Shibahara,T., Tanaka,T.,
            Ishii,S., Yamamoto,J., Saito,K., Kawai,Y., Isono,Y., Nakamura,Y.,
            Nagahari,K., Murakami,K., Yasuda,T., Iwayanagi,T., Wagatsuma,M.,
            Shiratori,A., Sudo,H., Hosoiri,T., Kaku,Y., Kodaira,H., Kondo,H.,
            Sugawara,M., Takahashi,M., Kanda,K., Yokoi,T., Furuya,T.,
            Kikkawa,E., Omura,Y., Abe,K., Kamihara,K., Katsuta,N., Sato,K.,
            Tanikawa,M., Yamazaki,M., Ninomiya,K., Ishibashi,T., Yamashita,H.,
            Murakawa,K., Fujimori,K., Tanai,H., Kimata,M., Watanabe,M.,
            Hiraoka,S., Chiba,Y., Ishida,S., Ono,Y., Takiguchi,S.,
            Watanabe,S., Yosida,M., Hotuta,T., Kusano,J., Kanehori,K.,
            Takahashi-Fujii,A., Hara,H., Tanase,T., Nomura,Y., Togiya,S.,
            Komai,F., Hara,R., Takeuchi,K., Arita,M., Imose,N., Musashino,K.,
            Yuuki,H., Oshima,A., Sasaki,N., Aotsuka,S., Yoshikawa,Y.,
            Matsunawa,H., Ichihara,T., Shiohata,N., Sano,S., Moriya,S.,
            Momiyama,H., Satoh,N., Takami,S., Terashima,Y., Suzuki,O.,
            Nakagawa,S., Senoh,A., Mizoguchi,H., Goto,Y., Shimizu,F.,
            Wakebe,H., Hishigaki,H., Watanabe,T., Sugiyama,A., Takemoto,M.,
            Kawakami,B., Yamazaki,M., Watanabe,K., Kumagai,A., Itakura,S.,
            Fukuzumi,Y., Fujimori,Y., Komiyama,M., Tashiro,H., Tanigami,A.,
            Fujiwara,T., Ono,T., Yamada,K., Fujii,Y., Ozaki,K., Hirao,M.,
            Ohmori,Y., Kawabata,A., Hikiji,T., Kobatake,N., Inagaki,H.,
            Ikema,Y., Okamoto,S., Okitani,R., Kawakami,T., Noguchi,S.,
            Itoh,T., Shigeta,K., Senba,T., Matsumura,K., Nakajima,Y.,
            Mizuno,T., Morinaga,M., Sasaki,M., Togashi,T., Oyama,M., Hata,H.,
            Watanabe,M., Komatsu,T., Mizushima-Sugano,J., Satoh,T., Shirai,Y.,
            Takahashi,Y., Nakagawa,K., Okumura,K., Nagase,T., Nomura,N.,
            Kikuchi,H., Masuho,Y., Yamashita,R., Nakai,K., Yada,T.,
            Nakamura,Y., Ohara,O., Isogai,T. and Sugano,S.
  TITLE     Complete sequencing and characterization of 21,243 full-length
            human cDNAs
  JOURNAL   Nat. Genet. 36, 40-45 (2004)
REFERENCE   3
  AUTHORS   Tashiro,H., Yamazaki,M., Watanabe,K., Kumagai,A., Itakura,S.,
            Fukuzumi,Y., Fujimori,Y., Komiyama,M., Sugiyama,T., Irie,R.,
            Otsuki,T., Sato,H., Wakamatsu,A., Ishii,S., Yamamoto,J., Isono,Y.,
            Kawai-Hio,Y., Saito,K., Nishikawa,T., Kimura,K., Yamashita,H.,
            Matsuo,K., Nakamura,Y., Sekine,M., Kikuchi,H., Kanda,K.,
            Wagatsuma,M., Murakawa,K., Kanehori,K., Takahashi-Fujii,A.,
            Oshima,A., Sugiyama,A., Kawakami,B., Suzuki,Y., Sugano,S.,
            Nagahari,K., Masuho,Y., Nagai,K. and Isogai,T.
  TITLE     NEDO human cDNA sequencing project
  JOURNAL   Unpublished (2002)
COMMENT     NEDO human cDNA sequencing project supported by Ministry of
            Economy, Trade and Industry of Japan; cDNA full insert sequencing:
            Research Association for Biotechnology (RAB); cDNA library
            construction: Helix Research Institute (HRI) (supported by Japan
            Key Technology Center etc.); 5'- & 3'-end one pass sequencing:
            RAB, HRI, and Biotechnology Center, National Institute of
            Technology and Evaluation; clone selection for full insert
            sequencing: HRI and RAB; annotation: HRI and RAB.
FEATURES             Location/Qualifiers
     source          1..2440
                     /clone="BRAMY2007287"
                     /clone_lib="BRAMY2"
                     /db_xref="H-InvDB:HIT000015718"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="amygdala"
     CDS             437..910
                     /codon_start=1
                     /protein_id="BAC03530.1"
                     /translation="MKLKCIFGFATKETSCYNVTNIGFKSPSDFWQSVHSTLPRELAP
                     CLVFNTSPNLALFSAAFAFIVVKDSAGDSDVVVQELKSMVATKIAKYAVPDEILVVKR
                     LPKTRSGKVMRRLLRKIITSEAQELGDTTTLEDPSIIAEILSVYQKCKDKQAAAK"
BASE COUNT          539 a          580 c          663 g          658 t
ORIGIN      
        1 ttatgctata atgtgggctg gcccgtgctg cccagcagaa ctctcagctg cctctcagct
       61 gtctgtgttg tccagggtgg cagcctctgg ctgctcatgg tgctgaatgg cacttgaagt
      121 gtggctcatg cagccaggga gctgctgatt taattgaact gaaatagcta tcctggccca
      181 tggcaccatg ttgcacacac acccccaaag gctggtggtg cccatttgct gtgcatctgt
      241 gcaccttctc atggaagtct cattccatca aaccacatta tgggttattt cacagatgtg
      301 tacacagaga ggggaggtcc catgtcccag gtcacacgca gccagtcagc attagagctg
      361 agatgccaag ctctcagcca cacatgtgca ctcacctgga acatctgtgg agctgttaga
      421 atcgctgcca cttttcatga aactgaagtg catctttggg tttgcaacta aagaaaccag
      481 ctgctacaat gtcactaaca taggattcaa aagcccttcg gatttctggc agtctgtgca
      541 tagcaccctg cctcgggagt tggctccttg tctagtattt aatacatccc caaacttggc
      601 tttattttca gctgcctttg ccttcattgt ggtgaaagat agtgcgggtg actcagatgt
      661 ggtggtgcag gagctcaagt ccatggtggc caccaagatc gccaaatatg ctgtgcctga
      721 tgagatcctg gtggtgaaac gtcttccaaa aaccaggtct gggaaggtca tgcggcggct
      781 cctgaggaag atcatcacta gtgaggccca ggagctggga gacactacca ccttggagga
      841 ccccagcatc atcgcagaga tcctgagtgt ctaccagaag tgcaaggaca agcaggctgc
      901 tgctaagtga gctggcacct tgtggggctc ttgggatggg cgggcaccca agccctggct
      961 tgtccttccc agaaggtacc cctgaggttg gcgtcttcct acgtcccaga agcagccccc
     1021 accccacaca tgacccacac cgccctcacg tgaagctggg ctgagagccc tttctcccat
     1081 ccattggagg tcccaggagt gtcacccatg gagaggctat gcgacatggc tagggctggt
     1141 tctgccatct gagtttggtt tcctggaatg aaaaggcatt gccatctcca ttcctctgcc
     1201 ctcttgagcc agcacaggaa ggtgaggccc tgggatagcg cgcctgctca gataacacag
     1261 agctagttag ctagtagcaa ccgtgttttc tccagatctg tctagataca aaggtcagaa
     1321 atcttatttt tatactttta tattgtggaa gaacagcatg caacactcac atgtagtgtg
     1381 tggatttact tgaacatgtt ctttttaaca tgtagttatg aaaatctcct tttttgcctc
     1441 tactggtgag gaaacatgag gatcagaggc cacattttta attattgtta gtgtatttgg
     1501 aagtctgaat tggagatgtt tgtacctctg tctaaacagt tcccttgaga acttccaagc
     1561 ctccggcatc ttttcctggt gagtgtttct cctgtgcttg gttgtgtata atggagctaa
     1621 ctcctaagcg gtggggtgaa tgtggccgcc ttagttctga agctactcca gttatgttct
     1681 gtttcttcaa gctgtgatcc agaaagattt ttgtgccccc agatgcctct tgataggaga
     1741 ggcaacatac tccaaatagt tgggttcttc agggaagcta ttagaaactc aggtgacttg
     1801 ttagagcact aacttggtca gagccaaatc ctggcaaacg ctgcctgacc ttcactctgt
     1861 ggttggggca gtgagaacca ctgaggtcca atgatgagac ttggaggtct ggatccagtc
     1921 tctctttgtt ttaatgtgac ttaggtgctg tcaacattag caagataatg gaaatcacga
     1981 cgccagtggg tgcttacctc cctgctaggc atgcaggggc tggcggttgg caggggaagg
     2041 aggcccagtg agccgggtcc cttaggggag ggagagtttg tcctctttgc cccacagtct
     2101 acccttcagg gccttgtggc agtgccagtg ttcggggggt gtctgggcca ctgagtaccc
     2161 actcggtcgt ggttgtgctg gcctcttggg tgagtgaacc tgtgaagccc aggaggtggt
     2221 gttggctgca gggtacacaa atactgagtg gtggtctttt gttacaggct tagcaacaaa
     2281 gctgtgccct gggcatgggg ggctgtagtg tagctacagt tgtgcgtttg tgaaatggct
     2341 tagctttcca tgttgctgag aggaacctgg acatggtccc gggcatctga atgatctgta
     2401 ggggagggag ttcaaataaa gctttatttt gttcattttc
//