LOCUS       AJ310543                4045 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for EGLN1 protein.
ACCESSION   AJ310543
VERSION     AJ310543.1
KEYWORDS    EGLN1 gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4045)
  AUTHORS   Taylor,M.S.
  JOURNAL   Submitted (21-FEB-2001) to the INSDC. Taylor M.S., Medical
            Genetics, MRC Human Genetics Unit, Western General Hospital, Crewe
            Road, Edinburgh, EH4 2XU, UNITED KINGDOM.
REFERENCE   3
  AUTHORS   Taylor,M.S.
  TITLE     Characterization and comparative analysis of the EGLN gene family
  JOURNAL   Gene 275(1), 125-132(2001).
   PUBMED   11574160
FEATURES             Location/Qualifiers
     source          1..4045
                     /db_xref="H-InvDB:HIT000247055"
                     /organism="Homo sapiens"
                     /map="1q42.2"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             97..1377
                     /gene="EGLN1"
                     /product="EGLN1 protein"
                     /function="putative regulator of growth and apoptosis"
                     /db_xref="GOA:Q9GZT9"
                     /db_xref="H-InvDB:HIT000247055.15"
                     /db_xref="HGNC:HGNC:1232"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR006620"
                     /db_xref="PDB:2G19"
                     /db_xref="PDB:2G1M"
                     /db_xref="PDB:2HBT"
                     /db_xref="PDB:2HBU"
                     /db_xref="PDB:2Y33"
                     /db_xref="PDB:2Y34"
                     /db_xref="PDB:3HQR"
                     /db_xref="PDB:3HQU"
                     /db_xref="PDB:3OUH"
                     /db_xref="PDB:3OUI"
                     /db_xref="PDB:3OUJ"
                     /db_xref="PDB:4BQW"
                     /db_xref="PDB:4BQX"
                     /db_xref="PDB:4BQY"
                     /db_xref="PDB:4JZR"
                     /db_xref="PDB:4KBZ"
                     /db_xref="UniProtKB/Swiss-Prot:Q9GZT9"
                     /protein_id="CAC42509.1"
                     /translation="MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCK
                     EHQRQDWKKHKLVCQGSEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARRDN
                     ASGDAAKGKVKAKPPADPAAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKA
                     NLYPPSNTPGDALSPGGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKET
                     GQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSM
                     DDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDW
                     DAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFD
                     ADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF"
     polyA_signal    4005..4010
                     /note="putative"
BASE COUNT         1113 a          868 c          914 g         1150 t
ORIGIN
        1 atctctctcc ccgctcccca gcctcgggcg aggccgtccg gccgctaccc ctcctgctcg
       61 gccgccgcag tcgccgtcgc cgccgccgcc gccgccatgg ccaatgacag cggcgggccc
      121 ggcgggccga gcccgagcga gcgagaccgg cagtactgcg agctgtgcgg gaagatggag
      181 aacctgctgc gctgcagccg ctgccgcagc tccttctact gctgcaagga gcaccagcgt
      241 caggactgga agaagcacaa gctcgtgtgc cagggcagcg agggcgccct cggccacgga
      301 gtgggcccac accagcattc cggccccgcg ccgccggctg cagtgccgcc gcccagggcc
      361 ggggcccggg agcccaggaa ggcagcggcg cgccgggaca acgcctccgg ggacgcggcc
      421 aagggaaaag taaaggccaa gcccccggcc gacccagcgg cggccgcgtc gccgtgtcgt
      481 gcggccgccg gcggccaggg ctcggcggtg gctgccgaag ccgagcccgg caaggaggag
      541 ccgccggccc gctcatcgct gttccaggag aaggcgaacc tgtacccccc aagcaacacg
      601 cccggggatg cgctgagccc cggcggcggc ctgcggccca acgggcagac gaagcccctg
      661 ccggcgctga agctggcgct cgagtacatc gtgccgtgca tgaacaagca cggcatctgt
      721 gtggtggacg acttcctcgg caaggagacc ggacagcaga tcggcgacga ggtgcgcgcc
      781 ctgcacgaca ccgggaagtt cacggacggg cagctggtca gccagaagag tgactcgtcc
      841 aaggacatcc gaggcgataa gatcacctgg atcgagggca aggagcccgg ctgcgaaacc
      901 attgggctgc tcatgagcag catggacgac ctgatacgcc actgtaacgg gaagctgggc
      961 agctacaaaa tcaatggccg gacgaaagcc atggttgctt gttatccggg caatggaacg
     1021 ggttatgtac gtcatgttga taatccaaat ggagatggaa gatgtgtgac atgtatatat
     1081 tatcttaata aagactggga tgccaaggta agtggaggta tacttcgaat ttttccagaa
     1141 ggcaaagccc agtttgctga cattgaaccc aaatttgata gactgctgtt tttctggtct
     1201 gaccgtcgca accctcatga agtacaacca gcatatgcta caaggtacgc aataactgtt
     1261 tggtattttg atgcagatga gagagcacga gctaaagtaa aatatctaac aggtgaaaaa
     1321 ggtgtgaggg ttgaactcaa taaaccttca gattcggtcg gtaaagacgt cttctagagc
     1381 ctttgatcca gcaatacccc acttcaccta caatattgtt aactatttgt taacttgtga
     1441 atacgaataa atgggataaa gaaaaataga caaccagttc gcattttaat aaggaaacag
     1501 aaacaacttt ttgtgttgca tcaaacagaa gattttgact gctgtgactt tgtactgcat
     1561 gatcaacttc aaatctgtga ttgcttacag gaggaagata agctactaat tgaaaatggt
     1621 ttttacatct ggatatgaaa taagtgccct gtgtagaatt tttttcattc ttatattttg
     1681 ccagatctgt tatctagctg agttcatttc atctctccct tttttatatc aagtttgaat
     1741 ttgggataat ttttctatat taggtacaat ttatctaaac tgaattgaga aaaaattaca
     1801 gtattattcc tcaaaataac atcaatctat ttttgtaaac ctgttcatac tattaaattt
     1861 tgccctaaaa gacctcttaa taatgattgt tgccagtgac tgatgattaa ttttatttta
     1921 cttaaaataa gaaaaggagc actttaatta caactgaaaa atcagattgt tttgtagtcc
     1981 ttccttacac taatttgaac tgttaaagat tgctgctttt tttttgacat tgtcaataac
     2041 gaaacctaat tgtaaaacag tcaccattta ctaccaataa cttttagtta atgttttaca
     2101 aggaaaaaga cacaagaaga gtttaaattt ttttgttttg ttttgttttt ttgagacagt
     2161 cttgctctgt tacccaggct ggaggggagt ggtgcattct tggctcactg caacctccgc
     2221 cttccaggtt caagcaatcc tcccacctca gcctcccaac tagctgggac tgcaggcaca
     2281 caccaccatg cctgactaat ttttgtatgt ttagtagaga cggggttttg ccatgttgcc
     2341 taggctgggg tttaagttaa attttttaaa aaactaaagt gactggcact aagtgaactt
     2401 gagattatcc tcagcttcaa gttcctaaga taagggcttt cttaagcttt caggtgtatg
     2461 tatcctctag atgtagacaa taatgtccca tttctaagtc ttttcctttt gcttctcctt
     2521 aaattgattg tacttccaaa tttgctgtta tgtttttttc ctaatactgt gatctatctg
     2581 atctgcagac aagaaccttg tctctgttga agagcatcaa ggggagatta tgtacacatt
     2641 gaaactgaag tgtggtgtta ctgacggaat gtgcagtaac tcctcagata tctgttaagg
     2701 catttcccag atgtgatgcc agccttctta cctgtactga aagatgctta gcttagaaaa
     2761 aaacaaaaca gatgcaaaat cagataattt tattttgttt catgggtttt cttatttact
     2821 ttttaaacaa gggaaggaat attagaaaat cacacaaggc ctcacataca tgttatttaa
     2881 agaatgaatt gggacggatg tcttagactt cactttccta ggctttttag ccaaaaccta
     2941 aagggtggta tccatatttt gcgtgaatta tgggtgtaag accttgccca cttaggtttt
     3001 ctatctctgt ccttgatctt cttgccaaaa tgtgagtata cagaaatttt ctgtatattt
     3061 caacttaaga catttttagc atctgtatag ttgtattcaa tttgagacct tttctatggg
     3121 aagctcagta atttttatta aaagattgcc attgctattc atgtaaaaca tggaaaaaaa
     3181 attgtgtagt gaagccaaca gtggacttag gatgggattg aatgttcagt atagtgatct
     3241 cacttaggag aatttgcagg agaaagtgat agtttattgt tttttcctcg cccatattca
     3301 gttttgttct acttcctccc cttccttcca gatgataaca tcacatctct acagtaagtg
     3361 cctctgccag cccaacccag gagcgcaagt tgtctttgcc atctggtcta tagtacagtg
     3421 cgcggcgtta ggccacaact caaaagcatt atctttttta gggttagtag aaattgtttt
     3481 atgttgatgg gaggtttgtt tgattgtcaa aatgtacagc cacagccttt taatttggga
     3541 gcccctgttg tcattcaaat gtgtacctct acagttgtaa aaagtattag attctactat
     3601 ctgtgggttg tgcttgccag acaggtctta aattgtatat tttttggaaa agtttatata
     3661 ctctcttagg aatcattgtg aaaagatcaa gaaatcagga tggccattta tttaatatcc
     3721 attcatttca tgttagtggg actattaact tgtcaccaag caggactcta tttcaaacaa
     3781 aatttaaaac tgtttgtggc ctatatgtgt ttaatcctgg ttaaagataa agcttcataa
     3841 tgctgttttt attcaacaca ttaaccagct gtaaaacaca gacctttatc aagagtaggc
     3901 aaagattttc aggattcata tacagataga ctataaagtc atgtaatttg aaaagcagtg
     3961 tttcattatg aaagagctct caagttgctt gtaaagctaa tctaattaaa aagatgtata
     4021 aatgttgttg aaacaaaaaa aaaaa
//