LOCUS       AK000555                2348 bp    mRNA    linear   HUM 12-SEP-2006
DEFINITION  Homo sapiens cDNA FLJ20548 fis, clone KAT11542.
ACCESSION   AK000555
VERSION     AK000555.1
KEYWORDS    FLI_CDNA; oligo capping; fis (full insert sequence).
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2348)
  AUTHORS   Sugano,S., Suzuki,Y., Ota,T., Obayashi,M., Nishi,T., Isogai,T.,
            Shibahara,T., Tanaka,T. and Nakamura,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-FEB-2000) to the DDBJ/EMBL/GenBank databases.
            Contact:Sumio Sugano
            Institute of Medical Science, University of Tokyo, Deptment of
            Virology; Shirokane-dai, 4-6-1, Minato-ku, Tokyo 108-8639, Japan
REFERENCE   2
  AUTHORS   Watanabe,K., Kumagai,A., Itakura,S., Yamazaki,M., Tashiro,H.,
            Ota,T., Suzuki,Y., Obayashi,M., Nishi,T., Shibahara,T., Tanaka,T.,
            Nakamura,Y., Isogai,T. and Sugano,S.
  TITLE     NEDO human cDNA sequencing project
  JOURNAL   Unpublished (2000)
COMMENT     NEDO human cDNA sequencing project supported by Ministry of
            International Trade and Industry of Japan; cDNA full insert
            sequencing: Research Association for Biotechnology; cDNA library
            construction, 5'- & 3'-end one pass sequencing: Departent of
            Virology and Human Genome Center, Institute of Medical Science,
            University of Tokyo (partly supported by Science and Technology
            Agency).
FEATURES             Location/Qualifiers
     source          1..2348
                     /cell_line="KATO III"
                     /cell_type="signet-ring cell carcinoma"
                     /clone="KAT11542"
                     /clone_lib="KAT"
                     /db_xref="H-InvDB:HIT000003030"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector pME18SFL3"
                     /organism="Homo sapiens"
     CDS             168..1433
                     /codon_start=1
                     /protein_id="BAA91250.1"
                     /translation="MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVAS
                     EESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVT
                     YYTALHIAVLRNQPDMVELLVHHGADVNRRDRIHESSPLDLASEEPERLPCLQRLLDL
                     GADVNAADKHGKTALLHALASSDGVQIHNTENIRLLLEGGADVKATTKDGDTVFTCII
                     FLLGETVGGDKEEAQMINRFCFQVTRLLLAHGADPSECPAHESLTHICLKSFKLHFPL
                     LRFLLESGAAYNCSLHGASCWSGFHIIFERLCSHPGCTEDESHADLLRKAETVLDLMV
                     TNSQKLQLPENFDIHPVGSLAEKIQALHFSLRQLESYPPPLKHLCRVAIRLYLQPWPV
                     DVKVKALPLPDRLKWYLLSEHSGSVEDDI"
BASE COUNT          473 a          699 c          703 g          473 t
ORIGIN      
        1 tcttccggcg ggggcgcggc ttggactgag gagcggaccc ggccgggcgc aggggctgga
       61 ctggcggagc aggtggggtc cgcggccgcc ggagcgttcc ggtcggcgtc tgggcatctc
      121 ggcctcggca gaaagcgcga ccgccctgct gcgcggggcc cgcggcgatg ccgttcctgc
      181 acggcttccg gaggatcatc ttcgagtacc agccgctggt ggatgcgatt ctgggctccc
      241 tggggatcca ggaccccgag cggcaggagt ctctggaccg gcccagttat gtcgccagcg
      301 aggagagccg aatccttgtt ctcactgagc tgctggagag gaaagcccac tctccctttt
      361 accaggaagg cgtgagcaac gccctgctca agatggctga gctggggctg acgcgggcgg
      421 ccgacgttct cttgcggcat ggggccaatc tcaactttga agacccagtc acctactaca
      481 cggccttgca catcgccgtc ctgcggaacc agccggacat ggtggagctg ctggtgcatc
      541 acggggccga cgttaatcgg agggaccgga tccacgagag tagccccttg gacctggcca
      601 gcgaggagcc tgagcgcctg ccctgcctgc agcgcctcct ggaccttgga gctgatgtca
      661 atgccgctga caagcatgga aaaactgctc tgctccatgc tctggccagc agcgacgggg
      721 tgcagatcca caatactgag aacattcgtc tcttactgga aggaggggca gacgtcaagg
      781 ccaccaccaa agatggggac acagtgttca cctgcatcat cttcctgctt ggtgagaccg
      841 tgggagggga caaagaggag gcccagatga tcaaccgctt ctgcttccaa gtcacacggc
      901 tgctgctggc acacggggcc gaccccagcg agtgcccagc ccacgagtcc ctcacccaca
      961 tctgcctgaa gagctttaaa ctgcacttcc ctctcctgcg cttcctcctg gagtccggag
     1021 ccgcctacaa ctgctccctg cacggtgcgt cctgctggtc tggctttcac atcatctttg
     1081 agaggctctg ttcccaccca ggctgcacgg aagacgagag ccatgcggac ctcctgcgca
     1141 aagctgagac tgtcctggat ctcatggtga ccaactctca gaaactccag ctgcccgaaa
     1201 acttcgatat ccaccctgtg ggcagcctgg cggaaaagat ccaggccctc cacttctcct
     1261 tgaggcagct ggagagctat cccccgcccc tcaagcacct gtgccgtgtg gccatccggc
     1321 tctaccttca gccgtggcct gtggatgtga aggtcaaagc cctgcctctg cccgacaggc
     1381 tgaagtggta cctccttagc gagcacagtg gctccgtgga agatgacatc tgataggtct
     1441 caggctacag gaacggggga cacgggcagc tcaggtcagc ctgttggtag atgctgggac
     1501 agcattagaa gagggtcttt ttgatctggg agatgagacg ggatccttca tgagaaaagc
     1561 cagccaggta gagcctgaag ctgtgatcac tccagtggtg aagggtgcag ctctggttct
     1621 tccagagaga ctgccccctt ccctccagcg gcactccaag tcccccccat gttggaaaga
     1681 ggaacagggc ttggattgat gtttataccc tctgaattgg agggcagtgc cagggcattt
     1741 gcagaagctg ggaaggacca agcctcagca ccccagggct gcggggctct tgttggccgc
     1801 acgtggcagt gcagctggag aggaagcctg gggcacgtcc tgtgcggtgc caccaaggcc
     1861 ccacccctgc cccttttcct tccaggttct gttactcaca gaagtgtttc tggtgggctc
     1921 tgcgggagaa gacactaagg gccccacagg cttgtttcat ggtgttgcaa gccaagctgg
     1981 cccctgcctg ttcctgtagc tctggggcca ggtcagccgt ggccccacct accagaactg
     2041 tgctctgctg gcagctgtgc ttttgccaaa cccagggcct cagcgaccat gacttctgct
     2101 aaaaagcaat catgagtgcg tggctgggga cagacctctc tgaagtgtct cctgttgtga
     2161 ggggctcact ttggagccac tgaagagccg actgtgccac ccacttgcga gcctcagtcc
     2221 cttccaagct gcactggtca ttgggaattg tgtaaacacc tctggggata agctgaggtg
     2281 actaaatgat atatttatat tataagatta aactgacttt cttggcctta aaaaaaaaaa
     2341 aaaaaaaa
//