LOCUS       AJ880391                 333 bp    mRNA    linear   ROD 15-APR-2005
DEFINITION  Mus musculus partial mRNA for kappa light chain variable region
            (IgG1 TS1 VL gene).
ACCESSION   AJ880391
VERSION     AJ880391.1
KEYWORDS    IgG1 TS1 VL gene; kappa light chain variable region.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
            Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 333)
  AUTHORS   Erlandsson,A.
  JOURNAL   Submitted (16-FEB-2005) to the INSDC. Erlandsson A., Division for
            chemistry, Karlstad university, Universitetsgatan 2, KARLSTAD
            SE-65188, SWEDEN. 
REFERENCE   2
  AUTHORS   Erlandsson,A., Holm,P., Ullen,A., Stigbrand,T. and  Sundstrom,B.E.
  TITLE     Studies of the interactions between the anticytokeratin 8
            monoclonal antibody TS1, its antigen and its anti-idiotypic
            antibody alphaTS1 
  JOURNAL   J. Mol. Recognit. 16(3), 157-163(2003).
   PUBMED   12833571
FEATURES             Location/Qualifiers
     source          1..333
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
     CDS             <1..>333
                     /gene="IgG1 TS1 VL"
                     /product="kappa light chain variable region"
                     /db_xref="InterPro:IPR003596"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR013106"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="UniProtKB/TrEMBL:Q5F2I7"
                     /protein_id="CAI54295.1"
                     /translation="DIVLTQSPASLAVSLGQRATISCRASQSVSTSNYNYMHWYQQRP
                     GQPPKLLIKYASNLESGVPARFSGSGSGTDFTLNIHPVEEEDTATYYCQHSWEIPLTF
                     GAGTKLEIK"
BASE COUNT           84 a           93 c           82 g           74 t
ORIGIN
        1 gacattgtgc tgacccagtc tcctgcttcc ttagctgtgt ctctggggca gagggccacc
       61 atctcctgca gggccagcca aagtgtcagt acatctaact ataattatat gcactggtac
      121 cagcagagac caggacagcc acccaaactc ctcatcaagt acgcatccaa cctagaatct
      181 ggggtccctg ccaggttcag tggcagtggg tctgggacag acttcaccct caacatccat
      241 cctgtggagg aggaggatac tgcaacatat tactgtcagc acagttggga gattccgctc
      301 acgttcggtg ctgggaccaa gcttgaaata aaa
//