LOCUS AJ880391 333 bp mRNA linear ROD 15-APR-2005
DEFINITION Mus musculus partial mRNA for kappa light chain variable region
(IgG1 TS1 VL gene).
ACCESSION AJ880391
VERSION AJ880391.1
KEYWORDS IgG1 TS1 VL gene; kappa light chain variable region.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 333)
AUTHORS Erlandsson,A.
JOURNAL Submitted (16-FEB-2005) to the INSDC. Erlandsson A., Division for
chemistry, Karlstad university, Universitetsgatan 2, KARLSTAD
SE-65188, SWEDEN.
REFERENCE 2
AUTHORS Erlandsson,A., Holm,P., Ullen,A., Stigbrand,T. and Sundstrom,B.E.
TITLE Studies of the interactions between the anticytokeratin 8
monoclonal antibody TS1, its antigen and its anti-idiotypic
antibody alphaTS1
JOURNAL J. Mol. Recognit. 16(3), 157-163(2003).
PUBMED 12833571
FEATURES Location/Qualifiers
source 1..333
/organism="Mus musculus"
/mol_type="mRNA"
/db_xref="taxon:10090"
CDS <1..>333
/gene="IgG1 TS1 VL"
/product="kappa light chain variable region"
/db_xref="InterPro:IPR003596"
/db_xref="InterPro:IPR007110"
/db_xref="InterPro:IPR013106"
/db_xref="InterPro:IPR013783"
/db_xref="UniProtKB/TrEMBL:Q5F2I7"
/protein_id="CAI54295.1"
/translation="DIVLTQSPASLAVSLGQRATISCRASQSVSTSNYNYMHWYQQRP
GQPPKLLIKYASNLESGVPARFSGSGSGTDFTLNIHPVEEEDTATYYCQHSWEIPLTF
GAGTKLEIK"
BASE COUNT 84 a 93 c 82 g 74 t
ORIGIN
1 gacattgtgc tgacccagtc tcctgcttcc ttagctgtgt ctctggggca gagggccacc
61 atctcctgca gggccagcca aagtgtcagt acatctaact ataattatat gcactggtac
121 cagcagagac caggacagcc acccaaactc ctcatcaagt acgcatccaa cctagaatct
181 ggggtccctg ccaggttcag tggcagtggg tctgggacag acttcaccct caacatccat
241 cctgtggagg aggaggatac tgcaacatat tactgtcagc acagttggga gattccgctc
301 acgttcggtg ctgggaccaa gcttgaaata aaa
//