LOCUS       AJ518105                 801 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens partial mRNA for Maab2 protein.
ACCESSION   AJ518105
VERSION     AJ518105.1
KEYWORDS    Maab2 protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 801)
  AUTHORS   Bauer M.
  JOURNAL   Submitted (21-NOV-2002) to the INSDC. Bauer M., Institute of
            Anatomy, University of Leipzig, Liebigstr. 13, D 04103, GERMANY.
REFERENCE   2
  AUTHORS   Bauer M.
  TITLE     Cloning and sequencing of a new isoform similar to BCAS3
  JOURNAL   Unpublished.
FEATURES             Location/Qualifiers
     source          1..801
                     /db_xref="H-InvDB:HIT000248400"
                     /organism="Homo sapiens"
                     /chromosome="17"
                     /map="17q23"
                     /mol_type="mRNA"
                     /cell_line="MCF7"
                     /db_xref="taxon:9606"
     CDS             189..>801
                     /gene="MAAB2"
                     /standard_name="metastasis associated antigen of breast
                     cancer"
                     /product="Maab2 protein"
                     /db_xref="GOA:Q9H6U6"
                     /db_xref="H-InvDB:HIT000248400.12"
                     /db_xref="HGNC:HGNC:14347"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR022175"
                     /db_xref="InterPro:IPR036322"
                     /db_xref="UniProtKB/Swiss-Prot:Q9H6U6"
                     /protein_id="CAD57723.1"
                     /translation="MNPIALGSRWLAYAENKLIRCHQSRGGACGDNIQSYTATVISAA
                     KTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQ
                     VLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSS
                     QCAVHHLYTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFP"
BASE COUNT          182 a          201 c          210 g          208 t
ORIGIN      
        1 gccgccttgc agtttgatct cagactgctg tgctggcaat cagcgagact ccgtgggcgt
       61 aggaccctcc gagccaggtg tgggatatag tctcgtggtg cgccgttttt taagccggtc
      121 tgaaaagcgc aatattcggg tgggagtgac ccgattttcc aggctgctat ccatgtccag
      181 ggccaaacat gaatcctatt gctcttggga gccgctggct tgcttatgca gaaaacaagt
      241 tgattcgatg tcatcagtcc cgtggtggag cctgtggaga caacattcag tcttatactg
      301 ccacagtcat tagtgctgct aaaacattga aaagtggcct gacaatggta gggaaagtgg
      361 tgactcagct gacaggcaca ctgccttcag gtgtgacaga agatgatgtt gccatccaca
      421 gtaattcacg gcggagtcct ttggtcccag gcatcatcac agttattgac accgaaaccg
      481 ttggagaggg ccaggtgctt gtgagtgagg attctgacag tgatggcatt gtggcccact
      541 tccccgccca tgagaagcca gtgtgctgca tggcttttaa tacaagtgga atgcttctag
      601 tcacaacaga cacccttggc catgactttc atgtcttcca aattctgact catccttggt
      661 cctcatcaca atgtgctgtc caccatctgt atactcttca caggggagaa actgaagcca
      721 aagtacagga catctgcttc agccatgact gtcgctgggt tgtggtcagt actctccggg
      781 gtacttccca cgttttccca t
//