LOCUS       AK000602                 992 bp    mRNA    linear   HUM 12-SEP-2006
DEFINITION  Homo sapiens cDNA FLJ20595 fis, clone KAT08558.
ACCESSION   AK000602
VERSION     AK000602.1
KEYWORDS    FLI_CDNA; oligo capping; fis (full insert sequence).
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 992)
  AUTHORS   Sugano,S., Suzuki,Y., Ota,T., Obayashi,M., Nishi,T., Isogai,T.,
            Shibahara,T., Tanaka,T. and Nakamura,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-FEB-2000) to the DDBJ/EMBL/GenBank databases.
            Contact:Sumio Sugano
            Institute of Medical Science, University of Tokyo, Deptment of
            Virology; Shirokane-dai, 4-6-1, Minato-ku, Tokyo 108-8639, Japan
REFERENCE   2
  AUTHORS   Watanabe,K., Kumagai,A., Itakura,S., Yamazaki,M., Tashiro,H.,
            Ota,T., Suzuki,Y., Obayashi,M., Nishi,T., Shibahara,T., Tanaka,T.,
            Nakamura,Y., Isogai,T. and Sugano,S.
  TITLE     NEDO human cDNA sequencing project
  JOURNAL   Unpublished (2000)
COMMENT     NEDO human cDNA sequencing project supported by Ministry of
            International Trade and Industry of Japan; cDNA full insert
            sequencing: Research Association for Biotechnology; cDNA library
            construction, 5'- & 3'-end one pass sequencing: Departent of
            Virology and Human Genome Center, Institute of Medical Science,
            University of Tokyo (partly supported by Science and Technology
            Agency).
FEATURES             Location/Qualifiers
     source          1..992
                     /cell_line="KATO III"
                     /cell_type="signet-ring cell carcinoma"
                     /clone="KAT08558"
                     /clone_lib="KAT"
                     /db_xref="H-InvDB:HIT000003077"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector pME18SFL3"
                     /organism="Homo sapiens"
     CDS             200..652
                     /codon_start=1
                     /protein_id="BAA91283.1"
                     /translation="MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEA
                     VLQEDGPESEPFPQSAGKGGPQEEVTRGPQGALGRLRELCRRWLRPEVHTKEQMLTML
                     PKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSAVAVFASLPVEVTSL"
BASE COUNT          238 a          239 c          313 g          202 t
ORIGIN      
        1 gagccggggt gaatctggag gggccgggcc gagcccgggg gcgctttcgc acgcgaagca
       61 accgctagag caggacctgg tctcccaaga gcgggactac ttgttgatat ttgaggaggg
      121 aagtgtctta cctgagagcc tggctggaga agactgaggt ccaaggcttg aagcctaagt
      181 gattgcccca ggactgtgga tgatggctgc agacatcccg agagtgacca ctccgctgag
      241 ctccttggtc caggtgcctc aagaggaaga tagacaggag gaggaggtca ccaccatgat
      301 cctggaggat gactcctggg tgcaagaagc tgtgctgcag gaggatggcc ctgagtctga
      361 gccctttccc cagagtgctg gcaagggcgg cccccaggag gaggtgacca ggggaccaca
      421 gggtgcactc ggccgcctcc gagagctctg ccggcgctgg ctgagaccag aggtacacac
      481 caaggagcag atgttaacca tgctgccaaa ggaaattcag gcttggctgc aagagcatcg
      541 gcctgaaagc agtgaggagg cagcggccct ggtggaagac ttgacccaga cccttcagga
      601 cagtgctgta gctgtctttg cttcccttcc ggtggaggtg accagtttgt aatgaacttc
      661 tggatctcca gtcagatact atggaggaga gagtgatgga gggctgagga gaggcctcag
      721 gttgttattt ggttggggag gcacagagca gaggttcagg tctcagcagg tgtcagaggt
      781 gattacagcc cttcccatcc accttgcagc aggggctttg tgcctttcat ctttaactgg
      841 gcacctgaga tgggaaccaa tggggaccat cccagacaca tgggtttgtc tgtccctgac
      901 ttctgcctct gagattgtct ttgttggtct ttgtttaata aacgccccga ccttcctcat
      961 gaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa
//