LOCUS AK006956 545 bp mRNA linear HTC 06-OCT-2010 DEFINITION Mus musculus adult male testis cDNA, RIKEN full-length enriched library, clone:1700080G18 product:hypothetical protein, full insert sequence. ACCESSION AK006956 VERSION AK006956.1 KEYWORDS HTC_FLI; HTC; CAP trapper. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 545) AUTHORS Adachi,J., Aizawa,K., Akahira,S., Akimura,T., Arai,A., Aono,H., Arakawa,T., Bono,H., Carninci,P., Fukuda,S., Fukunishi,Y., Furuno,M., Hanagaki,T., Hara,A., Hayatsu,N., Hiramoto,K., Hiraoka,T., Hori,F., Imotani,K., Ishii,Y., Itoh,M., Izawa,M., Kasukawa,T., Kato,H., Kawai,J., Kojima,Y., Konno,H., Kouda,M., Koya,S., Kurihara,C., Matsuyama,T., Miyazaki,A., Nishi,K., Nomura,K., Numazaki,R., Ohno,M., Okazaki,Y., Okido,T., Owa,C., Saito,H., Saito,R., Sakai,C., Sakai,K., Sano,H., Sasaki,D., Shibata,K., Shibata,Y., Shinagawa,A., Shiraki,T., Sogabe,Y., Suzuki,H., Tagami,M., Tagawa,A., Takahashi,F., Tanaka,T., Tejima,Y., Toya,T., Yamamura,T., Yasunishi,A., Yoshida,K., Yoshino,M., Muramatsu,M. and Hayashizaki,Y. TITLE Direct Submission JOURNAL Submitted (10-JUL-2000) to the DDBJ/EMBL/GenBank databases. Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22 Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL :http://www.osc.riken.jp/ REFERENCE 2 AUTHORS CONSRTM The FANTOM Consortium, Riken Genome Exploration Research Group and Genome Science Group (Genome Network Project Core Group) TITLE The Transcriptional Landscape of the Mammalian Genome JOURNAL Science 309, 1559-1563 (2005) REFERENCE 3 AUTHORS CONSRTM RIKEN Genome Exploration Research Group and Genome Science Group (Genome Network Project Core Group) and the FANTOM Consortium TITLE Antisense Transcription in the Mammalian Transcriptome JOURNAL Science 309, 1564-1566 (2005) REFERENCE 4 AUTHORS CONSRTM The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase I and II Team TITLE Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs JOURNAL Nature 420, 563-573 (2002) REFERENCE 5 AUTHORS CONSRTM The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM Consortium TITLE Functional annotation of a full-length mouse cDNA collection JOURNAL Nature 409, 685-690 (2001) REFERENCE 6 AUTHORS Carninci,P. and Hayashizaki,Y. TITLE High-efficiency full-length cDNA cloning JOURNAL Meth. Enzymol. 303, 19-44 (1999) REFERENCE 7 AUTHORS Carninci,P., Shibata,Y., Hayatsu,N., Sugahara,Y., Shibata,K., Itoh,M., Konno,H., Okazaki,Y., Muramatsu,M. and Hayashizaki,Y. TITLE Normalization and subtraction of cap-trapper-selected cDNAs to prepare full-length cDNA libraries for rapid discovery of new genes JOURNAL Genome Res. 10, 1617-1630 (2000) REFERENCE 8 AUTHORS Shibata,K., Itoh,M., Aizawa,K., Nagaoka,S., Sasaki,N., Carninci,P., Konno,H., Akiyama,J., Nishi,K., Kitsunai,T., Tashiro,H., Itoh,M., Sumi,N., Ishii,Y., Nakamura,S., Hazama,M., Nishine,T., Harada,A., Yamamoto,R., Matsumoto,H., Sakaguchi,S., Ikegami,T., Kashiwagi,K., Fujiwake,S., Inoue,K., Togawa,Y., Izawa,M., Ohara,E., Watahiki,M., Yoneda,Y., Ishikawa,T., Ozawa,K., Tanaka,T., Matsuura,S., Kawai,J., Okazaki,Y., Muramatsu,M., Inoue,Y., Kira,A. and Hayashizaki,Y. TITLE RIKEN integrated sequence analysis (RISA) system-384-format sequencing pipeline with 384 multicapillary sequencer JOURNAL Genome Res. 10, 1757-1771 (2000) COMMENT cDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science Laboratory in RIKEN. Division of Experimental Animal Research in Riken contributed to prepare mouse tissues. Please visit our web site for further details. URL:http://www.osc.riken.jp/ URL:http://fantom.gsc.riken.jp/ clone information is available at: http://fantom.gsc.riken.jp/3/db/annotate/ main.cgi?masterid=1700080G18 FEATURES Location/Qualifiers source 1..545 /clone="1700080G18" /clone_lib="RIKEN full-length enriched mouse cDNA library" /db_xref="FANTOM_DB:1700080G18" /db_xref="MGI:1906532" /db_xref="taxon:10090" /dev_stage="adult" /mol_type="mRNA" /organism="Mus musculus" /sex="male" /strain="C57BL/6J" /tissue_type="testis" CDS <1..420 /codon_start=1 /note="hypothetical protein (evidence: decoder)" /note="putative" /note="start codon is not identified" /protein_id="BAB24804.1" /transl_table=1 /translation="DGSASPPGDRHDGEASTALRLRGGGSRRRSLRPPAASSASGAAR QRWPGPGPGGQPAEQVADAAAKWFMPPKMVANPKEPSARSRARGTETSAPKRLPHILL GAPLRSRLDPSLKCALFLCFKAPTRSVNGELWYKAIW" regulatory 528..533 /note="putative" /regulatory_class="polyA_signal_sequence" polyA_site 545 /note="putative" BASE COUNT 105 a 172 c 157 g 111 t ORIGIN 1 gacggctcgg cttccccgcc cggagaccgc catgatggcg aggccagcac ggctctgcgg 61 ctccggggag ggggctctcg gcggcgctct ctgagacccc cggccgcctc gtcggcctct 121 ggtgcggctc ggcagcgctg gccggggccc ggaccaggag ggcaaccggc tgagcaagtc 181 gcggacgcgg cggcgaagtg gttcatgccg cccaagatgg ttgctaatcc gaaggagccc 241 tccgctcgga gccgagcgcg gggaactgag acctccgctc caaagcggct cccccacatt 301 ttactcggcg cgcctttgcg tagtcgcctc gacccctctc tgaaatgcgc tttgtttctc 361 tgtttcaaag ccccaaccag atctgtaaac ggggaacttt ggtacaaagc aatatggtaa 421 tttattctct cgttccttag accaacattt ctaaagggcc cctttccgta ctggatgctg 481 ttatgggtgc tccgaagtgc acctgttagc aaaccaaggc tctatttaat aaaaataaaa 541 aaccc //