LOCUS       AK088128                1446 bp    mRNA    linear   HTC 06-OCT-2010
DEFINITION  Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN
            full-length enriched library, clone:E430004K14 product:CD8
            antigen, alpha chain, full insert sequence.
ACCESSION   AK088128
VERSION     AK088128.1
KEYWORDS    HTC_FLI; HTC; CAP trapper.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1446)
  AUTHORS   Adachi,J., Aizawa,K., Akimura,T., Arakawa,T., Bono,H.,
            Carninci,P., Fukuda,S., Furuno,M., Hanagaki,T., Hara,A.,
            Hashizume,W., Hayashida,K., Hayatsu,N., Hiramoto,K., Hiraoka,T.,
            Hirozane,T., Hori,F., Imotani,K., Ishii,Y., Itoh,M., Kagawa,I.,
            Kasukawa,T., Katoh,H., Kawai,J., Kojima,Y., Kondo,S., Konno,H.,
            Kouda,M., Koya,S., Kurihara,C., Matsuyama,T., Miyazaki,A.,
            Murata,M., Nakamura,M., Nishi,K., Nomura,K., Numazaki,R., Ohno,M.,
            Ohsato,N., Okazaki,Y., Saito,R., Saitoh,H., Sakai,C., Sakai,K.,
            Sakazume,N., Sano,H., Sasaki,D., Shibata,K., Shinagawa,A.,
            Shiraki,T., Sogabe,Y., Tagami,M., Tagawa,A., Takahashi,F.,
            Takaku-Akahira,S., Takeda,Y., Tanaka,T., Tomaru,A., Toya,T.,
            Yasunishi,A., Muramatsu,M. and Hayashizaki,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-APR-2002) to the DDBJ/EMBL/GenBank databases.
            Contact:Yoshihide Hayashizaki
            The Institute of Physical and Chemical Research (RIKEN), Omics
            Science Center, RIKEN Yokohama Institute; 1-7-22 Suehiro-cho,
            Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan
            URL    :http://www.osc.riken.jp/
REFERENCE   2
  AUTHORS   
  CONSRTM   The FANTOM Consortium, Riken Genome Exploration Research Group and
            Genome Science Group (Genome Network Project Core Group)
  TITLE     The Transcriptional Landscape of the Mammalian Genome
  JOURNAL   Science 309, 1559-1563 (2005)
REFERENCE   3
  AUTHORS   
  CONSRTM   RIKEN Genome Exploration Research Group and Genome Science Group
            (Genome Network Project Core Group) and the FANTOM Consortium
  TITLE     Antisense Transcription in the Mammalian Transcriptome
  JOURNAL   Science 309, 1564-1566 (2005)
REFERENCE   4
  AUTHORS   
  CONSRTM   The FANTOM Consortium and the RIKEN Genome Exploration Research
            Group Phase I and II Team
  TITLE     Analysis of the mouse transcriptome based on functional annotation
            of 60,770 full-length cDNAs
  JOURNAL   Nature 420, 563-573 (2002)
REFERENCE   5
  AUTHORS   
  CONSRTM   The RIKEN Genome Exploration Research Group Phase II Team and the
            FANTOM Consortium
  TITLE     Functional annotation of a full-length mouse cDNA collection
  JOURNAL   Nature 409, 685-690 (2001)
REFERENCE   6
  AUTHORS   Carninci,P. and Hayashizaki,Y.
  TITLE     High-efficiency full-length cDNA cloning
  JOURNAL   Meth. Enzymol. 303, 19-44 (1999)
REFERENCE   7
  AUTHORS   Carninci,P., Shibata,Y., Hayatsu,N., Sugahara,Y., Shibata,K.,
            Itoh,M., Konno,H., Okazaki,Y., Muramatsu,M. and Hayashizaki,Y.
  TITLE     Normalization and subtraction of cap-trapper-selected cDNAs to
            prepare full-length cDNA libraries for rapid discovery of new genes
  JOURNAL   Genome Res. 10, 1617-1630 (2000)
REFERENCE   8
  AUTHORS   Shibata,K., Itoh,M., Aizawa,K., Nagaoka,S., Sasaki,N.,
            Carninci,P., Konno,H., Akiyama,J., Nishi,K., Kitsunai,T.,
            Tashiro,H., Itoh,M., Sumi,N., Ishii,Y., Nakamura,S., Hazama,M.,
            Nishine,T., Harada,A., Yamamoto,R., Matsumoto,H., Sakaguchi,S.,
            Ikegami,T., Kashiwagi,K., Fujiwake,S., Inoue,K., Togawa,Y.,
            Izawa,M., Ohara,E., Watahiki,M., Yoneda,Y., Ishikawa,T., Ozawa,K.,
            Tanaka,T., Matsuura,S., Kawai,J., Okazaki,Y., Muramatsu,M.,
            Inoue,Y., Kira,A. and Hayashizaki,Y.
  TITLE     RIKEN integrated sequence analysis (RISA) system-384-format
            sequencing pipeline with 384 multicapillary sequencer
  JOURNAL   Genome Res. 10, 1757-1771 (2000)
COMMENT     cDNA library was prepared and sequenced in Mouse Genome
            Encyclopedia Project of Genome Exploration Research Group in Riken
            Genomic Sciences Center and Genome Science Laboratory in RIKEN.
            Division of Experimental Animal Research in Riken contributed to
            prepare mouse tissues.
            
            Please visit our web site for further details.
            URL:http://www.osc.riken.jp/
            URL:http://fantom.gsc.riken.jp/
            
            clone information is available at:
            http://fantom.gsc.riken.jp/3/db/annotate/
            main.cgi?masterid=E430004K14
FEATURES             Location/Qualifiers
     source          1..1446
                     /cell_type="thymic cells"
                     /clone="E430004K14"
                     /clone_lib="RIKEN full-length enriched mouse cDNA library"
                     /db_xref="FANTOM_DB:E430004K14"
                     /db_xref="MGI:2427025"
                     /db_xref="taxon:10090"
                     /dev_stage="2 days neonate"
                     /mol_type="mRNA"
                     /organism="Mus musculus"
                     /strain="NOD"
                     /tissue_type="thymus"
     CDS             7..750
                     /codon_start=1
                     /note="CD8 antigen, alpha chain (MGD|MGI:88346
                     GB|AK017889, evidence: BLASTN, 99%, match=1389)"
                     /note="putative"
                     /protein_id="BAC40163.1"
                     /transl_table=1
                     /translation="MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAE
                     LGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLF
                     SAVRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRT
                     PSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLIC
                     YHRSRKRVCKCPRPLVRQEGKPRPSEKIV"
     regulatory      1429..1434
                     /note="putative"
                     /regulatory_class="polyA_signal_sequence"
     polyA_site      1446
                     /note="putative"
BASE COUNT          364 a          375 c          349 g          358 t
ORIGIN      
        1 gacaccatgg cctcaccgtt gacccgcttt ctgtcgctga acctgctgct gctgggtgag
       61 tcgattatcc tggggagtgg agaagctaag ccacaggcac ccgaactccg aatctttcca
      121 aagaaaatgg acgccgaact tggccagaag gtggacctgg tatgtgaagt gttggggtcc
      181 gtttcgcaag gatgctcttg gctcttccag aactccagct ccaaactccc ccagcccacc
      241 ttcgttgtct atatggcttc atcccacaac aagataacgt gggacgagaa gctgaattcg
      301 tcgaaactgt tttctgccgt gagggacacg aataataagt acgttctcac cctgaacaag
      361 ttcagcaagg aaaacgaagg ctactatttc tgctcagtca tcagcaactc ggtgatgtac
      421 ttcagttctg tcgtgccagt ccttcagaaa gtgaactcta ctactaccaa gccagtgctg
      481 cgaactccct cacctgtgca ccctaccggg acatctcagc cccagagacc agaagattgt
      541 cggccccgtg gctcagtgaa ggggaccgga ttggacttcg cctgtgatat ttacatctgg
      601 gcacccttgg ccggaatctg cgtggccctt ctgctgtcct tgatcatcac tctcatctgc
      661 taccacagga gccgaaagcg tgtttgcaaa tgtcccaggc cgctagtcag acaggaaggc
      721 aagcccagac cttcagagaa aattgtgtaa aatggcaccg ccaggaagct acaactacta
      781 catgacttca gagatctctt cttgcaagag gccaggccct cctttttcaa gtttcctgct
      841 gtcttatgta ttgccctctg tattgtttta gtaggggtgt gatggggaca gttccttttt
      901 ctttatgaat tctctttgac acaaagcata cttgtatgca tacaatggga gtaatgagca
      961 gactgtaaca ccagagctag ttccagtttc ggggtccatg tcactggtgg cctcagcacc
     1021 cacttgatat aaatctcctg tctgcccatc atatagaaga agctgaagat cagaggtgga
     1081 aacagcagga tctgtagacc cggagagaac ccaagctaga ggaaccctca ctgactggtg
     1141 cagggatctc acccccatcc cctgagctct ctgtttaggt atgtgtcttt agtatagcat
     1201 gcttgtgcct caaactgcaa ggaagcaagt ggtatgaatc tgtgatctgc tcagctctgg
     1261 ctgtgagcat cagatgtaac aaatcaaagt caggagaact gcctttagca gtgcacctgg
     1321 acatcagagc cccttgtaag aactgggaaa ttgctggcag tctagtggag cggtacggta
     1381 aatctggaaa acactcccct ctgtcactga aggctgtagt agaatccaat taaagctatt
     1441 caaacc
//