LOCUS       AK024191                2692 bp    mRNA    linear   HUM 09-JAN-2008
DEFINITION  Homo sapiens cDNA FLJ14129 fis, clone MAMMA1002617, weakly similar
            to ZINC FINGER PROTEIN 135.
ACCESSION   AK024191
VERSION     AK024191.1
KEYWORDS    FLI_CDNA; oligo capping; fis (full insert sequence).
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2692)
  AUTHORS   Isogai,T. and Otsuki,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-AUG-2000) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Helix Research Institute, Genomics Laboratory; 1532-3 Yana,
            Kisarazu, Chiba 292-0812, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Ota,T., Suzuki,Y., Nishikawa,T., Otsuki,T., Sugiyama,T., Irie,R.,
            Wakamatsu,A., Hayashi,K., Sato,H., Nagai,K., Kimura,K., Makita,H.,
            Sekine,M., Obayashi,M., Nishi,T., Shibahara,T., Tanaka,T.,
            Ishii,S., Yamamoto,J., Saito,K., Kawai,Y., Isono,Y., Nakamura,Y.,
            Nagahari,K., Murakami,K., Yasuda,T., Iwayanagi,T., Wagatsuma,M.,
            Shiratori,A., Sudo,H., Hosoiri,T., Kaku,Y., Kodaira,H., Kondo,H.,
            Sugawara,M., Takahashi,M., Kanda,K., Yokoi,T., Furuya,T.,
            Kikkawa,E., Omura,Y., Abe,K., Kamihara,K., Katsuta,N., Sato,K.,
            Tanikawa,M., Yamazaki,M., Ninomiya,K., Ishibashi,T., Yamashita,H.,
            Murakawa,K., Fujimori,K., Tanai,H., Kimata,M., Watanabe,M.,
            Hiraoka,S., Chiba,Y., Ishida,S., Ono,Y., Takiguchi,S.,
            Watanabe,S., Yosida,M., Hotuta,T., Kusano,J., Kanehori,K.,
            Takahashi-Fujii,A., Hara,H., Tanase,T., Nomura,Y., Togiya,S.,
            Komai,F., Hara,R., Takeuchi,K., Arita,M., Imose,N., Musashino,K.,
            Yuuki,H., Oshima,A., Sasaki,N., Aotsuka,S., Yoshikawa,Y.,
            Matsunawa,H., Ichihara,T., Shiohata,N., Sano,S., Moriya,S.,
            Momiyama,H., Satoh,N., Takami,S., Terashima,Y., Suzuki,O.,
            Nakagawa,S., Senoh,A., Mizoguchi,H., Goto,Y., Shimizu,F.,
            Wakebe,H., Hishigaki,H., Watanabe,T., Sugiyama,A., Takemoto,M.,
            Kawakami,B., Yamazaki,M., Watanabe,K., Kumagai,A., Itakura,S.,
            Fukuzumi,Y., Fujimori,Y., Komiyama,M., Tashiro,H., Tanigami,A.,
            Fujiwara,T., Ono,T., Yamada,K., Fujii,Y., Ozaki,K., Hirao,M.,
            Ohmori,Y., Kawabata,A., Hikiji,T., Kobatake,N., Inagaki,H.,
            Ikema,Y., Okamoto,S., Okitani,R., Kawakami,T., Noguchi,S.,
            Itoh,T., Shigeta,K., Senba,T., Matsumura,K., Nakajima,Y.,
            Mizuno,T., Morinaga,M., Sasaki,M., Togashi,T., Oyama,M., Hata,H.,
            Watanabe,M., Komatsu,T., Mizushima-Sugano,J., Satoh,T., Shirai,Y.,
            Takahashi,Y., Nakagawa,K., Okumura,K., Nagase,T., Nomura,N.,
            Kikuchi,H., Masuho,Y., Yamashita,R., Nakai,K., Yada,T.,
            Nakamura,Y., Ohara,O., Isogai,T. and Sugano,S.
  TITLE     Complete sequencing and characterization of 21,243 full-length
            human cDNAs
  JOURNAL   Nat. Genet. 36, 40-45 (2004)
REFERENCE   3
  AUTHORS   Isogai,T., Ota,T., Hayashi,K., Sugiyama,T., Otsuki,T., Suzuki,Y.,
            Nishikawa,T., Nagai,K., Sugano,S., Aotsuka,S., Yoshikawa,Y.,
            Matsunawa,H., Ishii,S., Kawai,Y., Saito,K., Yamamoto,J.,
            Wakamatsu,A., Nakamura,Y., Nagahari,K., Masuho,Y. and Sasaki,N.
  TITLE     NEDO human cDNA sequencing project
  JOURNAL   Unpublished (2000)
COMMENT     NEDO human cDNA sequencing project supported by Ministry of
            International Trade and Industry of Japan; cDNA full insert
            sequencing: Research Association for Biotechnology; cDNA library
            construction, 5'- & 3'-end one pass sequencing and clone
            selection: Helix Research Institute (supported by Japan Key
            Technology Center etc.) and Department of Virology, Institute of
            Medical Science, University of Tokyo.
FEATURES             Location/Qualifiers
     source          1..2692
                     /clone="MAMMA1002617"
                     /clone_lib="MAMMA1"
                     /db_xref="H-InvDB:HIT000007465"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="Mammary gland"
     CDS             373..1497
                     /codon_start=1
                     /protein_id="BAB14850.1"
                     /translation="MEPGGEPTGAKESSTLMESLAAVKAAFLAQAPSGSRSAEVQAAQ
                     STEPAAEAGAPEGEGHRGGPPRALGSLGLCENQEARERPGGSPRGPVTSEKTGGQSGL
                     ESDVPPNAGPGAEGGGSWKGRPFPCGACGRSFKCSSDAAKHRSIHSGEKPYECSDCGK
                     AFIHSSHVVRHQRAHSGERPYACAECGKAFGQSFNLLRHQRVHTGEKPYACADCGKAF
                     GQRSDAAKHRRTHTGERLYACGECGKRFLHSSNVVRHRRTHHGENPYECRECGQAFSQ
                     SSNLLQHQRVHTGERPFACQDCGRAFSRSSFLREHCRIHTGEKPHQCGHCGRAFRALS
                     GFFRHQRLHTGEKPFRCTECGRAFRLSFHLIQHRRVHGAE"
BASE COUNT          481 a          807 c          926 g          478 t
ORIGIN      
        1 gcagtccagc tgctctggac gctgaggccc cggcttctct tgctggggtg tcgattcggg
       61 agggctgagg gcgcggccga gagaacgggg cggtcaccgc cgccgtggcc cgcgcgtccc
      121 gcgctctcct tgcagtgcag gccccagccg ctctcgggcg cggcgtgggg gaggcggccc
      181 tgcaggtgcg tacccggggt ccgacacgtg cggggcttcc tgcgagctga gtccccgctg
      241 cgcgtcttca ggcctttgta agttgtcaaa tttcccaccg gcccagctca tcgagcttct
      301 tcccagctgt gaacaggagg gcctgttccc taattcttgc cgaaattgtt ccaactgctg
      361 gtgttctgca agatggagcc aggaggagag cccacaggtg ctaaagagag cagtaccctg
      421 atggagtccc ttgcagctgt gaaggctgct ttcctggcgc aggccccgag tggcagccgg
      481 tcagccgagg tgcaggcagc tcagagcacg gagcctgccg cagaggcagg cgctcccgag
      541 ggagagggcc acagaggggg gcctccccgg gcgttggggt ctcttggcct ttgtgaaaac
      601 caggaagcca gagagaggcc cggaggttcc cctcgaggcc cggtcacttc tgagaaaact
      661 ggaggacaga gtggcctcga gtcagacgtc cctccgaacg caggccccgg cgcagagggc
      721 gggggcagct ggaaggggcg gcctttcccg tgcggcgcct gtggccgcag cttcaagtgc
      781 tcctcggacg cggcaaagca ccggagcatc cactcggggg agaaaccgta cgagtgcagc
      841 gactgcggga aggccttcat ccacagctcg cacgtggtcc ggcaccagcg ggcgcacagc
      901 ggggagaggc cctacgcgtg cgccgagtgc ggcaaggcct tcggccagag cttcaacctc
      961 ctccggcacc agcgcgtgca cacgggcgag aagccctacg cgtgcgccga ctgcggcaag
     1021 gccttcggcc agaggtcgga cgccgccaag caccgccgca cccacaccgg ggagaggctg
     1081 tacgcgtgcg gcgagtgcgg gaagcgcttc ctgcacagct cgaacgtggt ccggcaccgg
     1141 cggacccacc acggggagaa cccgtacgag tgccgggagt gcggccaggc cttcagccag
     1201 agctccaacc tcctccagca ccagcgcgtg cacacggggg agcggccctt cgcctgccag
     1261 gactgcggcc gcgccttcag ccgcagctcc ttcctccgcg agcactgccg catccacacc
     1321 ggggagaagc cccaccagtg cggccactgc gggcgcgcgt tccgggcgct gtcgggcttc
     1381 ttccggcacc agcgactcca cacgggcgag aagccgttcc gctgcaccga gtgcggccgc
     1441 gccttccgcc tgagcttcca cctcatccag caccggcggg tgcatggcgc cgagtgagcc
     1501 ggggctgcgg cggaagagat gccggcggcc tggtgggcgc gaggccgagg ccgggggagg
     1561 ctcctgtccg ccccgtgcgc ggtgaggaag taacagccgg ctgcgcgcct ggttctcggg
     1621 ttgcgaaagc ctcgccaggc ctgcatccgc cttggcttgg gagcaatcag gagagacagg
     1681 gctcggggaa ggcgagcgct gcccgcggga ggcgattccc agaggcgggg aggtctcagg
     1741 ggtctgtccc gggccggccg cccgcctctg agactccccg cctcccacgg tcagctgctg
     1801 cggggcagtg gccggtgatt gaatcggtca ttcctccgca accaggcctc catcaaaacc
     1861 ctgcatgaga tgagggcctc gggcttcggg ttggtgaagg cggggtgggg gggcagttag
     1921 gaagggggcg cccagacagg gcatggaagc ctcgcgtcct cccccgtacc ttgcgggtcg
     1981 gtggttcatc catgtatttc aacgcctttt cacagccggt tcatatggtc ccgacttctg
     2041 tgtgcttaga aaattatgga acttggccgg gtgcggtggc tcccgcctgt aatcctagca
     2101 ctttgggagg ccgaggcggg cggatcacac ggtcaagaga tcaagaccat cctggccaac
     2161 atggcaaaac ccccatctcg actaaaaata caaaaaatta attgggcgtg gtggcgtgcg
     2221 cctgtaatct cagctacttg ggagcctggg gcaggagaat cacttgaacc tgggaggcgg
     2281 aggttgcagt gagcggagat ctgggcactg tactttagcc tgggcgacag agagacccat
     2341 ctcaaaaaaa aaaattggaa cctgagaagg gggtcgtggg gtccccgggg cccaccgtct
     2401 gcacttggca tctgaagtcg gggtggtctt gtgggactga ccccttaccc tgtgggttct
     2461 gcactagctc cgggcaattg gtgacagaat cgagttaaat tgtaggacat cgcgttggtg
     2521 tctgagaggg agttggagag ctggttggtg tggagggaaa ggcttacaca catgtgattt
     2581 cagaagcgtt ctgtgggtag aggaatcgtt ttctctttga gactgttatg agtatgtaca
     2641 aatgttattt cctgtaaaat attttcattt tttaaaatgt tattttctag at
//