LOCUS AJ437024 513 bp mRNA linear HUM 07-OCT-2008
DEFINITION Homo sapiens mRNA for p19 H-RasIDX protein (H-RAS gene).
ACCESSION AJ437024
VERSION AJ437024.1
KEYWORDS H-RAS gene; p19 H-RasIDX protein.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 513)
AUTHORS Bach-Elias,M.
JOURNAL Submitted (22-FEB-2002) to the INSDC. Bach-Elias M., Molecular
Pathology and Therapeutics, IIBB-CSIC, c/Jorge Girona Salgado
18-26, 08034 Barcelona, SPAIN.
REFERENCE 2
AUTHORS Guil,S., de,La,Iglesia,N., Fernandez-Larrea,J., Cifuentes,D.,
Ferrer,J.C., Guinovart,J.J. and Bach-Elias,M.
TITLE Alternative splicing of the human proto-oncogene c-H-ras renders a
new Ras family protein that trafficks to cytoplasm and nucleus
JOURNAL Cancer Res. 63(17), 5178-5187(2003).
PUBMED 14500341
FEATURES Location/Qualifiers
source 1..513
/db_xref="H-InvDB:HIT000248003"
/organism="Homo sapiens"
/mol_type="mRNA"
/cell_line="HeLa S3"
/db_xref="taxon:9606"
CDS 1..513
/gene="H-RAS"
/product="p19 H-RasIDX protein"
/db_xref="GOA:P01112"
/db_xref="H-InvDB:HIT000248003.10"
/db_xref="HGNC:HGNC:5173"
/db_xref="InterPro:IPR001806"
/db_xref="InterPro:IPR005225"
/db_xref="InterPro:IPR020849"
/db_xref="PDB:121P"
/db_xref="PDB:1AA9"
/db_xref="PDB:1AGP"
/db_xref="PDB:1BKD"
/db_xref="PDB:1CLU"
/db_xref="PDB:1CRP"
/db_xref="PDB:1CRQ"
/db_xref="PDB:1CRR"
/db_xref="PDB:1CTQ"
/db_xref="PDB:1GNP"
/db_xref="PDB:1GNQ"
/db_xref="PDB:1GNR"
/db_xref="PDB:1HE8"
/db_xref="PDB:1IAQ"
/db_xref="PDB:1IOZ"
/db_xref="PDB:1JAH"
/db_xref="PDB:1JAI"
/db_xref="PDB:1K8R"
/db_xref="PDB:1LF0"
/db_xref="PDB:1LF5"
/db_xref="PDB:1LFD"
/db_xref="PDB:1NVU"
/db_xref="PDB:1NVV"
/db_xref="PDB:1NVW"
/db_xref="PDB:1NVX"
/db_xref="PDB:1P2S"
/db_xref="PDB:1P2T"
/db_xref="PDB:1P2U"
/db_xref="PDB:1P2V"
/db_xref="PDB:1PLJ"
/db_xref="PDB:1PLK"
/db_xref="PDB:1PLL"
/db_xref="PDB:1Q21"
/db_xref="PDB:1QRA"
/db_xref="PDB:1RVD"
/db_xref="PDB:1WQ1"
/db_xref="PDB:1XCM"
/db_xref="PDB:1XD2"
/db_xref="PDB:1XJ0"
/db_xref="PDB:1ZVQ"
/db_xref="PDB:1ZW6"
/db_xref="PDB:221P"
/db_xref="PDB:2C5L"
/db_xref="PDB:2CE2"
/db_xref="PDB:2CL0"
/db_xref="PDB:2CL6"
/db_xref="PDB:2CL7"
/db_xref="PDB:2CLC"
/db_xref="PDB:2CLD"
/db_xref="PDB:2EVW"
/db_xref="PDB:2GDP"
/db_xref="PDB:2LCF"
/db_xref="PDB:2Q21"
/db_xref="PDB:2QUZ"
/db_xref="PDB:2RGA"
/db_xref="PDB:2RGB"
/db_xref="PDB:2RGC"
/db_xref="PDB:2RGD"
/db_xref="PDB:2RGE"
/db_xref="PDB:2RGG"
/db_xref="PDB:2UZI"
/db_xref="PDB:2VH5"
/db_xref="PDB:2X1V"
/db_xref="PDB:3DDC"
/db_xref="PDB:3I3S"
/db_xref="PDB:3K8Y"
/db_xref="PDB:3K9L"
/db_xref="PDB:3K9N"
/db_xref="PDB:3KKM"
/db_xref="PDB:3KKN"
/db_xref="PDB:3KUD"
/db_xref="PDB:3L8Y"
/db_xref="PDB:3L8Z"
/db_xref="PDB:3LBH"
/db_xref="PDB:3LBI"
/db_xref="PDB:3LBN"
/db_xref="PDB:3LO5"
/db_xref="PDB:3OIU"
/db_xref="PDB:3OIV"
/db_xref="PDB:3OIW"
/db_xref="PDB:3RRY"
/db_xref="PDB:3RRZ"
/db_xref="PDB:3RS0"
/db_xref="PDB:3RS2"
/db_xref="PDB:3RS3"
/db_xref="PDB:3RS4"
/db_xref="PDB:3RS5"
/db_xref="PDB:3RS7"
/db_xref="PDB:3RSL"
/db_xref="PDB:3RSO"
/db_xref="PDB:3TGP"
/db_xref="PDB:421P"
/db_xref="PDB:4DLR"
/db_xref="PDB:4DLS"
/db_xref="PDB:4DLT"
/db_xref="PDB:4DLU"
/db_xref="PDB:4DLV"
/db_xref="PDB:4DLW"
/db_xref="PDB:4DLX"
/db_xref="PDB:4DLY"
/db_xref="PDB:4DLZ"
/db_xref="PDB:4DST"
/db_xref="PDB:4DSU"
/db_xref="PDB:4EFL"
/db_xref="PDB:4EFM"
/db_xref="PDB:4EFN"
/db_xref="PDB:4Q21"
/db_xref="PDB:521P"
/db_xref="PDB:5P21"
/db_xref="PDB:621P"
/db_xref="PDB:6Q21"
/db_xref="PDB:721P"
/db_xref="PDB:821P"
/db_xref="UniProtKB/Swiss-Prot:P01112"
/protein_id="CAD24594.1"
/translation="MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQV
VIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKR
VKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSSSSS
GTLWDPPGPM"
BASE COUNT 111 a 145 c 165 g 92 t
ORIGIN
1 atgacggaat ataagctggt ggtggtgggc gccggcggtg tgggcaagag tgcgctgacc
61 atccagctga tccagaacca ttttgtggac gaatacgacc ccactataga ggattcctac
121 cggaagcagg tggtcattga tggggagacg tgcctgttgg acatcctgga taccgccggc
181 caggaggagt acagcgccat gcgggaccag tacatgcgca ccggggaggg cttcctgtgt
241 gtgtttgcca tcaacaacac caagtctttt gaggacatcc accagtacag ggagcagatc
301 aaacgggtga aggactcgga tgacgtgccc atggtgctgg tggggaacaa gtgtgacctg
361 gctgcacgca ctgtggaatc tcggcaggct caggacctcg cccgaagcta cggcatcccc
421 tacatcgaga cctcggccaa gacccggcag ggcagccgct ctggctctag ctccagctcc
481 gggaccctct gggacccccc gggacccatg tga
//